GenomeNet

Database: RefSeq
Entry: NC_016523
LinkDB: NC_016523
Original site: NC_016523 
LOCUS       NC_016523            1042069 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 4, complete genome.
ACCESSION   NC_016523
VERSION     NC_016523.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 1042069)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1042069)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612859.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1042069
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="4"
     gene            complement(<1..>732)
                     /gene="TPHA0D00095"
                     /locus_tag="TPHA_0D00095"
                     /db_xref="GeneID:11534555"
     mRNA            complement(<1..>732)
                     /gene="TPHA0D00095"
                     /locus_tag="TPHA_0D00095"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685039.1"
                     /db_xref="GeneID:11534555"
     CDS             complement(<1..732)
                     /gene="TPHA0D00095"
                     /locus_tag="TPHA_0D00095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685087.1"
                     /db_xref="GeneID:11534555"
                     /db_xref="UniProtKB/TrEMBL:G8BS32"
                     /translation="MNDNIGTDTINREISGIADANNCDDRNVKCQIAETYDGLIDYQV
                     QIINEIRGNNQNLIISDKEKQITRKKIKKEAKIFNCKILLFLYNNTMSTSGLTNWNEP
                     LKILVLYIWNSEHNIVLFSPNLKPNIDCENDSLYRMIKDDLLGESYAKLFTTLLAFNY
                     DTTKHIALLEQSSQRLVNIDNKRLTLFIRATYHFIKLQDNVGRLNVVSTKNYLVWKKF
                     KELAVTGKENELLSSEWYIEIESRLE"
     gene            <8514..>9611
                     /gene="TPHA0D00100"
                     /locus_tag="TPHA_0D00100"
                     /db_xref="GeneID:11534603"
     mRNA            <8514..>9611
                     /gene="TPHA0D00100"
                     /locus_tag="TPHA_0D00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685040.1"
                     /db_xref="GeneID:11534603"
     CDS             8514..9611
                     /gene="TPHA0D00100"
                     /locus_tag="TPHA_0D00100"
                     /inference="similar to DNA sequence:INSDC:YML131W"
                     /note="similar to Saccharomyces cerevisiae YML131W;
                     ancestral locus Anc_8.0"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685088.1"
                     /db_xref="GeneID:11534603"
                     /db_xref="GOA:G8BS33"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BS33"
                     /translation="MYSAKQFVIKTLPTPGLPFNFDSTDSKATFELKTLELKESDLKE
                     GEVLIESLLLSNDPAQKFWISSVDKNYAAGVQVGEIIPARGIAKILASKNGEFKAGDY
                     VTGTIGWTTYAIIHDTKKAFLRKVSKEQVGDLSWHLSALGGTSLTAYFIFYHYAQFEE
                     NEKFNGKTILISGAAGAVGIVCIQIALHVFKAKKVIATAGGPEKIRYVEEFDPSRVVG
                     VDYKDSNFKENLIKAAGGPNTVDLFIDNVGGDVLEIGTELLKPHSTLIVCGSISGYND
                     PSKLIYKSFVSVLTKRLTIKGVLLGDNIADFGKGLTKLSQMIEAGQLDISKAETLVDC
                     TGEKFADVPNVWNGLFSGTNKGKLISKVNEY"
     gene            <10491..>12218
                     /gene="TPHA0D00110"
                     /locus_tag="TPHA_0D00110"
                     /db_xref="GeneID:11534406"
     mRNA            <10491..>12218
                     /gene="TPHA0D00110"
                     /locus_tag="TPHA_0D00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685041.1"
                     /db_xref="GeneID:11534406"
     CDS             10491..12218
                     /gene="TPHA0D00110"
                     /locus_tag="TPHA_0D00110"
                     /inference="similar to DNA sequence:INSDC:YFL049W"
                     /note="similar to Saccharomyces cerevisiae SWP82
                     (YFL049W); ancestral locus Anc_8.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685089.1"
                     /db_xref="GeneID:11534406"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:G8BS34"
                     /translation="MSSYSHGNDDVDGGKFFTVSKLQLLNHEKFLLKELVLTSRSPDT
                     IQFPLSEFPRVNVNVPDYVGGELKTLNESSIAYKMTKTDELGERKIQSNGHLLSCRKY
                     LFDVFSLKKYTDGTLFVLVQDLMDALLVDGDQDEFLSKYHQFYPIVPDASQLKFIEKS
                     VPNLLKKNEKLNWSPKFVTAKSAFVQFGAAVICEGTRLTDDYWETVARDSSLTSHHRV
                     FKISSKLQKLFFKLQPSFLVEQENQKKEQEHMKNTQANSQYNLDNLELPSLLIMEQPS
                     SEIKNKYLKDFSVGNSTTVSVPGQNISGSLELSTQYKIPKYHNRFSFVQAIQNNAMDI
                     PIDQELNLEGSATESETNTNSQSRPMTPSQGNQDAAHSKPVSRMLSSLLNSTSSSGNK
                     SRKKTSESTPYFKDSRLIEPDLIINGWKFESLPLINENNTDKSLQPYSFRGLPYFHKD
                     KLIGRLKNLTPNNIRELEHMHDSIAANTGIQTARRVRKSRWFKYWQYKAGVPIGLYEN
                     QQDYFKNVYLNEILKQVTVETHYDEHSHSDKTVTTIRIPNANFLTNNNIQGVEPPYSS
                     FFEKAEYRK"
     gene            complement(<12325..>13605)
                     /gene="TPHA0D00120"
                     /locus_tag="TPHA_0D00120"
                     /db_xref="GeneID:11534119"
     mRNA            complement(<12325..>13605)
                     /gene="TPHA0D00120"
                     /locus_tag="TPHA_0D00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685042.1"
                     /db_xref="GeneID:11534119"
     CDS             complement(12325..13605)
                     /gene="TPHA0D00120"
                     /locus_tag="TPHA_0D00120"
                     /inference="similar to DNA sequence:INSDC:YFL048C,YLR080W"
                     /note="similar to Saccharomyces cerevisiae EMP47 (YFL048C)
                     and EMP46 (YLR080W); ancestral locus Anc_8.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685090.1"
                     /db_xref="GeneID:11534119"
                     /db_xref="GOA:G8BS35"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8BS35"
                     /translation="MILRILSQLFLFINISRVLCHPVGNTDALKLSPEYSLPDLLKAD
                     SIPSHWSAEDSVKLAEGRIVLTPEKKTKGSLWLKNVYNLDHSFTIEWTFRSVSFFGKS
                     KGGLSFWFTDSSKEKNKNLFNGPSTFEGLQLLVDNSSPVGSALNALLNDGSINFAEKN
                     LYDSSFASCLLSYQDSSVPTSLRLTYNADDNNLLKLQLDNKVCFQTRKIKIPKGSYSI
                     GVTANNADNVESFEILNMKLYNGVISDSMIPNKKSMPQPKYLTKIIDKDSGKEKLIES
                     SKLELESNQISNYELYKKLDKVEGKILANDIANLEEKLLSIVKIQKELAENVDQLSRV
                     VANQPSNGQNKNDLENNDSFKDFLAMNEKLEKVINEQEKLRETSKHQVHNGPQLDEIL
                     RKLFIWLLPLIAIMLVMAYHTFRIRQEIVKTKLL"
     gene            <14561..>16723
                     /gene="TPHA0D00130"
                     /locus_tag="TPHA_0D00130"
                     /db_xref="GeneID:11531003"
     mRNA            <14561..>16723
                     /gene="TPHA0D00130"
                     /locus_tag="TPHA_0D00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685043.1"
                     /db_xref="GeneID:11531003"
     CDS             14561..16723
                     /gene="TPHA0D00130"
                     /locus_tag="TPHA_0D00130"
                     /inference="similar to DNA sequence:INSDC:YFL047W"
                     /note="similar to Saccharomyces cerevisiae RGD2 (YFL047W);
                     ancestral locus Anc_8.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685091.1"
                     /db_xref="GeneID:11531003"
                     /db_xref="GOA:G8BS36"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G8BS36"
                     /translation="MPSFAESFWSNDLNSGLAQLFDRLYHGCEQCDEFTQLFASRMQY
                     EVAYGRQLFGVRNNVENINDFQDSSSTVESSLQKMIDATSNEGKNHLDIAANLEELVL
                     KPFSKWCEDHRGRVKYSEDILKKNAKNFQKSRAYVAKLEKEYFNSCRKLETYRNTNFS
                     EDQLRKAMSALKIQQKYDKHIEKEKDYQHFATIADINFDYKTMRETLKLFLTGLPKEE
                     FKLPLISYSFPNTNNGSDITKFIIKYFSLKDSDHAETFAQELITLGFLKHCNGVGNNF
                     VNSEKFQYQWKKDAYKFAKVPYPNEIDNIVRNNDEVTESLVSHYMDEITASTPDIEVS
                     IRDKPELTNEESILFQLVKDVEDADTKYRQESYKMDNLRCSIEELMVDHLTFMEKCEL
                     DRLKAIKKVTFDFYSVFVNKITSIKLNVDRLMESEEAIDPTQDLLQLIKEHRTGYFQP
                     KVITYNNFYNPGTTQNFGIDLETRSRLDKRVVPLIISAILLYMDNIYPDLDNDKVRIS
                     IWISPVKLNLTHELRAILNRKQFQDEGEIIELLKQSKYEPSTVASVLKIYLLELPNAL
                     IKNDITDVLKALYLDYSSPATSHDSIEDKSITEKLNEEVVTDKDDKDVILDNKDMKRI
                     KGLSAILASLSKPRIATLAAIITHFHRLIQILKMGENGEHTALEFSNSISREFANCII
                     EVNIHDGNDLGFKIFYDLLQYKHEIINFLKEHNSKSKK"
     gene            complement(<16866..>17699)
                     /gene="TPHA0D00140"
                     /locus_tag="TPHA_0D00140"
                     /db_xref="GeneID:11534407"
     mRNA            complement(<16866..>17699)
                     /gene="TPHA0D00140"
                     /locus_tag="TPHA_0D00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685044.1"
                     /db_xref="GeneID:11534407"
     CDS             complement(16866..17699)
                     /gene="TPHA0D00140"
                     /locus_tag="TPHA_0D00140"
                     /inference="similar to DNA sequence:INSDC:YLR079W"
                     /note="similar to Saccharomyces cerevisiae SIC1 (YLR079W);
                     ancestral locus Anc_8.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685092.1"
                     /db_xref="GeneID:11534407"
                     /db_xref="UniProtKB/TrEMBL:G8BS37"
                     /translation="MAPSTPKRNGASEFLHHSDGDLGNTDMDAGIFDDNFVEYNDTRT
                     LKTPMKGGTKSLLQPVTPITATKKTERTSLNLFDSTNTHSKDSLRTPINQATESPRLL
                     TPSQIVSDSKSISRVLFPLDNTEESEEYEDKDFVHNNSNKLVFEDTSKRKAQESSIIE
                     EGTFNKLRRSTPGTPSNQIITEDIKNEWHNENNTISIFEEKRTEYVKETKLYNPFEVD
                     DILTEEEILRRKNELIQNNQNIEDVVTYFNKNGKIVRTRKLTSEEKEKFKPKRLFKDN
                     Y"
     gene            <18209..>18952
                     /gene="TPHA0D00150"
                     /locus_tag="TPHA_0D00150"
                     /db_xref="GeneID:11534575"
     mRNA            <18209..>18952
                     /gene="TPHA0D00150"
                     /locus_tag="TPHA_0D00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685045.1"
                     /db_xref="GeneID:11534575"
     CDS             18209..18952
                     /gene="TPHA0D00150"
                     /locus_tag="TPHA_0D00150"
                     /inference="similar to DNA sequence:INSDC:YLR078C"
                     /note="similar to Saccharomyces cerevisiae BOS1 (YLR078C);
                     ancestral locus Anc_8.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685093.1"
                     /db_xref="GeneID:11534575"
                     /db_xref="UniProtKB/TrEMBL:G8BS38"
                     /translation="MNAIYNHAVKQKNQLRDEIAKFESNLVTAPISLQGSISATLVSF
                     EKSINQYKEQVIKFQKENGKSTEESVIETIAKGGSRLESLINESKELTTKYKELKQKY
                     NEANARTELFANTSSTENPFNDASAMMNKRNVGVSQTSSNVDSSNQAGSLPMYDGLLK
                     EQNIFQKGNAQLDLILEMGQQSLEDIMEQNEVLKKVQDRMSSSLRTLGVSEETIHQIN
                     KRVFKDKLIFWIALFLLFLGMYLILKWLR"
     gene            complement(<19107..>20900)
                     /gene="TPHA0D00160"
                     /locus_tag="TPHA_0D00160"
                     /db_xref="GeneID:11534136"
     mRNA            complement(<19107..>20900)
                     /gene="TPHA0D00160"
                     /locus_tag="TPHA_0D00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685046.1"
                     /db_xref="GeneID:11534136"
     CDS             complement(19107..20900)
                     /gene="TPHA0D00160"
                     /locus_tag="TPHA_0D00160"
                     /inference="similar to DNA sequence:INSDC:YLR077W"
                     /note="similar to Saccharomyces cerevisiae YLR077W;
                     ancestral locus Anc_8.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685094.1"
                     /db_xref="GeneID:11534136"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:G8BS39"
                     /translation="MIRRQLLKKGITYRLLNCNHQLQTFALLNKSFTRKSSNTPKYDE
                     AELLAPRLTSNEYKADKKRQNFQWQEKSEEELSKEYADRIEKMAKLKAMLQGLGILVT
                     LGGVITIYSKWTSIHRWYLDRKLRFDLKYNKDSIQKKSSKKKSDNTKSTAPILPIIPI
                     DEKAFDVPGVYVWGQTATNDLLYPTRISQFDNQKFRDICLSPKDSLPNLAIDQNGDLI
                     KWDTSSHEFLLIDQNLISVKYSNEIAYALTKAGKILIIPVADHEMRYSHISSRRSWVK
                     PWKTYQNYNLSLDTDQAFKHKNENYIKDFDTGDNHLVLISNACKAYSCSTGITDVRND
                     NIKSYGQFGIPIFSQFDPMPKTNKLYEIELLNAGLNEDKKLITREIDQIACGARHTIA
                     KDKEGSVFAFGSNLFGQLGLPISYNNEYVSYPKKIGKFQSYFTRDEKFKCQNIFASDE
                     TSFVEMTSQTENEYYKNNSNISKRIFFSFGNGKNGTLGNGRYKNSQEEPSPIKVSNND
                     STKIEDLSCGGDFVVGTTNDKSVLLWGDNSYGQLANGKKYKTCKPQYMPDILKANSTL
                     TFNEFTETKLHLNEKQVIKPGKNSCCIYWKS"
     gene            <21311..>21964
                     /gene="TPHA0D00170"
                     /locus_tag="TPHA_0D00170"
                     /db_xref="GeneID:11534269"
     mRNA            <21311..>21964
                     /gene="TPHA0D00170"
                     /locus_tag="TPHA_0D00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685047.1"
                     /db_xref="GeneID:11534269"
     CDS             21311..21964
                     /gene="TPHA0D00170"
                     /locus_tag="TPHA_0D00170"
                     /inference="similar to DNA sequence:INSDC:YFL046W"
                     /note="similar to Saccharomyces cerevisiae YFL046W;
                     ancestral locus Anc_8.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685095.1"
                     /db_xref="GeneID:11534269"
                     /db_xref="InterPro:IPR012439"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:G8BS40"
                     /translation="MLSHGLRFSSRYNVNLRTVNAARTLKTTGIRLNDFDTVHIRNTS
                     KYRQLLIERGKFSSQQAATIVNLMSDAMKGGVNHVSQDLAKRERLTQLTYQQRVDFAK
                     LRDQLLTSDRSEFHNIQNEYESIRTDLEKLRSKMKQEITKANAGFKLDLSLEKGRVRD
                     ESSHHDLKIKEIDTRIDQEIVNMKVQIDSVKTQVLQWLFGVCTGTFALMLAYVRLIS"
     gene            complement(<22126..>22890)
                     /gene="TPHA0D00180"
                     /locus_tag="TPHA_0D00180"
                     /db_xref="GeneID:11534459"
     mRNA            complement(<22126..>22890)
                     /gene="TPHA0D00180"
                     /locus_tag="TPHA_0D00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685048.1"
                     /db_xref="GeneID:11534459"
     CDS             complement(22126..22890)
                     /gene="TPHA0D00180"
                     /locus_tag="TPHA_0D00180"
                     /inference="similar to DNA sequence:INSDC:YFL045C"
                     /note="similar to Saccharomyces cerevisiae SEC53
                     (YFL045C); ancestral locus Anc_8.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685096.1"
                     /db_xref="GeneID:11534459"
                     /db_xref="GOA:G8BS41"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BS41"
                     /translation="MVAAEFAYKENPETLVLFDVDGTLTPARLFITPNVKETLQKLRK
                     KVVIGFVGGSDLSKQVEQLGATVLDDFDYSFSENGLTAYRLGKELASQSFINWIGEEK
                     YNKLVVFILKYLSNIELPKRRGTFVEFRNGMINVSPIGRNASTEERNEYEKYDKQHNV
                     REKFVQALKDEFPDYGLTYSIGGQISFDVFPTGWDKTYCLQHVQADNFKEIHFFGDKT
                     FKGGNDYEIYEDKRTIGHSVTNPEETVKILNEIFHL"
     gene            complement(<23920..>24585)
                     /gene="TPHA0D00190"
                     /locus_tag="TPHA_0D00190"
                     /db_xref="GeneID:11531115"
     mRNA            complement(<23920..>24585)
                     /gene="TPHA0D00190"
                     /locus_tag="TPHA_0D00190"
                     /product="60S ribosomal protein L10"
                     /transcript_id="XM_003685049.1"
                     /db_xref="GeneID:11531115"
     CDS             complement(23920..24585)
                     /gene="TPHA0D00190"
                     /locus_tag="TPHA_0D00190"
                     /inference="similar to DNA sequence:INSDC:YLR075W"
                     /note="similar to Saccharomyces cerevisiae RPL10
                     (YLR075W); ancestral locus Anc_8.10"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="XP_003685097.1"
                     /db_xref="GeneID:11531115"
                     /db_xref="GOA:G8BS42"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:G8BS42"
                     /translation="MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVG
                     EFPLCVHLVSNELEQLSSEALEAARICANKYMTKVSGRDAFHLRVRVHPFHVLRINKM
                     LSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVIEGLRRARYKFP
                     GQQKIIISKKWGFTSLDRAEYVKRMEAGEVKDDGAFVKFLSKKGPLEANMREFPAYFA
                     NQA"
     gene            <25129..>25629
                     /gene="TPHA0D00200"
                     /locus_tag="TPHA_0D00200"
                     /db_xref="GeneID:11534124"
     mRNA            <25129..>25629
                     /gene="TPHA0D00200"
                     /locus_tag="TPHA_0D00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685050.1"
                     /db_xref="GeneID:11534124"
     CDS             25129..25629
                     /gene="TPHA0D00200"
                     /locus_tag="TPHA_0D00200"
                     /inference="similar to DNA sequence:INSDC:YLR074C"
                     /note="similar to Saccharomyces cerevisiae BUD20
                     (YLR074C); ancestral locus Anc_8.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685098.1"
                     /db_xref="GeneID:11534124"
                     /db_xref="GOA:G8BS43"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:G8BS43"
                     /translation="MGRYSVKRYKTKRRTKDLDLIYNELTSKEKIHGLLNQPMDETKP
                     GLGQHYCIHCAKYMETAIALKTHLKTKVHKRRVKELKEVPYTQEVANAAAGVDLNKFL
                     NRVEQIKTKVGIEKNDNEVLLKDHLTEKLSNIKSTEPTLPWVTEENVEQPVEATSSTQ
                     DEIKMD"
     gene            complement(<25797..>26780)
                     /gene="TPHA0D00210"
                     /locus_tag="TPHA_0D00210"
                     /db_xref="GeneID:11534235"
     mRNA            complement(<25797..>26780)
                     /gene="TPHA0D00210"
                     /locus_tag="TPHA_0D00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685051.1"
                     /db_xref="GeneID:11534235"
     CDS             complement(25797..26780)
                     /gene="TPHA0D00210"
                     /locus_tag="TPHA_0D00210"
                     /inference="similar to DNA sequence:INSDC:YFL044C"
                     /note="similar to Saccharomyces cerevisiae OTU1 (YFL044C);
                     ancestral locus Anc_8.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685099.1"
                     /db_xref="GeneID:11534235"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:G8BS44"
                     /translation="MFIQQLLNKFKCHNIQSHLQKMRLKITGQNGFNEVLTLDNDSTL
                     QDLVNKVAIESKIISIRYGYPPVKVELNQENLCQKLDNLNISSGEKISLVLESDGFKG
                     TGSVVSETPAKILKETQIYVEIPGEGEKVLQTHVVPDDNSCLFHSISYCMYKEITLAQ
                     ELRKIVSDEILKKPDFYNSAILEKSNKEYASWILKKDSWGGGIEISILSEKLEVAIYV
                     VDIDGEDISKFNEDKYDKFIMIVFNGVHYDSVEIESNKKTVFDKNEELNSNIVLSGAL
                     SIAKQLKDNGYSFNTHKDRIKCNTCQRILVGERDVAKHAEATGHYDFGQAK"
     gene            complement(<27012..>29246)
                     /gene="TPHA0D00220"
                     /locus_tag="TPHA_0D00220"
                     /db_xref="GeneID:11534544"
     mRNA            complement(<27012..>29246)
                     /gene="TPHA0D00220"
                     /locus_tag="TPHA_0D00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685052.1"
                     /db_xref="GeneID:11534544"
     CDS             complement(27012..29246)
                     /gene="TPHA0D00220"
                     /locus_tag="TPHA_0D00220"
                     /inference="similar to DNA sequence:INSDC:YFL042C,YLR072W"
                     /note="similar to Saccharomyces cerevisiae YFL042C and
                     YLR072W; ancestral locus Anc_8.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685100.1"
                     /db_xref="GeneID:11534544"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G8BS45"
                     /translation="MSRLLWNKYSANDNRLQDIKNASNSTIANSTSETVLKISTRPSY
                     EESSGENSGNMSDVDEICSKGSRGTLQTKHSQHVLTTKRSLMRMGSDHISMKSLPADP
                     HVSEINSLSENGATYSDDNEALKLVNGFVDKGSYQLDSKEKNDRQNKSLDFNPNNAND
                     QNASNYSFLGNVMTSLAFGKGNHDMDQNYSLDKFSEKQHFASTTRDKIFHNLFQSIAE
                     DERLIDTFENFKIIIDILGKKNVTYFGDLYISSHHLSFNSKSLNGLNFNFTLLFTDVL
                     KIKLSGKSNIVVKTTNGDLLITSKNSKQKKTNLLIADLHTLLNDSHSSQSILYSGVNN
                     TEHANRALSPTLLLTHNNKCPSGENLHNQRKISENNDELIQNAIRSVDDYSTSELNFT
                     NDNDSDIEFDYDNVDAQVTGTEDSLCDLDNSNQSIYILKPDSKYSYNGPAIHSKTSGS
                     SEKLHKNEYVLSETVLNSPPGLVFQLMFSDLNYNFWLEFGKVQSNTEFSGFGIYEDNI
                     DEDGNTYREYKYTKALNYPIGPKSTTCFTRDTILRMDFTDHIDVLNTTTTPDVPSGDS
                     FSMKTRYQFSWGDDNTCVLKISYWVDWTGSSWIKGMIDSSCKSGQISVNKEMIPFIQE
                     YVRKHTIQSKSVPPKKKISIDNPTYKIKESSKIQKILEPSNNSKPVSTQTARNGEKSN
                     SKKLEDKASNTHNYIIIILLCCVTLLCSIQTYQNYVIQKTVDELNESMRIITKIVLTY
                     WSTE"
     gene            <29994..>32264
                     /gene="TPHA0D00230"
                     /locus_tag="TPHA_0D00230"
                     /db_xref="GeneID:11531022"
     mRNA            <29994..>32264
                     /gene="TPHA0D00230"
                     /locus_tag="TPHA_0D00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685053.1"
                     /db_xref="GeneID:11531022"
     CDS             29994..32264
                     /gene="TPHA0D00230"
                     /locus_tag="TPHA_0D00230"
                     /inference="similar to DNA sequence:INSDC:YLR069C"
                     /note="similar to Saccharomyces cerevisiae MEF1 (YLR069C);
                     ancestral locus Anc_8.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685101.1"
                     /db_xref="GeneID:11531022"
                     /db_xref="GOA:G8BS46"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS46"
                     /translation="MLLMPRLVPVQRTTSFFKHIPSILVNSNRSFHASQLRKAGIDEE
                     ESKVLTTIQSSLTDADNVALNKLRNIGISAHIDSGKTTFTERVLYYTGRIDAIHEVRG
                     RDSVGAKMDSMDLEREKGITIQSAATYCSWEKDGQKYHYNLIDTPGHIDFTIEVERAL
                     RVLDGAVMILCAVSGVQSQTVTVDRQMRRYNVPRITFINKMDRMGANPWRAIEQINNK
                     LKISAAAIQVPIGSESELNGVVDIINREALYNKGPQGEIVEKGPVPDELKDLVEEKRS
                     ILIEKLADVDDEIAELFIDEQEPTVEQIKSAIRRATTARTFTPVLMGTALGNTGIQPM
                     LNAIVDYLPNPSEVVNTALDISKNETKVSLIPSLSKPFVGLAFKLEEGKYGQLTYIRV
                     YQGKLRKGSYISNVKNGKKIKVARLVRMHSDEMEDVEEVGPGEICATFGIDCSSGDTF
                     TDGSLQYSMTSMYVPDAVVSLSIKPKTKDSTNFSKAFNRFQKEDPTFRVKFDPESKET
                     IISGMGELHLEIYVERMKREYNVECETGKPQVSYRESITMPADFDYVHKKQSGGAGQY
                     GRVIGTLSNIEGETKENIFETAVVGGKISEKYLAACGKGFEEACEKGPLTGHRVIGVK
                     MLINDGAIHAVDSNELSFKTATMSAFRESFLRANPVILEPIMTVTVTCPNEFQGNVNS
                     LLNKLQAVIQDTENGHDEFTIKAECPLSTMFGFATSLRASTQGKGEFSLEFSHYSATP
                     PHVQKQLMAEYAKKHK"
     gene            complement(<32398..>33075)
                     /gene="TPHA0D00240"
                     /locus_tag="TPHA_0D00240"
                     /db_xref="GeneID:11531031"
     mRNA            complement(<32398..>33075)
                     /gene="TPHA0D00240"
                     /locus_tag="TPHA_0D00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685054.1"
                     /db_xref="GeneID:11531031"
     CDS             complement(32398..33075)
                     /gene="TPHA0D00240"
                     /locus_tag="TPHA_0D00240"
                     /inference="similar to DNA sequence:INSDC:YLR066W"
                     /note="similar to Saccharomyces cerevisiae SPC3 (YLR066W);
                     ancestral locus Anc_8.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685102.1"
                     /db_xref="GeneID:11531031"
                     /db_xref="GOA:G8BS47"
                     /db_xref="InterPro:IPR007653"
                     /db_xref="UniProtKB/TrEMBL:G8BS47"
                     /translation="MYSLSQRFQNVTNQALTYSFLIIGFVIATSWFHLQQNNVFQTPV
                     AINTLNSNINVRSSRFFGSTTGKPKENAKITFDLDADFTPFFNWNTKQIFAYLVAEYN
                     GDEKNTKNTVTFWDKIIADKENAVLSIKSEKSKYAVWDLEDKFAGRELTFKLQWNIQP
                     WIGPLVFGETVGNCTFTLPVEQKEKASSNTNNDEATAEKPQKKNRKARKARKAKATNK
                     DSTENKN"
     gene            complement(<34030..>35721)
                     /gene="TPHA0D00250"
                     /locus_tag="TPHA_0D00250"
                     /db_xref="GeneID:11534263"
     mRNA            complement(join(<34030..35147,35712..>35721))
                     /gene="TPHA0D00250"
                     /locus_tag="TPHA_0D00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685055.1"
                     /db_xref="GeneID:11534263"
     CDS             complement(join(34030..35147,35712..35721))
                     /gene="TPHA0D00250"
                     /locus_tag="TPHA_0D00250"
                     /inference="similar to DNA sequence:INSDC:YFL039C"
                     /note="similar to Saccharomyces cerevisiae ACT1 (YFL039C);
                     ancestral locus Anc_8.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685103.1"
                     /db_xref="GeneID:11534263"
                     /db_xref="GOA:G8BS48"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:G8BS48"
                     /translation="MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIM
                     VGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
                     VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVT
                     HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCY
                     VALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQ
                     TTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPE
                     RKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF"
     gene            <36467..>37024
                     /gene="TPHA0D00260"
                     /locus_tag="TPHA_0D00260"
                     /db_xref="GeneID:11530960"
     mRNA            <36467..>37024
                     /gene="TPHA0D00260"
                     /locus_tag="TPHA_0D00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685056.1"
                     /db_xref="GeneID:11530960"
     CDS             36467..37024
                     /gene="TPHA0D00260"
                     /locus_tag="TPHA_0D00260"
                     /inference="similar to DNA sequence:INSDC:YLR065C"
                     /note="similar to Saccharomyces cerevisiae YLR065C;
                     ancestral locus Anc_8.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685104.1"
                     /db_xref="GeneID:11530960"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:G8BS49"
                     /translation="MAGNATKKQANANNESLNTLYKLSIPIVLLSYLRVASVSQLVKN
                     TVFNVPLMACLYVFEKNARPTYRTEQVTGGAQRKRLVHEGSLDLNQQGGLTEYMFDMI
                     YLSLAGNLGKFLLNTNKVWYVVYVVIPLYVLYKINGLKNQFFGSKDSKQAGPDGGISK
                     ESAPSKSKRQTKREQRGDKAQVRYR"
     gene            complement(<37369..>37992)
                     /gene="TPHA0D00270"
                     /locus_tag="TPHA_0D00270"
                     /db_xref="GeneID:11534595"
     mRNA            complement(<37369..>37992)
                     /gene="TPHA0D00270"
                     /locus_tag="TPHA_0D00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685057.1"
                     /db_xref="GeneID:11534595"
     CDS             complement(37369..37992)
                     /gene="TPHA0D00270"
                     /locus_tag="TPHA_0D00270"
                     /inference="similar to DNA sequence:INSDC:YFL038C"
                     /note="similar to Saccharomyces cerevisiae YPT1 (YFL038C);
                     ancestral locus Anc_8.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685105.1"
                     /db_xref="GeneID:11534595"
                     /db_xref="GOA:G8BS50"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS50"
                     /translation="MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVD
                     FKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNSVKMW
                     LQEIDRYATSTVLKLLVGNKSDMTDKRVVEYDVAKEFAEQNKMPFLETSALDSTNVEE
                     AFLTMARQIKESISHQQQIEMKSGNDDKSGNVNLKGQSLAASSSSCC"
     gene            complement(<38413..>39249)
                     /gene="TPHA0D00280"
                     /locus_tag="TPHA_0D00280"
                     /db_xref="GeneID:11530952"
     mRNA            complement(<38413..>39249)
                     /gene="TPHA0D00280"
                     /locus_tag="TPHA_0D00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685058.1"
                     /db_xref="GeneID:11530952"
     CDS             complement(38413..39249)
                     /gene="TPHA0D00280"
                     /locus_tag="TPHA_0D00280"
                     /inference="similar to DNA sequence:INSDC:YLR064W"
                     /note="similar to Saccharomyces cerevisiae YLR064W;
                     ancestral locus Anc_8.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685106.1"
                     /db_xref="GeneID:11530952"
                     /db_xref="UniProtKB/TrEMBL:G8BS51"
                     /translation="MTGGGNANGASPSSVHQAYPLSALLRTRLRQPQFYWFLGHFLAL
                     YHFVCLHLSFWSWNNQLYHYEMCLLYVSVTYTVVLYQFYKSGQLRFVSLRQFFRILKT
                     LDNLQYFVLVAFFLILAITQMVMISGVLYPLMVFSVFHFLNYFKENLLPFLPINSIFK
                     NLVNNNFTNFINNYSNFFFQMAQFFEIITCLKLTLIKLPLLLVKFPVLMVTKNDLYTI
                     LASIFYLYFFKLRYLQSKSMQLLLTQLVMKADSNIPLNYKSIWLKYKNLIKVIFENLP
                     VA"
     gene            complement(<39398..>39985)
                     /gene="TPHA0D00290"
                     /locus_tag="TPHA_0D00290"
                     /db_xref="GeneID:11534293"
     mRNA            complement(<39398..>39985)
                     /gene="TPHA0D00290"
                     /locus_tag="TPHA_0D00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685059.1"
                     /db_xref="GeneID:11534293"
     CDS             complement(39398..39985)
                     /gene="TPHA0D00290"
                     /locus_tag="TPHA_0D00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685107.1"
                     /db_xref="GeneID:11534293"
                     /db_xref="UniProtKB/TrEMBL:G8BS52"
                     /translation="MSALTLTDYLLLICLSSIVYLKSGRCCVVDSSCFLFCEERARKR
                     GVICDDGRISRSRGGRRPCLRYALIGKNDLVPVPGRRQCQCQRQCQCQRQCVGMLVSA
                     CQYVSVFICRYGGIPVCGSMHAATLLHPRVSLWPSTGDPASFHPGNRSAKKNFNGTNF
                     TCQRPLFSTHHQPWNTETTMVYKESGSFFLGLLFL"
     gene            <40283..>41638
                     /gene="TPHA0D00300"
                     /locus_tag="TPHA_0D00300"
                     /db_xref="GeneID:11534265"
     mRNA            <40283..>41638
                     /gene="TPHA0D00300"
                     /locus_tag="TPHA_0D00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685060.1"
                     /db_xref="GeneID:11534265"
     CDS             40283..41638
                     /gene="TPHA0D00300"
                     /locus_tag="TPHA_0D00300"
                     /inference="similar to DNA sequence:INSDC:YFL037W"
                     /note="similar to Saccharomyces cerevisiae TUB2 (YFL037W);
                     ancestral locus Anc_8.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685108.1"
                     /db_xref="GeneID:11534265"
                     /db_xref="GOA:G8BS53"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G8BS53"
                     /translation="MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGNYHGHDDLQK
                     AKLGVYFNEASSGKWVPRSVNVDLEPGTIDAVRNSAMGNLFRPDNYIFGQSSAGNVWA
                     KGHYTEGAELVDSVLDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVVPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLN
                     QPSYGDLNKLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAI
                     GTQSFRSLSVPELTQQMFDARNMMAASDPRNGRYLTVAAFFRGKVSVKEVEDEMLKVQ
                     TRNSSYFVEWIPNNVQTAVCSVPPKDLDMSATFIGNSTSIQELFKRVGDQFSAMFKRK
                     AFLHWYTSEGMDEMEFSEAESNMNDLVSEYQQYQEATVEDDEEEIDYANDDQPVIENF
                     D"
     gene            <42445..>46413
                     /gene="TPHA0D00310"
                     /locus_tag="TPHA_0D00310"
                     /db_xref="GeneID:11534618"
     mRNA            <42445..>46413
                     /gene="TPHA0D00310"
                     /locus_tag="TPHA_0D00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685061.1"
                     /db_xref="GeneID:11534618"
     CDS             42445..46413
                     /gene="TPHA0D00310"
                     /locus_tag="TPHA_0D00310"
                     /inference="similar to DNA sequence:INSDC:YFL036W"
                     /note="similar to Saccharomyces cerevisiae RPO41
                     (YFL036W); ancestral locus Anc_8.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685109.1"
                     /db_xref="GeneID:11534618"
                     /db_xref="GOA:G8BS54"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="InterPro:IPR024075"
                     /db_xref="InterPro:IPR029262"
                     /db_xref="UniProtKB/TrEMBL:G8BS54"
                     /translation="MLTKRRWVLSSLKSRVLCFSKDRFISTKASLLLNQANNADVAKM
                     NHINGNPNLNIRDLGFMKSSDVSLAPNFSQFDNSQSSVNLVSSHKRDVMQLWSLLEAC
                     LHSNYMERAFSILKSLYTVQHHRSYFIDDYNFYLMKFVENCGSISELQKKVKTDLQKH
                     FPETEYNDKTLAIMIHHALSFKSSTGKSSDEGEIANAIKTYFLMGNNGLRKIVSFVDV
                     FTVEDYNKLYSKYNAISLMDIPPVMRPLVKDESPVNNDLVNTIIGSQRDNTHNLASDG
                     NETADDSSAVNMNADQEVIPKLDFDATVTTVDKDASKLVAVDTIGMKVVRHTLLGLTL
                     NENQKKKIKSFHFEADKNLLNIDEQKTIDFYELSNSLTNEAERERFEDALNEFNQDRQ
                     RALELRATNAAKERWKYDFEEAKARGDISIKKNLNVKLWEWYTKMLPYVKQEIEKCKE
                     VMNSTEKKSTVSRQNRLRMEYAPYFTLVDPEKMCVITILELLKLNSTGGIIEGMRTAR
                     AVIAVGKAIEMEFRSEQLLKNESHIFKEIKQSQNLKRFVRSAKSRFRSIKIEQSKIIW
                     SQPARAKIGSIMISNLINVAKIEVGGMDPVTKEKVYGEVPAFSHSYQYHNGLKLGVLK
                     IHKSLVHQLNGERMVAAVQPQLLPMLVAPREWKNWKCGGYYYTQSTLIRSKDSPEQVA
                     YLKAVSDAGAIDRVYHGLNVLGSTPWTVNRKIFNVISEVWNTGKPFLDIPGIQNTLNL
                     LPPPAKDADPSIIRQWKLKNKDIANKFSSNRSVRCDSNYKLEIARAFLGEKIYFPHNL
                     DFRGRAYPLSPHFNHLGNDMSRGLLIFWRGKQLGASGLKWLKVHLSNLYGFDKASLED
                     RVRFAEENMENIKDSAENPLNGKGWWKSADKPWQALSTCIELNEAFKLENPEDFISHQ
                     PVHQDGTCNGLQHYAALGGDCEGAKQVNLKPSDKPMDVYKYVANLVVERLKKEAAGGD
                     EKAKVLQDKITRKVVKQTVMTNVYGVTYVGATFQIDKQLSDVFENRNQSLELSKYLTR
                     HVFMAIRELFHGAHLIQDWLGECSNKISRSIRLDVNEKSFKNQNKPDFMSSVIWTTPL
                     GLPIVQPYREGSKKQVRTNLQTVFISDPFSINPVNARRQKAGFPPNFIHSLDASHMLL
                     SASACGEKGLDFASVHDSYWTHACDIDIMNKALRDQFVALHEVDLIQRLKNEFDERYK
                     NYVQVTNIDRSSDLAKRIIQVRAQLSEELGHSCTLADEIQHERTRQELLNSDNPEDKK
                     KGEEMVTSVSLTSDHITAVKEVKASAYGSMPIIIPLKLPPIPPKGNFDVQETKESLYF
                     FS"
     gene            complement(<46569..>47720)
                     /gene="TPHA0D00320"
                     /locus_tag="TPHA_0D00320"
                     /db_xref="GeneID:11530955"
     mRNA            complement(<46569..>47720)
                     /gene="TPHA0D00320"
                     /locus_tag="TPHA_0D00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685062.1"
                     /db_xref="GeneID:11530955"
     CDS             complement(46569..47720)
                     /gene="TPHA0D00320"
                     /locus_tag="TPHA_0D00320"
                     /inference="similar to DNA sequence:INSDC:YFL034C-B"
                     /note="similar to Saccharomyces cerevisiae MOB2
                     (YFL034C-B); ancestral locus Anc_8.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685110.1"
                     /db_xref="GeneID:11530955"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:G8BS55"
                     /translation="MKILCRNFGRNGKKNKNQTSPLATPSAPMTNSIYSNTNASTSRH
                     SLRRTNSPLKRSSTPSSQQQQQQQQQQQQQQXLQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQLLLQQQQQQQQQHRLQLQQQQQQQQQQQQQHVL
                     PEHSQGRQIQQQQHKSAVSQPTIDEQGNKKLMFLSEPFVRTALVKGSFKTIVQLPKYV
                     DVGDWVALNVFEFFTNLNQFYGVIAEYVTPEAYPTMNAGPHTDFLWLDANNRQVSLPA
                     SQYIDLALTWINNKLNDKNLFPTSNDVPFPQNFQRDVQRIMVQMFRIFAHMYYHHFDK
                     IIHLSLEAHWNSLFAHFISFSKEFNIMDRKDMYPLLSLIEVFERQDKII"
     gene            complement(<48406..>49288)
                     /gene="TPHA0D00330"
                     /locus_tag="TPHA_0D00330"
                     /db_xref="GeneID:11531027"
     mRNA            complement(join(<48406..48756,49277..>49288))
                     /gene="TPHA0D00330"
                     /locus_tag="TPHA_0D00330"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_003685063.1"
                     /db_xref="GeneID:11531027"
     CDS             complement(join(48406..48756,49277..49288))
                     /gene="TPHA0D00330"
                     /locus_tag="TPHA_0D00330"
                     /inference="similar to DNA
                     sequence:INSDC:YFL034C-A,YLR061W"
                     /note="similar to Saccharomyces cerevisiae RPL22B
                     (YFL034C-A) and RPL22A (YLR061W); ancestral locus
                     Anc_8.31"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_003685111.1"
                     /db_xref="GeneID:11531027"
                     /db_xref="GOA:G8BS56"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:G8BS56"
                     /translation="MAPNTSRKQKITKTFTVDVSSPVENGVFDPAAYAKYLIDHIKVE
                     GAVGNLGNAVTVQENGSVVTVVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNE
                     YKLSFYQVTPEDEEEDEE"
     gene            <49968..>53144
                     /gene="TPHA0D00340"
                     /locus_tag="TPHA_0D00340"
                     /db_xref="GeneID:11534126"
     mRNA            <49968..>53144
                     /gene="TPHA0D00340"
                     /locus_tag="TPHA_0D00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685064.1"
                     /db_xref="GeneID:11534126"
     CDS             49968..53144
                     /gene="TPHA0D00340"
                     /locus_tag="TPHA_0D00340"
                     /inference="similar to DNA sequence:INSDC:YFL034W"
                     /note="similar to Saccharomyces cerevisiae YFL034W;
                     ancestral locus Anc_8.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685112.1"
                     /db_xref="GeneID:11534126"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BS57"
                     /translation="MSDSEEDLGITLKGLKIGKKVRNNSTVESGEKLDNPVDNTQSFD
                     DCRYDNDPAFNIGNDHIENELSVGLDSNPFLELFVDTGEVRINDSNDNNENGKIQSEL
                     SNVPSRVSVNSDVSVIVSNNALDHDEFGSDENNSDSSDEWQTMPTVASHNIYNNKGEL
                     EVKPYKIHSSNSLSQSQQNLSQTQSNDNLNTNESKKGNVFGYTKVGTEDQVQRSYLNN
                     KKTDFLFSHKKLLNSNHSKLSIESPNKVDVHSKFYDEYEYETEELIDVDTNKQLNITK
                     NLLSGNEKIAYAGAINVLTNEMCEELAHLSLCVDIKSHKKLAQRLQYTQKAMAAWKVD
                     VTSRLYKHLEITDVEVKMVEKLSLHGIILEDLVKCLKTTTTIENPFTDDAVISDDDNE
                     LEKEGKVTEVDTNDLNSDFKNDDGNKEDVTNDMNDITITESADIKNTSNNSKESINPS
                     PPREIIDAENIKDRELNVDVAWTIICDLFLLQLQNSAYDSRARTLLIKFAKALNITKM
                     EIDEFEKRITDSLDLEQSTEDQVWNEHMHATRRRKKNKKKKLAYVGLAMVGGSLVLGL
                     SGGLLAPVIGAGIAAGLSTMGVTGATGFLTGIGGTATVAVTSTAIGAKIGAQGMSKRM
                     GSVRTFEFRPLHNNRRLNLILSVSGWMIGNVDDVRLPFSTVDPIEGDLYSLYWEPEML
                     RSVGQTINILASEVFTQTIQQVLGATILTAFMASIQVPMALSKLGYLIDNPWNVSLDR
                     AWAAGLILADTLVARNLGDRPMTLVGFSLGSRVIFSCLVELCKRKAMGIVENVIIFGT
                     PTVKNKEHLVMARSVVSGRFINGYSNIDWVLAYLFRATSGGFRSIMGISKIEGIEGIE
                     NFDCSKIVEGHLKYRENIPKLLKALNIPVTSDEFAEIEETMDPEEVSRQRQLMNDVNV
                     AQQKLAADKKNNGWLSGWMKPKKSKWQTMVEQSVEEGRSNTSALASGSTGSKRKDNSL
                     VDHGALMQELANIRSAMNKKNSKDGKPLSEPIDLMELTKPDSQVYRKPPENPNNFSLL
                     SAGRPVLPKDEEMNSNGRNISFSFPDDI"
     gene            complement(<53272..>55059)
                     /gene="TPHA0D00350"
                     /locus_tag="TPHA_0D00350"
                     /db_xref="GeneID:11534542"
     mRNA            complement(<53272..>55059)
                     /gene="TPHA0D00350"
                     /locus_tag="TPHA_0D00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685065.1"
                     /db_xref="GeneID:11534542"
     CDS             complement(53272..55059)
                     /gene="TPHA0D00350"
                     /locus_tag="TPHA_0D00350"
                     /inference="similar to DNA sequence:INSDC:YLR060W"
                     /note="similar to Saccharomyces cerevisiae FRS1 (YLR060W);
                     ancestral locus Anc_8.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685113.1"
                     /db_xref="GeneID:11534542"
                     /db_xref="GOA:G8BS58"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:G8BS58"
                     /translation="MPTVSVLKQQLFDLLGKNYTNEEFDELCFEFGIELDEDTTEEAL
                     KNNEEPQLKIEIGANRYDLLCIEGIAQSLNEYLGRAESPKYKLTAPTTKLIVDPTVAQ
                     IRPYCASAILRNIKFDAKSYASFIALQDKLHSNLCRNRSLVAMGTHDLDTMQLPVHYR
                     ALPPKDIKFVPLNQTKEFNGEELIEFYNQPEQKSNIGRFTHIIEDSPVFPVIMDDNDV
                     VCSLPPLINSEHTKISMDTRNIFIDITATDKTKAEIVVNMLVSMFSRYCDEPFTVEPV
                     TIESDHNGESRVCPDISERVMDVSIKYINSCLGLEQTPEEIAACLKKMSLKAVSSTEN
                     KDVMHVSIPITRPDILHRCDIMEDAAVGYGYNNLPKGEKLSNANFISTPLPINKVSDI
                     FRAASAQASWVEVLPLTLCSHDENFKFIRVEDDGTKVVQLANPKTLEYQVVRTTLLPG
                     ILKTVKENRKHSLPIKLFETGDVVFKNEQLERKAYNERHWGAIYVGKNSGFEIIQGLL
                     GKIMQTFRTNWLIDYGVSSSGRGYWIEEDKSLTTYFEGRGARIMFRSKEGEQAQQIGH
                     LGVLHPEVMNNFDIPHAASYVEINAEVFL"
     gene            complement(<55596..>60206)
                     /gene="TPHA0D00360"
                     /locus_tag="TPHA_0D00360"
                     /db_xref="GeneID:11531046"
     mRNA            complement(<55596..>60206)
                     /gene="TPHA0D00360"
                     /locus_tag="TPHA_0D00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685066.1"
                     /db_xref="GeneID:11531046"
     CDS             complement(55596..60206)
                     /gene="TPHA0D00360"
                     /locus_tag="TPHA_0D00360"
                     /inference="similar to DNA sequence:INSDC:YFL033C"
                     /note="similar to Saccharomyces cerevisiae RIM15
                     (YFL033C); ancestral locus Anc_8.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685114.1"
                     /db_xref="GeneID:11531046"
                     /db_xref="GOA:G8BS59"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BS59"
                     /translation="MMNITRSASNSSSGSSTNYEKYLNLATESNPSMILELDLLGNIR
                     YISPIWEQIIGTKLPEVGSSMSDIIIGSETDKGVFNEVIKIWADNDSVSYTVTFGLHG
                     KYSEVVTMEACGVLIHDSITNKATHSMWIMKPIDEQLKDDYLRTSSRLPEEFIKILGF
                     GSHIFLDYLNFVQSQLCLDESNLPTPNLELCRVCETFVPDWWLESHSKSCVCEHRIQS
                     LIQLLQENLVEHCNYLYSITKENDSNEDSDNDSTISNYFNFEYKGYASKISPATIANL
                     IDLCELAMAANISQIQKPSDNTRIHTNTAFRAIEGSQQMDKFDFSPNTQTIIQEVTNW
                     RPPYIDEPDQGLTLLVEHTTKISKDKIDALLRLDNAMTFSYRLKNEVNNYVFQLIIEQ
                     IENNRLFLTHSMGSPIIRQNLTAKENSIDSDIQSNIPSSSQQTLTHGDSIDNIQQNNT
                     SIANIASPQSQRPQTGTLFADAYLNEDVIPNSEVQQDDSLLGNKEGSKTQWSSKIDGF
                     HSRSITPKQTIESAEKIENNSSMSMTDGLKISIFNNIMDPNTPKLRSDSYINLQNTGN
                     PTSRHKIAVPNSFVLPKMKTSIVVTPRKGSPLLTSSSSASNINSLNQISRSSSTTKNI
                     IDKCRSPISSPRVSINNLMTPDQVVNMNSVLKQPLSPLLLATNPVKNLNPNIKNYDVI
                     KPISKGAYGNVYLGRKKLTGDYVAIKVLRKSDMIAKNQVTNVKSERAIMIVQSEKPYV
                     VNLFESFQNKDNLFLVMEYLPGGDLATVIKMMGYLPDNWVKQYICEIVIGVADMHENG
                     IIHHDLKPENLLIDKKGHLKLTDFGLSRAGLVHRHQNRPQLGNRLSISSSHSNSSKNN
                     NNYDDMNNANIILDGIIRDRDRRHSNSSSISNIEPLMLNKNDSSGSFPFDDFTSTTAN
                     NNSASHKKQYCSLHSENQESTTLSDYALYHPNDSKNKANFFGTPDYLAPETIRGIFEG
                     NQCDWWSAGCILFEMYFGYPPFHGKDIQSVFENILLDDIHWPNFSSPEEERECISPEA
                     KDLITKFLIKDPLKRMGTGGISEIQEHSYFNDVNWDGVYEEEASFIPNVEHPEDTDYF
                     ELRGAVLEDLGEDLDDIVDTKIDDSNIEDSINISKVLSEGSQFKGTTSAVFERPNINT
                     PVNKTNISTLFEADSRRFSDPSSPTVKSPLSGLSQHLRERRHSKLSDSKGDFGSFNYR
                     NLVALDKANKDAINRLKSEHLMELQSSNRRTSTASIPSSSSDSSIVKVRQSRTSISNN
                     SAKGHAHNSSTVSELSFRSISPERTTAIYGQKIPTTNKGTNPEVVEGQNLSSYSKNDD
                     TNPLKLEMPSTPIQANKPYVLTHSPFTARSLSTSKTGSGKKNSEESSAEEVDKLQAIS
                     KIQSVRNRRKSARKNSSNVEQMLFKLDILLCEPIPIHRYYITKDLETLGCTVVSVAAG
                     DELISRATSGIKFDLIITALKLPKLGAVDIVKLLKHTNGINSFTPVVAVTSYYHEATN
                     ANIFSDVFEKPITLDVLKKLVSKYALLKSQMEEDSILSDNEP"
     gene            <61016..>61849
                     /gene="TPHA0D00370"
                     /locus_tag="TPHA_0D00370"
                     /db_xref="GeneID:11534125"
     mRNA            <61016..>61849
                     /gene="TPHA0D00370"
                     /locus_tag="TPHA_0D00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685067.1"
                     /db_xref="GeneID:11534125"
     CDS             61016..61849
                     /gene="TPHA0D00370"
                     /locus_tag="TPHA_0D00370"
                     /inference="similar to DNA sequence:INSDC:YLR059C"
                     /note="similar to Saccharomyces cerevisiae REX2 (YLR059C);
                     ancestral locus Anc_8.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685115.1"
                     /db_xref="GeneID:11534125"
                     /db_xref="GOA:G8BS60"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:G8BS60"
                     /translation="MFRLSRLLRNCRYYNSIGKSNPYLHNKRTGSYRFPKHIYDSKYK
                     MSSTNVVRGPLVWIDCEMTGLDHLNDHIIEICCIITDGDLNIVKDPVTGEDNVYESVV
                     HYGKDVMSKMNEWCIQQHGSSGLTDQVLKSEKTLASVQQEIQDFLVKYIPEQRVGLLA
                     GNSVHVDRLFLLREFPKLVEHLHYRIVDVSSIMEMCKRHNPELQSVVPPKQGAHTAKS
                     DIIESINQLKWYKEHYFKNSTETAEFVETEKQKHANQNENVVTPTNVISSENKKRKLE
                     N"
     gene            <65285..>66406
                     /gene="TPHA0D00380"
                     /locus_tag="TPHA_0D00380"
                     /db_xref="GeneID:11534579"
     mRNA            <65285..>66406
                     /gene="TPHA0D00380"
                     /locus_tag="TPHA_0D00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685068.1"
                     /db_xref="GeneID:11534579"
     CDS             65285..66406
                     /gene="TPHA0D00380"
                     /locus_tag="TPHA_0D00380"
                     /inference="similar to DNA sequence:INSDC:YFL031W"
                     /note="similar to Saccharomyces cerevisiae HAC1 (YFL031W);
                     ancestral locus Anc_8.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685116.1"
                     /db_xref="GeneID:11534579"
                     /db_xref="GOA:G8BS61"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BS61"
                     /translation="MTSAIAQNIHLLNSSPALVLNPASSPASSNETIDTKSLVNGIPS
                     DFKSTLPPRKRAKTKEEKEQRRIERILRNRKAAHQSREKKRLHLLFLEKKCAILEKIL
                     AKIDNLDTFLEADKALLADFQALSEEGLQFQPSSNSVGTSSPVDDEPTEKLSKSISSE
                     KKSTTKKVKKPTKSSNKHKIKLATVESNISPPSTILSSSNSDGNSLSDTGIFFKEEYD
                     SPMMPEEDSLTSFTINRERLNTWDLQLTRSYSNNEHGTSSNIGSVHKRLGSHQNDKLK
                     FMTKDDLVLSKGNTFKSSETNDESMDHLMNNRPSDYTPTLANNSTFKFKKIESDDFFL
                     LSDDCSNNNYNDIADSFGNANKSPFFNDYQNTDQQALYL"
     gene            <67045..>68238
                     /gene="TPHA0D00400"
                     /locus_tag="TPHA_0D00400"
                     /db_xref="GeneID:11534121"
     mRNA            <67045..>68238
                     /gene="TPHA0D00400"
                     /locus_tag="TPHA_0D00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685069.1"
                     /db_xref="GeneID:11534121"
     CDS             67045..68238
                     /gene="TPHA0D00400"
                     /locus_tag="TPHA_0D00400"
                     /inference="similar to DNA sequence:INSDC:YFL030W"
                     /note="similar to Saccharomyces cerevisiae AGX1 (YFL030W);
                     ancestral locus Anc_8.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685117.1"
                     /db_xref="GeneID:11534121"
                     /db_xref="GOA:G8BS62"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:G8BS62"
                     /translation="MLNSVKKIYNKLTYNELVAEKVILIPGPVELSAKVKESQTLAIM
                     VPTDPRFVLTFQRVLRNTRKLFNSENQNAQPFVMSGSGTLGWDVVGANVIRKNDKVLM
                     LNIGYFSSSFTKTLQLYGAEVKELAAQVGETVPLQTIKEELSKTDYKVLCITQVDTST
                     AVLSDVEGISKIAKEVSPDTLIIVDGVCSIGCETLKFDEWNIDFCLTASQKAIGATPG
                     LLICMASERFLKESFSKRASGMFTSLENWYPIVKGYENGETKYFATLNIPLICTLDVA
                     LQEIFAYPGGLEGRIEATRKTSERLHSMLCNELGLKLVPKDTNSTAHGVSVVYHDDPQ
                     SIISYLNNNGVIITGGLHKDIKSKCFRVGHMGYSACDPTSGHMRQLTTLIRQTKNLPP
                     QQHLK"
     gene            <68746..>70155
                     /gene="TPHA0D00410"
                     /locus_tag="TPHA_0D00410"
                     /db_xref="GeneID:11534556"
     mRNA            <68746..>70155
                     /gene="TPHA0D00410"
                     /locus_tag="TPHA_0D00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685070.1"
                     /db_xref="GeneID:11534556"
     CDS             68746..70155
                     /gene="TPHA0D00410"
                     /locus_tag="TPHA_0D00410"
                     /inference="similar to DNA sequence:INSDC:YLR058C"
                     /note="similar to Saccharomyces cerevisiae SHM2 (YLR058C);
                     ancestral locus Anc_8.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685118.1"
                     /db_xref="GeneID:11534556"
                     /db_xref="GOA:G8BS63"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G8BS63"
                     /translation="MSYSLSEKHKNLVQAHLSETDPELESIIKDEIDRQRHFIDLIAS
                     ENFTSTSVFDALGTPLCNKYSEGYPGARYYGGNQHIDRIELLCQKRALEAFHVTEDRW
                     GVNVQTLSGSPANLEVYQALMKPHERLMGLYLPDGGHLSHGYATENRSISAVSTYFES
                     FPYRVDQETGIIDYDTLEKNAILYRPKVLIAGTSAYCRLIDYKRMKEIADKCGAYLMV
                     DMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRNINPKTGKEVI
                     YDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKEYQIQVLKNAKILEEEFK
                     AAGYRLVADGTDSHMVLVSLREQHVDGARVEYVCERINIALNKNSIPGDKSALVPGGI
                     RIGSPAMTTRGMGEDDFKRIVQYINRAVTLAKNVQEQLPKDANRLKDFKAAIDAKTSE
                     LAGLKNEIHSWVGEYPLPI"
     gene            complement(<70327..>72903)
                     /gene="TPHA0D00420"
                     /locus_tag="TPHA_0D00420"
                     /db_xref="GeneID:11531073"
     mRNA            complement(<70327..>72903)
                     /gene="TPHA0D00420"
                     /locus_tag="TPHA_0D00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685071.1"
                     /db_xref="GeneID:11531073"
     CDS             complement(70327..72903)
                     /gene="TPHA0D00420"
                     /locus_tag="TPHA_0D00420"
                     /inference="similar to DNA sequence:INSDC:YLR057W"
                     /note="similar to Saccharomyces cerevisiae YLR057W;
                     ancestral locus Anc_8.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685119.1"
                     /db_xref="GeneID:11531073"
                     /db_xref="GOA:G8BS64"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:G8BS64"
                     /translation="MKYTKIVLSTIRRVRSILPLCITIGLLFYYTFQNEINTLNSYAE
                     NEVMPSISNDMHGVIQDPLNNTHDMNNNKNVGNNYEEKIKNKHEDHEASIHTTDSKKA
                     TSKIDLSDPKVLRVKNRYFPLLISNFTQEKFTHNYDIAQDLWLNSLLTTKVKYPLLFE
                     LDLPTRISKSEKELSSKNNEQAYLTEVQNPVIDPSVDTSQYESLLVEVKNLLSKALEN
                     DQVMIKSKQALNEAKGNQGKGFLWPIKLLDMLDSLYLMNENNIFNEALSIIKEIDFRL
                     PPSSISFVDIPDLITRALGGLLSAYELSEEPILLSQAKVLADFTLRAFDTPNGIPIMP
                     YPWQSLYQNRFPYRVGDAGSISKMALEFSRISQLSQDNRYFSAVFEVMHTLTKSKDEF
                     AIDYMFPEEVDPSGCKILTENEIWRGSHGRGTVMKSINEDFSFVHCEQKGTLKVSQPN
                     AADKQELFVINEKTIPVYENLIKLYHLFDNHDIIKDMEKQIEKHKLENDSKENVADTN
                     AKEAMNVDGNSVSHSKLVKKSAQDVIQGTLTTKKAFTEAMDHIIRLMKFHPKTPFSKK
                     LTLLSSLQTRSSYSPSKNELRVKMRRHQDMYAYSCELPSTLALGSRLFNMTNYMDFAS
                     ELTESCYILSSFFDGAMPDHMYFDACSKDDPTCTFSIESKIASITAGNYQYSPSDFNY
                     IDSNEVKISENLQTKNTISDPELSRINRVLIFVGSKDANYVSLGKSDLNEKKSVWSNR
                     PEDPLWINKMSDKKLLSPHTIKSLFYMYRVSGDEKWREMGKELFLKVVNTLKKNNQKA
                     KGLWDVHEIEGTDSDAYIPIPSSFYSQTLKYYYLLFSNKKEFSLDDYILTTGGHFIKK
                     DN"
     gene            <73309..>73563
                     /gene="TPHA0D00425"
                     /locus_tag="TPHA_0D00425"
                     /db_xref="GeneID:11530975"
     mRNA            <73309..>73563
                     /gene="TPHA0D00425"
                     /locus_tag="TPHA_0D00425"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685072.1"
                     /db_xref="GeneID:11530975"
     CDS             73309..73563
                     /gene="TPHA0D00425"
                     /locus_tag="TPHA_0D00425"
                     /note="ancestral locus Anc_8.39a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685120.1"
                     /db_xref="GeneID:11530975"
                     /db_xref="UniProtKB/TrEMBL:G8BS65"
                     /translation="MESNNEMSSKKRSLTITPVRRKGLTSKHQGDVNGDNKKRSIPGF
                     NLIEEHENVDWKKRWIIQNLELQRVTQLKTFLEIEKSIND"
     gene            complement(<73651..>74730)
                     /gene="TPHA0D00430"
                     /locus_tag="TPHA_0D00430"
                     /db_xref="GeneID:11531039"
     mRNA            complement(<73651..>74730)
                     /gene="TPHA0D00430"
                     /locus_tag="TPHA_0D00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685073.1"
                     /db_xref="GeneID:11531039"
     CDS             complement(73651..74730)
                     /gene="TPHA0D00430"
                     /locus_tag="TPHA_0D00430"
                     /inference="similar to DNA sequence:INSDC:YFL029C"
                     /note="similar to Saccharomyces cerevisiae CAK1 (YFL029C);
                     ancestral locus Anc_8.40"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685121.1"
                     /db_xref="GeneID:11531039"
                     /db_xref="GOA:G8BS66"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BS66"
                     /translation="MSKGKTIAITRFAHIFKLGNDKVVKSISKDGLLPPHDPLMELSI
                     LEKLTKNESNRNVIQLLDYQENTNYDLVFKYYPLTLKELLLSGYISIVNPYYNVTASS
                     PTENYYRNRFDSNKYAYDFFKQLINGLAYIHSLQIIHRDIKLDNILMEDNGNNNFTLV
                     VTDFGISYDASDENRGNELINDKITDVSTSIYKAPELLFSVRNYTNKVDIWAAFIVLS
                     QLLIDPAMKVKNQKNIPAVVTDGSFSDDDNDGFREEVGSDIKLLFSIFEKFGIPSAAQ
                     WPEVINYGTADTFIGMFGNSGDSKYFLDKKTPEAEEYMEQIIPGLRNIEGKQQRETLV
                     QCCIGMASFESTTRFSAEQLLEYLN"
     gene            complement(<74976..>76079)
                     /gene="TPHA0D00440"
                     /locus_tag="TPHA_0D00440"
                     /db_xref="GeneID:11531040"
     mRNA            complement(<74976..>76079)
                     /gene="TPHA0D00440"
                     /locus_tag="TPHA_0D00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685074.1"
                     /db_xref="GeneID:11531040"
     CDS             complement(74976..76079)
                     /gene="TPHA0D00440"
                     /locus_tag="TPHA_0D00440"
                     /inference="similar to DNA sequence:INSDC:YLR056W"
                     /note="similar to Saccharomyces cerevisiae ERG3 (YLR056W);
                     ancestral locus Anc_8.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685122.1"
                     /db_xref="GeneID:11531040"
                     /db_xref="GOA:G8BS67"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G8BS67"
                     /translation="MDFVLEVVDTLVLDKFYAKLLPVSLAENIPLDWHKSLNVNAGIT
                     NTTQLLNSLNGIPLKDRVCQDVYGYTPYWMDMTVDTFSSVLPRSNLLREALSLSVVAT
                     VFAWILYLFFGTLSYYTLFDRNVFNHPRYLKNQMKLEIKLAVSSIPLMSVMTSFWFIL
                     ELKGYSKLYTNLDLSDSKGWKQLVFEYVSFIMFTDCGIYLAHRWLHWPKVYKAIHKPH
                     HKWLVCTPFASHAFHPVDGYFQSLPYHLYPMFMPLNKYLYLVLFTFVNFWSIMIHDAN
                     HMSNNPYLNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRKPEDDLFDPELSKNTKAL
                     EEQIKRMEVIKLEVEGNDDDRVYDEGQDMKKNN"
     gene            complement(<76541..>77377)
                     /gene="TPHA0D00450"
                     /locus_tag="TPHA_0D00450"
                     /db_xref="GeneID:11534424"
     mRNA            complement(<76541..>77377)
                     /gene="TPHA0D00450"
                     /locus_tag="TPHA_0D00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685075.1"
                     /db_xref="GeneID:11534424"
     CDS             complement(76541..77377)
                     /gene="TPHA0D00450"
                     /locus_tag="TPHA_0D00450"
                     /inference="similar to DNA sequence:INSDC:YFL028C"
                     /note="similar to Saccharomyces cerevisiae CAF16
                     (YFL028C); ancestral locus Anc_8.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685123.1"
                     /db_xref="GeneID:11534424"
                     /db_xref="GOA:G8BS68"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS68"
                     /translation="MSTSLAVKIDHLTYTFPQQAAPALHDVSLEIPWHTRTLLVGCNG
                     AGKSTILRLLSGKHLCLGGNILVNDHNPFSPLPLDGDAGDVVNCVYLGLEWAHMEIIN
                     RDVRVSELLDSIGFAHFEQRGRELLQILEVDTHWRMHMLSDGQKRRVQLVMGLLKPWR
                     VLLLDEVTVDLDVIGRSRLLAFLEHETQRRRCSVLYATHIFDGLNSWPHRVLHLDRGR
                     IVDSLALPADVQFTAARDAEVAENRDTAGHRDTKPTLTVPKSDSLHPLALHWLARDRD
                     RT"
     gene            <77764..>79647
                     /gene="TPHA0D00460"
                     /locus_tag="TPHA_0D00460"
                     /db_xref="GeneID:11534598"
     mRNA            <77764..>79647
                     /gene="TPHA0D00460"
                     /locus_tag="TPHA_0D00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685076.1"
                     /db_xref="GeneID:11534598"
     CDS             77764..79647
                     /gene="TPHA0D00460"
                     /locus_tag="TPHA_0D00460"
                     /inference="similar to DNA sequence:INSDC:YLR055C"
                     /note="similar to Saccharomyces cerevisiae SPT8 (YLR055C);
                     ancestral locus Anc_8.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685124.1"
                     /db_xref="GeneID:11534598"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BS69"
                     /translation="MDEADDILEQNQMDDEVEEDDEDDFKDVEERADEDEEDENDEED
                     DENDEDDDDDDDDDDDDDDDENEDDDDENENDDDDDDDDENDDDNDENDDNDDNDDDE
                     NNDKEENTERTVEDADDADVEMEDGEDEDDQKKDMSAIKLTKTEKLRNYYSTMFCNAK
                     LAGSYSISPTVAIPIQTHVNAITMSKGLNYMFLGGSDGYIRKYDFKNSMDGKASLTLI
                     QKHSLPESMDYAGITLSYWENEIPQKKSTVKLTKNNKEYEPLVSPVYSLEVQSESMYI
                     LSGLNNGGITMQGVRYSEGSIAHYFKTPGSHQQTVNLLKLNNDETTFLSGSWDKKLLE
                     WDLRTGKIINDFQGVLSTPSSLEMRPLYSTVEISEMVENLKNSSAETENRSTKGADED
                     DDMDSLFGDDDEAADKSTLKDDKTNDAEMNVDINENIKEQSLDATKANDSLLEISKTT
                     LKRVYDPDIFMTSSLNGNVDIWDRRISSGVALTIKRGEATPPWCLSATWSADGDHIYA
                     GRRNACVEEFDIKMPSKPINTLKLPSISGSVSCVRAMPNNRHILCGSQDNIRLFDTKI
                     ATDTSGSKGRKYFSIVPGHHGGMISDIYIDPSCRFMISASGNRGWQGTTTDYALLYEI
                     DLQ"
     gene            complement(<79749..>81200)
                     /gene="TPHA0D00470"
                     /locus_tag="TPHA_0D00470"
                     /db_xref="GeneID:11534387"
     mRNA            complement(<79749..>81200)
                     /gene="TPHA0D00470"
                     /locus_tag="TPHA_0D00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685077.1"
                     /db_xref="GeneID:11534387"
     CDS             complement(79749..81200)
                     /gene="TPHA0D00470"
                     /locus_tag="TPHA_0D00470"
                     /inference="similar to DNA sequence:INSDC:YFL027C"
                     /note="similar to Saccharomyces cerevisiae GYP8 (YFL027C);
                     ancestral locus Anc_8.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685125.1"
                     /db_xref="GeneID:11534387"
                     /db_xref="GOA:G8BS70"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8BS70"
                     /translation="MITMGDEKTLGSEDVEVRSNEERLLKQKVIKFALQKKSTALLAH
                     LGRSKLGFADNEVRPKCWSQLLNNQLKKSSEYKRQQLDIVLNSKEVHMDEHQVQLDVN
                     RSFITIETPIIRNNLRFILNYFIIKILRLHPNLRYYQGYHDIISVIIVVYLNMSLINE
                     QLKWNVPINDVNEIMSSLTETELFNAIESFTLLYLRDFMTDSLYFTIDQLNIIPKLIK
                     DRDIFLFNKFKLDQLQPFYATSSLLTVYSHDLKIEDKTFDNNILFSIFDMIISHRNMA
                     IPLVIYSNFIVNAKEELLKAYESNISNFENQNDLINVIIQKQTLNDIFNDKTWDDVLS
                     LTRQNVLINTSYLKTSNVNKYSVLYNTGSGKDQPLTNYNIKTVLNYMKNELIINEKRK
                     IQIVRSKKFQLLRSNISKSIMRMKLPMVYQITLVVLLLLCSSYYRHFPNYSYNIDFFK
                     QFEGNNVCHNLYIHFHRLSKDILASINRLIAKT"
     gene            complement(<81646..>84099)
                     /gene="TPHA0D00480"
                     /locus_tag="TPHA_0D00480"
                     /db_xref="GeneID:11531134"
     mRNA            complement(<81646..>84099)
                     /gene="TPHA0D00480"
                     /locus_tag="TPHA_0D00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685078.1"
                     /db_xref="GeneID:11531134"
     CDS             complement(81646..84099)
                     /gene="TPHA0D00480"
                     /locus_tag="TPHA_0D00480"
                     /inference="similar to DNA sequence:INSDC:YFL024C"
                     /note="similar to Saccharomyces cerevisiae EPL1 (YFL024C);
                     ancestral locus Anc_8.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685126.1"
                     /db_xref="GeneID:11531134"
                     /db_xref="GOA:G8BS71"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:G8BS71"
                     /translation="MSTRSARSNSNTADGSGSSRFRHRKISIKQRLRIYKPSDLKNLD
                     KQELQQRDVVEIETGVEKHEEKEVHLHRILLKNNAGIINSQKKEYIPTPDASHKWDEF
                     NKFYTGKFNYPKSYIQFSATVEDCCSNSYLMDEIDDAFLNDSINKNISDSSSDKKSKL
                     TEDEFEILCTSFELAIHERQPFLSVDPENILSFEELKPTLMKTDIGDINIKNGLSKEI
                     NLNKNEKFVTEFDIHYENEPRPIENLLDLYGEQVYNHWKSRKITSEGAEIFPQLKFER
                     RGEKDDSNPYVCFRRRDVRLPRKTRRVDIVNTQKLRLLLQALRNTKELASLVAKREHT
                     LLNLFDKETKVFEDRCNIKKLKRKFNIVGDEEDLINHKRKRVNISKKLKKDSPSSDAS
                     TKKTNKSRLTKEELEEMFKSGQKLTKSQLYQLQQFQNPKDANATIGPLSSKLPKQQIT
                     QQQLQQQQKQLLQQQLLQQQQEQVSNVYVKLPTSKVPDIVLEDVEDLLSNKERNARKF
                     VLDRMEKRNMDDKNLFFNLTDDPYNPVFDVTLPKGVDLDTAPFASIALSKFQIDRAYY
                     VPHMEEYFKGTSKHVTAFNKNGEIIQNANPKYKQLEIYNSFKSKNEILSKEHPVKFRR
                     RIGRNGVMYIDCKPNVSVVANDNKLSEFFDFDKLEEENNSREPIDIYDSQMDAATRLY
                     GKWKYDSPRHEYGLNFYEEPPRLNQISNDTQTIRFGTMLGSKAYDQLRDITSKYRKEY
                     FTRISQQRLNAQNHIQTQQQTPNGNGDHNSDSKILNSQMETKTKIGNTTSQLLNKSND
                     SQLSKSQPNIVPVAQQKSS"
     gene            <85648..>88056
                     /gene="TPHA0D00490"
                     /locus_tag="TPHA_0D00490"
                     /db_xref="GeneID:11530976"
     mRNA            <85648..>88056
                     /gene="TPHA0D00490"
                     /locus_tag="TPHA_0D00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685079.1"
                     /db_xref="GeneID:11530976"
     CDS             85648..88056
                     /gene="TPHA0D00490"
                     /locus_tag="TPHA_0D00490"
                     /inference="similar to DNA sequence:INSDC:YLR054C"
                     /note="similar to Saccharomyces cerevisiae OSW2 (YLR054C);
                     ancestral locus Anc_8.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685127.1"
                     /db_xref="GeneID:11530976"
                     /db_xref="UniProtKB/TrEMBL:G8BS72"
                     /translation="MSIDQLTCLIGMNNYNNFTDFIFLLFLFLLTSIYFIQIVGETPS
                     IQFIAWRLSLGNVFIKLVSQYVSIDGLISWKSTRLGANFFTPNIFAKTIEEVKEKTSM
                     QNDSENKKYKSDIIVISGTSLDSFEKNCVELQPFCHPNTIVIVCSDFGVDLESTAKTI
                     FKNNCKFVLSIYCAAECRQLSLGSFALINDQDCYFYIGNTTIKNDIIETDCEPTAVLN
                     LCENFYDDPIMLRFCKIITESKWVIVDFIKDSRKMSAIVWKHIIPKICLNILCIIYDK
                     FEYNELLQNNSTKAIFEDLVDELMLISYKQCQIRIEEFFDPNKNVINYNNIITYSNKK
                     RQEICDTTSNEYPEYLSLPFELYCFYHKLEFPAHILLYQPIILGKKYNVSFSNLNFLY
                     SFYSQLLNLSGFSIFGGLSEQKTYFFHNLKGRLELENDRGSLNVTNYSKSEKKKKHKK
                     HKKKGNKSSTSIGNNVINASQDPMVESVNDLIQSDMALGSSKLPMNSDLTGNDFTNDA
                     LFSPGFEDVFLNLRSSLNSTGLIRVDPDLSKTEIKKTSQFNEEVVSYMDSETETSSSE
                     SDSQGTNNLHSKKNSKINVKDADNSYSSDESSDIVVLENLSINQNKYKKYSESLVDFF
                     ETPKLFKKFKTRVHSNYNGNYCNNQKTSKSETTLMDNRPYSTSCLEFKSKNYSNVISN
                     DLLELHSQMLKLEIQNSSIDNKEKRKQYANLELKLWKLQRRFHEFNGTISKYQTEPLE
                     ELLNHIDILNKGNTGDILNWTTCRYGEVDFYKNIRQDKEEIMNLFKDGVNGNKNLKTS
                     ILPN"
     gene            complement(<88267..>89760)
                     /gene="TPHA0D00500"
                     /locus_tag="TPHA_0D00500"
                     /db_xref="GeneID:11534284"
     mRNA            complement(<88267..>89760)
                     /gene="TPHA0D00500"
                     /locus_tag="TPHA_0D00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685080.1"
                     /db_xref="GeneID:11534284"
     CDS             complement(88267..89760)
                     /gene="TPHA0D00500"
                     /locus_tag="TPHA_0D00500"
                     /inference="similar to DNA sequence:INSDC:YFL022C"
                     /note="similar to Saccharomyces cerevisiae FRS2 (YFL022C);
                     ancestral locus Anc_8.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685128.1"
                     /db_xref="GeneID:11534284"
                     /db_xref="GOA:G8BS73"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8BS73"
                     /translation="MSAFQLEVLKQLDILGEIKSTTAVFANVNPQDVLSVLNSLKAHG
                     KLTYTKNETITYDLSEEGNNILNNGSHEVKLVQLINDMGKLQIKDVTSKLGPNGKVGQ
                     ARAFKNGWIIKTKENELELSDKAKDPSAIVDETKDILEKIIKNEPIDNKIIADLKKRK
                     LIIPKKNADFSVIKGPDFSLDLIKSETDVTSDMITSGSYKDAKFKPYNFNSQGIDPQS
                     GALHPLNKVREEFRQIFFSMGFTEMPSNQYVETGFWNFDALYVPQQHPARDLQDTFYI
                     KDPSKSDLPEDKVYMNNIKAVHEEGKFDSIGYRYNWKAEESQKLVLRTHTTAISAAML
                     HKLAKDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFA
                     KMGVTGLRFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGMFRPEMLEPMGLPRDLRV
                     LGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIESNPAARLDEDLYE"
     gene            <91198..>91872
                     /gene="TPHA0D00510"
                     /locus_tag="TPHA_0D00510"
                     /db_xref="GeneID:11534588"
     mRNA            <91198..>91872
                     /gene="TPHA0D00510"
                     /locus_tag="TPHA_0D00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685081.1"
                     /db_xref="GeneID:11534588"
     CDS             91198..91872
                     /gene="TPHA0D00510"
                     /locus_tag="TPHA_0D00510"
                     /inference="similar to DNA sequence:INSDC:YLR051C"
                     /note="similar to Saccharomyces cerevisiae FCF2 (YLR051C);
                     ancestral locus Anc_8.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685129.1"
                     /db_xref="GeneID:11534588"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:G8BS74"
                     /translation="MDKTVEDLFKQLKEASKTEEVNKNGNGTVSLEEEDISENKDVLQ
                     LDDDSKDTEKEFEKIEKNLRQLPKLQNEFDQLSKVSNNDEKKHEDIQGKKAVKLENRE
                     KSARSTTDWFTMPKVDSYKRDQVQRDLLLLKHRSALDPKRHYKKDKWKVPDRFSVGTI
                     VEDKTEFFSSRMTNKQRKSTMLETLMADDDSNKYFKRKYAEIQDRKTSGKKGHYKKIK
                     EMRKRK"
     gene            complement(<92112..>93593)
                     /gene="TPHA0D00520"
                     /locus_tag="TPHA_0D00520"
                     /db_xref="GeneID:11534580"
     mRNA            complement(<92112..>93593)
                     /gene="TPHA0D00520"
                     /locus_tag="TPHA_0D00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685082.1"
                     /db_xref="GeneID:11534580"
     CDS             complement(92112..93593)
                     /gene="TPHA0D00520"
                     /locus_tag="TPHA_0D00520"
                     /inference="similar to DNA sequence:INSDC:YFL018C,YPL017C"
                     /note="similar to Saccharomyces cerevisiae LPD1 (YFL018C)
                     and YPL017C; ancestral locus Anc_8.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685130.1"
                     /db_xref="GeneID:11534580"
                     /db_xref="GOA:G8BS75"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8BS75"
                     /translation="MLRSVSSKRSFSVASRLFANKKHEVVVIGGGPGGYIAAIKAAQQ
                     GYDTACVEKRGRLGGTCLNVGCIPSKALLNNSQLFHQMKSDAKGRGIDIDGTVNINVA
                     NLQKHKDTVVKQLTGGIEMLFKKHKIAYYKGEGSFEDTTHVKVSPVDGLEGSVKEETV
                     LETEKVIVATGSEVTPFPGITIDEERIISSTGALSLKEIPKRFTIIGGGIIGLEMASV
                     YSRLGSEVTIVEFQPQIGASMDGEVAKATQKFLKKQGINFKLSTKVLSGVREGEVVNI
                     EVEAVKDGKKEKLQADALLVAVGRRPYIKGLNAEKIGLEVDKRGRLVIDDQFNSKHPN
                     IKVVGDVTFGPMLAHKAEEEGVAAVEYFKTGHGHVNYNNIPSVMYSHPEVAWTGQTEE
                     QLKEANIKFKVGKFPFIANSRAKTNSDTEGFVKILIDEKTERILGAHIIGPNAGEMIA
                     EAGLAIEYGASAEDVARVCHAHPTLSEAFKEAAMAAYDQPLNF"
     gene            <94234..>94464
                     /gene="TPHA0D00530"
                     /locus_tag="TPHA_0D00530"
                     /db_xref="GeneID:11534228"
     mRNA            <94234..>94464
                     /gene="TPHA0D00530"
                     /locus_tag="TPHA_0D00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685083.1"
                     /db_xref="GeneID:11534228"
     CDS             94234..94464
                     /gene="TPHA0D00530"
                     /locus_tag="TPHA_0D00530"
                     /inference="similar to DNA sequence:INSDC:YFL017W-A"
                     /note="similar to Saccharomyces cerevisiae SMX2
                     (YFL017W-A); ancestral locus Anc_8.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685131.1"
                     /db_xref="GeneID:11534228"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8BS76"
                     /translation="MVSAPELKKYLEKKIVIKLNGERRIAGVLRGYDVFLNVVVDDAV
                     EVSKNGTSLNLGSQTVVRGNSILSIEALDTLV"
     gene            complement(<94592..>95086)
                     /gene="TPHA0D00540"
                     /locus_tag="TPHA_0D00540"
                     /db_xref="GeneID:11531068"
     mRNA            complement(<94592..>95086)
                     /gene="TPHA0D00540"
                     /locus_tag="TPHA_0D00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685084.1"
                     /db_xref="GeneID:11531068"
     CDS             complement(94592..95086)
                     /gene="TPHA0D00540"
                     /locus_tag="TPHA_0D00540"
                     /inference="similar to DNA sequence:INSDC:YFL017C"
                     /note="similar to Saccharomyces cerevisiae GNA1 (YFL017C);
                     ancestral locus Anc_8.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685132.1"
                     /db_xref="GeneID:11531068"
                     /db_xref="GOA:G8BS77"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BS77"
                     /translation="MTSPEGFSIRRTRKEDYEGVLSTLKSLTTVGTISRSHFESIVSY
                     WDSIRLLNARKQEGGELGYKYNNFVIVDDHNGQVAATGNIIIEQKLIHECGLVGHIED
                     ISVSEKYQGKKLGKFLIDKLTSVGFANGCYKIILDCDRKNVKFYEKCGYEEAGVEMRI
                     RSNL"
     gene            complement(<95500..>96960)
                     /gene="TPHA0D00550"
                     /locus_tag="TPHA_0D00550"
                     /db_xref="GeneID:11531080"
     mRNA            complement(<95500..>96960)
                     /gene="TPHA0D00550"
                     /locus_tag="TPHA_0D00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685085.1"
                     /db_xref="GeneID:11531080"
     CDS             complement(95500..96960)
                     /gene="TPHA0D00550"
                     /locus_tag="TPHA_0D00550"
                     /inference="similar to DNA sequence:INSDC:YFL016C"
                     /note="similar to Saccharomyces cerevisiae MDJ1 (YFL016C);
                     ancestral locus Anc_8.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685133.1"
                     /db_xref="GeneID:11531080"
                     /db_xref="GOA:G8BS78"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:G8BS78"
                     /translation="MLASKLVSRNFVKAGGFNGKRPLLYVNNYKRLLHTTKPLFNADE
                     TFKDPYKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKTFHNLQNAYEILSDE
                     KKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSG
                     FRNGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHG
                     SGLKNGEQHKRKTCSYCNGTGTQVHVKSGFQMASTCMHCHGEGTTIAREDTCSACDGD
                     GVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVK
                     SDPKFFVKNKYDIWTIKEIPITTAALGGTVEIETVDGKNIRLKVISGTQHDQVTSIPN
                     MGIPYRNGTGRGNMNVQYKIVIKKPQSNIERCLWEGLADVTNDKMAKRTIVNGSGSIM
                     DQASTVGTSSENDLNSLKRIEKFIKDAFKKFKGDNK"
     gene            <97618..>98655
                     /gene="TPHA0D00560"
                     /locus_tag="TPHA_0D00560"
                     /db_xref="GeneID:11531116"
     mRNA            <97618..>98655
                     /gene="TPHA0D00560"
                     /locus_tag="TPHA_0D00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685086.1"
                     /db_xref="GeneID:11531116"
     CDS             97618..98655
                     /gene="TPHA0D00560"
                     /locus_tag="TPHA_0D00560"
                     /inference="similar to DNA sequence:INSDC:YPL018W"
                     /note="similar to Saccharomyces cerevisiae CTF19
                     (YPL018W); ancestral locus Anc_8.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685134.1"
                     /db_xref="GeneID:11531116"
                     /db_xref="UniProtKB/TrEMBL:G8BS79"
                     /translation="MDFSIDASSSVESSDSNSSRSDIDNELVLDEEQKKVLELEELKE
                     QLLLKRRNLVSQIDGLKATVNAEKKKKLIQGRNLDSNSNELLLSLMLTSNRFNTSIGD
                     ERKDPIQKIDGLSSIQKELLHKFDTLPLLNVDLRLKYLEDYLFTNVDVQVISNELAND
                     DIVHSTIVFFFKLSDLSITLTLKYDQVLGILEEFEIVSISDNYALNIMPIVKSCTNNP
                     NLFLFFCFEYDKLIGKRNTIMNEVLTAIKNRLMKYEMLNDNETLVLYNQVLQDDGELA
                     IIKLELNYLIAFNDTDSNFRLPSTKIEQSLWKDDQLITNNNDIMNSLMKEYGVFEGLK
                     EYCKSCLFPIT"
     gene            complement(<98790..>99371)
                     /gene="TPHA0D00570"
                     /locus_tag="TPHA_0D00570"
                     /db_xref="GeneID:11531024"
     mRNA            complement(<98790..>99371)
                     /gene="TPHA0D00570"
                     /locus_tag="TPHA_0D00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685087.1"
                     /db_xref="GeneID:11531024"
     CDS             complement(98790..99371)
                     /gene="TPHA0D00570"
                     /locus_tag="TPHA_0D00570"
                     /inference="similar to DNA sequence:INSDC:YFL010C"
                     /note="similar to Saccharomyces cerevisiae WWM1 (YFL010C);
                     ancestral locus Anc_8.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685135.1"
                     /db_xref="GeneID:11531024"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:G8BS80"
                     /translation="MSQSRKNQPFIPEGWTAQFDKEYQTWFFINLSNGNSQWEPPNGT
                     SWKFGSANASDPNEPPAYDEVVNDNKNGKQVQTQTQQQQYPQQQFQQQYPQQPYIQQQ
                     YPQQPYIQQQYPQQQPYYQQQNTQGKSSGRNNALYGGLAGAGVGLVGGALLSNALTPH
                     YYDGYGPGFDGGYGPGYDGGLDGGFDCGFDGGF"
     gene            <100671..>102869
                     /gene="TPHA0D00580"
                     /locus_tag="TPHA_0D00580"
                     /db_xref="GeneID:11531002"
     mRNA            <100671..>102869
                     /gene="TPHA0D00580"
                     /locus_tag="TPHA_0D00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685088.1"
                     /db_xref="GeneID:11531002"
     CDS             100671..102869
                     /gene="TPHA0D00580"
                     /locus_tag="TPHA_0D00580"
                     /inference="similar to DNA sequence:INSDC:YFL009W"
                     /note="similar to Saccharomyces cerevisiae CDC4 (YFL009W);
                     ancestral locus Anc_8.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685136.1"
                     /db_xref="GeneID:11531002"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BS81"
                     /translation="MELLNRPNVLATPLSGDFETNNSVTNQPSTTDNLKNETAESTEV
                     YQPNNYERSDAISNRANTVINSASDMEDLGTVKVCTPASSFMVNTDQIGGSIIKESVD
                     DSSNNTSSQNNQIGQDAIADDTLPPSPVASPVIIFPVESSDEENKIVALTKDKNTSPL
                     IDFGTTTVESLQNLTDELLHTLQTDFQSKQCYKNILFNLIAQMNRSDLSDLGTLLKDN
                     LKRDFITTLPIEITLKVLRNLDFQDIQNCSLVTKSWNSLLTSTAYIWKMLLIKENFIS
                     RQSFSKYFKTLSLKYPEIGTDYEKGYRLDFLRNYKFLKNWYNVNFTPEVTSLPGHLTS
                     VITCLQFEDNRIITGADDKMIRIYDAVTKKFVNELRGHNGGVWALKYDENGILVSGST
                     DRSVRIWDIDLGVCTHVFKGHTSTVRCLHIVKYKNIKYVVTGSRDNTLHVWKLPNKCN
                     TEDKDKYPIVYDSTEENPYFVGILRGHLASVRTVSGYGNIIISGSYDNTLMVWDIIKM
                     KCLYILTGHINRIYSTIYDHKRNRCISASMDSTIRVWDLANIQNNGTCTEVMNSMVSC
                     VNVTGSMYTLQGHTALVGLLKLSDKFLVSAAADGSLRGWDANTYSRKFTYHHNNLSAI
                     TTFDMNDNLLVSGSEGQFNVYNLRTGKLIHSNILRADHIWSVQFKENILVVAIEFDRK
                     SYVEILDFNIPCSSTATTTATTTATLTSSTSSSITSSSYSTSATASTNHQ"
     gene            <103790..>110053
                     /gene="TPHA0D00590"
                     /locus_tag="TPHA_0D00590"
                     /db_xref="GeneID:11531117"
     mRNA            <103790..>110053
                     /gene="TPHA0D00590"
                     /locus_tag="TPHA_0D00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685089.1"
                     /db_xref="GeneID:11531117"
     CDS             103790..110053
                     /gene="TPHA0D00590"
                     /locus_tag="TPHA_0D00590"
                     /inference="similar to DNA sequence:INSDC:YFL007W"
                     /note="similar to Saccharomyces cerevisiae BLM10
                     (YFL007W); ancestral locus Anc_8.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685137.1"
                     /db_xref="GeneID:11531117"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:G8BS82"
                     /translation="MDSDSIFQQRIKYYDLDFDPEKENHLKNIFDPKSKWFSRNVKPL
                     IMMEDNLPYTTETHTERAKYLCHILVNLYIAISSLDIQGLVNISSKDLAEFKNEVDSL
                     ELNSDFFSLSYANDEISHLDLKRHFNPVSSPKSPASKQTVFSDEEIEQSEAEGLELID
                     MSSSGKITNFSATIISVNHWTNELRNCLKFNIPLSLRKKLVIVFYQLSLVQGQKISRH
                     IYIEMFEFLSDRNNDGTDFTELLYEDGLRLDHIRLYNFLFEFLPTPDSDYVKRDLSSK
                     EDLNLFKLLLRLADDAKIFFDETNLTLMKDSMDKIISSLAPSTMSIILPLLTSSVPFH
                     YNEMHKITDYSSFMYSIWNTSSPNVAIDTHLYDFIGNLAEYSYWNYVKNTDIKKYIEF
                     DRFGIFNESQLDFMFNRIQGHLKNDFQIHSQSRTIRPLIYAINGSSNELYFEKLEKLS
                     KSLVTYVHPSNNGHWTKLIAKFVQCFIKFYHKRYTDEEKVRKNGISNKAMLNEDTHEE
                     LVRIFTHLLNIGSQNKNEDVSNYYISSYTYLLDLNPPNSNLIYDHIILELYDAFSGEY
                     INSKQRIITSIKKYSNIMRFMVMEKLYRVHITNIFVTLISKLDYNDLQLSNCLIKGII
                     GTATFIPLEVPSSEDGHYTFESYTLPFIQQHYEHLKFNADKLFYYEAEFLDMAYKGSS
                     TIIQNSLQQYIEKIFQFFTIDIEDTLIMKMCNTTMIIIESMSDDMFEYFSKVFQKSFW
                     SIDDFGEKSPNNELLTIQLAALVKRDHSLSKKLYSQLSYNIKEQIQRGAGSVRSASEI
                     QQRDFKLVLYLTALNDILRQSHSAILDFHEELLDFLKELYKAITNPPVAVITSILIHS
                     ILTSLTITEIIDFRQFSEFKNISYEEKWGAYQFNNNKFLKDNLNFKWHIPSDKEVSVA
                     IDFFDKIFDFCKSQVEIIITSDRVDSKSSDIFQKYLLVTIHAISGISILFDPDFNRNK
                     SKPADELTYKEKLLLVKNLNENNLDGNELDIDVEAISSNKGEDYFEIHSGDESSGIVE
                     VTENLDQLIMEDNTNVSEPPTTFGTPVIGASNNLPMSSLSSSISFRDVDIYSFNYFFG
                     NTIEEKFSNKLYFHIHNTRDKVGKYFHKLYLFLTDNFENYTTLFQTLLHGMKVWITDV
                     GKETVFNEDPSALLDWSFNTNIQSISHRELPYTRTCIALEIDQFHKNRVLSRSTNRRP
                     SKVESKLLKDIFLLSISVYPDIYKPAQSALAHCTKQIIGSYSFIINTALESLKLSITE
                     NDYMKTEVILKTLMIKKIHYKLMTDYKNIEVCVMTLLECCKIEKLDIAMYGNKILTDV
                     VNNLKIPSSVCIYDEHAISCLAPPDNSIQLQIDTVKKAKNKKRELYISLLTKLQNQLI
                     ELLRQTPDSDWKRISFIIKFVTSLQSNLQVSNNKEFLLILFEKTKSTNPHIMQLSIKS
                     ILRVINKIFSLSDYDYNISKASESTFDPHFFERVATISDEFNDNFRNEMNNFDKPSYF
                     IDSKMYNGWICWGNEMRVMKQGTIDLKLNEYDFSILRTFSELMDVEWFKQLVIHFIQE
                     NEAKNVISSAHVSLFYLVIYCCTKLNSKIELDEILKICEDNYKPTDKASMVLSLEIFS
                     SLIYGSKYFDEETNKKCEGFIETFIKDCLENDLNSDAFSIWSTVCWWLPTVSDIRRTP
                     AFYKIFSDITILREVNSERMTEQTHRIIMYKNILTSLDFRCPSFKKVFDSMVFDHPYD
                     NVRQSIAKLLSTMIQNSSNLSLKSTDELIKKTNNIDSNEEIGIPIRKMPEFMDKFIRN
                     QFKEITKEQQNITNLTPQLLLKSRFYYLTSTMVYLLREILRGPNKILFVPYLMNGILP
                     FLIEMMRHKDMCKLANINPTFLFIGIAYLPITNKSVLSDMIDILCSNRLMLDTSLQIQ
                     LKLKLIEHFYSSNLLNFGNDKKNLNIILNYIANDCLFNEKFVEVRIEASKVLSDIIHN
                     LSPDDTVFQNLINKFDAILIDYNKDFRGKKVKERKEISQKDIRLHGSILGIGSFISAF
                     PYAFPLPKWIPEQLSLLSYWARVTGSSGTSAKDIIGDFKKLRTDTWEFDRASFTNEQL
                     EDLEGVLWRSYYA"
     gene            <110889..>113582
                     /gene="TPHA0D00600"
                     /locus_tag="TPHA_0D00600"
                     /db_xref="GeneID:11531136"
     mRNA            <110889..>113582
                     /gene="TPHA0D00600"
                     /locus_tag="TPHA_0D00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685090.1"
                     /db_xref="GeneID:11531136"
     CDS             110889..113582
                     /gene="TPHA0D00600"
                     /locus_tag="TPHA_0D00600"
                     /inference="similar to DNA sequence:INSDC:YFL004W,YPL019C"
                     /note="similar to Saccharomyces cerevisiae VTC2 (YFL004W)
                     and VTC3 (YPL019C); ancestral locus Anc_8.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685138.1"
                     /db_xref="GeneID:11531136"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:G8BS83"
                     /translation="MLFGMKLATGIYEPWKEYYLDYDKLKELLKESEFSNTTDKHNSN
                     TFSGNSKLVWSDDDESRFVELLDGELEKVYSFQAEKYNILLDRLNRLEDKLSDSLAKS
                     AKDSSINFEEFKNNLEIILLEANGLDNFTRLNYTGFIKIVKKHDKLHPQFASVKSLLE
                     VRLKKLPLHSEEYSPLLYQISYLYNIIRNSTTNNMISNSISLNSLSKSVINENNISNS
                     FVDEESFVFKSLKFWIHKDNLMEVKTRILRHLPVLLYAAAPTENDDMTHSMENDVILS
                     DNIMNTSSTKSDSTTNLDNKIFANRGSGTDREGSKRYGYDPVINTLYFDNENFELYHD
                     KLVRTKDAPTLRLRWVGHLYENPDIFLEKRIVSTSKPVSAGDENSNLNEMIDFKELRI
                     KLKEKYINDFIFNEGLKYKEQTLKNLEKIRANPELFSENKKNIDTLQKFIVENDLQPV
                     LRTRYTRTAFQIPGDDRVRVTIDSDILYIREDSFDKSRPIRDSDSWHRFDIDANVANP
                     MRFLRKGEYTDFPFAVMEIKIRSDNFKNLRQTPTMSSSMVSGKGSKKHYKWIHELTNS
                     HLVKEVPKFSKYSQGVASLFGDDDKLDILPFWLPSLENDIKKDPKEAYEEEIMREEKQ
                     KKIQKKLDEMRKATNMHNKGTNKNEDIQDTAAQTAPQSAISSGRNNEADLVGNESSDE
                     EDDEQNIRRGTKSKKYKNRNKKDLNFLQVLSGRDAKLNGFDSEDEEIELPPGVIKPTS
                     LIKNAGPIKVEAKVWLANERTFNRWLKVTTLFSILTFSIYNSVKKADYPHVADTLAYL
                     YFGLTLFCGVWSYIIYIKRLNVIKERSGDHLDAPLGPILVAVFLSLTLIVNFVLSFRA
                     QARRQLIDDSLRVTTNSINNNSWKLQIIQNFIFRVVGTAAS"
     gene            <113889..>115598
                     /gene="TPHA0D00610"
                     /locus_tag="TPHA_0D00610"
                     /db_xref="GeneID:11530950"
     mRNA            <113889..>115598
                     /gene="TPHA0D00610"
                     /locus_tag="TPHA_0D00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685091.1"
                     /db_xref="GeneID:11530950"
     CDS             113889..115598
                     /gene="TPHA0D00610"
                     /locus_tag="TPHA_0D00610"
                     /inference="similar to DNA sequence:INSDC:YPL020C"
                     /note="similar to Saccharomyces cerevisiae ULP1 (YPL020C);
                     ancestral locus Anc_8.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685139.1"
                     /db_xref="GeneID:11530950"
                     /db_xref="GOA:G8BS84"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:G8BS84"
                     /translation="MNKHNHMIQDQSSFKRLKIDENKKTIPLKNDKRGTYRYQNERIN
                     SQRSVSSGFISKKKDSQFQNNNRRVQSLDIKNAANDEIKSIRSWLDYYKLFGNLTSNI
                     WSLFARYDNNSILHESIHDGFLDSDQNDIQVEKTVNAFLKNDKKYKDGNGRFNWDKWQ
                     PATLPNLSSKYKRYSNDEVPIKQPYGSTFLRMKRTREYYTSSQKKLSRRSLLLNQSDE
                     ISYLRMIFNNDTDIPKLLKKERENQLLLIKEDRYIKSEIKSSIRELTDKIKHIWLDRK
                     TKTKNSTLEATSDDLVFLKEFKTENEVNESKLKITDNLKFQIYLSNYLTETNLTKRFS
                     KYENPEYDYKRKLKIKSSVSLIPKVSAYDTNKIKTILEEKYDRVLSDGLIAINLRDFK
                     TLANNRWINDTIIEFYMMKIESTIPNVVAFNSFFYENLFSKGYNGVRRWMKRKKVSIS
                     QLDKIIVPVNLHQTHWVLAVIDMQKKNISYVDSLSNGPTTNSYNILQSLQQYVIEESN
                     QQLGKDFKLVFEKSPQQINSYDCGIYLCLNSIYMVNDLPLTFSHTDAVNMRLHLGTMI
                     LNP"
     gene            complement(<115810..>118278)
                     /gene="TPHA0D00620"
                     /locus_tag="TPHA_0D00620"
                     /db_xref="GeneID:11534568"
     mRNA            complement(<115810..>118278)
                     /gene="TPHA0D00620"
                     /locus_tag="TPHA_0D00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685092.1"
                     /db_xref="GeneID:11534568"
     CDS             complement(115810..118278)
                     /gene="TPHA0D00620"
                     /locus_tag="TPHA_0D00620"
                     /inference="similar to DNA sequence:INSDC:YFL003C"
                     /note="similar to Saccharomyces cerevisiae MSH4 (YFL003C);
                     ancestral locus Anc_8.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685140.1"
                     /db_xref="GeneID:11534568"
                     /db_xref="GOA:G8BS85"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS85"
                     /translation="MSSANISSFINAKIFNNSRSAANISSRNQVQSKVTSKKNRGVYT
                     SLLKDSLVVVSRNNITTKNKQNLRITRTRSKRCQTGHLNKNNEKIFLTIFETPTDLNT
                     RVGTCLVNYNTGEMILSDYLDSQIYIRTVNKIQLYEPTDILLPSYSLSPKMSKLATII
                     KFNINNSVNILEAPTKFFNPKEGSDILERSSINYDKYLNEKAELLEKSYSLSAVSASV
                     KYYNQKILKNGSNNFNNFDKYRVKYETINNTMLIDSKTIVGLELTENKFDKNGLSLFK
                     FLDNTCTKMGQRTLRNNILQPLTDKDNIEMRLKVVQEFEKNTDSLSEIRNSLKKLQDL
                     DKLFSKLLSNQKSSISPEQKINYILSLKESISIILTLRTEIIKLVPKSKILNEIKEIL
                     ENPLVTELFTLFNSYINEDARWATSPYELQNQRTYAIKSGTNGLLAVSRELYKNTVDE
                     IMSHIDAESEKLELALDYSYDSTRCFFLKIKKDNNIIMENFPPSLINIVNKKKYYECT
                     TVTIMKLNLRLRELQSEITLISENVIDSLLNQMDAYIAILFMVSEAISLLDLLTTFTF
                     NSLGKNYCYPTFSDKLYLVESRHPILENTVKQFIPNDISSTALTSRMQVITGCNKSGK
                     SVYLKQIALLCIMAQMGSPIPADIACLPLYDKLHARVCHDTLEITSSTFTFEMKEMAY
                     FLDNLTQSTLLIVDELGRGSSIGDGFIISLSISEFLLKAKATVFLSTHFHDLAVILQQ
                     NMSVSHLSMKTILEENQNLKMLFKVSTEIVDTKNTVFYFIKPYYPKDLLLKVKQIQEL
                     LIVEERQKAKNNQKFDNKNNIREK"
     gene            complement(118446..118519)
                     /gene="TPHA0Dtrna3N"
                     /locus_tag="TPHA_0Dtrna3N"
                     /db_xref="GeneID:11534227"
     tRNA            complement(118446..118519)
                     /gene="TPHA0Dtrna3N"
                     /locus_tag="TPHA_0Dtrna3N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11534227"
     gene            complement(121688..121760)
                     /gene="TPHA0Dtrna11K"
                     /locus_tag="TPHA_0Dtrna11K"
                     /db_xref="GeneID:11534258"
     tRNA            complement(121688..121760)
                     /gene="TPHA0Dtrna11K"
                     /locus_tag="TPHA_0Dtrna11K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11534258"
     gene            <123821..>126655
                     /gene="TPHA0D00630"
                     /locus_tag="TPHA_0D00630"
                     /db_xref="GeneID:11534146"
     mRNA            <123821..>126655
                     /gene="TPHA0D00630"
                     /locus_tag="TPHA_0D00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685093.1"
                     /db_xref="GeneID:11534146"
     CDS             123821..126655
                     /gene="TPHA0D00630"
                     /locus_tag="TPHA_0D00630"
                     /inference="similar to DNA sequence:INSDC:YGL167C"
                     /note="similar to Saccharomyces cerevisiae PMR1 (YGL167C);
                     ancestral locus Anc_8.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685141.1"
                     /db_xref="GeneID:11534146"
                     /db_xref="GOA:G8BS86"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006413"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8BS86"
                     /translation="MSDNPFENQTVGSNLGTGSNDNLLSNSDIFTESNPSLVYCTMSI
                     QETMEKLNTNGTTGLDSIEEVSRRKIEYGPNEIVAEDDESLFKKFFMNFVEDPLILLL
                     IGSAVISFIMGNIDDALSITMAIVIVVTVGFVQEYRSEKSIEALNKLVPAECHLIRGG
                     QNSKILASGLVPGDLVHFKIGDRIPADLRIIEQVDLSIDESNLTGENEPVHKSAKHVN
                     KDSFNDQPNCFVPISNRNSIAFMGTLVREGHGKGIVIGTGANTSFGAVCEMMSNIEKP
                     KTPLQLAMDKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPI
                     IVTVTLALGVLRMAKRKAIIRRLPSVETLGSVNIICSDKTGTLTSNHMTVSKLWCLGS
                     MSNKSNILSLEKNKDGNLKNYLTEDLKATLKVANICNNASFSQEHGAFLGNPTDIALV
                     EQLSKFELTDMRSSIKKTSELAFNSKRKYMAVKAKNNEDKSTIFVKGAYEKVLDHSTH
                     YLSKAGKIEKLTPAMKDTIIECANTLASEGLRVLSFASIEVSNASTPVTEADIKDLVF
                     FGLIGMNDPPRPTVKPAIEQLLQGGVHVIMITGDSENTALSIAEEIGIPIISPEVSIL
                     TGDKLNDMNDDELASVIDRVNIFARATPEHKLNIIRALRKRGDIVAMTGDGVNDAPAL
                     KLADIGIAMGNMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTS
                     IAALSLIALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDNEVMKKPPRKRTD
                     KILTDDVLKRLLTTAVFIIFGTVYVFIKEMAEDGQVTSRDTTMTFTCFVFFDLFNALA
                     CRHSTKSIFELGFFSNKMFNIAVGLSLLGQMCAIYVPFFQSIFKTESLSIGDLAFLLC
                     ISCTVFIGDECRKYFSRKRSSNDPYYYSNV"
     gene            complement(<126892..>128163)
                     /gene="TPHA0D00640"
                     /locus_tag="TPHA_0D00640"
                     /db_xref="GeneID:11534128"
     mRNA            complement(<126892..>128163)
                     /gene="TPHA0D00640"
                     /locus_tag="TPHA_0D00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685094.1"
                     /db_xref="GeneID:11534128"
     CDS             complement(126892..128163)
                     /gene="TPHA0D00640"
                     /locus_tag="TPHA_0D00640"
                     /inference="similar to DNA sequence:INSDC:YGL169W"
                     /note="similar to Saccharomyces cerevisiae SUA5 (YGL169W);
                     ancestral locus Anc_8.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685142.1"
                     /db_xref="GeneID:11534128"
                     /db_xref="GOA:G8BS87"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:G8BS87"
                     /translation="MKIKKSLQLIMSYHTRILKVDPSSIKFSPTAHIDGSLPEITDPA
                     TREALLEAARIIKDTDDNVAFPTETVYGLGGSALNDKSVSNIYKAKNRPSDNPLITHI
                     SSIDQLNRKIYNNKQSESQLQDTYQHIPLSYHSLISKLWPGPLTILLPVPDKNDNTLS
                     ELTTVGQPTFAVRIPSNPIARALIALSDTPIAAPSANASTRPSPTLAEHVYHDLNTKL
                     PLILDGGPCSVGVESTVVDGLSTPPLLLRPGGFTYEQIVELGGSEWTDCKIENRKTLA
                     KGEVVRTPGMKYKHYSPSATVALLIPEKKSQDSSKYFIKINELIADECNKNNIKKVAV
                     LTSIELNKKKSDLLTNLNELELKDKPEIILKTLGLNGEEIQMNLFALLREVDELDKVD
                     LIIVEGMTEDREGLAVMNRLKKAAGENHYYI"
     gene            129976..130046
                     /gene="TPHA0Dtrna5G"
                     /locus_tag="TPHA_0Dtrna5G"
                     /db_xref="GeneID:11534122"
     tRNA            129976..130046
                     /gene="TPHA0Dtrna5G"
                     /locus_tag="TPHA_0Dtrna5G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11534122"
     gene            complement(<130279..>131415)
                     /gene="TPHA0D00660"
                     /locus_tag="TPHA_0D00660"
                     /db_xref="GeneID:11531077"
     mRNA            complement(<130279..>131415)
                     /gene="TPHA0D00660"
                     /locus_tag="TPHA_0D00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685095.1"
                     /db_xref="GeneID:11531077"
     CDS             complement(130279..131415)
                     /gene="TPHA0D00660"
                     /locus_tag="TPHA_0D00660"
                     /inference="similar to DNA sequence:INSDC:YGL162W,YPR009W"
                     /note="similar to Saccharomyces cerevisiae SUT1 (YGL162W)
                     and SUT2 (YPR009W); ancestral locus Anc_8.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685143.1"
                     /db_xref="GeneID:11531077"
                     /db_xref="GOA:G8BS88"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BS88"
                     /translation="MHTLCCVSQRYVAAIASRSLTRSRYSIHHIVSLESLTRTCFYSL
                     IYKSPRSLGSHSFILDLSLSHGYILLIVSFHLCASMSTSSTHITVAMCSSSIILSNKN
                     NLLPPLLLPNLYNDAKNLRTLNLDHTNLYKFAAIAVDSSSSEHKPLFYLNTANKTDRQ
                     YKIGKKNADVERKLQFPSPSASPQPFLQQPVSPVGTRDENYDNKSSNSKAKAFTRRQR
                     IGPSCDNCRSKKIKCNATIDIVFQNNAVLNLFTKNLHHFITLDELKFFQSINHIDATT
                     AALKQSLAQIDQNELLTNELYLVKHLDKIILFKPCSHCNKKSNSKKSNDLENSNCCQF
                     PKGFTRADIGAFNKVIKKMSTTGTKLQPSDQNIYNLIVDDLFKQ"
     gene            complement(<132060..>132545)
                     /gene="TPHA0D00670"
                     /locus_tag="TPHA_0D00670"
                     /db_xref="GeneID:11534462"
     mRNA            complement(<132060..>132545)
                     /gene="TPHA0D00670"
                     /locus_tag="TPHA_0D00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685096.1"
                     /db_xref="GeneID:11534462"
     CDS             complement(132060..132545)
                     /gene="TPHA0D00670"
                     /locus_tag="TPHA_0D00670"
                     /inference="similar to DNA sequence:INSDC:YLR245C"
                     /note="similar to Saccharomyces cerevisiae CDD1 (YLR245C);
                     ancestral locus Anc_8.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685144.1"
                     /db_xref="GeneID:11534462"
                     /db_xref="GOA:G8BS89"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G8BS89"
                     /translation="MSSNEQLLEMLRANTLKARTLSYSPYSQFKVGCCLLVRDPNGGG
                     VSGHHDTVIKVLGANVENASYGNTICAERTAMLKAMTSEEHAAAARDPKNWLAIGIIG
                     DNPEGFISPCGICRQFIREFLTPDTENDVPIYLFSHTADNYKTTNISELLPMSFGPDS
                     L"
     gene            <133182..>136016
                     /gene="TPHA0D00680"
                     /locus_tag="TPHA_0D00680"
                     /db_xref="GeneID:11531043"
     mRNA            <133182..>136016
                     /gene="TPHA0D00680"
                     /locus_tag="TPHA_0D00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685097.1"
                     /db_xref="GeneID:11531043"
     CDS             133182..136016
                     /gene="TPHA0D00680"
                     /locus_tag="TPHA_0D00680"
                     /inference="similar to DNA sequence:INSDC:YGL163C"
                     /note="similar to Saccharomyces cerevisiae RAD54
                     (YGL163C); ancestral locus Anc_8.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685145.1"
                     /db_xref="GeneID:11531043"
                     /db_xref="GOA:G8BS90"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS90"
                     /translation="MARRLPDRPPNGIGFGSTPKLVPRQLNVDDARNVLSKPFKVPYK
                     VSKPAGSTSRSPTVLANTRRVLRERNKNVSYKGLDGDGAELNSLQNIDGVVNENGELI
                     KTRRKDALSARRLAEDPERLSRIELTLRKTFNVPIKGYTQRHSLPLTLGTKRKIISEP
                     RPLHDPSDELAIVLYDPSVDGDMIIQEDADQVESIRDIATMGNKKEQEKEKEKQKQME
                     IERLAHQQKFSHRSVMPNGIRNKPLTELLKHNLTSTDMNESAKKFPSIPVVLDPMLVK
                     ILRPHQVEGVKFLYRCVTGLVMKDYLEKEALEMLPASIDANDTSRISEVSNEDLEMKD
                     QSNSESNDSTPKTGTPSDTTPSEKETQDNSKNIGAYGCIMADEMGLGKTLQCITLMWT
                     LLKQGPKGKRLIDKCIIVCPSSLVNNWANELIKWLGPGTLTPLAIDGKKSSLANGGNA
                     TVSQAVRGWAQARGRNIVKPVLIISYETLRRNVDQLQGCKVGLMLADEGHRLKNGESL
                     TFTALNSIDCPRRVILSGTPIQNDLSEYFSLLNFSNPGLLGTRSEFRRNFEIPILNGR
                     DSEASDEDIKKGERQLQKLSHIVSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQRDV
                     YKSIIKTKEVAEAVKNSKKGGSMMLRSIGLLKKLCNHPDLINLEEELDNLDDSLVIPD
                     DYNISNAAKSRDVRIEFSGKFAILERFLHKINTESNDKIVLISNYTQTLDLIEKLCRR
                     RQYGVLRLDGTMNINKRQKLVDRFNSPDEPEFIFLLSSKAGGCGINLIGANRLILLDP
                     DWNPASDQQALARVWRDGQKKDCFIYRFISTGTIEEKVFQRQSMKMSLSSCVVDEKED
                     VERLFSTDNLKQLFQLNEKTICDTHETYGCKRCDLSGKQRLKSPTMLYGDATSWNHLN
                     HQALEKTNDHLLRNEFGFDDVSYAFQYISH"
     gap             136142..136161
                     /estimated_length=20
     gene            complement(<136217..>138151)
                     /gene="TPHA0D00690"
                     /locus_tag="TPHA_0D00690"
                     /db_xref="GeneID:11530956"
     mRNA            complement(<136217..>138151)
                     /gene="TPHA0D00690"
                     /locus_tag="TPHA_0D00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685098.1"
                     /db_xref="GeneID:11530956"
     CDS             complement(136217..138151)
                     /gene="TPHA0D00690"
                     /locus_tag="TPHA_0D00690"
                     /inference="similar to DNA sequence:INSDC:YGL166W,YPR008W"
                     /note="similar to Saccharomyces cerevisiae CUP2 (YGL166W)
                     and HAA1 (YPR008W); ancestral locus Anc_8.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685146.1"
                     /db_xref="GeneID:11530956"
                     /db_xref="GOA:G8BS91"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:G8BS91"
                     /translation="MVLVNGIKYACERCIRGHRVTTCTHTDQPLMMIKPKGRPSTTCD
                     LCKELRKNKRIVDKLLEEGKQCTCGRLRKRLEQQKLKDEAKARSKELKRRNKLLGGGE
                     QGNKSNVKIDLLKQHNDNTFDTTNYKRKDSVISERRMSALSMNSFTGTGKSISMLNNN
                     PHLFGTDSSVHSYSDVSSMNSPTSIDGGNSFINGFSSSNPNNFISNNSNLFTKNYSDS
                     HSNLFNVFNSNNYLDSNVGNNNNNNNTSPQNNDSVHAISSPVNTSGKITKDYHRVNSL
                     ASISSTQSQHYLEQSFSSPQSPSFYNTTHITSNLTANTTNSNGKKDISISSIIPTNLS
                     NMSPDWLSGVNNSENNDNNNMKNSKSNDYPNNNIENNLNDIKIKQEHDLDDMNGLLDS
                     IMNSSALQGMSRASYLLKQENPSNHSLNNPLIKPEPKDDNILDFDVTTANKFTATNTN
                     ETNNNATLDKITNAQKNLNNMKNITTNVNDGVGILSLTPGLLDMDANNNFSGANSLLN
                     IPGNDNDFNASSFPDSQLLKNDQDQSLQEPKIKNENYVMGLDPQDEDFAKHSDSIYSS
                     YNDILKGMVNDMSSSNNYSNVNMDNSTIDVSMNSPSNQFGNENLLKDKIFLNNTMNSD
                     LDQQVIQNVIKSEYDDTFNI"
     gene            <141986..>143575
                     /gene="TPHA0D00700"
                     /locus_tag="TPHA_0D00700"
                     /db_xref="GeneID:11531044"
     mRNA            <141986..>143575
                     /gene="TPHA0D00700"
                     /locus_tag="TPHA_0D00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685099.1"
                     /db_xref="GeneID:11531044"
     CDS             141986..143575
                     /gene="TPHA0D00700"
                     /locus_tag="TPHA_0D00700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685147.1"
                     /db_xref="GeneID:11531044"
                     /db_xref="UniProtKB/TrEMBL:G8BS92"
                     /translation="MTVLIQTSSAAMSSNWDNYSYDNNSDNSSSNNYAKLELSQYIDN
                     LTNNRCGSNLEAIQSRSAFNNNIVLTNSSDASSVTNSWSARFKNMFEKNINVDDSYDS
                     FDSSLYTDKSSITKPSPWFTRLFDKRSGKEQSQNSSHQTESFHATVLPESICNRKYEE
                     TPKSKIIEVEYTRYSQGKVEKTASTVNGSLRNTRSKNWFKTVFKGKSEASEVLEYPGL
                     VQPEPEVLENTYSDDSIYESEKLEYLPIKIDIVDVGSLSVSDCLTPINDGNHNIXXXX
                     XXXELEAELSGRQASIDTCLFQEQPILTTVSETHSYPVVSKHISGFCDDSVYESRVKN
                     DSSERKAGSHRDYTNCINPYTPILRARIREEKIALLNNKSKINDNAFTEPEHKRIFQK
                     DTYDEEYCEPKGAFSRHSSGSDILESEQTKKQTTTLVDVQEKQVLDPVQXXXXXXXHE
                     RFMQIIKRTKYNFRKFIKRNNKKEWILYQLQKTTDEVLDNGVLVCELIGDMLTDAIEK
                     VEPFPKLLQCAVGHVCMKLAH"
     gap             142802..142820
                     /estimated_length=19
     gap             143309..143327
                     /estimated_length=19
     gene            144702..144791
                     /gene="TPHA0Dtrna6F"
                     /locus_tag="TPHA_0Dtrna6F"
                     /db_xref="GeneID:11531081"
     tRNA            join(144702..144739,144755..144791)
                     /gene="TPHA0Dtrna6F"
                     /locus_tag="TPHA_0Dtrna6F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11531081"
     gene            complement(<144837..>145757)
                     /gene="TPHA0D00710"
                     /locus_tag="TPHA_0D00710"
                     /db_xref="GeneID:11531078"
     mRNA            complement(<144837..>145757)
                     /gene="TPHA0D00710"
                     /locus_tag="TPHA_0D00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685100.1"
                     /db_xref="GeneID:11531078"
     CDS             complement(144837..145757)
                     /gene="TPHA0D00710"
                     /locus_tag="TPHA_0D00710"
                     /inference="similar to DNA sequence:INSDC:YFR004W"
                     /note="similar to Saccharomyces cerevisiae RPN11
                     (YFR004W); ancestral locus Anc_8.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685148.1"
                     /db_xref="GeneID:11531078"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:G8BS93"
                     /translation="MERLQRLMMNSKAGATDANRDDTQETVYISSIALLKMLKHGRAG
                     VPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQ
                     MVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGNVVIDAFRLID
                     TGVLLNNQEPRQTTSNTGLLNKGNIQALINGLNRHYYSLNIAYHKTSSETSMLMNLHK
                     KQWQTGLKMNDYEEKENSNLELTKKMVNIARMYSKRIEEEKELTEDELKTRYVGKQDP
                     KKHLTEASEKLLEENIISVITSGVNSNITR"
     gene            <146495..>147487
                     /gene="TPHA0D00720"
                     /locus_tag="TPHA_0D00720"
                     /db_xref="GeneID:11534446"
     mRNA            <146495..>147487
                     /gene="TPHA0D00720"
                     /locus_tag="TPHA_0D00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685101.1"
                     /db_xref="GeneID:11534446"
     CDS             146495..147487
                     /gene="TPHA0D00720"
                     /locus_tag="TPHA_0D00720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685149.1"
                     /db_xref="GeneID:11534446"
                     /db_xref="UniProtKB/TrEMBL:G8BS94"
                     /translation="MKLNRAILQIISTINISLLVSGLNVTQPSQPIPPIPPAANRHKF
                     AIETINDLVLISQTSLSCNPLFGTFGPAMSVMQAASCTYNAIACGMNLSAKILEGWDI
                     LEDDTAIKSYVMTLMNQHTMDNSKTGEEALYLQDLNDITKFIHSESNKLQKIHNNYDN
                     IDNVSHLDEELKEQYKLIGTILLNPLDMHTDIYFKDITTENFGNTRIGCVNFLYGKNS
                     IFTNTNFQMETCFSKHGINEIATHFKERGIVKGSVAVYKAMSELGITKTIRAPKELYT
                     AFAKAFIGHYKEGVQKINNLIDKINDTEWDGGKLEFQLEDKGHFLMSLEVSKSQ"
     gene            <147988..>148467
                     /gene="TPHA0D00730"
                     /locus_tag="TPHA_0D00730"
                     /db_xref="GeneID:11531113"
     mRNA            <147988..>148467
                     /gene="TPHA0D00730"
                     /locus_tag="TPHA_0D00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685102.1"
                     /db_xref="GeneID:11531113"
     CDS             147988..148467
                     /gene="TPHA0D00730"
                     /locus_tag="TPHA_0D00730"
                     /inference="similar to DNA sequence:INSDC:YFR003C"
                     /note="similar to Saccharomyces cerevisiae YPI1 (YFR003C);
                     ancestral locus Anc_8.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685150.1"
                     /db_xref="GeneID:11531113"
                     /db_xref="InterPro:IPR011107"
                     /db_xref="UniProtKB/TrEMBL:G8BS95"
                     /translation="MSRNLQQSQQLTEESRTLQTQNRSNIIKLRAPKKEKSKSNEQGV
                     RWKSDVIDNENMNKKKTKICCIFHPNVENEEDLEDDYCTEHSHDEPHEESSSSSSESE
                     NEKDLDFDERRRRRIERRHRKLKENSTVSPNAYEIQPDYTEYRKRMQNKNKLKNIIF"
     gene            complement(<148677..>151241)
                     /gene="TPHA0D00740"
                     /locus_tag="TPHA_0D00740"
                     /db_xref="GeneID:11534587"
     mRNA            complement(<148677..>151241)
                     /gene="TPHA0D00740"
                     /locus_tag="TPHA_0D00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685103.1"
                     /db_xref="GeneID:11534587"
     CDS             complement(148677..151241)
                     /gene="TPHA0D00740"
                     /locus_tag="TPHA_0D00740"
                     /inference="similar to DNA sequence:INSDC:YFR002W"
                     /note="similar to Saccharomyces cerevisiae NIC96
                     (YFR002W); ancestral locus Anc_8.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685151.1"
                     /db_xref="GeneID:11534587"
                     /db_xref="GOA:G8BS96"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:G8BS96"
                     /translation="MENSLDMCAVSSANASVNKKNSASNSLKMINDLLENSKTLPTTV
                     SDLGSIQLSINELKKRTSELRAQNKDTDIDLTKAHYLLAGSGLAIEDVDNTLESLHKY
                     QMMESHAPGMQAEGEIDHYLKLKKDQIVSMSIDKLLSTSSKDFDIFLDNNLKLDWKSL
                     EHDVGQRFGLYVKNMNTIDNTNSSKHVMDMPKWSSEKSSLLNDSTTLLNVNENYLLRN
                     KFERYAKIIHSFNNCRQQQNHFSLVNEVISMIENFGDSTNRQLLECWKILQAIQEKES
                     IVISSRRYVEKQFLAYVDELYKKNLNEGLPTGINKVKSFIDSKLRGKDNKWLIENLTI
                     VNGIPIWALIFYLLRAGLHQEALEVAINNHSSFNKVEKTFLIYFKAFITAKSAQLPVE
                     LTTKLHIEYNQHIKSALGGDPFRMAVYKIIGRCDLSSKNISSIALNIEDWLWFHLMLV
                     KEDVSDNDPVYEKYKLIDLQNIILSYGISHFSEYYLQVLLLSGLYEFAVEHACTISKI
                     DGVHIAIGLANCHLLKTTTSHSDKNNSLLVSSGTGNSINFVRLLSTYTTSFRKSDPRI
                     AAEYLLLVGIVNDESEMKLCHEAIRELVLETKEFTILLGRINADGTRIPGVIEERKNL
                     LNLNEMHDYLNKISEQAAYKADEDGRTQDSLMLYQLAENYDIVISIVNDLLGDLLSES
                     NMSKPLTNIYSNNPNDPIYIAETLIHIYMNNLDISKKIQTKNKITNITLLKISEARKT
                     FAAGQWQNTLNLIEEIDLIPLSNTAEIRRSAQEVMNIDKNILKIIPNLLIMIMTCVYN
                     ISENLRQSAYQSAIKAQQHEALKNIAKNCSMYAGMIKYKMPKEVYSQLTKLEITLQ"
     gene            complement(<151878..>153050)
                     /gene="TPHA0D00750"
                     /locus_tag="TPHA_0D00750"
                     /db_xref="GeneID:11531085"
     mRNA            complement(<151878..>153050)
                     /gene="TPHA0D00750"
                     /locus_tag="TPHA_0D00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685104.1"
                     /db_xref="GeneID:11531085"
     CDS             complement(151878..153050)
                     /gene="TPHA0D00750"
                     /locus_tag="TPHA_0D00750"
                     /inference="similar to DNA sequence:INSDC:YPL001W"
                     /note="similar to Saccharomyces cerevisiae HAT1 (YPL001W);
                     ancestral locus Anc_8.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685152.1"
                     /db_xref="GeneID:11531085"
                     /db_xref="GOA:G8BS97"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="UniProtKB/TrEMBL:G8BS97"
                     /translation="MSINDFKPEVWTSSSNGALKVSLVTENAVTFSPQFTYPIYGDSE
                     QIFGYKDLTIHLVFDAITLKPFVNVKYSQKLDEDADDIEAKLLEFLPKDDIIIKDEAK
                     WISAFEKERIEYALPPDKFKISEYKIENDEYVVYKVPLGNEQTKKMHLRIQILSLLYI
                     EAASYIEADDPNWEIVWSFNKNTKECAGYVTTYRYWKYKGGKNFDENDNLKYRGKISQ
                     FLVLPPYQGKGHGSKIYSAIYNNWLTDSTIAELTVEDPNESFDDLRDRCDLTTLYESG
                     VFESIPEAFPIDETWIDETQQKFKVEKRQFNRLVEMMMLKTEHKSYGLQVKKRLYIKN
                     YDALVDMEDQEKKDALEKSFLMLDEDYKRILSACNLVKRKNNNTVQNDNGAKKLKL"
     gene            complement(<153533..>154837)
                     /gene="TPHA0D00760"
                     /locus_tag="TPHA_0D00760"
                     /db_xref="GeneID:11531128"
     mRNA            complement(<153533..>154837)
                     /gene="TPHA0D00760"
                     /locus_tag="TPHA_0D00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685105.1"
                     /db_xref="GeneID:11531128"
     CDS             complement(153533..154837)
                     /gene="TPHA0D00760"
                     /locus_tag="TPHA_0D00760"
                     /inference="similar to DNA sequence:INSDC:YFL001W"
                     /note="similar to Saccharomyces cerevisiae DEG1 (YFL001W);
                     ancestral locus Anc_8.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685153.1"
                     /db_xref="GeneID:11531128"
                     /db_xref="GOA:G8BS98"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8BS98"
                     /translation="MNWKYVTNILRHIVPNASKSDIVKIGNKYENWTKQQLIDRLQAL
                     ETLSNSNITAEYHSQNSDIKKDNLTIQRKKHPKEFNFEKYHKRHVALKFCYLGWDYNG
                     LALQKDKTPLPTIEGILLEAMKKCKFIPSMNPKDFKFSRCGRTDKGVSALNQIISLDM
                     RSELPPAEQVDANFDHKEINYTAILNQILPPAIRITAVCLNPPKDFDARFNCISRHYK
                     YFFKLDNLDITLMREAAKHFEGENDFRNFCKLDGSKQIKNYERTIFSFDISKVKEDIY
                     CFDIIASAFLWHQVRYMVAILFLVGQKLEPSSIVKDLLDVNKYPRKPIYDMAADFPLV
                     LYDCNYSDMKWIKSNINDYKAIKFRKSLEAIDYQLQIKATIASIFLEELKEVDNNTSN
                     KTRICTGDGHGNFTSIYSKIEDRLTMRSFEEINENYRKKHLE"
     gene            <155185..>157002
                     /gene="TPHA0D00770"
                     /locus_tag="TPHA_0D00770"
                     /db_xref="GeneID:11530990"
     mRNA            <155185..>157002
                     /gene="TPHA0D00770"
                     /locus_tag="TPHA_0D00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685106.1"
                     /db_xref="GeneID:11530990"
     CDS             155185..157002
                     /gene="TPHA0D00770"
                     /locus_tag="TPHA_0D00770"
                     /inference="similar to DNA sequence:INSDC:YFL002C"
                     /note="similar to Saccharomyces cerevisiae SPB4 (YFL002C);
                     ancestral locus Anc_8.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685154.1"
                     /db_xref="GeneID:11530990"
                     /db_xref="GOA:G8BS99"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS99"
                     /translation="MSKSLLWDNLDYQLQPWIRTAVDVMGFDEMTPVQASTIPLFARN
                     KDVVVDSITGSGKTVSFVIPILEKIIIEEANSSKLKKGHFHSLIISPTRELAKQIQSV
                     IESFLTHYPEDLYPIKSQLIVGTNTNTVRDNVSEFLDNRPQILVGTPGRIFEFLKSSG
                     IKSKSCSMVILDEADRLLDVSFLKDIENIMQILPKQRRTGLFSATINSAGSNIFKIGL
                     RNPVKVTVNSKILAPVTLSLNYAITEPEKKFQLFLSVLNNYKFKKCIAYFPTCISVQY
                     YYSFIQHLVEKKIVNEDLQIFSLHGKLQTSSRMKTLETFTETLSNAVLITTDVAARGI
                     DIPDVDLVIQLDPPTDADIFLHRCGRTGRANKIGKAITFLNKGREEDYVSFMEVKNVK
                     LELIELDVQGIPEDFNKIFMDWILEDRARFDHALRSYVAYIRHYSNHSASSIFRFQSF
                     DFVGLCRMYGLFRMPRMPEITKNFKDDVENPKVFSNGWLIDPPIDLDLFKYSDSKQEK
                     KRLAELKAIKDVHDKKRLKFLLKKKNESWSNKTETKESKLERRAKMEIKRKAIEAELA
                     KNDSENSDEEIEDWKQVVLQRKKKQKSSASGMQGSFDDL"
     gene            complement(<157069..>158442)
                     /gene="TPHA0D00780"
                     /locus_tag="TPHA_0D00780"
                     /db_xref="GeneID:11531018"
     mRNA            complement(<157069..>158442)
                     /gene="TPHA0D00780"
                     /locus_tag="TPHA_0D00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685107.1"
                     /db_xref="GeneID:11531018"
     CDS             complement(157069..158442)
                     /gene="TPHA0D00780"
                     /locus_tag="TPHA_0D00780"
                     /inference="similar to DNA sequence:INSDC:YPL003W"
                     /note="similar to Saccharomyces cerevisiae ULA1 (YPL003W);
                     ancestral locus Anc_8.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685155.1"
                     /db_xref="GeneID:11531018"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BSA0"
                     /translation="MEKFDRQIRLWGSKGQLLLESSNICIITNNTQTICVQEYLKNLL
                     QLGINNIDLIKVNNTNTADDDIKIGFFDYHYENNKNNGNGNSVNELLVDNINELNLEN
                     YNVIILIDLIEIKTLNFFNNIKLNQPILSCYSKGLYGYLHLKVNEPHFIINKNLEFMK
                     YDLKLYDENWLELKNYMDSIDLNIIELSQLPYVIILYKALYDLSNSKKIELNDIPLNQ
                     LKDHLSKFKPISKIVSNTDMNYLEAKRFAHLALRNKTFETHFIEQMNLIEEINPIDLF
                     DPINQYGLTIQKLFYSYCISPESEHDMPLSGTLPDMESDNRLYNDIKTIYDKRSKRDS
                     ENFNNYVKNITHEIPDDFIDDFASNITQTDTFVSESNFTKMIELNTSYPTLILKELIG
                     DQYYKNATSKVSSLKGFNLNSYPTTSIIAGIVAQETIKLITHQFEPIDNTIVYDGLNN
                     NIEIYKI"
     gene            <160512..>161540
                     /gene="TPHA0D00790"
                     /locus_tag="TPHA_0D00790"
                     /db_xref="GeneID:11534611"
     mRNA            <160512..>161540
                     /gene="TPHA0D00790"
                     /locus_tag="TPHA_0D00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685108.1"
                     /db_xref="GeneID:11534611"
     CDS             160512..161540
                     /gene="TPHA0D00790"
                     /locus_tag="TPHA_0D00790"
                     /inference="similar to DNA sequence:INSDC:YPL014W"
                     /note="similar to Saccharomyces cerevisiae YPL014W;
                     ancestral locus Anc_8.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685156.1"
                     /db_xref="GeneID:11534611"
                     /db_xref="UniProtKB/TrEMBL:G8BSA1"
                     /translation="MQNPIPLKPENKLLNLSIDTNSAAPNKNKQYLKDITDMDGDDMD
                     VDIDVTGIKTPLNFFKQPNFSINHFNENNSSSITPCSTPLNSTTTTTNFYKSNQNQNS
                     NMSLASTVSDYPNYNGKQDKTKQQFIINSSKYFNIEFTKLLLEIYSDFASDPLVTPFD
                     YSNPPSGVLNRVAKISVEESKKKNIEIGVDTNNWLLTLIRFKLQQEIKNEFANSRANS
                     VTSVSSSIPTNLQTNFNDLISNYANNINNTNSTCNNNINNTPIASGILQPAAFDYFSR
                     PISTQDIISNNCGNTLSRGPLTPVSGLPPNLAQLTRPRSNSSQTFAHLPSLSRTASHN
                     LLLQNQQR"
     gene            complement(<161700..>162065)
                     /gene="TPHA0D00800"
                     /locus_tag="TPHA_0D00800"
                     /db_xref="GeneID:11531123"
     mRNA            complement(<161700..>162065)
                     /gene="TPHA0D00800"
                     /locus_tag="TPHA_0D00800"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_003685109.1"
                     /db_xref="GeneID:11531123"
     CDS             complement(161700..162065)
                     /gene="TPHA0D00800"
                     /locus_tag="TPHA_0D00800"
                     /inference="similar to DNA sequence:INSDC:YPL013C"
                     /note="similar to Saccharomyces cerevisiae MRPS16
                     (YPL013C); ancestral locus Anc_8.79"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_003685157.1"
                     /db_xref="GeneID:11531123"
                     /db_xref="GOA:G8BSA2"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR020592"
                     /db_xref="InterPro:IPR023803"
                     /db_xref="UniProtKB/TrEMBL:G8BSA2"
                     /translation="MTCGLVRIRLARFGRTNNPIYNIVVTNSKKARDAKPIEVLGVYN
                     PIPVKNNKKSKQKDNVAVQLKNVELDFDRAKYWIGVGAQPSDIVTKLFIKSNILGTEW
                     SKRAALDRKVVIPMRKTME"
     gene            <162899..>166549
                     /gene="TPHA0D00810"
                     /locus_tag="TPHA_0D00810"
                     /db_xref="GeneID:11534619"
     mRNA            <162899..>166549
                     /gene="TPHA0D00810"
                     /locus_tag="TPHA_0D00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685110.1"
                     /db_xref="GeneID:11534619"
     CDS             162899..166549
                     /gene="TPHA0D00810"
                     /locus_tag="TPHA_0D00810"
                     /inference="similar to DNA sequence:INSDC:YPL012W"
                     /note="similar to Saccharomyces cerevisiae RRP12
                     (YPL012W); ancestral locus Anc_8.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685158.1"
                     /db_xref="GeneID:11534619"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BSA3"
                     /translation="MDADRVAHYLELEDKLAKIRIQIHSKLDNQKHIAIILSAVEENI
                     QNLDTNDTSKNLVHYMVSLMSLLDQAIDPNTHKIKDLSLLSSTCYLLDIIFHYAPKQL
                     LKSKFSEILTKIAPCITDEGASAALIRSAIGCLESQLIAQDAQIWNNTQALTVTPRRG
                     LQGLLELSLDPRPKIRKRAAEAVFNILSNPPAAPTAEHVASIFIASFCIKSLTSVMNE
                     FSVTSNKKLRNQSGPNDLNTKIIHNIRFISKVISSNQWPSPQIEPLCDLLLEVTKSSD
                     QFLVTAAFECFESLFNSLSEQSSTLGLADNKFLNVLEIIYSLKPSNNDTHLAGAWIAV
                     VVKSLSSYAVHQPLKAMQKIPEVFKLISTYLASESEEIYTSASQCLIAILTNAIRDEL
                     LLELPSNTEATIDVVDGLLEEMSVLITDFLSIKYTHCGKEILNVLAAAFTKLRHRANP
                     SFIKLLVIVDQWRINENNYMEYRNEVEKVIGSAISGMGPDIVLSYLPLNLENPTDEQP
                     GRAWLLPILRDYTKNTRLLTFINEILPLIEVFEDKCKQLNSESVQLKVFQTVIDQLWS
                     TLPRFCELPTDLQESFTSDFASKLSSILYSKVELRTTICHALKMLVDSNSAYANGALA
                     DNILLQESFPVQNAKDNLTYLSKMSPNILSVLFNVYSQTAPNARGYILETIESFIKIT
                     TEEDLQTTFNKVCTLLNSAMDEESENVQKGKPQLSATLLDLVVCMVKYVPASSYSALF
                     SIFSITVNSVDALTQKRAYRIVTRLSELDAGFEALSGFISDITKVFVETSDKTQTSTR
                     SVRLSAIKALVSMLPSNQMDFIVKVVPEVILATKDVNEKSRETAFETLIEMGKKMNEP
                     NSVVRLSEIPGYDSTTPDQPSSVTEFFKIMSAGLIGESQHMVSATITAYACVVFEFKD
                     EIDPSMLLEIYDTIQLYLTSNSREIAKSAIGYIKVCILGLPVELMHDKVPELLPKLLR
                     WSNEHTGHFKAKVKNIIERMIRRFGYELVEQAFPEEDRKLLTNIRKARNRNSKKGSEL
                     SEGKSNATSAKGSRFMSAFDEVVYDSSDDENDDTEVSNGKGKKASKQFIIEGENPLDL
                     LDSQTLAHISTTNVRNNKKEQRRKIRDDEAFSFDDEGKLVVKPGSSKTVNEEDPLMSV
                     TSGINAYLDAVKNGPIRGQKNKLKFKKNKDADDEDDFDNSPKPTKKNDSRNKIGKGSF
                     KKNQKFKSRRKL"
     gene            complement(<166724..>167923)
                     /gene="TPHA0D00820"
                     /locus_tag="TPHA_0D00820"
                     /db_xref="GeneID:11534244"
     mRNA            complement(<166724..>167923)
                     /gene="TPHA0D00820"
                     /locus_tag="TPHA_0D00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685111.1"
                     /db_xref="GeneID:11534244"
     CDS             complement(166724..167923)
                     /gene="TPHA0D00820"
                     /locus_tag="TPHA_0D00820"
                     /inference="similar to DNA sequence:INSDC:YPL011C"
                     /note="similar to Saccharomyces cerevisiae TAF3 (YPL011C);
                     ancestral locus Anc_8.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685159.1"
                     /db_xref="GeneID:11534244"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="UniProtKB/TrEMBL:G8BSA4"
                     /translation="MTSTSEFYYYLLRVSMLQLLKVQGFDRSKPSTVNAITDLYVKFL
                     ELLLGEITKLSRSRQDFDDSIALQDITQAFQNLGIIKPVDILDIYDENPELASDKGLQ
                     NFKKWWMDSDMRQQECLVSLPTTDLLNMEDMTLNDNNASTNINGSRNGNDNNGEGKTS
                     SQQASLVPDYLKQLQNKDPNKNDDNENEDELLEDMVNNGDFDNWIKFVIVKQRLSLSK
                     KLSKEKARSVDKLPGIAGLKNSVLDLQLNNSSSNEASMQVLQSDLLPSTQDIEKLENA
                     PIYLQKGFELLKKLPIMKQETNLSNITLSYENNEMEEDDDVELLDAGESKEELDKTAN
                     DYDQINKFEQDEQYENMQFDHKPEPSPGSFAMGSHFNSRYKEMDDIDNEFQRESIDFN
                     PESFERF"
     gene            <168725..>169288
                     /gene="TPHA0D00830"
                     /locus_tag="TPHA_0D00830"
                     /db_xref="GeneID:11534458"
     mRNA            <168725..>169288
                     /gene="TPHA0D00830"
                     /locus_tag="TPHA_0D00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685112.1"
                     /db_xref="GeneID:11534458"
     CDS             168725..169288
                     /gene="TPHA0D00830"
                     /locus_tag="TPHA_0D00830"
                     /inference="similar to DNA sequence:INSDC:YPL010W"
                     /note="similar to Saccharomyces cerevisiae RET3 (YPL010W);
                     ancestral locus Anc_8.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685160.1"
                     /db_xref="GeneID:11534458"
                     /db_xref="GOA:G8BSA5"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:G8BSA5"
                     /translation="MTDSLSLYSVKAVLILDNQGDRVYAKYYSAPHVPNLSLFPSVKQ
                     EKEFEKRLFKKIHKQESEILIFEDNIVLYKEYMDVVLCLIGPLEENEIILQQAFTAFK
                     DSLDLILDSGIDKKNTQEHYDMVLLAIDETFDNGVILETDPASIASRVTTPPSSEQQM
                     HLDLDKGLMSAWGFAKSKLQERLQQGI"
     gene            complement(<169497..>172547)
                     /gene="TPHA0D00840"
                     /locus_tag="TPHA_0D00840"
                     /db_xref="GeneID:11534599"
     mRNA            complement(<169497..>172547)
                     /gene="TPHA0D00840"
                     /locus_tag="TPHA_0D00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685113.1"
                     /db_xref="GeneID:11534599"
     CDS             complement(169497..172547)
                     /gene="TPHA0D00840"
                     /locus_tag="TPHA_0D00840"
                     /inference="similar to DNA sequence:INSDC:YPL009C"
                     /note="similar to Saccharomyces cerevisiae YPL009C;
                     ancestral locus Anc_8.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685161.1"
                     /db_xref="GeneID:11534599"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:G8BSA6"
                     /translation="MKQRISALDLQLLGEELKNSIEHHRLTNIYNISDSNRQFLLKFN
                     RTESKCSVLVDCGLRIHSTTFNRPIPPAPSGFVVKLRKHLKSKRLTALRQVKNDRILV
                     LQFADGLYYLVLEFFSSGNVILLDEEKKILSLQRVVQEHENRVGEVYTMFDDSLFIGG
                     NEKPIADKREYTEDLIESWINEVKEKIAAEANVISEPGHQKKKLRVPSIHKLLLSKVP
                     HLSSDLISKNLKKNEIDPSLSSLDFVDKISKLNQLLVETEDEYTDLLKNRYSKGYILA
                     KRNPKFIEEKDSKDTEYIYETFHPFAPYVDPNEIDISKVIEVEGPYNNTLDLFFSTIE
                     SSKYALRIQNQEFLAKKKLDDAVNENLTKINALRDIQSINEEKGVLIIEKADLIEEVK
                     GAVQSLIDQQMDWNAIENIIRNEQKKRNNIARLIMLPLNLKENKINIILPAEDNNSDD
                     SDNSSSSSDSDSEYSDNSDSDSSDDDIEKNRIKRKNRKNSKNVKIKGTQITIDLALSA
                     FANASEYFNKKKTSAEKQKKVEKNAEKALKNIEERIKVQLNKKLKDSHDILKKIRAPY
                     FFERFNWFFSSEGFLILMGKSPLDTDQIYSKYIEDDDIYMSNSFGTQVWIKNPEKTEI
                     PPNTLMQAGVLCMSASEAWSKKIASSPWWCFAKNVSKFSSDGKSVLEPGLFRMKNDKQ
                     QNFLPPAQLVMGFGFLWKVKIEDEGDADDNLNEVREEVLTGDEDNVVEKIVNESADVT
                     DQNELLKEDEEIESFNGMSSITQEINNLDITNADNISNQQTTTNNINEMDASKTVATV
                     LTSLSKNVRGKKGKLKKMQKKYADQDDNERLLRLQVLGTLKGIEKEQEKLKEELSRQE
                     ERERKKHRRERQKQLQALSFTESEKVKINYDRLRTELKTTLEPDDEIIDIIPVFAPWP
                     ALLKYKYKIKVQPGTAKKQKTVNDILHHFLNRKTDPNNCDKELDWVSEHDIIKSLKAQ
                     DLILSISADKLKISIPGQNSLNDRLKGKKSGTGKNGFKSKNKKK"
     gene            complement(172761..172879)
                     /gene="TPHA0Dtrna7L"
                     /locus_tag="TPHA_0Dtrna7L"
                     /db_xref="GeneID:11534412"
     tRNA            complement(join(172761..172805,172841..172879))
                     /gene="TPHA0Dtrna7L"
                     /locus_tag="TPHA_0Dtrna7L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:11534412"
     gene            complement(<174935..>176392)
                     /gene="TPHA0D00850"
                     /locus_tag="TPHA_0D00850"
                     /db_xref="GeneID:11534415"
     mRNA            complement(<174935..>176392)
                     /gene="TPHA0D00850"
                     /locus_tag="TPHA_0D00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685114.1"
                     /db_xref="GeneID:11534415"
     CDS             complement(174935..176392)
                     /gene="TPHA0D00850"
                     /locus_tag="TPHA_0D00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685162.1"
                     /db_xref="GeneID:11534415"
                     /db_xref="UniProtKB/TrEMBL:G8BSA7"
                     /translation="MTVLIQTSSAAMSSNWDNRSYDNNSDNSSSNNYSKLELSQYIDN
                     LTNNRCGSNLEAIQSRSAFNNNIVLTNSSDASSVTNSWSARFKNMFEKNINVDDSYDS
                     FDSSLYTNKSSVTKPSPWFTRLFDKRTGKEQFQKSTHQTESFHATVLPESICNRKYEE
                     TPKSKIVEVEYTRYSQGKVEKTASTVNGSLRNTRSKNWFKTVFKGKSEASEVLEYPGL
                     VQPEPEVLENTYSDDSIYESEKLEYLPIKIDIVDVGSLSVSDCLTPINDGNHNIPSPP
                     WDYRHEYKKLDDNYRKNSGENYHYNNEHVETSTVYSSYYSSNNVQELEAELSVRQASI
                     DTCLFQEQPILTTASETHSYPVVSKHISGFCDDSVYESRVKNDSSERKAGSHRDYTNC
                     INPYTPILRARIREEKIALLNNKSKINDNAFTEPEHKRIFQKDTYDEEYCEPKGAFSR
                     HSSGSDILESEQTKKQTTTLVDVTRKTGIGSSSTC"
     gap             176415..176434
                     /estimated_length=20
     gene            complement(<176864..>177601)
                     /gene="TPHA0D00860"
                     /locus_tag="TPHA_0D00860"
                     /db_xref="GeneID:11534432"
     mRNA            complement(<176864..>177601)
                     /gene="TPHA0D00860"
                     /locus_tag="TPHA_0D00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685115.1"
                     /db_xref="GeneID:11534432"
     CDS             complement(176864..177601)
                     /gene="TPHA0D00860"
                     /locus_tag="TPHA_0D00860"
                     /inference="similar to DNA sequence:INSDC:YPR016C"
                     /note="similar to Saccharomyces cerevisiae TIF6 (YPR016C);
                     ancestral locus Anc_8.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685163.1"
                     /db_xref="GeneID:11534432"
                     /db_xref="GOA:G8BSA8"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:G8BSA8"
                     /translation="MATRTQFENSNEIGVFSKLTNTYCLVALGGSENFYSAFEAELGD
                     SIPIAHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGL
                     VHPQTSVQDQEELSSLLQVPLVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDANPDAISGNLRDTLIETYS"
     gene            complement(<178142..>178549)
                     /gene="TPHA0D00870"
                     /locus_tag="TPHA_0D00870"
                     /db_xref="GeneID:11531133"
     mRNA            complement(<178142..>178549)
                     /gene="TPHA0D00870"
                     /locus_tag="TPHA_0D00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685116.1"
                     /db_xref="GeneID:11531133"
     CDS             complement(178142..178549)
                     /gene="TPHA0D00870"
                     /locus_tag="TPHA_0D00870"
                     /inference="similar to DNA sequence:INSDC:YPR017C"
                     /note="similar to Saccharomyces cerevisiae DSS4 (YPR017C);
                     ancestral locus Anc_8.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685164.1"
                     /db_xref="GeneID:11531133"
                     /db_xref="GOA:G8BSA9"
                     /db_xref="InterPro:IPR007515"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="UniProtKB/TrEMBL:G8BSA9"
                     /translation="MTKLRCSFTDCNSMIINLDDDKIVSMSDEIYAAFKLMQQKDGSH
                     NNKFMIVNDIWDFDNVGVSRDIPEQVVDNNGELIEVEISDEQWSISKCLKYLLCADCD
                     KGPIGMVCELTNKRDNSITKTINLLSLNSVSHI"
     gene            <179051..>180007
                     /gene="TPHA0D00880"
                     /locus_tag="TPHA_0D00880"
                     /db_xref="GeneID:11531050"
     mRNA            <179051..>180007
                     /gene="TPHA0D00880"
                     /locus_tag="TPHA_0D00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685117.1"
                     /db_xref="GeneID:11531050"
     CDS             179051..180007
                     /gene="TPHA0D00880"
                     /locus_tag="TPHA_0D00880"
                     /inference="similar to DNA sequence:INSDC:YGL170C"
                     /note="similar to Saccharomyces cerevisiae SPO74
                     (YGL170C); ancestral locus Anc_8.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685165.1"
                     /db_xref="GeneID:11531050"
                     /db_xref="UniProtKB/TrEMBL:G8BSB0"
                     /translation="MPKSNVSDIVNSLKVLKLNDENVESSKSNYSDNFKSLINENYYL
                     QMQLKEKDSELMKLRKHGQVEQQRHNVYDYKLGTTDEDKFSNFGSDLISHFSESPMKC
                     KRGTSVKTETSLATTNITEINKDHLLFKNNVIPFIENLILILNTNFIFEKECNDLNNL
                     YKQFLENTAEQDSQLLNNILTKIIFLTRQLVAILNKELKFSKRNKNIESKDTHRDRSK
                     HHYNQIDMKYLQEQILYKLDELANKKQKYRKPQYSKESEKGLEIIPIGYREQKNELKQ
                     QKRDPTQSSSSREKCSRSKRKDSLQNFLLEVQNEYTSKSFHS"
     gene            <180414..>182294
                     /gene="TPHA0D00910"
                     /locus_tag="TPHA_0D00910"
                     /db_xref="GeneID:11534299"
     mRNA            <180414..>182294
                     /gene="TPHA0D00910"
                     /locus_tag="TPHA_0D00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685118.1"
                     /db_xref="GeneID:11534299"
     CDS             180414..182294
                     /gene="TPHA0D00910"
                     /locus_tag="TPHA_0D00910"
                     /inference="similar to DNA sequence:INSDC:YPR018W"
                     /note="similar to Saccharomyces cerevisiae RLF2 (YPR018W);
                     ancestral locus Anc_8.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685166.1"
                     /db_xref="GeneID:11534299"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:G8BSB1"
                     /translation="MSMSSERSDVPKSDRKSILSFFQNPSIDRKKSEKQMSSEEVRAN
                     VINDDKGKSMSNDVEITTISDSESEQEQENPSESTGVHKKVNLVTGSNEVDIIKHIDL
                     QKKAEIETDVGNGNQVKKEEKSKNNEANDSSKEEKAKQKREALQKERDAKLKLKEEDK
                     KQKELQRKKEKLEREKRLQEEKKKREEKAEEVKRKREEVRLLKEAEKLKREEERLAVK
                     RKREEEKKAKERAQSRIGNFFKKVNDSGTMISSKTDYEKQFLKFYATEGVHLSTSPQL
                     SSDDLKESIKKLDLFLNSRLEDNTEDINQWLDKRTKRRGYKVKNTAVNLLQQMTTKEK
                     GDDALQAMLSLVPTKYIKFYENVRPPYMGTYSKDIIIPANNPFTTEGTGYSYDYDSDL
                     EWVNEEDEEGGEIDDLESGEEDEEEEDDEASEGEFDEFLDSEDKHETKKKKFIGPLIP
                     IVHLRNDIDKLEEDDKTYFEQLSIEFLLDPTAYPIDPLATPSIIANMNNNQYSNTSEA
                     IDNNTSPLKRPSTALEDGDITGTSTPGSSPDKKKQKHLITETKALLKLFDNLQDSTFS
                     LATVTEIVQKHIPNYNKQIIKNTVKEYAVRSTGKGDTPRKWSIKDMSAWNELRSKLDK
                     KE"
     gene            <182908..>185721
                     /gene="TPHA0D00920"
                     /locus_tag="TPHA_0D00920"
                     /db_xref="GeneID:11531029"
     mRNA            <182908..>185721
                     /gene="TPHA0D00920"
                     /locus_tag="TPHA_0D00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685119.1"
                     /db_xref="GeneID:11531029"
     CDS             182908..185721
                     /gene="TPHA0D00920"
                     /locus_tag="TPHA_0D00920"
                     /inference="similar to DNA sequence:INSDC:YPR019W"
                     /note="similar to Saccharomyces cerevisiae CDC54
                     (YPR019W); ancestral locus Anc_8.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685167.1"
                     /db_xref="GeneID:11531029"
                     /db_xref="GOA:G8BSB2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8BSB2"
                     /translation="MSNPPSVPDGNQNTPNGNRRRNEQSSPIANGSDTPPQSSPALFY
                     NSSSSQRDSDTFGRDSGHRPNRAVGAGIGSSPFNYPSSSQNSNQQGSDSFGTQRRTTG
                     NVLSSQNTPGYPYMDHRSDASLNPASSLGGSGHRVMMRRNDIHASDLSSPRRIVDFDS
                     HSNSITSSSSSRISSEANEPLRIIWGTNVSIQECATNFRNFLMSFQYKFRKVLDGQDS
                     FINTTTDEELYFVKQLNEMRELGTSNLNLDVRNLLAFKQTEELYYQLLNYPQEVISIM
                     DQTIKDCMVSLVVDANLDYNLDEIESKFYKVRPYNIGTQKGMRELNPNDIDKLVSLKG
                     LILRATPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEANSLSLIHNR
                     CSFADKQVIKLQETPDLVPDGQTPHSISLCVYDELVDSCRAGDRIEVSGTFRSVPVRV
                     NQRQRALKSLYKTYIDVVHIKKVSDKRMGVDTSTIEQELLQNKIDNNEVQEVRPVSDE
                     DIRKIKELSEQDDIYEILSRSIAPSIYELEDVKKGILLQLFGGANKTFTKGGRYRGDI
                     NILLCGDPSTSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGA
                     LVLSDGGVCCIDEFDKMSDATRSVLHEVMEQQTISIAKAGIITTLNARTSVLASANPI
                     GSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEGTDRQLAKHLTSLYLEDRPENV
                     SKGNILPVELLTTYINYAKQHIHPVISEEAKSELVRSYVNMRKLGDDSRSDEKRITAT
                     TRQLESMIRLAEAHAKMRLSETVTLDDVQEAVRLIKSAIKDYATDPKTGKIDMNLVQT
                     GKSVIQRKLQEDLGREIINILTENPSDSMTFNNLIKQLNEQSQDRVDSSDISEALSRL
                     QQEDKLIILGEGVRRSIRLNHRV"
     gene            <186262..>186633
                     /gene="TPHA0D00930"
                     /locus_tag="TPHA_0D00930"
                     /db_xref="GeneID:11531066"
     mRNA            <186262..>186633
                     /gene="TPHA0D00930"
                     /locus_tag="TPHA_0D00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685120.1"
                     /db_xref="GeneID:11531066"
     CDS             186262..186633
                     /gene="TPHA0D00930"
                     /locus_tag="TPHA_0D00930"
                     /inference="similar to DNA sequence:INSDC:YPR020W"
                     /note="similar to Saccharomyces cerevisiae ATP20
                     (YPR020W); ancestral locus Anc_8.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685168.1"
                     /db_xref="GeneID:11531066"
                     /db_xref="GOA:G8BSB3"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="UniProtKB/TrEMBL:G8BSB3"
                     /translation="MLGRLQSVSASLATKTNIWTAKTIYYGKVAAELSKQVYLKEGLQ
                     PPTVAQFKQVYCDLYKRALQLSKNPNSIFSYSQCLTKNNIVKFGAIGVQIAGFYTAGE
                     AIGRRKLVGYKNYSTNVEHKH"
     gene            complement(<186966..>188678)
                     /gene="TPHA0D00940"
                     /locus_tag="TPHA_0D00940"
                     /db_xref="GeneID:11534616"
     mRNA            complement(<186966..>188678)
                     /gene="TPHA0D00940"
                     /locus_tag="TPHA_0D00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685121.1"
                     /db_xref="GeneID:11534616"
     CDS             complement(186966..188678)
                     /gene="TPHA0D00940"
                     /locus_tag="TPHA_0D00940"
                     /inference="similar to DNA sequence:INSDC:YGL171W"
                     /note="similar to Saccharomyces cerevisiae ROK1 (YGL171W);
                     ancestral locus Anc_8.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685169.1"
                     /db_xref="GeneID:11534616"
                     /db_xref="GOA:G8BSB4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSB4"
                     /translation="MDIFRVLTRGANVNKKATKKNGVSVDYSMVKNEQTMDKSREEHT
                     INRELDFFRNKRIINKVEKEKLENSKDADEDEKKVVTETELNFDETLKITTKEEALAL
                     RKSYKGNITGSDVPLPIGSFEDLISRFSFDKRLLRNLLENHFTEPTPVQSECIPLALH
                     TRDMLACAPTGSGKTLAFLIPLLQQVIEQKEEIGLKGLIISPTKELADQIFLECTKLA
                     NRLYLDKKRPLQIALLSKSLSSKLKNKVISDKKYDIIISTPLRLIDVVKNEALDLSTV
                     KHLIFDEADKLFDKTFVEQTDDILNSCSDPSLRKAMFSATIPSNVEEIAQTIMMDPIR
                     VIIGHKEAANANIEQKLIFCGNEEGKLIAIKQLVQQGEFRPPVIIFLESITRAKALYH
                     ELMYDNLNVDVIHAERTPIQRNKIIEKFKTGELWCLITTDVLARGIDFKGVNLVINYD
                     VPRTAQAYVHRIGRTGRGNRSGKAVTFYTKEDSIAVKPIVNVMKQSGAEVSAWMEKIA
                     KISKKEKQLIKNGQAHKERKQISTVPKIEKQKKKRKFEMIEASKKRKLMENSETSKIE
                     PTEE"
     gene            complement(<189155..>190639)
                     /gene="TPHA0D00950"
                     /locus_tag="TPHA_0D00950"
                     /db_xref="GeneID:11534304"
     mRNA            complement(<189155..>190639)
                     /gene="TPHA0D00950"
                     /locus_tag="TPHA_0D00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685122.1"
                     /db_xref="GeneID:11534304"
     CDS             complement(189155..190639)
                     /gene="TPHA0D00950"
                     /locus_tag="TPHA_0D00950"
                     /inference="similar to DNA sequence:INSDC:YGL172W"
                     /note="similar to Saccharomyces cerevisiae NUP49
                     (YGL172W); ancestral locus Anc_8.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685170.1"
                     /db_xref="GeneID:11534304"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:G8BSB5"
                     /translation="MFNFNKSNSTGSATGGLFGQQNANQAPGAATGGLFGQQNTNQAP
                     GSTTGGLFGQQNTNQAAGSTTGGLFGQQHANQTPGAATGGLFGQQNANQAPGAATGGL
                     FGAKPAGSTPSGGLFGGNSGSTVAGGGLFGAKPAAGTTTGNLFGQQNNNQAPGAATGG
                     LFSSKPASGGLFGSNTSTAAPTTGGLFGSKPASGGLFGNSMNTGTTASGGLFGNTSSQ
                     APATSGGLFGSKPAFGGLNTQQSTAPFGGANNSLFGNTASNNIMSGGLFGGQQQQQQQ
                     QSSFYAISQLAITPMTKISDLPPQLRQEIENLDQYIQRQVQISQHLKADADAHLELIT
                     SVPRDLKFLTKTQSMTKQLLSEDLRKIASIKEATNQNVIFTQQFAVLFQQMLTPDSKI
                     SSIELEKFFQQKMHTFETKLDDYVRVLNDIESTISGLNNDLFGTNGSAHSGISSSDIN
                     GIYVMKSGLNSLVSTVTEEFKLFMDTAERVAELHQRIKELTVTN"
     gene            <191215..>195156
                     /gene="TPHA0D00960"
                     /locus_tag="TPHA_0D00960"
                     /db_xref="GeneID:11531008"
     mRNA            <191215..>195156
                     /gene="TPHA0D00960"
                     /locus_tag="TPHA_0D00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685123.1"
                     /db_xref="GeneID:11531008"
     CDS             191215..195156
                     /gene="TPHA0D00960"
                     /locus_tag="TPHA_0D00960"
                     /inference="similar to DNA sequence:INSDC:YGL173C"
                     /note="similar to Saccharomyces cerevisiae KEM1 (YGL173C);
                     ancestral locus Anc_8.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685171.1"
                     /db_xref="GeneID:11531008"
                     /db_xref="GOA:G8BSB6"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:G8BSB6"
                     /translation="MGIPKFFRYISERWPMILQQVEPDKTPGFDYLYLDMNSIFHMAT
                     HSNDVSDDVGKGTTDEVIYSRIFTYIDHIFLMIKPTTIIYMAIDGVAPRAKMNQQRSR
                     RIRTAMDAEKAIDAMKNAIGEENWDSSMEPFDKNSITPGTEFMAQLTINLKYFIHEKK
                     TNDSNWRDVQVIFSGHEVPGEGEHKIMDYIRKLKSQRDYDPNSRHCIYGSDADLIILG
                     LSTHIPHLAVLREEMIFGRKKDIRAGLEAQNFLLLHMSILREYLELEFEDLKTKLSFK
                     YDFERIIDDFVLILFVIGNDFLPNLPDLHLNKGAFPVILETFKKALMSLDSYINFNGT
                     INLERLGVWLDYLSHFEFMNFKQKVFTVQWFNEQLNKIPTINKNVNDQNDLQKKLNLI
                     NSMLHWVTKMDTEILSPSSFAINREQIKDIYHFFNKLSEGYGFEISKDQSENYIISKT
                     QNANDVNYIKSSLTELLICYEDLIKDQNKTKSNVQDIYNEDKFKSWKQNYYKSKLEFS
                     ETSYGEDLRNLTANYVEGLQWVLDYYYKECPSWSWYYKYHYAPRISDLRDGLKQRIVF
                     DQDEPFTPFQQLMAVLPSRSSKLIPSIFRPLMLDPSSPIIDFYPTTVKFDKNGKAADW
                     EAVVLISFVDQDRLINAMKPFLNLLTPEEASRNAHGSNIMFFYDSKNNSTYQTSLKGA
                     FKDIINDKCIELEFTIDVPEEVKYGFLKGTLEKSNMRPKFPSLYYLKFTNKLLNCGCL
                     IFESPTQQSSMSINIPNRQMSEKALQKFILMNLGKVAFTSWPYLELSRVTSFITDEYE
                     YTQIGRDDNDKKKGMGYISRKLTTKEKADFHKLKTSIIRKLQKTSAVILQSITVLVKV
                     QCFERLEKNINGSFKKIFKNNFEYHPLQVVIFNGNTKLLKEFNYTQGPSLSFEEQFPK
                     DTFIVCLGKENYGNYGQIVDNLNGKKLHIKCSHNISPDDYINLAKQLKLKSMDDVKYY
                     PTHKVCKLLKISPLFLANITSRFVVIDAKDNAINIAIPMRFKNIDKKIMGYTYKNNNL
                     WMYSEKAINLLLKFKKKFPALFQRLSNTKDRFIRIKNIFPDVSADDLITVLKDVKKWI
                     NEETVSFIKVSNSCHMLNDESVQCIEEYQKSRSNELIDTNKSDLITNAKFIKRPETFT
                     NNLISQTFNLGDRILFVQSYGKVPFASKGTVIGLDTLNNRPLIRVICDSEITSATNYG
                     GILQTQRIVTSDASDILNLSNKQFGWFQKKENTDRRDLKNKSTTSAADKERVSVRNIQ
                     NQHKKVQLQHKEISKNREVIEITNELTQADIPVPLYQSAISKPFEFKTFDS"
     gene            complement(<195530..>196681)
                     /gene="TPHA0D00970"
                     /locus_tag="TPHA_0D00970"
                     /db_xref="GeneID:11534397"
     mRNA            complement(<195530..>196681)
                     /gene="TPHA0D00970"
                     /locus_tag="TPHA_0D00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685124.1"
                     /db_xref="GeneID:11534397"
     CDS             complement(195530..196681)
                     /gene="TPHA0D00970"
                     /locus_tag="TPHA_0D00970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685172.1"
                     /db_xref="GeneID:11534397"
                     /db_xref="GOA:G8BSB7"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:G8BSB7"
                     /translation="MVYLSVIKHAVSYDVSNSELPICDIESDYDGQSDNLRILAVFMV
                     LISSGLGSFFPILSSKYSVIRLPNWCFFIAKFFGSGVITATAFIHLLEPATDELGNDC
                     LGGTFAEYPWAFGICLMSLFTLFLVEIVTHHLMEKNVAGVTPNKVVHMHDEISSSDEG
                     FDKVDDVNELEVTNTQLTTASEDRIDFNPIIGANHYSHAEHHQDIEQMNSALEETGKE
                     SYSSQIVSLLILEFGVIFHSIFVGLSLAVSGDEFKTLFVVIIFHQMFEGLGLGSRIAE
                     QNWGVRNTYTPWLLALGFTVATPIAIAIGIGVRYSYFPGSRNALISSGIFDSLSAGIL
                     IYTGLVELMAHEFLFSKQFQGENGFKKMLLAYVCMCCGCALMALIGKWA"
     gene            complement(<197456..>200197)
                     /gene="TPHA0D00980"
                     /locus_tag="TPHA_0D00980"
                     /db_xref="GeneID:11534593"
     mRNA            complement(<197456..>200197)
                     /gene="TPHA0D00980"
                     /locus_tag="TPHA_0D00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685125.1"
                     /db_xref="GeneID:11534593"
     CDS             complement(197456..200197)
                     /gene="TPHA0D00980"
                     /locus_tag="TPHA_0D00980"
                     /inference="similar to DNA sequence:INSDC:YPR021C"
                     /note="similar to Saccharomyces cerevisiae AGC1 (YPR021C);
                     ancestral locus Anc_8.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685173.1"
                     /db_xref="GeneID:11534593"
                     /db_xref="GOA:G8BSB8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BSB8"
                     /translation="MELINSMSSKRARQVEIFKRFAHVIDEDQKRLPPYEYELTDADQ
                     FQEKTGDLILTYNDFIHLITSSQSLHSAFTDHSFNLNIIPNATFGCIFFALDTDNKGY
                     LTINDWFHFNNLLAFDNYQYILLFEFFKKFDKAFLEREGIKMNAINYGDKSLSFDNLL
                     INFNQLKHVLNFLQDQVLRNSDKDAHIDFIRRNKLVLDWNNLPFLKYYEYYCDGKRLG
                     LPMNDVLPYISLNSMITMMQNDLKNEKLRLGFEKLSHADKRFNNTLTINKNQLVYLLK
                     LFFAHRISQDVFDSLNFTNNSLISSDNNHITYNVIKDIFYLFQHFDLLNQALVKYVTV
                     NDLSDSALREHEISKQVLNEILNCKYNKVNNIIQFSPSQINILFSVVANAKQKNKKKT
                     KGEIKHHHKDSHIDDFISNEYSHGNNISKRQLEIFNAYYQDMANAVDDEEDIYCDKDD
                     RGNNGFLEFVLQFYSSGNIGQNATKGNYLTIEDFMKIINPNYLNNLVHSMEIKRLQQN
                     SLYSTYYFFPIFDSLYNFGLGSIAGCIGATIVYPIDMVKTRMQAQRAVSRYTSYFNCF
                     TKIISREGFKGLYSGIGPQLVGVAPEKAIKLTVNDFMRNKLTDSRTGKIHINNEILSG
                     ATAGMCQVIFTNPLEIVKIRLQVKSEYATTAAKDITAISIVRQLRVTGLYKGVVACLS
                     RDVPFSAVYFPTYSHIKKDIFNFDPCDKTKKHSLKTWELLLAGALAGMPAAFLTTPFD
                     VIKTRLQMDPRKGETKYNGIFHAAQTILREESFKSFFKGGGARVLRSSPQFGFTLAAY
                     EMFKNLFPMSQDGHIGSNNINSNQPLSGPSNTANKDEIPSITSSFKNVANAQNSSVRI
                     QSSLLRDVVDPYSNTYVNYYYKSCEIAKVFLDLDNNFSSFDSNMYYRFYDEIKNSQQ"
     gene            complement(<200729..>201760)
                     /gene="TPHA0D00990"
                     /locus_tag="TPHA_0D00990"
                     /db_xref="GeneID:11530986"
     mRNA            complement(<200729..>201760)
                     /gene="TPHA0D00990"
                     /locus_tag="TPHA_0D00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685126.1"
                     /db_xref="GeneID:11530986"
     CDS             complement(200729..201760)
                     /gene="TPHA0D00990"
                     /locus_tag="TPHA_0D00990"
                     /inference="similar to DNA sequence:INSDC:YPR023C"
                     /note="similar to Saccharomyces cerevisiae EAF3 (YPR023C);
                     ancestral locus Anc_8.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685174.1"
                     /db_xref="GeneID:11530986"
                     /db_xref="GOA:G8BSB9"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR008676"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="InterPro:IPR026541"
                     /db_xref="UniProtKB/TrEMBL:G8BSB9"
                     /translation="MSFELGGKCLAFHGPLLYEAKILKIWNSKEDSITRLNNDVVDES
                     DRPESPVEGDFLYFVHYQGWKASWDEWIGEDRIKEYNEENVELKKKLIADAKNAKKEL
                     QKSQQQQKKKSQASLSTQYASTGSESRKKAVESALYSNSLYTTSSSSSSATSSISNFG
                     NMNHHPPKLVMHIPSKLRSVLVNDWEYVTRNKQILKLPSDRNIKQILDLYETEASKVL
                     ESPASQSQLREFCDGFKLYFENSLPVCLLYRIERLQFEELKDKTNLIEKYGSIHLLRL
                     LSIIPELISNSLTMDKQSSQLIIKQSELLLQWLLFNDEKLNLFPHPYSVNNFYVNTSS
                     QYEGVALGM"
     gene            <202605..>204125
                     /gene="TPHA0D01000"
                     /locus_tag="TPHA_0D01000"
                     /db_xref="GeneID:11530940"
     mRNA            <202605..>204125
                     /gene="TPHA0D01000"
                     /locus_tag="TPHA_0D01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685127.1"
                     /db_xref="GeneID:11530940"
     CDS             202605..204125
                     /gene="TPHA0D01000"
                     /locus_tag="TPHA_0D01000"
                     /inference="similar to DNA sequence:INSDC:YER123W"
                     /note="similar to Saccharomyces cerevisiae YCK3 (YER123W);
                     ancestral locus Anc_8.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685175.1"
                     /db_xref="GeneID:11530940"
                     /db_xref="GOA:G8BSC0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BSC0"
                     /translation="MNPQLKQKKHIVGIHFAVGPKIGEGSFGVIFEGENILNDSDNQP
                     VAIKFEPRRSDAPQLRDEFRAYRILNGCEGIPHAYYFGQEGMHNVLIIDLLGPSLEDL
                     FEWCGRKFSVKTTCLVAKQMISRVRTIHEHDLIYRDIKPDNFLISQYQRVKSDGESEK
                     RIASSANNDPNLIYTVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQ
                     SRRDDLESLGHVFFYFLKGSLPWQGLKAPNNKLKYEKIGLTKQKLKPEDLLSNNIPVQ
                     FATYLKYVRNLKFDEDPDFDYLLSLMDEVLKGYSPEEHYDWMDLNDGCGWDIHINKRA
                     NLHGYGNPTPRATNRTNNSHTNNNTNIRIAESSNNVTQSANVTNKENTFNKGYSNIKA
                     ISQQNHDLQQQKFTMSTKTKQYNNLTPISLPNTISIGSKKQLMKHSNRNYPNNDLDSG
                     NTKLNVNSNNNHGQYHSINNNSGPGSSSQQYLLDNDSTYNQSSGNTCWSYIFCGYC"
     gene            complement(<204354..>206117)
                     /gene="TPHA0D01010"
                     /locus_tag="TPHA_0D01010"
                     /db_xref="GeneID:11534393"
     mRNA            complement(<204354..>206117)
                     /gene="TPHA0D01010"
                     /locus_tag="TPHA_0D01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685128.1"
                     /db_xref="GeneID:11534393"
     CDS             complement(204354..206117)
                     /gene="TPHA0D01010"
                     /locus_tag="TPHA_0D01010"
                     /inference="similar to DNA sequence:INSDC:YER124C"
                     /note="similar to Saccharomyces cerevisiae DSE1 (YER124C);
                     ancestral locus Anc_8.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685176.1"
                     /db_xref="GeneID:11534393"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BSC1"
                     /translation="MSDYYCPSNIFRNNAIAIPKRNELRLKNKVTNKYSYTNNRQKQQ
                     LRKCSEDFNDYYTTKKLYSNYFEVPNCTNNETSFSHLDIDPNNNILIANESKLKLLSF
                     EVESQFHSKLHGIQTIHLPKPNLTSSIFFNKKENNDTLSILSGHSNGVVNLIDTSLES
                     GNAQVKTRFNHKKYLKSIPSLVTSGCFPIKKLVAPKNDNIFISLANDSLFIYDLNEKS
                     KPLFLKLFAGVESLAYNNSLNFTNNKLMALSGSKFGKAGISLLDLTSSHSNPTNLISN
                     QYYPITNSYSRPEVSYDCLWIDDFLIANTLGNKVKVWDIRSTAGEALVTIESNKGYIE
                     SLMYNSTSKLLFTNDDQNTVISWDLRDLKKMRRGILSQGFNSVMNESGTSQESNGTYC
                     IGNIVVNGNSTIQQSNQKSNINSSLKINLLDDGSLVSLRNTELGYHAIKTVTCSTNLQ
                     LVDEEQNKYTFQEQVERKEETKDTKYPIQNEDISEENHSDSTLTSIIEEVRIKPYVPP
                     YTKEFNSKIYNNHELNNSTLTLIDHNNNDTILDIDVDKYFNTLSKSIDEGSQDDSFGH
                     KHSTSMYSLNQLAISGSTIYN"
     gene            complement(<206213..>206686)
                     /gene="TPHA0D01020"
                     /locus_tag="TPHA_0D01020"
                     /db_xref="GeneID:11534252"
     mRNA            complement(<206213..>206686)
                     /gene="TPHA0D01020"
                     /locus_tag="TPHA_0D01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685129.1"
                     /db_xref="GeneID:11534252"
     CDS             complement(206213..206686)
                     /gene="TPHA0D01020"
                     /locus_tag="TPHA_0D01020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685177.1"
                     /db_xref="GeneID:11534252"
                     /db_xref="UniProtKB/TrEMBL:G8BSC2"
                     /translation="MGGVCRDSVVGGGPIACCRLARVGHCVHRCECICGGACSVRSAP
                     VGDPRAYGDTHTCVCHYGRTGVSGSVTKIASVTARRGVWFSGSFVTRRAAPAGPPAGA
                     ALGVLVFTCWQVAGTVLVTQTLRHTVVSDWLYLLLMLLGSMVSLFLRLAIDYTSI"
     gene            <207354..>209822
                     /gene="TPHA0D01030"
                     /locus_tag="TPHA_0D01030"
                     /db_xref="GeneID:11534297"
     mRNA            <207354..>209822
                     /gene="TPHA0D01030"
                     /locus_tag="TPHA_0D01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685130.1"
                     /db_xref="GeneID:11534297"
     CDS             207354..209822
                     /gene="TPHA0D01030"
                     /locus_tag="TPHA_0D01030"
                     /inference="similar to DNA sequence:INSDC:YER125W"
                     /note="similar to Saccharomyces cerevisiae RSP5 (YER125W);
                     ancestral locus Anc_8.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685178.1"
                     /db_xref="GeneID:11534297"
                     /db_xref="GOA:G8BSC3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR024928"
                     /db_xref="UniProtKB/TrEMBL:G8BSC3"
                     /translation="MPCSISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTTAAK
                     KTLNPYWNETFKFKDVNENSILTVQVFDQKKFKKKDQGFLGVINIKITDVLNLDSNDT
                     YNSNEETITRDLKKSNDNMAVSGRLIVVLSKVPNSTSSATTSNTRTTSRSSRARSSAS
                     NATVGATANRTGSSAGGSAATAATNNSTTAANGNNNITTSTSRNTTTPASASNEASNT
                     ESNSANNNTTHQLSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTFDQTE
                     NTANSLQNTELERIQHRGRTLPESSSASASNSNQDITVNTNNNSQTPAINGSAAAALA
                     ATGATTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQ
                     QQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRR
                     KVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLD
                     YGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTIQINPNSAINPEHLNYFKFIGRVVG
                     LGVFHRRFLDAFFVGALYKMILRKKVILQDMEGVDAEVHNSLKWMLENDIEGILDLTF
                     SADDERFGELVTIDLKPDGRNIEVTNENKKEYIELYTQWKIYDRVQEQFKAFMDGFNE
                     LIPEDLVTVFDERELELLIGGIAEIDVEDWKKHTDYRGYQESDEVIQWFWKCITEWDN
                     EQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGESNQLPKSHTCFNRVDLPP
                     YDVYDSLKQKLTLAVEETIGFGQE"
     gene            complement(<210613..>213006)
                     /gene="TPHA0D01040"
                     /locus_tag="TPHA_0D01040"
                     /db_xref="GeneID:11534261"
     mRNA            complement(<210613..>213006)
                     /gene="TPHA0D01040"
                     /locus_tag="TPHA_0D01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685131.1"
                     /db_xref="GeneID:11534261"
     CDS             complement(210613..213006)
                     /gene="TPHA0D01040"
                     /locus_tag="TPHA_0D01040"
                     /inference="similar to DNA sequence:INSDC:YGL178W"
                     /note="similar to Saccharomyces cerevisiae MPT5 (YGL178W);
                     ancestral locus Anc_8.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685179.1"
                     /db_xref="GeneID:11534261"
                     /db_xref="GOA:G8BSC4"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BSC4"
                     /translation="MQNNARHQHQLSVNSVQSLIEPTTPPSLGQMNNKRFHQKTQSLD
                     LSNFNQFMSATANNQTNKFNNSSPLLYTNGVPSSFNMDGNFLGGSSQNSALYINNSST
                     NNSSSSTSQSTPISFNKGTNLPLINEFDVLHNTNYMPFPINAPLGINTNQLAPTNSNM
                     NAILSNNGKHNNELSNNIVPLEYSNGVQNIQPQLLTTSHESSFKTKTLPMSKKSVNTD
                     KPLANMNEINSRPLEELDFLSLSTDQYGCRFLQKKLEDKNINDSNKVRDLLFDQTRDH
                     FLDLILDPFGNYLVQKLCYYLTTDQKTILIQAIYTNMYQISINQYGTRSLQKIIDVAE
                     EDYQIDMIIDGFSNREYISTDQVVKIINDLNGNHVIQKCIFKFQPSKLNFLIDVINTG
                     NNIVHISTHKHGCCVLQKLLGICKLQQTLKISMNIIEYLPKLINDQFGNYIVQFLLDT
                     DELKFYFLPETYKKLSNNLPQLSCMKFSSNVIEKIIKILYVVITKSANCSNVIPNQDD
                     LVPNVMEILISIIEIFTANLNVLIRDNYGNYTLQTLLDVKNYSTLLDYTPIDKMDPTS
                     EKDSKSQAFEKFKRELSTKITHLIFLTKELLPSIKATSYAKKIKSKVKDFAEFKGVQI
                     SDLTSECNILPTDNQQISEVTKSKHTKHSSLPKNNHKKPFNKTQNRNSNNNSSYSYSK
                     HHYNYTGNHNYDQKINQYTQNHYEAPAYDVNAISRPLSKLDLNLLQPMNENIYNSKDS
                     MGYPESSYFNAYEKNNGFEKASSRFDTGINKAFIGNTNDITPNFNKVDFSSQQYPFN"
     gene            complement(<216444..>217763)
                     /gene="TPHA0D01050"
                     /locus_tag="TPHA_0D01050"
                     /db_xref="GeneID:11534430"
     mRNA            complement(<216444..>217763)
                     /gene="TPHA0D01050"
                     /locus_tag="TPHA_0D01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685132.1"
                     /db_xref="GeneID:11534430"
     CDS             complement(216444..217763)
                     /gene="TPHA0D01050"
                     /locus_tag="TPHA_0D01050"
                     /inference="similar to DNA sequence:INSDC:YER130C"
                     /note="similar to Saccharomyces cerevisiae YER130C;
                     ancestral locus Anc_8.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685180.1"
                     /db_xref="GeneID:11534430"
                     /db_xref="GOA:G8BSC5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BSC5"
                     /translation="MSTLTRVESNDTVYGSGNLKNLSFFNNSQSALNNDANHFTLQIL
                     PKSNFNNNSSGQSNITNDLTGNTLVTNSTSQLVASPNSDFTYNDNYINNSYNFRNEIF
                     NNNNNEKRLSISEYITDRTNYYEYEKLELNLNEFGILSPQEDTDFDAFSIMTDLEDTS
                     LPAPDLDKSSTKKVMNYFKLNIFNNTHTNSNNSNSTLPMDNMNTNFQHTTLNTTEESP
                     QIFKKRYFWSRNKNIKKESGTGSEKLLNDDNITFDQDSMLNDDDSRLIIDPSQLITKS
                     NTANPTEGQITNDFLSSPDFIISGVENSIFSDDFTENMKIEELEHIEIDTKVIVPSIF
                     VEDFKIDKKTRIPNKTTDHSNAQSIILPKKIGILPKTRGRKPSPILDSSKQFGCDYCE
                     RRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIKTHTH"
     gene            complement(<219691..>224442)
                     /gene="TPHA0D01060"
                     /locus_tag="TPHA_0D01060"
                     /db_xref="GeneID:11530977"
     mRNA            complement(<219691..>224442)
                     /gene="TPHA0D01060"
                     /locus_tag="TPHA_0D01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685133.1"
                     /db_xref="GeneID:11530977"
     CDS             complement(219691..224442)
                     /gene="TPHA0D01060"
                     /locus_tag="TPHA_0D01060"
                     /inference="similar to DNA sequence:INSDC:YER132C,YGL197W"
                     /note="similar to Saccharomyces cerevisiae PMD1 (YER132C)
                     and MDS3 (YGL197W); ancestral locus Anc_8.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685181.1"
                     /db_xref="GeneID:11530977"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G8BSC6"
                     /translation="MLIPQPSSTVCYDLKLPNLPANFKTLDEAKKRSLTLDCRTGAAI
                     SIARSNIFVHGGLVLPLNLTEVSLVNVQQEIIMYFAKEKGVGSSFKNLIDWVSSEVFF
                     LDLISRTWQRVPTTMKENTENNRDQLTEGSLVTNRLFHSMCYTSSHLYIFGGLAVYPE
                     SGYELIATNSLWQLDLVTKEWSLISEDPQIPRRFSHSMHVKNENDESKDTKIVIVGGL
                     SNLDEPLQVVNIFNITKNCWELEIDPLYKDHISLNIEGKRASMVTKSNFSILVENNKA
                     DVPALICYYPQIKETLNRDSTNFTNASNTQLPKDRYSHTVGNVSPLAALPLLPDSKGI
                     VMDIDPTQYRYVLNNIFDLRYPTGEYYGYEIILAGYYLDTDDVSFQCYSYDIRSGKWS
                     RINLSCNHCRQSKAFHRFWKLFVWKSHHKILLMGSKVNDGYLPTIQKFDHLMTLEIPT
                     ANIQKKEVAKFSHFNKSLVSPISFNFKDEHLIPTISNTDGPLATGKQSYSSSVTSKFE
                     SYIRYIAPTEMESVSSVFQSYAMVLGKDAMELFGSPLSDFEFISDEGEAIGVPIYLLR
                     KRWGRYFDMLLAKGYSKVCQDYEATGIQSALIKFTPSQSFSGSKLNRHPSNVSSEGFL
                     DIKARLASMTSLEKFTEDSNYPKLRRSSSASIDSDHHIISGLNNNIIPETTEPLDFSN
                     TLSRGSLNSRSRSSQVDIASTSTGMVFRVPFQDRSKTGTTVFSDLKVPNERRASLNSL
                     PTLEMLKKDVRRLSHPKMTTLTQDHSVLSRGTPADIIHSRRTSVNSARNLLPIHSRKG
                     SLASQASLMSYLSSNSDMMAPLSSSRRDSINTLDSQNSGLLNVPLPPQCLAPTELLPP
                     VPKTNTRKSSILINDISSTSAPSSPLMSKLNIQSDNIPHLSQLRKSSSSSALGDNCSS
                     ASSNNYKDKRRGFGSWSSTASNRNVEFEPLLTPRALYLPWSTATLQAFAEFFYTGQVN
                     LRWQLVPVVLNLLIMAKLYEVPLLSSLITEALYTVVSRKEENLHLITRSLLEATTKEA
                     RKEAGKNEEALHKILQNNPRYLELMKLKDSLDNIENGYFDMPLQSMSGKLSISTTASD
                     ESDRYRRSSSLASYKSNPNNAMYRDILKNGSGSVTSAGSGPVTTLKTPLNKKSSNLRK
                     SEDFGDYKFATQETVDQDKLRVLSSIDMDDDSDSASSEEKLSYIDKLRKLSVAYRRKS
                     MDGTSNINLLDNLDASSSSQSDLDDSDFELGIFSLNTIKKKLSERYADESIDPLMDGT
                     SVSSECLNPTIGSNDPLSNRTSGNISIDPRSSKSSAANSSQAFLNKIIYNRCALKDSV
                     PGIGSQSPPMGNSNGNISQPYMSQMPTLENIMVPNSLPPISYIIKSIYRTAILTNDVR
                     LMIRCLDCLEISEALKKIKRKMNAAQNNANKNAIKSNSKSSIKNIKGKNSASTGQINE
                     SSKNKNTSTTSHSSTPPLSTKSTDSINISRSESPGPKPRTSKSGSKNMAPRYSSFNFL
                     MSPSVANSQSGDSLAFDKQQLSAISPRTSVAADTSIKESIANSHSKPKRNSNGNNNTA
                     TNTSSTLNQSSTNTPSNNNITGSLFFFGKKK"
     gene            complement(<225125..>225985)
                     /gene="TPHA0D01070"
                     /locus_tag="TPHA_0D01070"
                     /db_xref="GeneID:11534426"
     mRNA            complement(<225125..>225985)
                     /gene="TPHA0D01070"
                     /locus_tag="TPHA_0D01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685134.1"
                     /db_xref="GeneID:11534426"
     CDS             complement(225125..225985)
                     /gene="TPHA0D01070"
                     /locus_tag="TPHA_0D01070"
                     /inference="similar to DNA sequence:INSDC:YGL198W"
                     /note="similar to Saccharomyces cerevisiae YIP4 (YGL198W);
                     ancestral locus Anc_8.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685182.1"
                     /db_xref="GeneID:11534426"
                     /db_xref="UniProtKB/TrEMBL:G8BSC7"
                     /translation="MSSIAAENDALVEPDIIESDIPISDKHAKNKKSSKGKSKGNYTS
                     IGSEDAPLTNAPSISIPMEGNIDGSGPPNNQIIADATGISRGTLDESVLDTLKRDIIE
                     INNRLKQVVYPHFPSSYALAGGVSQVNGGNSVDDLHAQSSDLWAPLTFVISYSLIVSH
                     AQSLFSSLFITCWFILLVLALHLRLTKPHQSMSLISYISLSGYCLFPLVIQALLTQTL
                     LPLLLRVALKGHTNLQVRINAILKLILISVCLMWATTAITLVTNAKGVVQVYPLALCL
                     FGLAWLSISL"
     gene            <226889..>227503
                     /gene="TPHA0D01080"
                     /locus_tag="TPHA_0D01080"
                     /db_xref="GeneID:11534410"
     mRNA            <226889..>227503
                     /gene="TPHA0D01080"
                     /locus_tag="TPHA_0D01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685135.1"
                     /db_xref="GeneID:11534410"
     CDS             226889..227503
                     /gene="TPHA0D01080"
                     /locus_tag="TPHA_0D01080"
                     /inference="similar to DNA sequence:INSDC:YGL200C"
                     /note="similar to Saccharomyces cerevisiae EMP24
                     (YGL200C); ancestral locus Anc_8.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685183.1"
                     /db_xref="GeneID:11534410"
                     /db_xref="GOA:G8BSC8"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8BSC8"
                     /translation="MFAQSLNLLVVAILYISSFASAHNVLLPANGRRCFYENLKKDDE
                     FTVSFQYGNRDSESNEELRGDLVIFGQNRNDILVSIRDVTYGEQTLTAPYTGKFEYCF
                     LNERSGVATKDVSFNIWGTKFVDVNDEDDTLEGSVRKLTRLINEVKNEQEYLILRERT
                     HRNTAESTNDRVKWWSIAQLGVVVVNTVFQIFYLKRFFEVTSIV"
     gene            complement(227772..227843)
                     /gene="TPHA0Dtrna2H"
                     /locus_tag="TPHA_0Dtrna2H"
                     /db_xref="GeneID:11531063"
     tRNA            complement(227772..227843)
                     /gene="TPHA0Dtrna2H"
                     /locus_tag="TPHA_0Dtrna2H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:11531063"
     gene            <230062..>231042
                     /gene="TPHA0D01090"
                     /locus_tag="TPHA_0D01090"
                     /db_xref="GeneID:11534267"
     mRNA            <230062..>231042
                     /gene="TPHA0D01090"
                     /locus_tag="TPHA_0D01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685136.1"
                     /db_xref="GeneID:11534267"
     CDS             230062..231042
                     /gene="TPHA0D01090"
                     /locus_tag="TPHA_0D01090"
                     /inference="similar to DNA sequence:INSDC:YEL029C"
                     /note="similar to Saccharomyces cerevisiae BUD16
                     (YEL029C); ancestral locus Anc_1.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685184.1"
                     /db_xref="GeneID:11534267"
                     /db_xref="GOA:G8BSC9"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8BSC9"
                     /translation="MKRVLATQSHVVYGYVGNKAATFPLQCLGWDVDCCNSVQFSNHT
                     GYGIDKVFGNVTSEKALDDLLRGVFINFPNSYSAFLTGYLPNKGTVRTMGKYYKKFKI
                     ENPNSLWVMDPVMGDEGQLYVNEDVIPEYKELIFNPDKLVDVITPNQYELEILYDKKI
                     NTFEELKTAFQSLHATIPIIVVTSCYSTLFNDPNHIYTVASIKGQEPVILRVPLIESY
                     FTGVGDLFSALLLDRLYEYKKDIIKGIRDDPRNLFEEKMNEVLNVIQNVLLITKKYAP
                     NSLKSVIGDATKMKDMELKIIQSKNVYDIQMKDRDARKDLHIHNFIFNAL"
     gene            <231436..>233298
                     /gene="TPHA0D01100"
                     /locus_tag="TPHA_0D01100"
                     /db_xref="GeneID:11534143"
     mRNA            <231436..>233298
                     /gene="TPHA0D01100"
                     /locus_tag="TPHA_0D01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685137.1"
                     /db_xref="GeneID:11534143"
     CDS             231436..233298
                     /gene="TPHA0D01100"
                     /locus_tag="TPHA_0D01100"
                     /inference="similar to DNA sequence:INSDC:YJR046W"
                     /note="similar to Saccharomyces cerevisiae TAH11
                     (YJR046W); ancestral locus Anc_1.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685185.1"
                     /db_xref="GeneID:11534143"
                     /db_xref="UniProtKB/TrEMBL:G8BSD0"
                     /translation="MNSKERRLPIIDLNKISDEQELLPIIRSILLRNDTFLIKNFANR
                     NIIDGLLDDLSQTLPDLNQGFDSNFTGTIKLPDYSDDIHVEQYIFNTDTTIQFNRECE
                     NIALRKLYNRLFRLSLFLSSVCLKSIGPEFEKLISEEAYSTKLTRYYLDSEYNRKVNE
                     NEDNRLDINDILPYDILVESMFSQTYELFNSSGIISIFPVASEIMYKPQTVSVSDNTN
                     WANVSDTDSILVHSGELLSILSGNLYTTSPLKINYGFNKLVHLTFYPPLSTPINYNGK
                     ETTVNDILFENQIKEFPIVADKFYKSKVMLNALVEKLNFYKRLFTTAEAVLSLYLLSK
                     STGASPELHSILPQMTNMMAAKITEESFLRMLSIWPEAYTLSNNSNQELTVDIPKLNP
                     LATLTSKSRKLDFVHHAEKWLQKHKTSEPIPSDVPILKYNKRRLSDSNTKKQKTPDLR
                     NGKTVENLKTSNLSSNDNNKRQYLHNTREELEFKEREVSSQSDLLKKIRAKSKRSEAL
                     LEQRQRQYEQFLAVKMRHILKIISSLPWDKPYTITSLTSLIVDSLQDSNNPIGLTETE
                     DILLRFQKLIPDMMGIYSVAGGLKVFKWSYLDKELVEKRLEDFKKIKTILVWNK"
     gene            complement(<233380..>234285)
                     /gene="TPHA0D01110"
                     /locus_tag="TPHA_0D01110"
                     /db_xref="GeneID:11531100"
     mRNA            complement(<233380..>234285)
                     /gene="TPHA0D01110"
                     /locus_tag="TPHA_0D01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685138.1"
                     /db_xref="GeneID:11531100"
     CDS             complement(233380..234285)
                     /gene="TPHA0D01110"
                     /locus_tag="TPHA_0D01110"
                     /inference="similar to DNA sequence:INSDC:YOR228C"
                     /note="similar to Saccharomyces cerevisiae YOR228C;
                     ancestral locus Anc_8.649"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685186.1"
                     /db_xref="GeneID:11531100"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:G8BSD1"
                     /translation="MIQQSDLKEVSPQPIANEGELPDDIVKDNSKKKKWLDFMQFSNS
                     QINIFTVLRYVQKTSVYPLAVYFPLHSINTFIVPAISPNYTPNEVLMMVREVLPSPEL
                     TTKMLVMSALVHTGSGFLIRVLNLWRNRKHPKQENTETFIHENSQDNSQKTIGLVGGV
                     SGFLLGLKKRFSIPPQVVSGYVLNTALAFHLLIMKFGPSLANIDIDFGYVKWILQNNE
                     KTTKWVFGIVPLATLITSGTYHILAGSCQYLNFKSLSSRRKWSDLITIMTVFGGVSLI
                     RLSTATSDIFGSRNYNAIFSALHLK"
     gene            <234669..>235715
                     /gene="TPHA0D01120"
                     /locus_tag="TPHA_0D01120"
                     /db_xref="GeneID:11531053"
     mRNA            <234669..>235715
                     /gene="TPHA0D01120"
                     /locus_tag="TPHA_0D01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685139.1"
                     /db_xref="GeneID:11531053"
     CDS             234669..235715
                     /gene="TPHA0D01120"
                     /locus_tag="TPHA_0D01120"
                     /inference="similar to DNA sequence:INSDC:YPL138C"
                     /note="similar to Saccharomyces cerevisiae SPP1 (YPL138C);
                     ancestral locus Anc_8.650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685187.1"
                     /db_xref="GeneID:11531053"
                     /db_xref="GOA:G8BSD2"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BSD2"
                     /translation="MDYVPLPSWCKAYSDVKLDKETNEELFCICKKPDNGDLMVGCDG
                     CDDWFHFSCVKIPLQYRELIAAFYCPYCQAGITGKSVEQPWGNHPIPKTMWKRKCRVE
                     SCFSPCKESSKYCSEAHGQEYIKNLVNRVQLMQTNGTVLDKEVVLTQLVELSENDREK
                     FKAYGTEGFIYQDVNKELNPELHSSLIENDSQLKDLESQISQIKEKTLPKIEKKIQIL
                     DEYIQWFKEVINAISGLGGSEQNQDNGTGASKKKKKSSKTPNTVKRICGYTSDLTNHP
                     TLEEFVAAYNPEEKYNFDICSNQRCQKHHDWAKMFGERYEQEKRSIEAFNERLALLIQ
                     MRKNNYIFNITREH"
     gene            <236199..>237554
                     /gene="TPHA0D01130"
                     /locus_tag="TPHA_0D01130"
                     /db_xref="GeneID:11534592"
     mRNA            <236199..>237554
                     /gene="TPHA0D01130"
                     /locus_tag="TPHA_0D01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685140.1"
                     /db_xref="GeneID:11534592"
     CDS             236199..237554
                     /gene="TPHA0D01130"
                     /locus_tag="TPHA_0D01130"
                     /inference="similar to DNA sequence:INSDC:YOR229W,YPL139C"
                     /note="similar to Saccharomyces cerevisiae WTM2 (YOR229W)
                     and UME1 (YPL139C); ancestral locus Anc_8.651"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685188.1"
                     /db_xref="GeneID:11534592"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BSD3"
                     /translation="MDNTSINKVKNEEFKIWKKTVPSLYNHITTRKPIYLSPQVNHSV
                     NNFSKIKKTICFTDKVIPQKDSGILETSVLYSQGYEVFELGFELPLGAYAKSSERITD
                     PKFNCDDKTTTTPLSAKWSYQGETISKLEYLNVGETTAIAMANTGSLAWFKDGLKVPI
                     HAMQEIIGPGTSLSSIHSAKGGPSDINDFSISLDDETIIKTQSLSDNGSIIKLIDNAA
                     KPGTVLRSINVSKECITHTIKYIDNNMFVTCSSDNIIRFWDTRGDDKPMFVLQDSKDG
                     LLTSLDTTPLIDSLFITGSDTGVIKLWDVRQVLAETNDLSYRQHGEDPVHQELFRFTQ
                     SGDDGVSDVHFSKTSLEDFLTVGSSGNVYTWSLSPVLSGAEEAKDQDAMDVDTLNIDS
                     LKFFHAGGNRNKKVDKSATSKRNTVAWHPVINDVVTTVEDDGLVTVYKPYLGRDFDDK
                     E"
     gene            <238656..>240524
                     /gene="TPHA0D01140"
                     /locus_tag="TPHA_0D01140"
                     /db_xref="GeneID:11534253"
     mRNA            <238656..>240524
                     /gene="TPHA0D01140"
                     /locus_tag="TPHA_0D01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685141.1"
                     /db_xref="GeneID:11534253"
     CDS             238656..240524
                     /gene="TPHA0D01140"
                     /locus_tag="TPHA_0D01140"
                     /inference="similar to DNA sequence:INSDC:YOR233W,YPL141C"
                     /note="similar to Saccharomyces cerevisiae KIN4 (YOR233W)
                     and YPL141C; ancestral locus Anc_8.654"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685189.1"
                     /db_xref="GeneID:11534253"
                     /db_xref="GOA:G8BSD4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BSD4"
                     /translation="MEPGLIQSDDPRTPCRSPVPNEGNSTSNYETPITQRPRSRSVHY
                     QHSSRKKKQPRFGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQ
                     VAIKLIRRDTLSASKESEIKLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASG
                     GEFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLIT
                     DFGFVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYL
                     PWDDDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPAKRMSMKHIL
                     QHAWITPHQVFLSVTTEEWDRSFIVKKSNPSTPSSDRTAPTQNRLSRYTCSNNNSSMS
                     IRNHRAPRPHSTTFLDIKRDSLIIDSTLFNMPLPPKESQFNATSNSSKTSLSSNTSVP
                     TTTCSAISSSGNASSNKHSHHTRTNSAASIALQAVVNSDRENHILKDITNTIHDTGTV
                     QNSKKTARKYRPMSYHPDMSTLTEYSKHYLADKIYAQREDSIDEEAQTTESTNNTEDI
                     ENTNPKISTVMEYPTRPLNNRQNTSRTPLTHHGGTDAGRSTTKKLFDFIKRRSIRI"
     gene            <241865..>243202
                     /gene="TPHA0D01150"
                     /locus_tag="TPHA_0D01150"
                     /db_xref="GeneID:11534613"
     mRNA            <241865..>243202
                     /gene="TPHA0D01150"
                     /locus_tag="TPHA_0D01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685142.1"
                     /db_xref="GeneID:11534613"
     CDS             241865..243202
                     /gene="TPHA0D01150"
                     /locus_tag="TPHA_0D01150"
                     /inference="similar to DNA sequence:INSDC:YOR237W,YPL145C"
                     /note="similar to Saccharomyces cerevisiae HES1 (YOR237W)
                     and KES1 (YPL145C); ancestral locus Anc_8.658"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685190.1"
                     /db_xref="GeneID:11534613"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:G8BSD5"
                     /translation="MSQIANSSSWTSFLKSISSFNGDISSLTAPPFILSPTSLSEFSQ
                     YWAEHPDLFLEPSFINNDNFKDLFKDVDPEIESPEVARMLSVTKWFISTLKSQYCSRN
                     ESMGSEKKPLNPFLGELFVGKWENNTNKEKFGETVLLSEQVSHHPPMTAYTIFNDKNN
                     VRLQGYNQIKATFSKTLMLGVKQFGHTIYELGGDIDEQYLITVPPLHIEGILAASPFV
                     ELEGKTFIQSSTGYLAVIEFSGRGYFSGKKNTFKARIYNDSVSYKKNKENALYTISGQ
                     WSGTSTIVKKSETTSSKDEAPVFYDASRDPIDPLTVKPLENQHPLESRKAWSVVAEAV
                     KSGDFDLIVKTKTELEDAQRELRKEEEANGIEWKRRWFQSVDYAEGADEDKAIIPDDD
                     DIFAKLAEKIQLSTKNVPSGTMVGDKEDKKEGLSSQHWRFNRNAWDNEKEIAL"
     gene            <243973..>245331
                     /gene="TPHA0D01160"
                     /locus_tag="TPHA_0D01160"
                     /db_xref="GeneID:11530948"
     mRNA            <243973..>245331
                     /gene="TPHA0D01160"
                     /locus_tag="TPHA_0D01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685143.1"
                     /db_xref="GeneID:11530948"
     CDS             243973..245331
                     /gene="TPHA0D01160"
                     /locus_tag="TPHA_0D01160"
                     /inference="similar to DNA sequence:INSDC:YPL146C"
                     /note="similar to Saccharomyces cerevisiae NOP53
                     (YPL146C); ancestral locus Anc_8.659"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685191.1"
                     /db_xref="GeneID:11530948"
                     /db_xref="InterPro:IPR011211"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:G8BSD6"
                     /translation="MAPSTSMSRPSQYKQSSRKGKKAWRKNIDLSDIEKAVAEKNEFE
                     ISHGTKDLSDLKDDTLFAVDTVGNTELKEKLIKRKQIKKNLKSREILDAIQTNSKVPA
                     LNHPRFNKSSNENSKKNKIQGVSKKEISRLMAMAGRVQGESVAKNMMAKDGLIKSGTN
                     DLWGDEPKKKISLPSGIELDSKLKDQIPEELLNQSTTSWSKPTTKPVTMDLAPIQVKE
                     FADMPHAGKSYNPNTKDWENLISNEFDKEMVKEEKRVALEEYRARISHLIEVLDDNEE
                     ESSDEDENENTKEVSADEEDEEDLLKLSVNPVVRNKKKTKQQRNKAKKHQEKVRLQEE
                     LKKLREQVRKLEDIESLNEDVEIDDQLKNSLKENAVNAPKMNKRNRLGTKYSVIEASV
                     DVKFKDELSDSLRKLRPEGNLLYDTVRKLQSTGKLEARVRKTRPQRKNKITEKWTYKD
                     FK"
     gene            complement(<245675..>248422)
                     /gene="TPHA0D01170"
                     /locus_tag="TPHA_0D01170"
                     /db_xref="GeneID:11534414"
     mRNA            complement(<245675..>248422)
                     /gene="TPHA0D01170"
                     /locus_tag="TPHA_0D01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685144.1"
                     /db_xref="GeneID:11534414"
     CDS             complement(245675..248422)
                     /gene="TPHA0D01170"
                     /locus_tag="TPHA_0D01170"
                     /inference="similar to DNA sequence:INSDC:YPL147W"
                     /note="similar to Saccharomyces cerevisiae PXA1 (YPL147W);
                     ancestral locus Anc_8.661"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685192.1"
                     /db_xref="GeneID:11534414"
                     /db_xref="GOA:G8BSD7"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSD7"
                     /translation="MSKSDSRKKLKDLLINLHQGCIEFDITTSSNSLLSFRSYYKTLL
                     LHLVDVIKSPTRTPKLRNRAIMILLTIILSGITLSTTVSYTGYKIIQVFKNLIVNSYS
                     RNGRNGKPVLRRTRSQMMLDTGARVMYIHEDNNMNLVGSNRDITLNSKLGNISGMART
                     NLNNIKQSFKKIFIPPRDEDLFEHDKFLFKNVEMGKLKKSQLFYSKFLSQLSVLSKIL
                     IPTIVDKNSILLFLQIFFLILRTYLSLLVARLDGRIVRDIISGRLKNFIVDIGYWFLI
                     AFPASYTNAAIKLLQRKLSLNFRVNLTRYIHDLYLDKKLSFYKIIFDYNANSSIIKNI
                     DNSITNDIAKFCDASTSIFANIAKPVIDLIFFSVYLRDNIGSIGVAGIFINYFVTGYI
                     LRAFAPPLGRLASDMSASDGDYYNYHLNLINNCEEISFYQGTNVETTKVKQLYYILMD
                     KMLIMDKSKFNYNMIEGYILKYTWSGLGYVFASFPIIFTTIASGINSEEQNMKQFIVN
                     KRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLISTLHRVHSNDFAYGAYIVGSNGT
                     GSMENLTGAQSKSFNLKADKVSSSINSSDSTVIRGTIQKNFNGLRFENIDVIIPSTKG
                     QLGSKLIKKLTFQIPPFIAPISSMKINSLQDLNTSLSKLNISNKNSIYDMTLPFSYGP
                     GSSLLILGPNSCGKSSIQRIIAEIWPIYNKNGLMSIPAEDELMCIPQRPYFSKGGTFR
                     DQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKRDKGWSYFDAVFDWKDVLSGGE
                     KQRMNFARILFHKPRFVILDEATNAISVDMEDYLFKMLKKYRFNFISISQRPSLVKYH
                     DLLLEISEDKEGTWTLQTLGTDEAISSIDNEIEELEAKLMKVQVWEEERRELQKRLEV
                     I"
     gene            <249451..>250158
                     /gene="TPHA0D01180"
                     /locus_tag="TPHA_0D01180"
                     /db_xref="GeneID:11531119"
     mRNA            <249451..>250158
                     /gene="TPHA0D01180"
                     /locus_tag="TPHA_0D01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685145.1"
                     /db_xref="GeneID:11531119"
     CDS             249451..250158
                     /gene="TPHA0D01180"
                     /locus_tag="TPHA_0D01180"
                     /note="ancestral locus Anc_8.663"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685193.1"
                     /db_xref="GeneID:11531119"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BSD8"
                     /translation="MSTSQLRNGPSLFEPIVPSIEPLQFKLKIDSDKAVTAFPIYNAG
                     EIPESLLDFMHNMFNEEILRGDTYPYFNVLTKEEFVNYWFSSFTAILLNTDNTSLLVD
                     LVANKSEKDVTYWNEMLLGTFYIKPNYSGRCSHNCNAGFLVNYHQRGQKIGYRLGQIY
                     LQWGHLLGYKYSIFNLVFVTNVGSWKIWDKLEFDRIGLVPRAAILKGYDEPVDAIIYG
                     RDLTSVKEELLNDFYKV"
     gene            <250654..>251931
                     /gene="TPHA0D01190"
                     /locus_tag="TPHA_0D01190"
                     /db_xref="GeneID:11534445"
     mRNA            <250654..>251931
                     /gene="TPHA0D01190"
                     /locus_tag="TPHA_0D01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685146.1"
                     /db_xref="GeneID:11534445"
     CDS             250654..251931
                     /gene="TPHA0D01190"
                     /locus_tag="TPHA_0D01190"
                     /inference="similar to DNA sequence:INSDC:YOR239W"
                     /note="similar to Saccharomyces cerevisiae ABP140
                     (YOR239W); ancestral locus Anc_8.665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685194.1"
                     /db_xref="GeneID:11534445"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BSD9"
                     /translation="MAVAELIKKFEEISKDVEATQENLEKVVCDEQTDEISENTENSN
                     SNEEINTFNCDVDEVPTNNISEDLGADLKGAEVVENDNKLTTEEQNAMAQDIKEEILN
                     AVAHDSSNVADKFENENEIVTNENNSRIGRDEPFEFGKRQLTESSDVWDHNAWDNVEW
                     GEDQVKEAQAKIELQYENPVSDFDKALFNKNPARYWDIFYKNNKENFFKDRKWLQIEF
                     PSLYAATKKDAGPVTIFEIGCGAGNTFFPILTENENEHLRIIAADFAPKAVELVKSSE
                     QFNPKYGHAAVWDLANSDGALPDGVEEHSVDIAVMIFVFSALAPNQWQQALDNLKKVL
                     KPGGKILFRDYGRYDLAQVRFKKNRLLDDNFYVRGDGTRVYFFTEEELREIFTKKYFI
                     ENKIGTDRRLLVNRKRQLKMYRCWLQAVFEVPE"
     gene            complement(<252099..>252986)
                     /gene="TPHA0D01200"
                     /locus_tag="TPHA_0D01200"
                     /db_xref="GeneID:11534444"
     mRNA            complement(<252099..>252986)
                     /gene="TPHA0D01200"
                     /locus_tag="TPHA_0D01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685147.1"
                     /db_xref="GeneID:11534444"
     CDS             complement(252099..252986)
                     /gene="TPHA0D01200"
                     /locus_tag="TPHA_0D01200"
                     /inference="similar to DNA sequence:INSDC:YPL149W"
                     /note="similar to Saccharomyces cerevisiae ATG5 (YPL149W);
                     ancestral locus Anc_8.666"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685195.1"
                     /db_xref="GeneID:11534444"
                     /db_xref="GOA:G8BSE0"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="UniProtKB/TrEMBL:G8BSE0"
                     /translation="MDEIRELVWNGGLNLQISLHPSAMVVNHLKDPIITNIRVPRDCY
                     IVFYMKVILKRFRNYLNLNINESNKDCFFWFEYENVPLYWNFPIGALYDTMTNIMPND
                     REEILLDRNDHLNIWKLELHCGTKIPNGLIPIIDEEEQIRRYWMHQWKQACYILNGSS
                     KKVMSFSMKDWQKFWDSVKKRNLSDFNDLAMKVRPSHPRNVPVIIHLNYPNLQKKLPF
                     IKIDHDADNGHPTVFNVLNSEYPEIFKSKNSSEVQCVCNGVIIPLEILIFELYKRFLN
                     FDGFLHLSICFSSNNNQFN"
     gene            complement(<253331..>254425)
                     /gene="TPHA0D01210"
                     /locus_tag="TPHA_0D01210"
                     /db_xref="GeneID:11531091"
     mRNA            complement(<253331..>254425)
                     /gene="TPHA0D01210"
                     /locus_tag="TPHA_0D01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685148.1"
                     /db_xref="GeneID:11531091"
     CDS             complement(253331..254425)
                     /gene="TPHA0D01210"
                     /locus_tag="TPHA_0D01210"
                     /inference="similar to DNA sequence:INSDC:YOR242C"
                     /note="similar to Saccharomyces cerevisiae SSP2 (YOR242C);
                     ancestral locus Anc_8.670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685196.1"
                     /db_xref="GeneID:11531091"
                     /db_xref="UniProtKB/TrEMBL:G8BSE1"
                     /translation="MLTYSYNLYPNNFSSDNRSNDITNFRGINNRNYELSNVSTTKFN
                     FLNNAKNYELIGFRRLAKNYLGRTSRHLRRKPSTNFRNNYRIDRAKQESNIVPSIVYF
                     ESRQDEEGNVENKNAINIPNLYKSKPVDSQLSSLSSDSQSPLSSPVGQYKTSLDSSIN
                     PTRVIYIRDIPSNVSMKSIISQIYGGPLESLKLIKHDESRSRNQDMELVFLKKADATN
                     FLRYSRTHLFHINGKRLYSEPGSNNNLLNSNKAFDSTINNNISRTLIMKRYNKTTEKQ
                     EQVSKEFLIDYFDIEEVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKAYD
                     DPYSEFHKKYSEEWVVWYGKDVTDRSCVEI"
     gene            complement(<254846..>256894)
                     /gene="TPHA0D01220"
                     /locus_tag="TPHA_0D01220"
                     /db_xref="GeneID:11534449"
     mRNA            complement(<254846..>256894)
                     /gene="TPHA0D01220"
                     /locus_tag="TPHA_0D01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685149.1"
                     /db_xref="GeneID:11534449"
     CDS             complement(254846..256894)
                     /gene="TPHA0D01220"
                     /locus_tag="TPHA_0D01220"
                     /inference="similar to DNA sequence:INSDC:YOR243C"
                     /note="similar to Saccharomyces cerevisiae PUS7 (YOR243C);
                     ancestral locus Anc_8.671"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685197.1"
                     /db_xref="GeneID:11534449"
                     /db_xref="GOA:G8BSE2"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR017091"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="InterPro:IPR020119"
                     /db_xref="UniProtKB/TrEMBL:G8BSE2"
                     /translation="MSESELHDKRPQPDAVGEDDAQTKRFKSDNQQESMTQDLSIREP
                     DVGITGFVSLDHSGFIGQIKQRYTDFLVNEIGLDGKVVHLNDKGFNIPKKPKPSQEEK
                     QKKREEEAAQRAQFQLDPELRKQLVDMLDEEDVQKIECVFKEAQTMETKKFFDDKTDR
                     TNLHILLRKAFNNELESVTTETNTFKIARNNRNSRVNKQILTEQNKDANGVENWGYGP
                     SKEFIHFTLHKENKDTMQAVNLICKFLRIPTKMIRYAGTKDRRGVTVQRLSISKIKLD
                     RLNALNKTLRGMLIGGYEFKDESLNLGDLSGNEFIITIRDVKTKESSTDSLEDTLSKG
                     CESINKNGFINYFGMQRFGTFSISTHVVGRELLMENWEKAANLILSDQENVLPKSKEA
                     RQYWEKTKDAAGTLKIMPHDCMAEKALLYSLASQEKESSGDYSSNSYYIAIMKIPRNL
                     RTMYVHAYQSFIWNAVASKRLASFGPKPIVGDLVISEEEQSRVTVEEDSNEFEEDTNQ
                     AKFIRARPLTSEDIESGKFTIADIVLPTPGFDIKYPENPELYKAYVDLLAQDNMDPTN
                     MRRKVRDFSMAGSYRNVIHIPQEMEYKIVKYKESTQQLVNTDLEMLNNKRAKDNSQKY
                     MKDKLERYMPDKGGDKTAVVIKFKLGVSAYATMLLRELMKLETSRRGDMCDVSVSDST
                     "
     STS             255159..255514
                     /standard_name="STS-Z40732"
                     /db_xref="UniSTS:82848"
     gene            <257551..>258912
                     /gene="TPHA0D01230"
                     /locus_tag="TPHA_0D01230"
                     /db_xref="GeneID:11534427"
     mRNA            <257551..>258912
                     /gene="TPHA0D01230"
                     /locus_tag="TPHA_0D01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685150.1"
                     /db_xref="GeneID:11534427"
     CDS             257551..258912
                     /gene="TPHA0D01230"
                     /locus_tag="TPHA_0D01230"
                     /inference="similar to DNA sequence:INSDC:YOR244W"
                     /note="similar to Saccharomyces cerevisiae ESA1 (YOR244W);
                     ancestral locus Anc_8.673"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685198.1"
                     /db_xref="GeneID:11534427"
                     /db_xref="GOA:G8BSE3"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="UniProtKB/TrEMBL:G8BSE3"
                     /translation="MSPPTEEKREGIPRKVETVEEILIKCECWVKKDNEERLAEILSI
                     NSRRSPPKFYVHYVDFNKRLDEWITTDRINLEKDVIFARPKEIEEEQTPKKKLKKRKK
                     QSGAGQETTSAVASDDEKIKSETPESTGVMDLDNLNVQGLRDEEITREEEIKKLRTSG
                     SMTQNPHEVARVRNLSKVIMGMYEIEPWYFSPYPIELTDLDTIYIDDFTLEYFGSKKQ
                     YERNRKKSTLRHPPGNEIYRDDFVSFFEIDGKKQRTWCRNLCLLSKLFLDHKTLYYDV
                     DPFLFYCMTRKDELGHHLVGYFSKEKESAEGYNLACILTLPQYQRMGYGKLLIQFSYE
                     LSKIEGKVGSPEKPLSDLGLLSYRAYWAEVLINTLVEHSNEITIDEISSITSMTTTDI
                     LHTAKTLNILRYYKGQHIIFLSQEVLDKYNQMKEKKRRSINPQYLNWVPPVFTAAQLR
                     FAW"
     gene            complement(<259089..>260168)
                     /gene="TPHA0D01240"
                     /locus_tag="TPHA_0D01240"
                     /db_xref="GeneID:11534460"
     mRNA            complement(<259089..>260168)
                     /gene="TPHA0D01240"
                     /locus_tag="TPHA_0D01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685151.1"
                     /db_xref="GeneID:11534460"
     CDS             complement(259089..260168)
                     /gene="TPHA0D01240"
                     /locus_tag="TPHA_0D01240"
                     /inference="similar to DNA sequence:INSDC:YPL152W"
                     /note="similar to Saccharomyces cerevisiae RRD2 (YPL152W);
                     ancestral locus Anc_8.674"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685199.1"
                     /db_xref="GeneID:11534460"
                     /db_xref="GOA:G8BSE4"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:G8BSE4"
                     /translation="MLPQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDY
                     TLPISQPVESMMKLLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKE
                     CFPSLTDSQIEQLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATN
                     LVLKVFIQYLKLMRVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKHLKPSS
                     IHNDDLIEMFADKYLYFGCIEFINSVKTTTTLRWHSPMLDDISGVKKWSKVAEGMFKM
                     YEAEVIKKLPIMQHFYFNDMFLICPENVSPPREHIHDGGEEDECLAEGHAHSTYGDCC
                     GIKVPSAIAASQINAMNKNKPLPFD"
     gene            complement(<260455..>261549)
                     /gene="TPHA0D01250"
                     /locus_tag="TPHA_0D01250"
                     /db_xref="GeneID:11530953"
     mRNA            complement(<260455..>261549)
                     /gene="TPHA0D01250"
                     /locus_tag="TPHA_0D01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685152.1"
                     /db_xref="GeneID:11530953"
     CDS             complement(260455..261549)
                     /gene="TPHA0D01250"
                     /locus_tag="TPHA_0D01250"
                     /inference="similar to DNA sequence:INSDC:YOR245C"
                     /note="similar to Saccharomyces cerevisiae DGA1 (YOR245C);
                     ancestral locus Anc_8.675"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685200.1"
                     /db_xref="GeneID:11530953"
                     /db_xref="GOA:G8BSE5"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:G8BSE5"
                     /translation="MMKHDNISLRLRSSVVKTDVPIINTLHCDINTPLQRRLQTLACA
                     WHITSMGMFSVLFLLLIAFPRFWIVIIPYMVYYMFDRSPADGNVVKRYSPFFRSLLLW
                     KYYCNYFPISLHKTVDLEPTFNENGERVGPKYIFGYHPHGIGALGAFGAFATEGCNYS
                     SLFPGIPISLMTLVTQFHIPIYRDYLMALGITSVSRKNALKVLGNDQSICIVIGGAME
                     SLLCQVNKVDLVIKKRKGFVKLAITSGNTHLVPVFSFGETNSYKIIQTKDGSFLRNIQ
                     LWIKETFSFTIPFFYARGVFNYDFGLLPFRTPMNIVVGKPIIIKEFTTDPSNEMVDYY
                     HDLYVEELKKIYYDNKDKYGFKNVELNLAD"
     gene            <262523..>263782
                     /gene="TPHA0D01260"
                     /locus_tag="TPHA_0D01260"
                     /db_xref="GeneID:11534266"
     mRNA            <262523..>263782
                     /gene="TPHA0D01260"
                     /locus_tag="TPHA_0D01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685153.1"
                     /db_xref="GeneID:11534266"
     CDS             262523..263782
                     /gene="TPHA0D01260"
                     /locus_tag="TPHA_0D01260"
                     /inference="similar to DNA sequence:INSDC:YPL154C"
                     /note="similar to Saccharomyces cerevisiae PEP4 (YPL154C);
                     ancestral locus Anc_8.677"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685201.1"
                     /db_xref="GeneID:11534266"
                     /db_xref="GOA:G8BSE6"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G8BSE6"
                     /translation="MLLQLSQLLPLALLLLGASDVVEGKKFTSKIYKRDINNEQLKDF
                     TFKEQIQQLGMKYLRNFEKFNPEVQFQANHPFGQNVFSTNPLNEGGSHNVPLSNYLNA
                     QYYTDISLGTPKQNFKVILDTGSSNLWVPSKDCTSLACYLHSKYDHDESTTYEKNGTK
                     FTIQYGSGSMDGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYDT
                     IAVNKVVPPFYNAIKQGILDENKFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDITWL
                     PVRRKAYWEVKFDSIALGDEVASLDGYGAAIDTGTSLITLPSGLAEVINTQIGAKKSW
                     SGQYTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMSGSCISAITPMDFPEPVGPLA
                     IIGDAFLRKYYSIYDLDNNAVGLAKSI"
     gene            <264339..>266429
                     /gene="TPHA0D01270"
                     /locus_tag="TPHA_0D01270"
                     /db_xref="GeneID:11534392"
     mRNA            <264339..>266429
                     /gene="TPHA0D01270"
                     /locus_tag="TPHA_0D01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685154.1"
                     /db_xref="GeneID:11534392"
     CDS             264339..266429
                     /gene="TPHA0D01270"
                     /locus_tag="TPHA_0D01270"
                     /inference="similar to DNA sequence:INSDC:YPL155C"
                     /note="similar to Saccharomyces cerevisiae KIP2 (YPL155C);
                     ancestral locus Anc_8.678"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685202.1"
                     /db_xref="GeneID:11534392"
                     /db_xref="GOA:G8BSE7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8BSE7"
                     /translation="MFPPQSPSLRSVGSFNNLKKGNRFGTTSTTTTRSSSPIRSVSSH
                     SDGQYHHSIKSRIIRNNPNSNQQTHEAYTGKIIVAIRPKPISNNEKKVWNIVDNKRIA
                     HDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSG
                     TQEDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLLDTNVEGVNFG
                     YSSNLQTPPRFGNSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNK
                     KISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSEKATSQQERRKEG
                     AFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPAL
                     SGNSIITTICTVDIRSDASSETLNTLRFASRAKNVSLHVTKKQNVSKDEEKDKLIFTL
                     IQQLEEQKKLIDDMNVNKMSGNVLNFEKHAVPFANEMVANANSGPNNNIDTSRTEKSN
                     IVDPSYALLESENKVLKFKLEHCENLLDKDIVELQDRQMINIVEMLPDGVGTLLEMKF
                     QGLESQIRQYKLYTANLEKRLASNKNDENRHNSGSNMVIPINSAQGSRIASNNSDISM
                     ADNCSEEDPYDIIRHKEEEIKELKKGLERKDKMIEALQSARRLRHRALKPLAEANLLY
                     ENEQENRGFNNLER"
     gene            complement(<266603..>267553)
                     /gene="TPHA0D01280"
                     /locus_tag="TPHA_0D01280"
                     /db_xref="GeneID:11530980"
     mRNA            complement(<266603..>267553)
                     /gene="TPHA0D01280"
                     /locus_tag="TPHA_0D01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685155.1"
                     /db_xref="GeneID:11530980"
     CDS             complement(266603..267553)
                     /gene="TPHA0D01280"
                     /locus_tag="TPHA_0D01280"
                     /inference="similar to DNA sequence:INSDC:YPL157W"
                     /note="similar to Saccharomyces cerevisiae TGS1 (YPL157W);
                     ancestral locus Anc_8.680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685203.1"
                     /db_xref="GeneID:11530980"
                     /db_xref="GOA:G8BSE8"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BSE8"
                     /translation="MGEKRLRPRGKKIDASHFLHIKKRKYKTQYQLLKKLYKDDCFKI
                     DTSAPLQEKAMKKYWNHRDKLFSKIDSLPIYMTHELWFSVTPELIAKFIAKYVRACLP
                     AATKVLDVFCGGGGNTIQFAKLFPKVYGVDFSIDHLYCTYRNAQSYGLADRIWLKYGS
                     WTQMVKKGKIQQLGIDCIFGSPPWGGPLYLKSKEYDLENSLLPVGLTELLEGFRSVSE
                     NIILFLPKNSQLSQIAMATRKVFGVTKKCKIIHVLQNGFSKGLFCIWGDALINYETED
                     GGERDNFNKASTSHNTETNEEPTNDKGKAQTYDLNYDIDG"
     gene            <268062..>268718
                     /gene="TPHA0D01290"
                     /locus_tag="TPHA_0D01290"
                     /db_xref="GeneID:11534281"
     mRNA            <268062..>268718
                     /gene="TPHA0D01290"
                     /locus_tag="TPHA_0D01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685156.1"
                     /db_xref="GeneID:11534281"
     CDS             268062..268718
                     /gene="TPHA0D01290"
                     /locus_tag="TPHA_0D01290"
                     /inference="similar to DNA sequence:INSDC:YPL159C"
                     /note="similar to Saccharomyces cerevisiae PET20
                     (YPL159C); ancestral locus Anc_8.682"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685204.1"
                     /db_xref="GeneID:11534281"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:G8BSE9"
                     /translation="MFKVIGKGKVGQIGLSQVRFQSSITFLTNQNLLNKNTRNNNNNA
                     TNTNAGASGSSKTATGTGISKTGVATKGLQMSGGLSGKSLADKKVLDYSWLPKVPQTS
                     SITHREITTNSLYSGYRPLFIDNKKGTLLGDVNSTAQDANSSIYEFAMKLNELSEPSP
                     WMMSATGLESYSEWDYVPSKVIKKLKPYDLSIKENDTLNNIGAENQLARTQKNVNKKN
                     "
     gene            <269989..>271365
                     /gene="TPHA0D01300"
                     /locus_tag="TPHA_0D01300"
                     /db_xref="GeneID:11531014"
     mRNA            <269989..>271365
                     /gene="TPHA0D01300"
                     /locus_tag="TPHA_0D01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685157.1"
                     /db_xref="GeneID:11531014"
     CDS             269989..271365
                     /gene="TPHA0D01300"
                     /locus_tag="TPHA_0D01300"
                     /inference="similar to DNA sequence:INSDC:YPL161C"
                     /note="similar to Saccharomyces cerevisiae BEM4 (YPL161C);
                     ancestral locus Anc_8.685"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685205.1"
                     /db_xref="GeneID:11531014"
                     /db_xref="UniProtKB/TrEMBL:G8BSF0"
                     /translation="MTSVTVDGACVMRCLIKGNEDALRTNTLAIQNILDIQFLKQHLD
                     DISILKLLLNNTNNTKFQLILQQSTLVEDILTQIFDFTIRISKEKLCYPHLIYNRMVI
                     EKSDFGYVNESTMPIQKELEVAYLSSMCLVEASENNPYICIAICKFINDSEVLLAGIK
                     DLINTKLAIKFNIIFYDNQPRTWILKFLKRLLTLTLNKQQSKHIPTDAITEFLKRFEY
                     ILVKEFDHAINNYYNDISYSILVFKTIVLAHSSTLYNFDFNACNLIKLSNLLRILSNT
                     INDESNCLEIESDTEEENLDIIFFFEALSIISELLSDKSFISNLLISKGHDEFISIFR
                     TMQYDLLISISNLEEKEVTSKITIIRKMLPLIKNISGHESYDADKDVGMCLLNLSKNI
                     KNPYTLTSYFIILSSILQLPSSKATENIHNIELFEYLRMTINFRDNIQLEYFNTFTQL
                     YLSRDTIN"
     gene            <272057..>272941
                     /gene="TPHA0D01310"
                     /locus_tag="TPHA_0D01310"
                     /db_xref="GeneID:11531079"
     mRNA            <272057..>272941
                     /gene="TPHA0D01310"
                     /locus_tag="TPHA_0D01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685158.1"
                     /db_xref="GeneID:11531079"
     CDS             272057..272941
                     /gene="TPHA0D01310"
                     /locus_tag="TPHA_0D01310"
                     /inference="similar to DNA sequence:INSDC:YPL162C"
                     /note="similar to Saccharomyces cerevisiae YPL162C;
                     ancestral locus Anc_8.686"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685206.1"
                     /db_xref="GeneID:11531079"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="UniProtKB/TrEMBL:G8BSF1"
                     /translation="MIIRKGDEDEDTCQLLGPVSIGIQVIMGAWIVMSLLMKRNYEHP
                     KRKLIVWTYDVSKQLIGSLLVHFLNLFISVVQEHKANLTFSLNIGDNGSGDEDDQCDY
                     YFLNLLLDTTIGIPIFWVAFTCIEKLFSYYNFKNIESGNYFTTEGAAVGKTSEKPSFV
                     AFLKQLNIFTSGLIVMKLVIFLVLYYFEEFAYWLANMLLGWSDPWPNFQIFLVMFISP
                     IALNLFQYYCVDNIIKLHSDHLTQQNAHNFEPITAVEDNAATDYINSISCQNSMMPGQ
                     SPAYDNDSSNKNSKYGSI"
     gene            <274166..>274816
                     /gene="TPHA0D01320"
                     /locus_tag="TPHA_0D01320"
                     /db_xref="GeneID:11534428"
     mRNA            <274166..>274816
                     /gene="TPHA0D01320"
                     /locus_tag="TPHA_0D01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685159.1"
                     /db_xref="GeneID:11534428"
     CDS             274166..274816
                     /gene="TPHA0D01320"
                     /locus_tag="TPHA_0D01320"
                     /inference="similar to DNA sequence:INSDC:YOR247W,YPL163C"
                     /note="similar to Saccharomyces cerevisiae SRL1 (YOR247W)
                     and SVS1 (YPL163C); ancestral locus Anc_8.687"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685207.1"
                     /db_xref="GeneID:11534428"
                     /db_xref="UniProtKB/TrEMBL:G8BSF2"
                     /translation="MQFQILHSLFLLVALTSAKGLYSNSTVDAVAEAADLAVSEEYSA
                     TTTTLSPSFSVVPSVVVSTYSDLTTTVQITNTIYNTVYYTINAISSSLSNAAGSAAST
                     TSYGGGYTSTTVTSTMKVTVTLDAVEVANLNKELNAIENGYLSSYAASNVYYSNATTT
                     ADACAPVTEYVTITADPITNFVTVTPEPVTEYVTLTASGFNSTSVNGTASVNGTLY"
     gene            <275319..>277601
                     /gene="TPHA0D01330"
                     /locus_tag="TPHA_0D01330"
                     /db_xref="GeneID:11534565"
     mRNA            <275319..>277601
                     /gene="TPHA0D01330"
                     /locus_tag="TPHA_0D01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685160.1"
                     /db_xref="GeneID:11534565"
     CDS             275319..277601
                     /gene="TPHA0D01330"
                     /locus_tag="TPHA_0D01330"
                     /inference="similar to DNA sequence:INSDC:YPL164C"
                     /note="similar to Saccharomyces cerevisiae MLH3 (YPL164C);
                     ancestral locus Anc_8.688"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685208.1"
                     /db_xref="GeneID:11534565"
                     /db_xref="GOA:G8BSF3"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028830"
                     /db_xref="UniProtKB/TrEMBL:G8BSF3"
                     /translation="MSCVMHKLDPTVSTKLRAQQHITSVPSVVRELLHNSADAKATQI
                     KIVVDFKKSMVYVQDNGNGIQPDNLETVGKLNYTSNITTLNDIKENDKYGFRGEALYH
                     IASVSHVKVISKSKDYNSTWIKSLNDNTCGIYSGEGGGHFSIHDSGTIILIEDLFYNV
                     PVRQTMLSKYSEPSLILQIKNDIFQVSIANPMIDIIVYDVTGSTEELTYKDTKSSYVL
                     IDMKPSLCKNRKLNTSQIFFNSYMNIYDSSFSKSNIKQINIKFRDYVLEGIISRSGTS
                     YKNRKFIYINGRRYINNVFLRSIDNIFQSVGFGSNNDDNVFLNSSKRKQYSKYPIIIL
                     NVKCKLELSDYIQDPTKQFINLSKKDIIEPLIYEAINTFLIRQGYTPSNVKTISDMSS
                     EKLGDISPRKSNQSLSLAAPEYGDISLNIIFNSKVTTNKITKTELRGRYKVSQTMHKS
                     TQHFINIRNILQKRNQIDSLQDSSYFSNINKKENKIHLASNKIEPGFNLQQYVTSLNQ
                     KFQLDKLHLDDLQVINQIDNKFILTILPDMNVRTNYSLIILDQHACDERIKLEQYLNE
                     YIKGVINKDIDLEVTKNININISKNDASLCNYFKNEFECWGIIFEIDDAYPNSPLLKI
                     LKLPKDLITNKYCDLDYLRTALLAHTHDLQKSVKSKIRPKLSHNKFVDWYLYLNYVPD
                     FVLDLFNTKACRSAIMFGDPLSKNECSVVVKLLSNCHFPFKCAHGRPSIFPLIQCKLD
                     EESFNISLKTSLWNEDYKIT"
     gene            complement(<277699..>279591)
                     /gene="TPHA0D01340"
                     /locus_tag="TPHA_0D01340"
                     /db_xref="GeneID:11531004"
     mRNA            complement(<277699..>279591)
                     /gene="TPHA0D01340"
                     /locus_tag="TPHA_0D01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685161.1"
                     /db_xref="GeneID:11531004"
     CDS             complement(277699..279591)
                     /gene="TPHA0D01340"
                     /locus_tag="TPHA_0D01340"
                     /inference="similar to DNA sequence:INSDC:YOR249C"
                     /note="similar to Saccharomyces cerevisiae APC5 (YOR249C);
                     ancestral locus Anc_8.689"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685209.1"
                     /db_xref="GeneID:11531004"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:G8BSF4"
                     /translation="MSEESLIITSSISPFDITILFLIYDYCFEFDVDTRTSIDVFLTL
                     ITPTFPTVEHNPLLQGNSNCYNLPKPVYPTLIDLYEYLKNNNYEATFRKLMSMLLSIN
                     NFDSISYILNRIETECLVKTNKEARESKRIYKSKKVVKSSLLGIFITRSISRYAICEF
                     DEKNRLWKNYQLFVKSFTELPIWKTISGSIEKYDGFQKVDNNFNEKDDSLVKFLDTMT
                     TKIFTCNQLGTMISHNHFQSILNWEVYNVSQFHKIDKSKVDIIFNHLPLHDSAKFPTV
                     HLLKYLIALEDYCYQDALTSLHNYFDYMLTQNADNYFHISLLGLGACYAYFHDCESAI
                     KSYTEATKVAREYKDSTILNLIMLWIVEFIQEHPEYTNRFQVMINQIVRYLKTSNENE
                     ASFIFGNAYKFETFLKMSKNDSSIEILESRFKYAAIAHQSVLNNNEMDQFLKHSFIIW
                     DYFGSKTLTELYRNMSSKTSDSLSTKIANVFENSLSDLTETLTVLRSIHSPNITYQQQ
                     MGIKLIKIRYLLLTEDYQQALDSLPTEKNTEFMDFRWRTTFELEKCNILIASKNGIRS
                     LSALLKLIDILAIIKNPKYLHQALVQLVQIMKQQNKTQEAQKLFNSNIALLLYYNSSD
                     INTLRV"
     gene            complement(<279973..>281322)
                     /gene="TPHA0D01350"
                     /locus_tag="TPHA_0D01350"
                     /db_xref="GeneID:11534277"
     mRNA            complement(<279973..>281322)
                     /gene="TPHA0D01350"
                     /locus_tag="TPHA_0D01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685162.1"
                     /db_xref="GeneID:11534277"
     CDS             complement(279973..281322)
                     /gene="TPHA0D01350"
                     /locus_tag="TPHA_0D01350"
                     /inference="similar to DNA sequence:INSDC:YOR250C"
                     /note="similar to Saccharomyces cerevisiae CLP1 (YOR250C);
                     ancestral locus Anc_8.690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685210.1"
                     /db_xref="GeneID:11534277"
                     /db_xref="GOA:G8BSF5"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028606"
                     /db_xref="InterPro:IPR029007"
                     /db_xref="UniProtKB/TrEMBL:G8BSF5"
                     /translation="MESLPGINDASSNQEVVNGDDEIHDLSLKKGDEWKIGVSSDNKL
                     IVKIIHGIAEIFGTELANNKDYVFQNFKFSIFAVEDVELQWRCMELVGTNLSVQENIT
                     AKYIYNLHFALEKLRAASFDGPKIMIVGNSNTGKTSLTRTLCSYAIKYKTYQPLFVNL
                     NPAEGIFTVPGAISATPVSDILDPQSSRWGQSMTSGATELHSKQPLVKNFGLEYIREN
                     RELYKVVISQLAEVAMNRMQNDALVHRSGCIINTPPLEDLDDDLSELLVSFNQFKVNY
                     IIYLGEETDENFSKIKKMFPESFLANILRIPKLSGIIPTDDIYKRSLQRSSIREYFYG
                     TYNSVLSPYTIGVDFDDLTVWKPKNMIEDQENMEQSSPSKYTSVEINASNLQHSLVSL
                     TYADRKENESAVQKAAILGYGLVTEVNEKRHKLRILLPVPGALPNKAMVLTSYRYLE"
     gene            complement(<281924..>282838)
                     /gene="TPHA0D01360"
                     /locus_tag="TPHA_0D01360"
                     /db_xref="GeneID:11531033"
     mRNA            complement(<281924..>282838)
                     /gene="TPHA0D01360"
                     /locus_tag="TPHA_0D01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685163.1"
                     /db_xref="GeneID:11531033"
     CDS             complement(281924..282838)
                     /gene="TPHA0D01360"
                     /locus_tag="TPHA_0D01360"
                     /inference="similar to DNA sequence:INSDC:YOR251C"
                     /note="similar to Saccharomyces cerevisiae YOR251C;
                     ancestral locus Anc_8.691"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685211.1"
                     /db_xref="GeneID:11531033"
                     /db_xref="GOA:G8BSF6"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:G8BSF6"
                     /translation="MSGFKLLTPIAFDKLLKGETTHRVIPIDATWFLPSFKRSGAQEF
                     LTIERIPNAIHFDIDTIKDPKSIYPHMAPDLETFNKSMSKLGLKRDDILVVYDRIGNF
                     SAPRCAWTLSLFGHENVYLLNNFLLYKKEGYPVDNSVVNSFSQYPETQYKSDINLSQK
                     EIIDFESILKLVNDNQLSAKYNAYDARALNRFEGKVPEPRPDIPSGHIPGFQPLPFTD
                     VLEGETGTYPSSTTELKAKINKAMENLKSTYDPKKPTIVMCGTGVTGIIIKTALEQSG
                     IKDVKCYDGSWTEWALRTDKKIIANNRD"
     gene            complement(<283224..>283940)
                     /gene="TPHA0D01370"
                     /locus_tag="TPHA_0D01370"
                     /db_xref="GeneID:11534422"
     mRNA            complement(<283224..>283940)
                     /gene="TPHA0D01370"
                     /locus_tag="TPHA_0D01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685164.1"
                     /db_xref="GeneID:11534422"
     CDS             complement(283224..283940)
                     /gene="TPHA0D01370"
                     /locus_tag="TPHA_0D01370"
                     /inference="similar to DNA sequence:INSDC:YPL166W"
                     /note="similar to Saccharomyces cerevisiae ATG29
                     (YPL166W); ancestral locus Anc_8.693"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685212.1"
                     /db_xref="GeneID:11534422"
                     /db_xref="UniProtKB/TrEMBL:G8BSF7"
                     /translation="MNNQNTIVYVRLKGKTPPGGLKVSKPFEWNAKKDDQLWQIVSSK
                     EAETQELDVNWEQLGQIFEDVPEKYLKQRTYSLISSKLKKLDHLKQKVNKIIDSKGSK
                     IIDLEAQRTNLQISQYISNKNIVDHQEEIPADEVSESKHGMKTNSANSSLNGAMYMHY
                     MNEDKLDKDDMYGEVISKLQTSKILENNFPIKFKNKLKLEDSGSIFENENEISSSLSV
                     SASALEEALLDRLPSNINDT"
     gene            <284370..>288881
                     /gene="TPHA0D01380"
                     /locus_tag="TPHA_0D01380"
                     /db_xref="GeneID:11530963"
     mRNA            <284370..>288881
                     /gene="TPHA0D01380"
                     /locus_tag="TPHA_0D01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685165.1"
                     /db_xref="GeneID:11530963"
     CDS             284370..288881
                     /gene="TPHA0D01380"
                     /locus_tag="TPHA_0D01380"
                     /inference="similar to DNA sequence:INSDC:YPL167C"
                     /note="similar to Saccharomyces cerevisiae REV3 (YPL167C);
                     ancestral locus Anc_8.694"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685213.1"
                     /db_xref="GeneID:11530963"
                     /db_xref="GOA:G8BSF8"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:G8BSF8"
                     /translation="MTDEDKLKSLEDSYTLNADHIYIQLNDYDFYSTKPSILDSTHGT
                     SLPLHKFENVPVIRIFGSLPTGHQVLCHVHGIYPYIYVGYDGSIHDISTVMNQKCSNI
                     HSKLENLSRVQLGNQKNDKASSHSKNDNNHRLKYVANVSIVKGIPFYGYHVGWSLFYK
                     ISFLKPHFVNRISDLIRNGDLFKNGAQIYEAHIPYYLQFCADFNLFGCSWLELDTCYF
                     RKPILNKILELDKLLLTPELEKFVTKFAGQNSSKVLDSNMFPKVGNSLLEVDVLPQYI
                     NNRNSLDFVDLHHDFIEKNNENIDEVRTRYINSTKHLNKEIESIREAFDLPPYFGEKI
                     NGRYNIESKWNNLKELKNIFEKTEARLYRKNGKTTTFDGYISNDPRFNKINTPHGMID
                     ELWPNAAIEIEDNITNDKENLNNITKSYSKPMSDLETDIGLLEVVTDNENNNSEEEGD
                     INRESHKEPMSEMDVDKPILGKEQKSQGPFSIDFQLTQSIANKRQLSINDFSNADEDI
                     KNIKQRRTDYIGIPVGRSAYACNPCNISYNSIVSDLENDGYPKVDYKNPFFSNPVDLK
                     NQSYSYSGKLFEITSSHLSQRIPLQFDESEIVIQDASSSKYFSSWKYLPEPPTFQEVQ
                     RSETSIGLKYKPNKSSLNKSIGGFRYAMDSETSITKQKSNIHSVLTHLTLEVHTQSRH
                     DKVPDPKHDRIQLIIWKVDEDSFPFDLNISTEGVMIVVEEKTDPELLGIITSAIGNLP
                     VGIYYSELEMFDAIIDLILFFDPDILSGFEVQKSSWGYMSERCTHVYKFDFLNEICRA
                     TKYTNNRKNSKWGTSHTTSISVPGRHVLNIWRAMRSEVNLKQYTVEILAYEVLHKRLP
                     RFSSQYLTELWNSRDITKIRTVVFYWINRVRVNVSLLKKQDYIERIIEQARLIGIDFY
                     SVYYRGSQFNVESVLVRLCKSESFLLLSPSKDDVRNQKPLECVPLVMEPDSLFYKSPL
                     VVLDFQSLYPSVMMAYNYCYSTMLGRVNEMSYVGNKIGVTSINYDENILTLLKDDIII
                     SPNGIAFVKPSVRKSTLTKMLNEILTTRFLVKKTMKDLPAENSKLNRLMNSRQLALKL
                     LANVTYGYASASFSGRMPNSDLSDAIVQTGREILQNAIEFIEGSEKYGAKVVYADTDS
                     LFVYLPGKTREDAFSIGRELATEISRRNPDPIVLNFEKVYNPCILLSKKRYVGYAYEY
                     ESQIKPIFNAKGIETVRRDGYRLQQQVVEKALTIFFSTQDLSLVKKYLFEIFTKLDRG
                     EIPIQDLCFAQEVKLGSYKSIDTAPAGAQVAMREMKNDKRAEPQYKERVPYLVVKGEA
                     GQILRDRSISPKEFLQNPSLEIDSEYYITKTLVPPLNRFFRLTGVDVNEWLNEMPRFK
                     KILTGEENQQLKKILNFSECINCHQSFTTGISTLCSDCSNQKSATAVNLIESIRKSET
                     AYENIQTVCRVCSFKYSHDAGPINSDISSNCISLDCPVYFSKLKTKKQLKSKQYSEIQ
                     RQLNTFDSW"
     gene            <289408..>291129
                     /gene="TPHA0D01390"
                     /locus_tag="TPHA_0D01390"
                     /db_xref="GeneID:11534402"
     mRNA            <289408..>291129
                     /gene="TPHA0D01390"
                     /locus_tag="TPHA_0D01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685166.1"
                     /db_xref="GeneID:11534402"
     CDS             289408..291129
                     /gene="TPHA0D01390"
                     /locus_tag="TPHA_0D01390"
                     /inference="similar to DNA sequence:INSDC:YPL169C"
                     /note="similar to Saccharomyces cerevisiae MEX67
                     (YPL169C); ancestral locus Anc_8.699"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685214.1"
                     /db_xref="GeneID:11534402"
                     /db_xref="GOA:G8BSF9"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:G8BSF9"
                     /translation="MNGFHNVNNLGSLATQQMMTNRVEVVITNWENGSINDLTSFLSR
                     QSRIAVRDVRVEGNAAIGYVANKKEAEALNKFNGIRFAGKSLKIQVTGGVDNSSPTVK
                     LLKAFLFRRYDPQTKMLNLGSIHTDAELVQKGLFTTISTQSKMFAAMMKLASSESNLV
                     VESVNLSDNNLKDINGITTLAQTFPNLKNLCLANNQIARYKSMEPWKNKFKKLRELLM
                     TNNPIVNERAYKNEMLKIFPKLVMLDNIVVRDAQKLDAIYNFPFKSKPFFFENNELGS
                     SSTEFVTNFLNLWDSDRSQLLQLYTPQSQFSMCSDASVPPSSVKDADQNPSFGFYLSS
                     SRNITKISTDTSIQQKLATGPEGIAEIFNSLPMTKHYLLEKAESYSMQTISYGQVNGF
                     MIILHGFFEETTKPMNVNNKGRPRRFNHGSNASSDKRLSKKSFDRVWVLVPTNYGVIV
                     ASDMLTVRPYVSAAWIKVPDTPATINNTAVPMQQMNQPNFVPNTTMNQQMSPPILAPT
                     LQLPPEIQARLSPIQLELLNKLHVDTKLNSEYTYMLAEQSGWNYDVAFKGFQSSMGQI
                     PREAYIQ"
     gene            complement(<291409..>291870)
                     /gene="TPHA0D01400"
                     /locus_tag="TPHA_0D01400"
                     /db_xref="GeneID:11531056"
     mRNA            complement(<291409..>291870)
                     /gene="TPHA0D01400"
                     /locus_tag="TPHA_0D01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685167.1"
                     /db_xref="GeneID:11531056"
     CDS             complement(291409..291870)
                     /gene="TPHA0D01400"
                     /locus_tag="TPHA_0D01400"
                     /inference="similar to DNA sequence:INSDC:YPL170W"
                     /note="similar to Saccharomyces cerevisiae DAP1 (YPL170W);
                     ancestral locus Anc_8.701"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685215.1"
                     /db_xref="GeneID:11531056"
                     /db_xref="GOA:G8BSG0"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:G8BSG0"
                     /translation="MSFLTNLLFGGVKTSQDPTGLSGTTDPNILNSNSQSEPIVEGIF
                     YPRTLSKYNGHDDEKIFIAIKGVVYDCTQGRQFYGPSGPYSNFAGHDASRGLALNSFD
                     TDVVRDWDQAIDDLENLSEAEKNALDEWEQHFINKYPKIGTLVPEAGVNDK"
     gene            complement(<292255..>294678)
                     /gene="TPHA0D01410"
                     /locus_tag="TPHA_0D01410"
                     /db_xref="GeneID:11534302"
     mRNA            complement(<292255..>294678)
                     /gene="TPHA0D01410"
                     /locus_tag="TPHA_0D01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685168.1"
                     /db_xref="GeneID:11534302"
     CDS             complement(292255..294678)
                     /gene="TPHA0D01410"
                     /locus_tag="TPHA_0D01410"
                     /inference="similar to DNA sequence:INSDC:YOR256C,YPL176C"
                     /note="similar to Saccharomyces cerevisiae TRE2 (YOR256C)
                     and TRE1 (YPL176C); ancestral locus Anc_8.702"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685216.1"
                     /db_xref="GeneID:11534302"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:G8BSG1"
                     /translation="MVKNNYERVSTTDAEHSGVNSPTVDLVAPESNNLSVEDDLNLSN
                     DTLPVEPPTYDDAHNLENINNFDEEMQMEDLNQFNNEGDETMIKKMKHVFKNLNYYYH
                     VNVKEKILDPIFIISEMFSEKIDFYLNKVGNPLILRRFFYIIFMSIVSFVVVSSGLLP
                     SSNKEALLGMFTNIPVLLQYSKISLDLAKLENDLEYISSMPHSSGSRGDTAIKDYIKS
                     SFRNNGLKSVIESEYPAYANYYNSANLTIYTKDNKKIDIPLDDRNWNPFSLNGSVSQS
                     NLIYANQGSLTELSKLKKENMITDNTVLLMDYSKLVSEQVLAAQKYGAKGVLFISNVG
                     AGNGDLVQSRSVALNQFYTGDALTPGWTGHAIQDNDFGSAPVLPKLLSLPISQNQAKL
                     ILDALSHKGVKLDNGAHSGIPGDVKVDFSVATTIRERHSVFNIMGKIEGREQSEKAII
                     IAASRNSYSYGTSYPNFGTSVLLSLVQLFEGFKYKFNWRPLRSIYFISFGGSEFNYAG
                     AAEFVEQRTSHIRKEVYSVLDISQLGITSNSHKIDIQTHPLLKSLFMSDDNKLKFDVH
                     VSDVHQYGDWTPFLANGVPVTILSSKQVTQDNDIAYTDQDTFDKYSELLHENDRKNLT
                     SDLMTYLLNIILKMVDVPLLPFDIRTYQNELKNHLSKAESLYGKKLNFKDVSSAINKW
                     KRIAIEQESWIRSWDNIVVQHSSNLEPSLLSIHRWNWNKLLSTISTSQISVTGIYKRR
                     HYKNILFGPAVWTNGLSDEFAWVFPGLRDAADENAWNEAQIQLDVITGALVKSLSKIM
                     DGRSDNIYQ"
     gene            <295189..>296550
                     /gene="TPHA0D01420"
                     /locus_tag="TPHA_0D01420"
                     /db_xref="GeneID:11534563"
     mRNA            <295189..>296550
                     /gene="TPHA0D01420"
                     /locus_tag="TPHA_0D01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685169.1"
                     /db_xref="GeneID:11534563"
     CDS             295189..296550
                     /gene="TPHA0D01420"
                     /locus_tag="TPHA_0D01420"
                     /inference="similar to DNA sequence:INSDC:YPL175W"
                     /note="similar to Saccharomyces cerevisiae SPT14
                     (YPL175W); ancestral locus Anc_8.703"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685217.1"
                     /db_xref="GeneID:11534563"
                     /db_xref="GOA:G8BSG2"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:G8BSG2"
                     /translation="MGYNIAMISDFFYPQLGGVEFHMYHLAQELIKLGNSVIIVVHAY
                     SPDRVGVRYLSNGLKVYYVPYFVLHRETTFPNVFGTFPWVRNILIREQIDIVHTHGSA
                     STFSLEGLLCGNTLGLKTVFTDHSLYGFGNITSIWVNKLLTFSLTNTDKVICVSNTCK
                     ENMIMRTKVDPSKMYVIPNAVVSADFKPTESAQDKEIRHEREGCKIVTINRLFANKGA
                     DLLTHIIPIICSLHSDVEFIIAGDGPKYVDFQQMIEKNRLEDKVTLLGPVPHEKVRDV
                     MCQGDIYLHASLTEAFGTVLVEAASCGLLIVTTTVGGIPEVLPSHMMVYADDTSVTKL
                     VESLNKAIKILKENKYNGSKVHEEIEGMYDWSLIARRTMNVYTGIFENAKPDDKNWLT
                     MIKKFNERDGIWAKHLYMLCGIVEYLLFLLFEILYPSKNIELAPKWPSKEVVSNRISH
                     SKY"
     gene            complement(<296591..>299176)
                     /gene="TPHA0D01440"
                     /locus_tag="TPHA_0D01440"
                     /db_xref="GeneID:11534248"
     mRNA            complement(<296591..>299176)
                     /gene="TPHA0D01440"
                     /locus_tag="TPHA_0D01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685170.1"
                     /db_xref="GeneID:11534248"
     CDS             complement(296591..299176)
                     /gene="TPHA0D01440"
                     /locus_tag="TPHA_0D01440"
                     /inference="similar to DNA sequence:INSDC:YPL174C"
                     /note="similar to Saccharomyces cerevisiae NIP100
                     (YPL174C); ancestral locus Anc_8.704"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685218.1"
                     /db_xref="GeneID:11534248"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:G8BSG3"
                     /translation="MVGVGDRVLAPTGGSGIARYIGPTEFADGLWCGIELDDSVGKND
                     GSVNGVRYFDLSKEGGLYGLFVKVDKIDKIVENVKVHKSEGSTNDVKRLKGVIEKLQD
                     KVLSLQSQLANKETAKFLEWYEDEINHLNLSIEKLSLKETDYLLKISDLIESLDDLKC
                     KYNECIVTLKELETEVDTSRKLDKKRIGELLNDAHIDETNLKDLATRLYNSLTSTTDQ
                     YESLLAENEDLLGENTTLQALFEDLNKENIALSKTATDLDKELEIVKDSKELVEFLTN
                     ENSKLQNILERKSSKIIDMEKEIEYQNNIISVYAEMEQELHLEIEDLKIKYSKSVKNN
                     EDLVNENVKLSSELKNLFNTNADISDVHKNNNGYTEKEIIYKDKIINKGNYLDKLLEY
                     LLSSKNYRKFIKLFPLLMQIVYDQFLINPLELSESYFLFYKTLLFLLIQVTIVIDGSD
                     ELDSSRKKYFLLDGILNIQYWINILYNNSGNLKIEDHSLLILFIKENDSIESNTTLLV
                     DIIYFLSSASVPEFMGSIMFSKNEYGTRSQKVTDIYQICLTIENLITEKRNLLTDDHQ
                     YSLKYQDKPLMISDLVNNILSLFHDVIINNDVDNFCNSMLENLIKVSDKFMTLEVISK
                     SIVDGAISDKDDATLELTLPVNLVEQPNLIKLETQLHDIQQENKNLLVKLEVLRNKLI
                     LFETNEESLKNLMSQIESLKEEKNTLKLMNEKSNIEITDLQTRLEEEQLNKYFKIKLP
                     GLDSLIKENEKIDRAGLISEIYELEHLVKKFTTPMELKDDSVLSWLDNFEDSINSRKD
                     ISNFEPNYHRTLLRNASTLLDSLDSIPLRDIYNDNSIHHYESYISRSSKNFNILKNAL
                     EKQFV"
     gene            <299669..>300154
                     /gene="TPHA0D01450"
                     /locus_tag="TPHA_0D01450"
                     /db_xref="GeneID:11534439"
     mRNA            <299669..>300154
                     /gene="TPHA0D01450"
                     /locus_tag="TPHA_0D01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685171.1"
                     /db_xref="GeneID:11534439"
     CDS             299669..300154
                     /gene="TPHA0D01450"
                     /locus_tag="TPHA_0D01450"
                     /inference="similar to DNA sequence:INSDC:YOR257W"
                     /note="similar to Saccharomyces cerevisiae CDC31
                     (YOR257W); ancestral locus Anc_8.705"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685219.1"
                     /db_xref="GeneID:11534439"
                     /db_xref="GOA:G8BSG4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR029530"
                     /db_xref="UniProtKB/TrEMBL:G8BSG4"
                     /translation="MNNNRNAMVSGKIQDQLLEEQKQEIYEAFTLFDMDNDGYLDFHE
                     VKVAMKALGFDLPKAEILDLIDQYDNDGRRKMEYNDFYVVVGQMILNRDPLDEIKRAF
                     KLFDDDNTGRISLKNLRRVAKELGETMTDDELRAMIDEFDLDGDGEINEQEFIDICTD
                     N"
     gene            <300786..>301664
                     /gene="TPHA0D01460"
                     /locus_tag="TPHA_0D01460"
                     /db_xref="GeneID:11534301"
     mRNA            <300786..>301664
                     /gene="TPHA0D01460"
                     /locus_tag="TPHA_0D01460"
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /transcript_id="XM_003685172.1"
                     /db_xref="GeneID:11534301"
     CDS             300786..301664
                     /gene="TPHA0D01460"
                     /locus_tag="TPHA_0D01460"
                     /inference="similar to DNA sequence:INSDC:YPL173W"
                     /note="similar to Saccharomyces cerevisiae MRPL40
                     (YPL173W); ancestral locus Anc_8.706"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /protein_id="XP_003685220.1"
                     /db_xref="GeneID:11534301"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:G8BSG5"
                     /translation="MSSRYEHLTKISSRILERLNPPKSMKQRSEKLRKLSLPEFLSVG
                     VSPVEKSEMYKTEKDWKFLPGDRVVLLKGSKKGSICYIKSQERSSNGYILDDNGPSKS
                     VPIPKEFWVAGQKSHMLNVPVPVKQSEIKLVADIDDPANPGATKTVAVRDVVFKGNYY
                     DENYKKVLPYRQVSGMPDLIIPWPKPEASKTNSSLGTSPEVAREQTFWVDSIVKNTIP
                     VNAFLTIRNPYSKYRRGTLTSKDIARLVAPKMPLTESKKEYIRDRQKLSQIRRPKLTD
                     AEKEQIGETILKHISS"
     gap             302040..302060
                     /estimated_length=21
     gene            complement(<302134..>303501)
                     /gene="TPHA0D01470"
                     /locus_tag="TPHA_0D01470"
                     /db_xref="GeneID:11534288"
     mRNA            complement(<302134..>303501)
                     /gene="TPHA0D01470"
                     /locus_tag="TPHA_0D01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685173.1"
                     /db_xref="GeneID:11534288"
     CDS             complement(302134..303501)
                     /gene="TPHA0D01470"
                     /locus_tag="TPHA_0D01470"
                     /inference="similar to DNA sequence:INSDC:YOR259C"
                     /note="similar to Saccharomyces cerevisiae RPT4 (YOR259C);
                     ancestral locus Anc_8.708"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685221.1"
                     /db_xref="GeneID:11534288"
                     /db_xref="GOA:G8BSG6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSG6"
                     /translation="MSAENDPLMSAFQDEGNDAKDNENNEERNGDNAGEFAEQHVEEG
                     KAEGEEEEDAEEEDIEVEVVDPVVEARNKALDDFKRKLLEHRRYDDQLKQRRQNIKDL
                     EKTFDKTEDDIKALQSIGQLIGEVMKDLSDEKYIVKASSGPRYIVGVRNSIDRSKLKK
                     GVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEISFDGIGGLTEQIRELREVIELP
                     LKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGE
                     SARIIREMFAYAKDHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFE
                     NLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEAGRLEIFKIHTEKVKKIGEF
                     DFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNHIIPEDLMKAVRKVAEVKKLEGSL
                     EYKKL"
     gene            <303979..>305484
                     /gene="TPHA0D01480"
                     /locus_tag="TPHA_0D01480"
                     /db_xref="GeneID:11534450"
     mRNA            <303979..>305484
                     /gene="TPHA0D01480"
                     /locus_tag="TPHA_0D01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685174.1"
                     /db_xref="GeneID:11534450"
     CDS             303979..305484
                     /gene="TPHA0D01480"
                     /locus_tag="TPHA_0D01480"
                     /inference="similar to DNA sequence:INSDC:YOR260W"
                     /note="similar to Saccharomyces cerevisiae GCD1 (YOR260W);
                     ancestral locus Anc_8.709"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685222.1"
                     /db_xref="GeneID:11534450"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BSG7"
                     /translation="MNLQAFIFCGKGNHLSPIVDQHFEHRSTPKALLPIGNRPMIEYV
                     IDWCDQANFKEINIVAQVDEIEQIKEGLTTFLELREKQFEALSKVLTQSYHTNHLHKP
                     IVINFISSKCNNTGEKLTKELLPRITNDFVLLPCDFVTDVPPQILYDHFLNMDDNNLA
                     MSVYYNNQIENSDRRHMGKQFFTVYSNNDDLSERSVLLDIYSKENVAKTKYLQIRNHM
                     LWRYPNATVSTKLLNSFIYYCSYDLVKLLRDDKSTDRNDNSSDEESMEIDLTEIKPSY
                     FKRKNKLIKDTINSNKSLAKVFRDLARRSWQHEEKRSTVAIFILPEVTSFYRANNLNS
                     FMEANRFILKIKAQSFSKQGKTAPTASVIGIDSIVGQDCTILEKTNIKMSAIGDGCKI
                     GKRCRIVGSIILSNVTIEDDVTLENVIIGEHAKISIKSKLTNCDVEEHYVVPSRSVLK
                     GEVLSRSEGNSDVEASSNAAESTTDDDETDEETDEYYDDEEFDDDDGLFER"
     gene            complement(<305822..>307216)
                     /gene="TPHA0D01490"
                     /locus_tag="TPHA_0D01490"
                     /db_xref="GeneID:11534557"
     mRNA            complement(<305822..>307216)
                     /gene="TPHA0D01490"
                     /locus_tag="TPHA_0D01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685175.1"
                     /db_xref="GeneID:11534557"
     CDS             complement(305822..307216)
                     /gene="TPHA0D01490"
                     /locus_tag="TPHA_0D01490"
                     /inference="similar to DNA sequence:INSDC:YPL172C"
                     /note="similar to Saccharomyces cerevisiae COX10
                     (YPL172C); ancestral locus Anc_8.710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685223.1"
                     /db_xref="GeneID:11534557"
                     /db_xref="GOA:G8BSG8"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR016315"
                     /db_xref="UniProtKB/TrEMBL:G8BSG8"
                     /translation="MSYGRNILPQQVIVRYLYTFNRQLFRNEKHLNIKQYQIRSLSFK
                     NRIRVESEKLNTAPVEFRPNLLHVDKDVDDIVEAAVKAIRCTSDVSVDPSETKDPDNS
                     KLPFNVKPISNIELKERRLRKQNNTVNKYDLTHIKKNIINPYIQLTKPRLTMLVMLSA
                     ICSYALSPYSASMSQLACLTIGTTFCSGAANAINMGREPDFDRQMIRTQARPVVQGIV
                     TPNQAFKFATVIGVAGVGILNVGVNPTVAFLGFSNIALYSWAYTSLKRKHIINTWVGA
                     LVGAIPPLMGWAAASPLTHPAAWCLAGLLYAWQFPHFNTLSHNIKNEYKNAGYVMTAW
                     KNPLLNARVSLRYSLLMFPLCFGLSYYGVTDWYYQLDSAIANGWMSFWAYKFYMQQRI
                     TYSAEIMKDKIAFNKSMAIASAYSRKTFWGSIIHLPAVLILAIVHKKGRWDWLLNNDK
                     NDDQNVPKHQKRLE"
     gene            complement(<307783..>308862)
                     /gene="TPHA0D01500"
                     /locus_tag="TPHA_0D01500"
                     /db_xref="GeneID:11534230"
     mRNA            complement(<307783..>308862)
                     /gene="TPHA0D01500"
                     /locus_tag="TPHA_0D01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685176.1"
                     /db_xref="GeneID:11534230"
     CDS             complement(307783..308862)
                     /gene="TPHA0D01500"
                     /locus_tag="TPHA_0D01500"
                     /inference="similar to DNA sequence:INSDC:YOR261C"
                     /note="similar to Saccharomyces cerevisiae RPN8 (YOR261C);
                     ancestral locus Anc_8.711"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685224.1"
                     /db_xref="GeneID:11534230"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:G8BSG9"
                     /translation="MSVSQENITVAPLVLLSVLDHYKRTNTPEGKRVVGVILGSTSKS
                     TIHVTNSFALPFEEDEKNSDVWFLDHNYIENMNDMCKKINAKEKIVGWYHSGPKLKAS
                     DLKINEIFKKYTSYNIFNSNTGSYSTTSNPLLLIVDVKQEGVGLATNAYISVEQVKDD
                     GSSTERTFIHLPCSIEAEEAEEIGVEHLLKDVRDQAAGGLSIRLTAQLRSLKGLQQKL
                     QHITNYLTKVSNNELPINHTILGKLQDVFNLLPNLGSPDDDELSATSANKAEVIRSSN
                     SLQKALTVKTNDELMIIYISNLVRSIIAFDNLIENKIQNQKMHEKLSSTEKKTGDEEE
                     HKEGDENSEENNRKETENSKPTSDK"
     gene            <309326..>310372
                     /gene="TPHA0D01510"
                     /locus_tag="TPHA_0D01510"
                     /db_xref="GeneID:11534423"
     mRNA            <309326..>310372
                     /gene="TPHA0D01510"
                     /locus_tag="TPHA_0D01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685177.1"
                     /db_xref="GeneID:11534423"
     CDS             309326..310372
                     /gene="TPHA0D01510"
                     /locus_tag="TPHA_0D01510"
                     /inference="similar to DNA sequence:INSDC:YOR262W"
                     /note="similar to Saccharomyces cerevisiae YOR262W;
                     ancestral locus Anc_8.712"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685225.1"
                     /db_xref="GeneID:11534423"
                     /db_xref="GOA:G8BSH0"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSH0"
                     /translation="MSFAQIVIGPPGSGKSTYCNGCSQFFNAIGRHVQVVNMDPANDR
                     LSYPCSVDIRDFITVEEIMQEQELGPNGGLMYAVESLQASMDLFVLQVKALVQEEKAY
                     VVFDCPGQVELFTHHSSLFKIFKRLEKELNMRFTVVNLIDCYYLTSPSQYISVVLLAL
                     RSMLMMDLPQINVFSKIDMVKSYGELPFRLDYYTEVQELEYLLPYIDKESNSVLGKRY
                     SKLTETISELITDFNLVSFEVLCVDDKQSMIHLQSVVDKANGYIFGSSEVGGDTVWAE
                     ATRQGATLQNSIDIQERWIDNKEKYDKEAEELEERLRKESEFNDKEVPLTEDDEWESA
                     LKDWEEKQGTDFVR"
     gene            <310797..>312947
                     /gene="TPHA0D01520"
                     /locus_tag="TPHA_0D01520"
                     /db_xref="GeneID:11534145"
     mRNA            <310797..>312947
                     /gene="TPHA0D01520"
                     /locus_tag="TPHA_0D01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685178.1"
                     /db_xref="GeneID:11534145"
     CDS             310797..312947
                     /gene="TPHA0D01520"
                     /locus_tag="TPHA_0D01520"
                     /inference="similar to DNA sequence:INSDC:YIL091C"
                     /note="similar to Saccharomyces cerevisiae YIL091C;
                     ancestral locus Anc_2.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685226.1"
                     /db_xref="GeneID:11534145"
                     /db_xref="GOA:G8BSH1"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSH1"
                     /translation="MSGRGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESK
                     PADALVSGEEAESESDDAKDEEDVGKKRNQVYGALLTILKSEHPEKKKQKKKFNQEKE
                     DAYNASDDEYNVSDKQEIENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFN
                     QVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKS
                     SLDSYFIKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYREL
                     YTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETI
                     IRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKL
                     YSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMN
                     IFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIA
                     GRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILK
                     STGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVK
                     VLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVR
                     MVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK"
     gene            complement(<313063..>315951)
                     /gene="TPHA0D01530"
                     /locus_tag="TPHA_0D01530"
                     /db_xref="GeneID:11530987"
     mRNA            complement(<313063..>315951)
                     /gene="TPHA0D01530"
                     /locus_tag="TPHA_0D01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685179.1"
                     /db_xref="GeneID:11530987"
     CDS             complement(313063..315951)
                     /gene="TPHA0D01530"
                     /locus_tag="TPHA_0D01530"
                     /inference="similar to DNA sequence:INSDC:YNL023C"
                     /note="similar to Saccharomyces cerevisiae FAP1 (YNL023C);
                     ancestral locus Anc_2.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685227.1"
                     /db_xref="GeneID:11530987"
                     /db_xref="GOA:G8BSH2"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BSH2"
                     /translation="MSDREITSQIETAAGNTESSSDEESYSKGSNESNFDSSEDEDDG
                     LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKT
                     IDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKN
                     FCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKC
                     KRVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKN
                     SEGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKT
                     SLKQLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCL
                     QKHFLVPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDE
                     SLVEAVHICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVR
                     CGSKLPPCPFECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVK
                     AVCFQEFGSCGEICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKC
                     HGSSPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDNSSASIELLPCDEDCEAHARHLQ
                     LRDAFGYDSSLDTSNKNIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIED
                     ILRKFVLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTR
                     IPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIK
                     KISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEV
                     LVGHFDFIGKEALIFDSIMLCNVEGYINQISDCTDTDKEKDSTSTSNE"
     gene            complement(<316471..>318594)
                     /gene="TPHA0D01540"
                     /locus_tag="TPHA_0D01540"
                     /db_xref="GeneID:11534120"
     mRNA            complement(<316471..>318594)
                     /gene="TPHA0D01540"
                     /locus_tag="TPHA_0D01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685180.1"
                     /db_xref="GeneID:11534120"
     CDS             complement(316471..318594)
                     /gene="TPHA0D01540"
                     /locus_tag="TPHA_0D01540"
                     /inference="similar to DNA sequence:INSDC:YIL095W,YNL020C"
                     /note="similar to Saccharomyces cerevisiae PRK1 (YIL095W)
                     and ARK1 (YNL020C); ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685228.1"
                     /db_xref="GeneID:11534120"
                     /db_xref="GOA:G8BSH3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BSH3"
                     /translation="MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSE
                     HKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDS
                     YVVLLLMEYCSGAGLLDFMNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDI
                     KIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLA
                     LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIR
                     VLLSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQRAMSSLQMDTTQPHRIPILKYT
                     QMSKPVISSQSSPSKHCQTFSQKDYPYIQPNLSNSARAKDYYLGGSSSTDTLESSLSK
                     QLSEDRVYDVNVNTMDSHCTYRRKLTPNYDHALKKGSSPSINDNSTLNNMTSLKHEHS
                     FNSREAYIHPDFSGSKHFITSNDALNLNCRTPRSRDSSINSNSSVDSISRNSTGGSLI
                     KSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDSVVRN
                     SEQFGGIPELSNDNKYQFDTTSKNRHEYNSLSRKLSLSSQKQNSLNDSTSNDPIILIT
                     NLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTDNKSSIKHFKSNIEHLTAYGNMN
                     GHLKTAHHLKAKPKVPTKPVFLRSP"
     gene            complement(<319711..>321204)
                     /gene="TPHA0D01550"
                     /locus_tag="TPHA_0D01550"
                     /db_xref="GeneID:11531072"
     mRNA            complement(<319711..>321204)
                     /gene="TPHA0D01550"
                     /locus_tag="TPHA_0D01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685181.1"
                     /db_xref="GeneID:11531072"
     CDS             complement(319711..321204)
                     /gene="TPHA0D01550"
                     /locus_tag="TPHA_0D01550"
                     /inference="similar to DNA sequence:INSDC:YIL097W"
                     /note="similar to Saccharomyces cerevisiae FYV10
                     (YIL097W); ancestral locus Anc_2.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685229.1"
                     /db_xref="GeneID:11531072"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:G8BSH4"
                     /translation="MKSIINEPSTDFHLRINEESFSIPAEILKRNLNKLERSVKLRTD
                     EISVLLNKVNELMDSNTLENDKSAVLEINKIIKKVDRLEKELLKTKDEEYDILMRIQE
                     RISFFKELEHAKSLTSRELLIGWYQKYTNLLIGDYLVRNSKSEIKKDDDTGCYNNDGS
                     LFLKQQHMEKLLDYDIIINANIISNSLIKHNDIGPLLTWIHDNTQYLKSIKSTLDFDA
                     RLQEYLQLLSKDNYKEAINCFQLHLVKFISTHSLEIQQAAGFLLYHKSRCIYQNGTTN
                     NPMKTPINSSMMNTEDSSKYNSLYLHFFNKELPTAYKEHDAFFTNSETKLELSGFGNL
                     NKSNNYSNLFDECRWKKLNDIFLREYYQMYGISKNEPLLIYLSLGISSLKTKDCLHKK
                     EITTSENKELDFYLNSKVISNKCPVCSNEFRNIAKEMPYAHHIESILYENPIMLPNGN
                     VYDKEQLEKLAAQVTERGLYNISSEEIIDPIDKQVYLKSSFVKMYPT"
     gene            complement(<321751..>322833)
                     /gene="TPHA0D01560"
                     /locus_tag="TPHA_0D01560"
                     /db_xref="GeneID:11534456"
     mRNA            complement(<321751..>322833)
                     /gene="TPHA0D01560"
                     /locus_tag="TPHA_0D01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685182.1"
                     /db_xref="GeneID:11534456"
     CDS             complement(321751..322833)
                     /gene="TPHA0D01560"
                     /locus_tag="TPHA_0D01560"
                     /inference="similar to DNA sequence:INSDC:YNL037C"
                     /note="similar to Saccharomyces cerevisiae IDH1 (YNL037C);
                     ancestral locus Anc_2.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685230.1"
                     /db_xref="GeneID:11534456"
                     /db_xref="GOA:G8BSH5"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8BSH5"
                     /translation="MLRQVVSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVT
                     DSVVKIFASQGLPIDWERIDVPGMSNENEVKKAVESLKRNKIGLKGIWHTSADQTGYG
                     SLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVE
                     SLKIITKPKTERIARFAFDFALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYP
                     DIKVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGANYGRE
                     HAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEGK
                     TTTKDIGGNASTTEFTDAVIDKLNAQ"
     gene            complement(<323974..>325947)
                     /gene="TPHA0D01570"
                     /locus_tag="TPHA_0D01570"
                     /db_xref="GeneID:11534576"
     mRNA            complement(<323974..>325947)
                     /gene="TPHA0D01570"
                     /locus_tag="TPHA_0D01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685183.1"
                     /db_xref="GeneID:11534576"
     CDS             complement(323974..325947)
                     /gene="TPHA0D01570"
                     /locus_tag="TPHA_0D01570"
                     /inference="similar to DNA sequence:INSDC:YIL099W"
                     /note="similar to Saccharomyces cerevisiae SGA1 (YIL099W);
                     ancestral locus Anc_2.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685231.1"
                     /db_xref="GeneID:11534576"
                     /db_xref="GOA:G8BSH6"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:G8BSH6"
                     /translation="MRKGIYLYDCYLDNNNDVIANNRWRSKFRKFAFFISICLATTFV
                     CVSLGGCSLASFGYIKSNFLFNDGYSSISSSSNFNTVNVTITDFNSHFLKTSQIQGLN
                     YYKDDQIYNFFYEKIKLKKIQSQLINKNEFEDWLQAQKSNSLERLLFNVMDKNLNGHE
                     NLLNKNEKIIEGAIVASQSTQDPNYFFQWIRDSAIVINTVTDNIFDEKNYNITLVGTF
                     LKYLNISYNLQRTDNLSGGSVPDGDLKGLGEPKWNVDNSPYNDNWGRPQNDGPPLRII
                     AILNFYSRLSIFNDANNSNVTVHDLIKEYNMKYTKLETNFTSETDIFNEIIYYDLKFI
                     INNWKERNFDIWEEVNGIHFFTSLMQLTSIKMTLNYMKTSGSFTTTGKLKPMYDSLID
                     TYEKMYKFILLDSGFIINNDSKHHIVETPEILSYRSGLDIATIIASLLSHSTDNEFLD
                     NSLPFDVDDSSILNSLYYLINEMSQLYPVNLNRKSMNMGVALGRYPEDVYDGYKKSEG
                     NPWFLATSSASELIYQLIIKIKTLKQDILIPLATESKNNNDHDIFWTLIFDNIAHIDT
                     KESNIKNGNSYQLLLPYNSRSFNQTLENLFKYGDSFLDCVREHSSEEGNLSEQFNKYT
                     GFLQGAQDLTWSYNSFLSACQSRDKVINMMSFK"
     gene            <328671..>330854
                     /gene="TPHA0D01580"
                     /locus_tag="TPHA_0D01580"
                     /db_xref="GeneID:11534291"
     mRNA            <328671..>330854
                     /gene="TPHA0D01580"
                     /locus_tag="TPHA_0D01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685184.1"
                     /db_xref="GeneID:11534291"
     CDS             328671..330854
                     /gene="TPHA0D01580"
                     /locus_tag="TPHA_0D01580"
                     /inference="similar to DNA sequence:INSDC:YIL101C"
                     /note="similar to Saccharomyces cerevisiae XBP1 (YIL101C);
                     ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685232.1"
                     /db_xref="GeneID:11534291"
                     /db_xref="GOA:G8BSH7"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G8BSH7"
                     /translation="MTVNQIDPTKVRLSDSPLDDYQRLYFLNLFSDIDNKNHNNNGQP
                     SLYINVKNVIFKTSYNEIFNDLRKFITINNKNKSIVKQNVAIELNGEKNNLNCLEYQV
                     PNILIHSDESQHTVYDISEQYWKRLASTEKNIFQFLKGELNLDNNLIISDYENGKIKF
                     SNDNFTLPTSCRKRQNSVVGKVKVVEKNDSNSMKIMFSQNQQDIILLNPNNYIIWTEK
                     HQHVFFSGIWRLYQDVIRALSNSPRYTVKSLKNNNDDVNQSNLVLQKICESEFRFTMN
                     YAFSGIDIGADIKKIRMRRSRKHNCSHPNKSSSVNNFSVVANAKYIDFPWSYVDASLE
                     KRLLDEYKQYLKTTQSLTEEEIDYLQFKDLIQKIRGGYTKIQGCWLPYTIAREFCLRF
                     CYPIRYLLIPVFGESFPDECSEKYFLMKLKATGINGPVIHTSKIKHNERNRKISSKDT
                     RTTRTQEKATKQPKKSGSKRVRKPRNSAEPSNKKQKKPSENKMKHESSITTKTQNLVL
                     PNQDKTPVTTAVVNSSCNVNQVPPRKRSSAQMEIENLIDPLTTINIAPISNIQTPNTA
                     FNDRIMQLQDLRSAATQNIHRESILPDLNYNRSSSWSISSSSTFMTFDKNSEDILPPL
                     SSILSIPTTIKNPICYRKNSNESVNASYILEPPSNVSNYSYRNPRPIYYPLTHRDMNR
                     NNSIYSLTSSAMGFRDTQNSFRKEDYEKNPVILKRASVEKAFQII"
     gene            <331386..>333905
                     /gene="TPHA0D01590"
                     /locus_tag="TPHA_0D01590"
                     /db_xref="GeneID:11531121"
     mRNA            <331386..>333905
                     /gene="TPHA0D01590"
                     /locus_tag="TPHA_0D01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685185.1"
                     /db_xref="GeneID:11531121"
     CDS             331386..333905
                     /gene="TPHA0D01590"
                     /locus_tag="TPHA_0D01590"
                     /inference="similar to DNA sequence:INSDC:YNL041C"
                     /note="similar to Saccharomyces cerevisiae COG6 (YNL041C);
                     ancestral locus Anc_2.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685233.1"
                     /db_xref="GeneID:11531121"
                     /db_xref="GOA:G8BSH8"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:G8BSH8"
                     /translation="MDFIDYDSFTTDNFSSPNDDGYTVPEPVARLNLNSISLNAPKHF
                     KDLNLASIIGQSEKDTKVKNINDVELNLHDKMQKYAELSIKELNLSENPNKSSIQLHS
                     YVPDVSNGSMDISNIVSPKYSQNVETTNVALNKKLSKILIDYSLSNYQTSSNLRKSLQ
                     ILESNKTVLSLDENKVDNPGYVGTLARKTLKNNVETELLKEHLSVLEAFKPIVTRIKT
                     LSKSLKNIEELGNTVMDETKEINEDSKDGNLNEVYQLYQEIDNLKQKKILLTAIKDEY
                     TLTQVEENIIENGPVNAEIFAVINKIMLIKERTMYLFGLPNNRAGTSLINEVNLNLDR
                     LNKKLYNYLIDFLFSFESSPNTMNEKLYGDNKESLLLFQNSLILLSNDLEYFNEFFKK
                     VTTMRSKSVLDQFLSQFDFSNDANPMIFSANDPLRYIGDILANVYSLIANEADFVKSL
                     FSLQEKQVGNIPISYLQNNKEFLQGLDDNLLNDIVQTLSNTCKIRIGQVIKFEEDPRI
                     LYDALQLISLYDLMFERKDIKPTNLLIVNLRELSASCKEKIMEYFSNYNTEIKDLKYE
                     VTDDLLPPEWISDYLQTITRLFQLYEKDSSMDDLNGNDNESLITTDFLTNIIKTPFDT
                     VLSEQLKVAFPHAKRKDNESALLNTVQINCFDLIKTKLQPYKKSVFSKNESKAEIFNW
                     ITKKYDVSISTMLDLQNKLLFEKTGLGIYNNLLNMIFPVDSIQDELDLDMYYSLTENP
                     LMNLDKIRENIFDKLNEFLPIALTELQGQLLFKLTSPTIADHICQTCFSQLSKFYVTF
                     KKVLMHLYPDKKDDIASILKFTEKEFNTLAGIDDTLTNSGI"
     gene            complement(<334057..>335109)
                     /gene="TPHA0D01600"
                     /locus_tag="TPHA_0D01600"
                     /db_xref="GeneID:11534273"
     mRNA            complement(<334057..>335109)
                     /gene="TPHA0D01600"
                     /locus_tag="TPHA_0D01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685186.1"
                     /db_xref="GeneID:11534273"
     CDS             complement(334057..335109)
                     /gene="TPHA0D01600"
                     /locus_tag="TPHA_0D01600"
                     /inference="similar to DNA sequence:INSDC:YNL042W"
                     /note="similar to Saccharomyces cerevisiae BOP3 (YNL042W);
                     ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685234.1"
                     /db_xref="GeneID:11534273"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:G8BSH9"
                     /translation="MEGGNKENVLDEFIKALVKNGNIKDRNPPAALSDKTLDKLIELR
                     VEMEKTKQFYYILENKTKVVEILKLCEKLDLPKNEIIKYLESNGPSSLPVTPKSNIDE
                     LNGPQYKRKETALSNNERENTIESNSLPLSVPISKFNEINIAKSPDNKQNNEINTVRS
                     ENILPRMSPKRPIISPHSQSTELTSPINKKYSIDSKMPKKHLRTLSVPVLRLHQNSDI
                     PSSMTSILGFPKDTDDFQDHFTHTFAFEKPLNVTNKKQPFKSKHIKTSMSQEAPSNLK
                     KAYEVATNTSVAVPRYPLNQSAILTSHQTLKEDSSQKKNEIISSINNKIHKEINGRSL
                     SQTIHKSSLSELLNNT"
     gene            complement(<336422..>336952)
                     /gene="TPHA0D01610"
                     /locus_tag="TPHA_0D01610"
                     /db_xref="GeneID:11530930"
     mRNA            complement(<336422..>336952)
                     /gene="TPHA0D01610"
                     /locus_tag="TPHA_0D01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685187.1"
                     /db_xref="GeneID:11530930"
     CDS             complement(336422..336952)
                     /gene="TPHA0D01610"
                     /locus_tag="TPHA_0D01610"
                     /inference="similar to DNA sequence:INSDC:YNL044W"
                     /note="similar to Saccharomyces cerevisiae YIP3 (YNL044W);
                     ancestral locus Anc_2.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685235.1"
                     /db_xref="GeneID:11530930"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:G8BSI0"
                     /translation="MNQLGSLAQFASFTQNLSLENIKNELSSFQSKLASIRPPQEFFN
                     VKNFSNPKTFSEVQARVSYNLRYYSTNYTIIIGLLSIYTLVTNLLLLFVIIFSVAGVT
                     GISKLEGQDLNTPFGPLKTTQLYTALLCVSVPLGFLASPISTLMWLIGASIVTVFGHA
                     ALLEKPIETVFEEETV"
     gene            complement(<337644..>339878)
                     /gene="TPHA0D01620"
                     /locus_tag="TPHA_0D01620"
                     /db_xref="GeneID:11534436"
     mRNA            complement(<337644..>339878)
                     /gene="TPHA0D01620"
                     /locus_tag="TPHA_0D01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685188.1"
                     /db_xref="GeneID:11534436"
     CDS             complement(337644..339878)
                     /gene="TPHA0D01620"
                     /locus_tag="TPHA_0D01620"
                     /inference="similar to DNA sequence:INSDC:YNL045W"
                     /note="similar to Saccharomyces cerevisiae YNL045W;
                     ancestral locus Anc_2.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685236.1"
                     /db_xref="GeneID:11534436"
                     /db_xref="GOA:G8BSI1"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR012777"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR015211"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BSI1"
                     /translation="MSSSLSLSFSLSFTRTKLSHSRNSMPRMSESNFSINDNNHQNMT
                     YCALSSNANRGILLVAVMVVLYYLRTYKKRKIEKNAMSLPLRTSFKLVSKNSISKNIR
                     SVRHSIKMVKLPDILEQHRPASSPEVDYSTFSNYHLFNVQNTTLDLNINFKESLINGA
                     IQLELTRKDVKTNVVNLDTSFLTIHSIELNNSTVVAEDFKLNARIEPLGSKLEISNIK
                     KYINKDTAFNLKLSFSTTKDCTALQWLTKEQTNSDKPYVFSQLEAIHARSLFPCFDTP
                     SVKSTFVANITSELPVVFSGIEKNVTDNGNGTSTYSFQQQVPIPAYLVGIASGNLVNA
                     EIGPRSKVYCEPFRLDDCKWEFSGDVEKFIKAAEKIVFPYEWGSYDILVNVNSYPYGG
                     MESPNMTFATPTLIAYDKSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERR
                     ITGAIHGEPTRHFSAIIGWNDLENSIKAMANPNRFSTLVQDLKDGTDPDEAFSSVPYE
                     KGFNLLFHLENVLGGTAEFDPFIKHYFTKYSRKSLDTYQFLDTLFDFFEHKRDVLENV
                     DWKTWLYTPGMPPKPHFITTLANDVYSLANKWVENAKAMKTEEELKAIFSIKDVDNFN
                     SNQLVLLVDTLVQSETDDFKWSSYPVASNAFLSVYHEKVVKTRNAEVVFRVFRFEITA
                     CMEEHYQELAHWLATVGRMKFVRPGYRLLNSVDRDLAVKTFEKLQNIYHPICKALVKQ
                     DLGL"
     gene            <341072..>342925
                     /gene="TPHA0D01630"
                     /locus_tag="TPHA_0D01630"
                     /db_xref="GeneID:11530965"
     mRNA            <341072..>342925
                     /gene="TPHA0D01630"
                     /locus_tag="TPHA_0D01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685189.1"
                     /db_xref="GeneID:11530965"
     CDS             341072..342925
                     /gene="TPHA0D01630"
                     /locus_tag="TPHA_0D01630"
                     /inference="similar to DNA sequence:INSDC:YIL105C,YNL047C"
                     /note="similar to Saccharomyces cerevisiae SLM1 (YIL105C)
                     and SLM2 (YNL047C); ancestral locus Anc_2.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685237.1"
                     /db_xref="GeneID:11530965"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BSI2"
                     /translation="MSKHNTMTSTMSDILPQQHRNLQQLQNLQNRTKSLGVTNDYNPA
                     YLQSIQNNLLNNNMDPNGKNFQLPLSTINTNQSNSNSKMDKAYMGSGAPLLFNSTANG
                     LAPDVQRSSSTATNTVPNLNTSDVIFQHKTPAVNSATPLSRQNMQQDPRSPLVVLIPT
                     NSHPTEILATRFTAWRSVIKSLVTYLSEASSIQDEIVRQQLRLTHAIEFPFFSIENLY
                     QPSSQEDKNNQNFFLSLGNGSVQDLPTILNLYHSSLASNASKVSKELSSDIIPRLRDL
                     RGDLLIKIKEIKVLNSDFKNSCQKELQKTKDDLKVFLQSIEEARYGTPKQDPYLTKLV
                     LNRQIKKQLSEENFLHEAFDNLQSSAEELEKVVVMEIQNALTNYAKLLGQQSQLVFDV
                     LISKLDTGFFSKNPNFEWENFIARDPNFILPDIPMRKMNSIIYKNQNDPLTYEITSGY
                     LEKRSKFLKAYSKGYYVLSPSFLHEFKSPDRKKDLVPIMSLPLNECTVTEHSRKGSSD
                     YKFILHSKQNGLIIRGHNWVLKSDSYENMMLWYNLINDLTKLTDHQAKVDYVIKKINL
                     TGDAAQNVLLNREALKDEERIDKSINVENDDQNYDDLNMVPEITVSSPIKR"
     gene            complement(<343171..>344868)
                     /gene="TPHA0D01640"
                     /locus_tag="TPHA_0D01640"
                     /db_xref="GeneID:11531058"
     mRNA            complement(<343171..>344868)
                     /gene="TPHA0D01640"
                     /locus_tag="TPHA_0D01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685190.1"
                     /db_xref="GeneID:11531058"
     CDS             complement(343171..344868)
                     /gene="TPHA0D01640"
                     /locus_tag="TPHA_0D01640"
                     /inference="similar to DNA sequence:INSDC:YNL048W"
                     /note="similar to Saccharomyces cerevisiae ALG11
                     (YNL048W); ancestral locus Anc_2.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685238.1"
                     /db_xref="GeneID:11531058"
                     /db_xref="GOA:G8BSI3"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:G8BSI3"
                     /translation="MILITTILVLLISTLYLCFRVLLKITYEYRRPSSKFLREFKIDH
                     KENDSTLVIKSRFYLGCLRYQLLKASSHVTEYSNDDTFSSCLKVDRKEWDTVIANAGR
                     GSEEKLYTDNKLYGFFHPYCNAGGGGEKVLWKAIETVLRNDKKNVAIVYTGDVDASRS
                     QILDNVNTTFGYKLEESRVVFIYLRTRFLVSDRTWPVFTLLGQAFGSFILTVEAYWRC
                     PVDFWCDTMGYPFGYPAIRFMADMPIIAYTHFPVISTDMLDKLKFSETSNSFRTKAKY
                     IYWSIFMFFYEWVGSLVFVSITNSTWTNNHIKSIWRDSHSEIIYPPCSTERLVIKEDK
                     WNRKNQAVVLAQFRNEKRHQLIIQEYSKYLAELSTTENYEPPKIIFVGSTRSQNDKDY
                     VENLKRLAYINYRIPMHLMEFVTDAPYEDIKKYLHESSYGINAMWNEHFGIAVVEYAA
                     AGLIPLVHASAGPLLDIVVPWDVKNNKEAKVNNEQTRTGFFFISEEDPDYVKTANDKN
                     AYNSLKDIFKQVSELCDTEKFEISKRGKLCVSIKFSDAKFDEDWDKYVMDMLDLEII"
     gene            complement(<345272..>346177)
                     /gene="TPHA0D01650"
                     /locus_tag="TPHA_0D01650"
                     /db_xref="GeneID:11534419"
     mRNA            complement(<345272..>346177)
                     /gene="TPHA0D01650"
                     /locus_tag="TPHA_0D01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685191.1"
                     /db_xref="GeneID:11534419"
     CDS             complement(345272..346177)
                     /gene="TPHA0D01650"
                     /locus_tag="TPHA_0D01650"
                     /inference="similar to DNA sequence:INSDC:YIL106W"
                     /note="similar to Saccharomyces cerevisiae MOB1 (YIL106W);
                     ancestral locus Anc_2.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685239.1"
                     /db_xref="GeneID:11534419"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:G8BSI4"
                     /translation="MSFLQNFHLSPGQTIRSTRGFKWNTNNGNAASNDNDNYKNFNVG
                     GGTQANELNAPANIMNHNQYSQPTRVLPQTPTKQVNSSPQQITDFNYTPSHQQPYIQA
                     PVGTTVSSHQDLKQIVEMTLGSKGVLNQAVKLPKGENENEWLAVHCVDFYNQINMLYG
                     TITEFCSPQSCPRMIATNEYEYLWSFQKDQPPVSVSAPKYVEVLMKWCQDQFDDETFF
                     PSKTSGTFPNRFIQKVAIPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLF
                     VQEFQLLRPSDFGPLLELVNELRDR"
     gene            complement(<346631..>348877)
                     /gene="TPHA0D01660"
                     /locus_tag="TPHA_0D01660"
                     /db_xref="GeneID:11531045"
     mRNA            complement(<346631..>348877)
                     /gene="TPHA0D01660"
                     /locus_tag="TPHA_0D01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685192.1"
                     /db_xref="GeneID:11531045"
     CDS             complement(346631..348877)
                     /gene="TPHA0D01660"
                     /locus_tag="TPHA_0D01660"
                     /inference="similar to DNA sequence:INSDC:YHR031C"
                     /note="similar to Saccharomyces cerevisiae RRM3 (YHR031C);
                     ancestral locus Anc_5.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685240.1"
                     /db_xref="GeneID:11531045"
                     /db_xref="GOA:G8BSI5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028880"
                     /db_xref="UniProtKB/TrEMBL:G8BSI5"
                     /translation="MIRSNSKPVKKTSSNNKQPSIASFFSKNSNSASLKNSTTSNAFK
                     KSSRPSSPQKEISSNQKATQLNKKSMLLFSSQGSFDENDPDFEVKKLMNKPHLNHFKK
                     SRLTGSFGTLCRTSSNSSVSSSTISHHLIQDEMSDSISSITSFTSIKGSSPRKISFTR
                     NISNDTFTQSALSSKNPNASPFEEDFGEMTTSTQFSLSASQSSERSNGSTSSLKRLTF
                     QGLDLQTKRIKPIKRHKSSLSSSQNKNNLNNIFSELKLTKEQQHVIDLIIRKKFSVFY
                     SGSAGTGKSIILRTIIGRLNGLYGKDTIAVTASTGLAASTIGGVTLHRWAGIGLGGGS
                     LDSLVNKIQKNHELNASWKNTRVLIVDEISMVDGKFLDRLEEIARRVRKINRPFGGIQ
                     LVLTGDFFQLPPVSKKEYNEPPLFCFESNMWKLCVQKTILLTKVFRQQDNELVDILNK
                     IRFGEIEDHMVQRLRSLRNEKRYSDGIKPTELYATRREVESSNSRQLDLLLGEKHEYV
                     ADDTGPKELHNLIDSSVMVERKITLKENAQVMMLKNKVESELVNGSLGIVLFFIPQTL
                     EKKMNEIYRIMDEEAINDMKLVSKVVGNPRARLSKEFQEELNMRPFARMERLENILFY
                     ATTRVSPKDIKFPYVKWTLPLGRFHHELMLPDNFVVDLPGSHSALQRSQIPIMLCWAL
                     SIHKSQGQTLQRLKVDLRNIFEAGQIYVALSRAISMDTLQVLNFDPSKIKVNEKVKEF
                     YQKLETVS"
     gene            complement(<349304..>350014)
                     /gene="TPHA0D01670"
                     /locus_tag="TPHA_0D01670"
                     /db_xref="GeneID:11530995"
     mRNA            complement(<349304..>350014)
                     /gene="TPHA0D01670"
                     /locus_tag="TPHA_0D01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685193.1"
                     /db_xref="GeneID:11530995"
     CDS             complement(349304..350014)
                     /gene="TPHA0D01670"
                     /locus_tag="TPHA_0D01670"
                     /inference="similar to DNA sequence:INSDC:YKL159C"
                     /note="similar to Saccharomyces cerevisiae RCN1 (YKL159C);
                     ancestral locus Anc_5.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685241.1"
                     /db_xref="GeneID:11530995"
                     /db_xref="GOA:G8BSI6"
                     /db_xref="InterPro:IPR006931"
                     /db_xref="UniProtKB/TrEMBL:G8BSI6"
                     /translation="MTTNTLIITFTGFDSRYEDNVGAQLDAIMDFLKVWLYDNILTKF
                     EINNSNPLVLLKLEKFKRILIVAPDHQLSELIISSIVQSNHFSELYCRICYTLQDSKI
                     NERTYLEVPKSQKLFLISPPVSPPPEFDFERVEDEPSRITHHIDDAPKAMTSFPAETN
                     ELKTTATQDIPTLMLNGADKPDGHRLLLSSSVANITLQRRPSVSVNVDDEPHESVETF
                     KTVLPPKSTFDDDSDLEE"
     gene            <351459..>354089
                     /gene="TPHA0D01680"
                     /locus_tag="TPHA_0D01680"
                     /db_xref="GeneID:11534283"
     mRNA            <351459..>354089
                     /gene="TPHA0D01680"
                     /locus_tag="TPHA_0D01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685194.1"
                     /db_xref="GeneID:11534283"
     CDS             351459..354089
                     /gene="TPHA0D01680"
                     /locus_tag="TPHA_0D01680"
                     /inference="similar to DNA sequence:INSDC:YHR047C,YKL157W"
                     /note="similar to Saccharomyces cerevisiae AAP1 (YHR047C)
                     and APE2 (YKL157W); ancestral locus Anc_5.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685242.1"
                     /db_xref="GeneID:11534283"
                     /db_xref="GOA:G8BSI7"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G8BSI7"
                     /translation="MSNSEQREILPTNLTPLHYDVELEPNFDSFKYNGKTSIDLKVNS
                     ADNIIKLNVYEINVSKISLQLNDSTLIDVETFDNDNEAQILTINLANESVLKDFIGKT
                     IRLNIEFVGELNENMAGFYRAKYEDKITGETKYMATTQMEPTDARRAFPCFDEPNLKS
                     TFSITLISSPNYTHLSNMDVKSEVIDKETGKKITLFNVTPKMSTYLVAFIVAELKYVE
                     NRDFRIPVRVYATPGNEKDGQYAADLTAKTLSFFEKTFNIQYPLPKIDNVAVHEFSAG
                     AMENWGLVTYRVVDVLIDEKNATLDRVQRVAEVVQHELAHQWFGNLVTMDWWEGLWLN
                     EGFATWMSWYSCNEFQPSWNVWEQYVTDTLQHALSLDSLRSSHPIEVPVKRADEINQI
                     FDAISYSKGASLLRMISKWLGEDVFIKGVSNYLNEFKYSNAKTEDLWKALSAASGKDV
                     SKVMNIWTKKVGFPIIIVEEDPADPRKITLTQNRYLSTGDVKPEEDETLYPVFLALRT
                     KEGVDHSVVFNEKTTTINLKDDSDFFKINGGQAGIYITKYSDERYAKLSKQRDLLSVE
                     DRTGLVADVKGLASSGYTSTTNFLKLVSDWKNEESFVVWEQIINSLSGLKSTWIFESE
                     DVKEALDEFTRQLISEKIHKLGWTFTENKGETSSFAEQRLKVTLFSSAAAARDPVVER
                     AAMEMFEKYTSGDKNAIHPLIKPVVFATAGRIGGIENYEKIFNIYKNPETSDEKLAAL
                     RTLGRFNDPQLIQRTLGYLLDGTVLNQDIYIPMGGLRGHKEGIIALWKWMQENWDELV
                     KRLPPGLSMLGSVLVVGTSGFTSLESVKDIETFFKGKSTKGFDQNLAQSLDTITSKAQ
                     WITRDADLVKSYLKDNGFYK"
     gene            complement(<354215..>354703)
                     /gene="TPHA0D01690"
                     /locus_tag="TPHA_0D01690"
                     /db_xref="GeneID:11530992"
     mRNA            complement(<354215..>354703)
                     /gene="TPHA0D01690"
                     /locus_tag="TPHA_0D01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685195.1"
                     /db_xref="GeneID:11530992"
     CDS             complement(354215..354703)
                     /gene="TPHA0D01690"
                     /locus_tag="TPHA_0D01690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685243.1"
                     /db_xref="GeneID:11530992"
                     /db_xref="UniProtKB/TrEMBL:G8BSI8"
                     /translation="MENDDTFQPKDNKSNSLLLASLLNIGLYSLINLIIVGLVFMVIA
                     LRRRKVKAALPRNSSPYSDSMKGVSPICIDNTILYPNLNFTTNDEVYYISKIDDTYVQ
                     QMRTYILDSHGEIMKDLPRTMTKAITTTRRLYFIRNSLSYIQKIRLKGFWKPFNRKNT
                     TS"
     gene            <355499..>356236
                     /gene="TPHA0D01700"
                     /locus_tag="TPHA_0D01700"
                     /db_xref="GeneID:11534147"
     mRNA            <355499..>356236
                     /gene="TPHA0D01700"
                     /locus_tag="TPHA_0D01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685196.1"
                     /db_xref="GeneID:11534147"
     CDS             355499..356236
                     /gene="TPHA0D01700"
                     /locus_tag="TPHA_0D01700"
                     /inference="similar to DNA sequence:INSDC:YHR044C"
                     /note="similar to Saccharomyces cerevisiae DOG1 (YHR044C);
                     ancestral locus Anc_5.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685244.1"
                     /db_xref="GeneID:11534147"
                     /db_xref="GOA:G8BSI9"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BSI9"
                     /translation="MVEFTVDVCLFDLDGTIVNSIEAVELAWIKLCKAYNVDHIEVLK
                     FSHGVRSIDVLVKFFPDIDNTDNAGVKLLESSIATEFANLVKLIPGSKDLLLSLDVNT
                     DGLAYGERKWAIVTSGSPYSVFSWFDNILKDVKKPDIFITGFDVKAGKPDPEGYASAK
                     EQLCKLWKFDSQKARAVVFEDAPAGVIAGKAMGATVVGITSSHSKEVLFEAGADYVVY
                     DLTQVSVVKNTRDDGITIKVVDPISKY"
     gene            complement(<356399..>357559)
                     /gene="TPHA0D01710"
                     /locus_tag="TPHA_0D01710"
                     /db_xref="GeneID:11531032"
     mRNA            complement(<356399..>357559)
                     /gene="TPHA0D01710"
                     /locus_tag="TPHA_0D01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685197.1"
                     /db_xref="GeneID:11531032"
     CDS             complement(356399..357559)
                     /gene="TPHA0D01710"
                     /locus_tag="TPHA_0D01710"
                     /inference="similar to DNA sequence:INSDC:YDR282C"
                     /note="similar to Saccharomyces cerevisiae YDR282C;
                     ancestral locus Anc_5.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685245.1"
                     /db_xref="GeneID:11531032"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ0"
                     /translation="MSLRHAMTPWRILRFQSLNSFHLQNIRRVNSKSIFLNSNTNIKT
                     TSNNTKRYPKSIKVNPSKHLRRNVGKKSGSHDDQETANVLSTYKVKTCSVITTAEKYN
                     LEKGIALLRDRGIIPVTLIPDEIITFKYIHEGEKTDIMVLADNGSVISWGLNEKELLD
                     NFIPILSEARINPLDESKYETEDIDFIEIENSKALSKNMESHLHNGSYIMDDLLIVNS
                     IDPELGLLDKAAFSSGIARSTSLAVLEAALEEHTQKSRIITEKFSRGIQINLKEKHFL
                     TSIGKLFLIRGRLNLYSNIIETPDLYWSEPRLEKIYKNVSHFLDIAPRINILNSKLDY
                     CTDHSRMLLSVLNEKKGTFLEWIIIYLITVEVCFELHHYWVSFQNSKEEKTI"
     gene            complement(<357988..>358872)
                     /gene="TPHA0D01720"
                     /locus_tag="TPHA_0D01720"
                     /db_xref="GeneID:11534437"
     mRNA            complement(<357988..>358872)
                     /gene="TPHA0D01720"
                     /locus_tag="TPHA_0D01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685198.1"
                     /db_xref="GeneID:11534437"
     CDS             complement(357988..358872)
                     /gene="TPHA0D01720"
                     /locus_tag="TPHA_0D01720"
                     /inference="similar to DNA sequence:INSDC:YDR287W"
                     /note="similar to Saccharomyces cerevisiae YDR287W;
                     ancestral locus Anc_5.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685246.1"
                     /db_xref="GeneID:11534437"
                     /db_xref="GOA:G8BSJ1"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ1"
                     /translation="MVLSSNELKDIENKIIDLLNNEIGPIIKKRTGTTFGEYSDKTNS
                     TDIVTEVDKSVEKKIKEFISENYPNFSFIGEETYIKGETKIGPEPTFIVDPIDGTTNF
                     VHAFPFSCTSIGLSENGDSVLGVVYNPHIDQMFHGSKGNGSYLNGERLDVKKRPLDFT
                     SSLVALESGYERGDTGNFLIKSKLCKAMLSENGAHVHGVRSLGSAAMNICYAAAGYLD
                     CYWEGGPWCWDVCASKCILEEAGGILVGGNKGVWDIHLNERVYLAVRGGTTEAEQKKY
                     VEKFWSYLEGDLVYEYSH"
     gene            <359349..>359684
                     /gene="TPHA0D01730"
                     /locus_tag="TPHA_0D01730"
                     /db_xref="GeneID:11530946"
     mRNA            <359349..>359684
                     /gene="TPHA0D01730"
                     /locus_tag="TPHA_0D01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685199.1"
                     /db_xref="GeneID:11530946"
     CDS             359349..359684
                     /gene="TPHA0D01730"
                     /locus_tag="TPHA_0D01730"
                     /inference="similar to DNA sequence:INSDC:YDR286C"
                     /note="similar to Saccharomyces cerevisiae YDR286C;
                     ancestral locus Anc_5.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685247.1"
                     /db_xref="GeneID:11530946"
                     /db_xref="InterPro:IPR008554"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ2"
                     /translation="MIQRVFSRSIHYSRPAQNLNNVRLTLFSKANCGLCTKAKTVLSS
                     VLEEDKYKDKVQLNLIDIDSPNNKEWWDKYCFDIPVLHIENNKSGEISKIFHKMTESE
                     VKDGIHEME"
     gene            complement(<359929..>362574)
                     /gene="TPHA0D01750"
                     /locus_tag="TPHA_0D01750"
                     /db_xref="GeneID:11530961"
     mRNA            complement(<359929..>362574)
                     /gene="TPHA0D01750"
                     /locus_tag="TPHA_0D01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685200.1"
                     /db_xref="GeneID:11530961"
     CDS             complement(359929..362574)
                     /gene="TPHA0D01750"
                     /locus_tag="TPHA_0D01750"
                     /inference="similar to DNA sequence:INSDC:YDR285W"
                     /note="similar to Saccharomyces cerevisiae ZIP1 (YDR285W);
                     ancestral locus Anc_5.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685248.1"
                     /db_xref="GeneID:11530961"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ3"
                     /translation="MSNFFRDNSVAFKPRTNIFSRLSLRDQNEQSTNLNDISEAKRKD
                     EIKGNLNSVNETFYGSNSEHSSQMFSSAILSPDNTNATEDTTGNIMDKKAIKDNKDIS
                     VAPSISNKKFDESEEDELEITEVRNLTPTNMFYPDTANNYPEDTSTVVDKKLTSINTG
                     AKNTDTNYNNHSLETSSNDVLLDAFNNTQKICSVLKIELQNAQQDNKKLKNKIQATDE
                     ETNKLASKFAEYKKKICDLEQKIKWFDEQKNHNDNKLHDLKKTNQLVVAKINDLKTNY
                     ESIGVTVSNLKRSKMMTETELNKKNKEIEYLQKELDDCSGQLSEEKIRNNNLILEFNT
                     IKTQNTEINESMKKNFNEFDSMLKTFINERFINCLKDESSNTKEEILKTFEIKLKENE
                     NNIKQNYQDDVVILKEFCKTENNNIINSINSSFSNTVSDSSSTLEKSIMQNIHNGNDK
                     VIENSNNMKNCIDEVKIQLVEDRNQINAEISKFSSLMSEYKEFEKKLETVSQENTELK
                     IQKTQLLTSIGTKEAQYEELLNQVGNLKLSTTTLEENEKCLKDQTEKLLEKVSEYEKS
                     IERLKNLESNSSANYENKLASQVTISNTLTSENDMLKNMVKRLEESKEQLSHENNKKF
                     ENHQKLLDQVSELNIELVHLKAGELELKEENYTLKKTIENNKSNFEENSSSVKRFQQK
                     IIELESDKQEYMSEKLDLLDKIEEKENRILKLANEVKVLEKETNQLKNYKNAQSNMSR
                     PNATTSKPNNIQKRDTKTLEGEKDSLLLSQLENTTNKKRKKTIAKEKLIIQEEPKEDN
                     IIKSYDNFDLSSSLNDDLEMIFPSQVELKINKKPNQRNNSHYTHDPYPNTRKKMLLSD
                     DFTSKLEKGPNPVQTSSVKKRKGIK"
     gene            <363678..>364586
                     /gene="TPHA0D01760"
                     /locus_tag="TPHA_0D01760"
                     /db_xref="GeneID:11530967"
     mRNA            <363678..>364586
                     /gene="TPHA0D01760"
                     /locus_tag="TPHA_0D01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685201.1"
                     /db_xref="GeneID:11530967"
     CDS             363678..364586
                     /gene="TPHA0D01760"
                     /locus_tag="TPHA_0D01760"
                     /inference="similar to DNA sequence:INSDC:YDR284C"
                     /note="similar to Saccharomyces cerevisiae DPP1 (YDR284C);
                     ancestral locus Anc_5.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685249.1"
                     /db_xref="GeneID:11530967"
                     /db_xref="GOA:G8BSJ4"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ4"
                     /translation="MIIDRSRLIRGISVSSLDSNRSSKWRIGDLLLLVLLLILNIPVY
                     YFQPFERQFYINDLTISHPYAEHQRVSDFMLFVYSLIVPLITMAIVWFLFSDAKHRWH
                     LLYVSVLGLVLSVTSVALFTNFVKNWFGRARPDFLARCIPTEGTPINVLVNARDVCTS
                     KDWDKILEGFRTTPSGHSSESFAGLGFLYFWLSGQLLTGNIHAALWTKAIALLPLLGA
                     TLIALSRTQDYRHHFIDVLLGSFIGFVFAFCTYRRYFPSIYDPLPFKPLLDDSNVTLQ
                     NNDHHYLPTSNNINEEVDPESRPFTV"
     gene            <365255..>370279
                     /gene="TPHA0D01770"
                     /locus_tag="TPHA_0D01770"
                     /db_xref="GeneID:11530951"
     mRNA            <365255..>370279
                     /gene="TPHA0D01770"
                     /locus_tag="TPHA_0D01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685202.1"
                     /db_xref="GeneID:11530951"
     CDS             365255..370279
                     /gene="TPHA0D01770"
                     /locus_tag="TPHA_0D01770"
                     /inference="similar to DNA sequence:INSDC:YDR283C"
                     /note="similar to Saccharomyces cerevisiae GCN2 (YDR283C);
                     ancestral locus Anc_5.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685250.1"
                     /db_xref="GeneID:11530951"
                     /db_xref="GOA:G8BSJ5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR016255"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024435"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ5"
                     /translation="MSSRLTLSEYYDIQKDEREALRSIYMDDFMDLTRQKSSWDKQPQ
                     IIFEISLRSVEKVPLESKITIHVAMTPMYPYTAAEVSFNNVENVMDSRLDLIKKKFKE
                     IHKYAKGQEHIFEIASAVQEQLDDSQNIANPQSLEEERLQRIQEEKEQLEKEEKEKAL
                     EKERNRLNEQKRIDEIIQKELEKRQDTEDEALFNRDTSINLVPPSEWISSGEAIVFPK
                     DIRAQLPNNSLYKFRAVVNPTPIKVPHDLMSFGTQYLVKPYVPPESPLADILMTSEVM
                     QDFCYLLTEIELDNSYFNTSNGKKEIAHLEKELDSLIKVNHDNVYKLYSYTIERLGNN
                     NSTFVWKIRLLTEYCVSFPLYDLLESVGFVNLATARIWMIRILEGLEALHKAGIYHKG
                     ISLRCIALVKDNDFGTTIPKLMHPSYGYTLMNMLNRYPNKSGIIEKPYIPWPAPELTN
                     NKSSKPQRLTDIWELGVVFLQIINGIDTVLNFASPQEFLESTPLEQTLYDLLVKMLDN
                     SPKSRFGALELLPMKFLRTNIDPNTTKNLAPMDGSLMNSENILSSVSALNGGSRTMSQ
                     SSNRRRSFNIGSRFYSVNPTVTSRYASDFEEIAILGQGAFGQVVKARNTLDSRYYAVK
                     KIRHTEEKLSTILTEVMLLASLNHQYVVRYYAAWLEEDMVNESAIISEDEESSSSDEE
                     SSSSNEESSSSNDDSNIEFKNSSFDEDDIFNHSSIFESRTNLELNDGNWDFISNSGFP
                     EIEFANSTNINEEGEESNSSDDEGDESSSSSDNISSASESGLKMTVSRTKPTNKKKST
                     LFIQMEYCENRTLYDLIHSENLSKQRDEYWRLFRQILEALSYIHSQGIIHRDLKPMNI
                     FIDQSRNIKIGDFGLAKNVHKSLDISRLDTQSLAGSTDNLTSAIGTALYVAIEVLVGK
                     GSYNQKIDMYSLGIIFFEMVYPFSTGMERVLILKDLRKSSITFPKSFDGSKMGTEKKI
                     IRLLLDHDPTKRPDAEKLLNSGWLPVKHQDIMMKDALKNLADPSSPWQQKVRETLFTQ
                     PYSLTNDILFDNSQSTGTSFTQILRSKMMEEVVTIFRKHGGIENNEPPRIFPKAPMYS
                     NQNVYEILDKNGTVLQLQYDLTYPMARYLSKSPNCSTKHYRFQHVYRPPPTSSSTMEP
                     RKFGEIDFDIISYSSIDSAFHDAETIKIIDEILTVLPVFEKTNTLFIMSHADILDSIF
                     NYCNIDKAQRPLISRMLSQIGFAKTFRDVKNDLRSQLNISSTSLNDLEFFDFKLDFDS
                     ARKRLHKIMVDSSHLKKIDESLLYISKVINFLKPFEVTRNIVISPFANFNSAFYKGGI
                     MYQAVYDDGSARSLVAAGGRYDNLITYFSRPSDEKTNTSRRAVGFNLAWETIFTVAQN
                     FFKLAHSRKVKNRNKFLKETTIDWKPSRVDILISSFSNSLLNTVGVEILTRLWKNNIK
                     ADLLRNCNSVEDVVSGAQKDGVDWIVLIKQQNYSGGSTNKKYKPLKIKRLSTSTDIDL
                     NLDEFLQLYQQDMKGSSYFQNDRTPIGDVNFEEQNNWDEISSASSSQGGLDAKDDRRS
                     NQKVIYVPNLAAKSRKYSKREKWVYEDSARDASQSIIHSLSNAPVITVDSIREETMEM
                     ITITSLAQKDEWLRKVFGSSNNATPRSFATSIYSVLSKEAAKGHKWAILYSNRENQSY
                     VVDLQR"
     gene            <370704..>371369
                     /gene="TPHA0D01780"
                     /locus_tag="TPHA_0D01780"
                     /db_xref="GeneID:11531074"
     mRNA            <370704..>371369
                     /gene="TPHA0D01780"
                     /locus_tag="TPHA_0D01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685203.1"
                     /db_xref="GeneID:11531074"
     CDS             370704..371369
                     /gene="TPHA0D01780"
                     /locus_tag="TPHA_0D01780"
                     /inference="similar to DNA sequence:INSDC:YHR041C"
                     /note="similar to Saccharomyces cerevisiae SRB2 (YHR041C);
                     ancestral locus Anc_5.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685251.1"
                     /db_xref="GeneID:11531074"
                     /db_xref="GOA:G8BSJ6"
                     /db_xref="InterPro:IPR013921"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ6"
                     /translation="MTRTAVIFNEKATPDALVEFKDALSNTLTSILEPWSLEFKTFRK
                     TTKNERSSNSSNIMYSVSFAHHDKGTVLIHDKYAIITTNNSNDIPKDLILNTCSTGTT
                     EPIDNLLALRLSNIWSQRQGIRGDAGETLQTTNLIVRVVNLFSSTGFKGLLIELNSLD
                     DDVSEEEFKISVDHVQTVLKDINCKDFKLSTDRLNFNENNGNRKLNILSDLAYQYIQV
                     LEY"
     gene            complement(<371504..>372634)
                     /gene="TPHA0D01790"
                     /locus_tag="TPHA_0D01790"
                     /db_xref="GeneID:11534130"
     mRNA            complement(<371504..>372634)
                     /gene="TPHA0D01790"
                     /locus_tag="TPHA_0D01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685204.1"
                     /db_xref="GeneID:11534130"
     CDS             complement(371504..372634)
                     /gene="TPHA0D01790"
                     /locus_tag="TPHA_0D01790"
                     /inference="similar to DNA sequence:INSDC:YDR289C"
                     /note="similar to Saccharomyces cerevisiae RTT103
                     (YDR289C); ancestral locus Anc_5.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685252.1"
                     /db_xref="GeneID:11534130"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ7"
                     /translation="MQFSSEQFVNRLNTLEDSQESIANGSKWLLSQYKYTDDIMTVWQ
                     DYMLNKNNNTRRKLMSVYLINHVVQESKRKKIVNFYGNDKFGSSVINVINKIYFTLPS
                     DLKKKVKRVLTIWKDRKIFSNVVLQDIDSSIFQESEEVPNKTGKQTSSIDSTSESSKN
                     KFEQTLSANLRELASKETELVKTTQSVNASYLRFKDIMKTNSRDNLNAIGDSTKLLIE
                     SNITIRTLKRDILNKLLEENDKLIEDEQNLLGEIDMILHSNTISNDQNYNNDNDDVLP
                     TYEDNKDESDSDSDISTDGKGNGGDKITSNESTMQKRTSELSATDDSEIDTQRKNQKA
                     QMNLLSILREMDRITVVVSRVMIMLIHQTTIKILSRRVFKIY"
     gene            <373610..>375421
                     /gene="TPHA0D01800"
                     /locus_tag="TPHA_0D01800"
                     /db_xref="GeneID:11534139"
     mRNA            <373610..>375421
                     /gene="TPHA0D01800"
                     /locus_tag="TPHA_0D01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685205.1"
                     /db_xref="GeneID:11534139"
     CDS             373610..375421
                     /gene="TPHA0D01800"
                     /locus_tag="TPHA_0D01800"
                     /inference="similar to DNA sequence:INSDC:YHR039C"
                     /note="similar to Saccharomyces cerevisiae MSC7 (YHR039C);
                     ancestral locus Anc_5.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685253.1"
                     /db_xref="GeneID:11534139"
                     /db_xref="GOA:G8BSJ8"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ8"
                     /translation="MSCLEYLTLNNAVTVVIGYVVFVYVYDAIFNDIRPIDANIVKDK
                     LEVPYDIIKKSWKSEKTEPPEKPGQRLIHSYCPATGQYIDSFESKTAADIDSMIKNAE
                     TAQQKFKKTSFAKRKLVLKTLESFILNNQDLLAKVACRDSGKTMLDASMGEILVTLEK
                     LKWILKHGEKTLKPSKRSGPTNFFMKFYKGAEIRYEPLGVISSIVSWNYPFHNLMGPL
                     IAAIFTGNAIVVKCSEQVVWSSEFFIKLVREILILCDEDPNLVQLCYCLPPNAEDDAA
                     NYFTSNSGFKHITFIGSQPVSHHILKCAADSLTPVVVELGGKDAFIVLDSVKNLDALS
                     SIIMRGTFQSSGQNCIGIERVIVSEKNYDSLVKILDKRMNENPLRQGSDIDKISTVDV
                     GAMISDNRFGQLEKMVEDAVSKGARLLKGGKRFNHPQFPNGNFFEPTLLVDVTPDMDV
                     AQNEVFGPILVMMKAKNTDDCIDLANSAPFGLGGSVFGADYTECNYVCDNLKTGNVAI
                     NDFATFYVCQLPFGGINGSGYGKFGGEEGLLGLCNAKSVCYDTLPFVSTQIPPPLDYP
                     IKSNETSWNFVKSFITGAYTDSIWQRIKSLISLAKNS"
     gene            complement(<375570..>376289)
                     /gene="TPHA0D01810"
                     /locus_tag="TPHA_0D01810"
                     /db_xref="GeneID:11534274"
     mRNA            complement(<375570..>376289)
                     /gene="TPHA0D01810"
                     /locus_tag="TPHA_0D01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685206.1"
                     /db_xref="GeneID:11534274"
     CDS             complement(375570..376289)
                     /gene="TPHA0D01810"
                     /locus_tag="TPHA_0D01810"
                     /inference="similar to DNA sequence:INSDC:YHR038W"
                     /note="similar to Saccharomyces cerevisiae RRF1 (YHR038W);
                     ancestral locus Anc_5.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685254.1"
                     /db_xref="GeneID:11534274"
                     /db_xref="GOA:G8BSJ9"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="UniProtKB/TrEMBL:G8BSJ9"
                     /translation="MLSKRLLNLTSGSNRFFFSSSLVLKKQSKVNNKSNSNNKNNDKT
                     NNNTDTEGTIDPFIYLKDANERFKATVEAHGKKLNEMKQGKANPSIFNNLVLADGSKF
                     LDVASTTLKGKNSLIVTVFDPNNTKNVISTIMAAGLNLNPEKDANNDQLLKVLLPPPT
                     TESRLQLCKEMKQVFENYKNSQSKQSLGFIRGEVLKQLKGFDKKNDSVRKVLQDLDKT
                     HKEFTTKLQEQLKQAEKSLLS"
     gene            complement(<376666..>380529)
                     /gene="TPHA0D01820"
                     /locus_tag="TPHA_0D01820"
                     /db_xref="GeneID:11534564"
     mRNA            complement(<376666..>380529)
                     /gene="TPHA0D01820"
                     /locus_tag="TPHA_0D01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685207.1"
                     /db_xref="GeneID:11534564"
     CDS             complement(376666..380529)
                     /gene="TPHA0D01820"
                     /locus_tag="TPHA_0D01820"
                     /inference="similar to DNA sequence:INSDC:YDR293C"
                     /note="similar to Saccharomyces cerevisiae SSD1 (YDR293C);
                     ancestral locus Anc_5.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685255.1"
                     /db_xref="GeneID:11534564"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BSK0"
                     /translation="MSDYNNNKKNSYVQTIGGRNNPKQIHVAHRRSQSELTNLMVEQF
                     TLQKQLENVQLQQQALLQQGQGQGQGQYYNNNVKSRSHSRNNSNYNNYSYDNNSSHGY
                     GGYGQGHGRTYSQNQSHSQSQYNSDLQGQSQSHRRTGSQSSGVYGHSRRQSLVLNEAK
                     KAAAEEQAKRHSVVNIEEDDNVPSLSPPFDSASTAPALGATDEVLRNQAGFKFPAAPA
                     ASVSHNSRNSSPQRKGNNNNSNIPTFKFPPAPAAAVNDVDNNTNNNDFSFPHRRSQSR
                     SNEASNNWRSPQNHLQPSNRANNNNTNGNNEQGQSQYHRYHNSTSSNFGSFDYSSSNG
                     YNSQFQPGHKQKQSNGSIQIFNNQNQQQRKSLFAPYLPHANIPQLINEGRLVTGILRV
                     NKKNRSDAWVSTDGVLDADIYICGSKDRNRALEGDLVAVELLAVDEVWDAKKEKEEKK
                     RRKDVANHNITENGMSANNNTAAVAADEDYHNDASAAIPMVSGVSRNSSIKTSFSYDG
                     NKNVESELAGSSSSVKRKGSLKQRPTQKKNDDVEVEGQSILLSEEEEINDDFKPLYAG
                     HVVAVLDRIPGQLFSGTLGLLRPSQQNQNQKQNQHNDRNQSHAPRIVWFKPTDKKVPL
                     LAIPTEFAPKDFVDNSDKYADKLFVASIKRWPITSLHPFGILISELGDINDPDIEINS
                     ILRDNNFSVNEYADPKNQLMEKPSFETIPLTEDDFKERLSFSSDAKTINHNQCNILAF
                     SETGTYSEFAIHVKNNDDGTIELGCHVVDITAHIEDGSSLDRRIRKRSTGVFLPQKYV
                     NLLPEQLTKLWSFEKDKKSATLSVLFTLDPKTYAIESTWVGESSIKPDLLMTIEDINN
                     ELKIEDVNKPSYLSKIKDIATSFYSKRTGYPNSSLLPSFSLLKSLDDEMVKIDLNIFE
                     KTIGFQILNELQIQTNAKVAETLYTKLGSSALLRRQLQPVSNKLESFKLKAERLGHDI
                     DISSSDSILKSILSIENLEERRIVELLLYKINSRAKYFVAGKVEPDQFGHFVSNLPLY
                     THFTSPMKRYADHVVHRQLRSVIKNVPYSEDIDSLKITADYCNFKKDCAFHAQQQGLH
                     LFLSQTINDMSSINSQILTMARVTQVYESSFDVLIPEFGIEKRVHGDQLPLMKAEFDS
                     MNRILELFWEKGVDSATFVPNDEKSQNSYRNSIRNKFKSTSSEIAETEAEAISGNISL
                     VSETLATKLEKLNLSAPKIKFPKDYSNTNLLDSFLKTTCIKQDEGNNIQEIKELQELP
                     VLLRAEIGMALPCLSVRALNPFVRK"
     gene            complement(<381538..>382938)
                     /gene="TPHA0D01830"
                     /locus_tag="TPHA_0D01830"
                     /db_xref="GeneID:11534562"
     mRNA            complement(<381538..>382938)
                     /gene="TPHA0D01830"
                     /locus_tag="TPHA_0D01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685208.1"
                     /db_xref="GeneID:11534562"
     CDS             complement(381538..382938)
                     /gene="TPHA0D01830"
                     /locus_tag="TPHA_0D01830"
                     /inference="similar to DNA sequence:INSDC:YHR036W"
                     /note="similar to Saccharomyces cerevisiae BRL1 (YHR036W);
                     ancestral locus Anc_5.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685256.1"
                     /db_xref="GeneID:11534562"
                     /db_xref="GOA:G8BSK1"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:G8BSK1"
                     /translation="MIIEPGNGLDLLASKDCSSYYEKDFKNQNSHDIIDKYLKYTPNN
                     PSPLRKALEIYSDVGYDGESSGYNFSDDEIGYFDDEHNHIETGGNKKRKRRYRYSSDE
                     ERLKLLTKHIDYQDQPVKKRDIIKDVIFKINKRIRKIKKCIYCIDFFVIMGAMKVILS
                     PSRLGILISSILYGIKLRPNGEESKYDIYYNSTSKVRVFDNGQHIEEAYGSQLNNNID
                     DEIENLLYNDSSSYQLYKEYGLRSRLVKPPLLSKKLLSDNNLIDDQNNLKSYHGESDS
                     NVIEFHQNEDAATTNNNNNNNNNNKTLNNRTSIQSKRDAMIIEQQKHRRKRYDLNQDI
                     YKLPSPFFNNGHCKPKYYSIYNLTYISQLFINTIISIFIIMIIFTGIKFTIKNEILDK
                     LSDTKLKLSIESIECIKNYEKNHCGSGKVKAMMIEKHCLNWKSCINNNKDFFHIWQQS
                     GIKLHLIIINGLKIYS"
     gene            complement(<383875..>385623)
                     /gene="TPHA0D01840"
                     /locus_tag="TPHA_0D01840"
                     /db_xref="GeneID:11530932"
     mRNA            complement(<383875..>385623)
                     /gene="TPHA0D01840"
                     /locus_tag="TPHA_0D01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685209.1"
                     /db_xref="GeneID:11530932"
     CDS             complement(383875..385623)
                     /gene="TPHA0D01840"
                     /locus_tag="TPHA_0D01840"
                     /inference="similar to DNA sequence:INSDC:YDR294C"
                     /note="similar to Saccharomyces cerevisiae DPL1 (YDR294C);
                     ancestral locus Anc_5.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685257.1"
                     /db_xref="GeneID:11530932"
                     /db_xref="GOA:G8BSK2"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8BSK2"
                     /translation="MDSEYPEGLETYSICQEIVNSILQFDTKKACILVNNGRSGLVSY
                     FKETALLELFKQYLLIVFVLGFVNKVFQYIKWYGLFGSIRRLYRCVAKKIFVLLLNSP
                     FLRKTVEKEVKTATDTIEKDLIKNSDSLIDFEELPKHGLSNKEVLNELDKLQNCLPYS
                     HWEDGRVSGAVYHGGDELIKLQSQAFEMYAVANQLHPDVFPGVRKMESEVVSMTLKLF
                     NAPENTGCGTTTSGGTESLLMACLSAKWYGYHHKGIKNPEMIVPVTAHAGFDKASYYF
                     GIKMHHVEVDPVTYKVDLKKVESFINRNTVLLVGSAPNFPHGIIDDIEGLGKIAKTHN
                     IPLHVDCCLGSFIVAYMKKAGFTDIPLFDFQVPGVTSISCDTHKYGFAPKGSSIIMYR
                     NADLRKQQYFVTSDWVGGLYGSPTLAGSRPGALVVGCWATMVHLGEDGYISSCKEIIG
                     AAKVLRNYIEENIPQLTIIGDPKLSVISFKSDVINVYDLADKLSAKGWHLSSLQNPAA
                     LHFAITKLSVPSVDLLATTLKELVAEELHNSTGISSTVGTSAIYGVAGSVKTTGISDK
                     LIVSFLDTLYKVKPTD"
     gene            complement(<386116..>388167)
                     /gene="TPHA0D01850"
                     /locus_tag="TPHA_0D01850"
                     /db_xref="GeneID:11531026"
     mRNA            complement(<386116..>388167)
                     /gene="TPHA0D01850"
                     /locus_tag="TPHA_0D01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685210.1"
                     /db_xref="GeneID:11531026"
     CDS             complement(386116..388167)
                     /gene="TPHA0D01850"
                     /locus_tag="TPHA_0D01850"
                     /inference="similar to DNA sequence:INSDC:YDR295C"
                     /note="similar to Saccharomyces cerevisiae HDA2 (YDR295C);
                     ancestral locus Anc_5.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685258.1"
                     /db_xref="GeneID:11531026"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="UniProtKB/TrEMBL:G8BSK3"
                     /translation="MSSKNLNVFYIPVGLTSFQKDLIEILISIHSKAFKTELGIGEGD
                     SVKAEEDRKDTNTSLTTLSNIQMTYMFDSGIWSVLNHPCLIVDHYMPRQFLLMEPTER
                     LINSSDKFKQLDMFLTSLLSRNRTTFPGVVKIALVSHGVRELDLLESYILGKKLKILR
                     LSGKSLYKEGYQYPVSSENNKQKSKRRKKDSSSDSSSSHDSSPNTTAANRYTGYAKDD
                     YDYSSKRNKNLDSKEEKEDWIFLTTSNHLLNNPKLLSEYDIDIIISFDPLLDPNMEAF
                     KNIKNLKNNKTAKKLSIIKLVVKDSPDHFILHKKMSYKKDNYQNILKSITHFLLTRES
                     VIPTTTIACKSNEKIETTERYPKIAYREFIEKLLLGEDIKRILPELELSTNTHLNDED
                     EILKCCKSTLCPLDYSDLQLDNDTTITNIKTYQSTLMKRTIERMKSLQNDYGIKKNII
                     LNKRVEETNIQNSFDELKHSIGETFKKSQEMEKLANNSEKTLEKAQSEKDKLKAKLTK
                     LQSKKLELSKLLSAETDSAVSDLKTNYLSQIENFTKEFEQIKKINDDLSKKNDDLRLD
                     YQQKSSKAAELAQTLKSEIERHDSLKKLLEGPTASLEYQSAVDLEKRLLNDKLNLKNE
                     NNLLKSYMEQVKKQYEANRTGGLKATSSSSATNSPNSSSSDTPSNQTSTNKYGRQRST
                     R"
     gene            <389368..>390042
                     /gene="TPHA0D01860"
                     /locus_tag="TPHA_0D01860"
                     /db_xref="GeneID:11531061"
     mRNA            <389368..>390042
                     /gene="TPHA0D01860"
                     /locus_tag="TPHA_0D01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685211.1"
                     /db_xref="GeneID:11531061"
     CDS             389368..390042
                     /gene="TPHA0D01860"
                     /locus_tag="TPHA_0D01860"
                     /inference="similar to DNA sequence:INSDC:YDR296W"
                     /note="similar to Saccharomyces cerevisiae MHR1 (YDR296W);
                     ancestral locus Anc_5.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685259.1"
                     /db_xref="GeneID:11531061"
                     /db_xref="InterPro:IPR024629"
                     /db_xref="UniProtKB/TrEMBL:G8BSK4"
                     /translation="MSGTSVKKVVGAARFRPTKWLKAAGYSPQVFVFRNLQSGQVLYS
                     QLPNFTDKQIDNQFQRPNWENKKPSTRRDLWKCMCVIDMPNHEGSVQLYQNLVRLRYL
                     RDVTLKGDAKAMRKKNGDGNTWFSGLYRPTYTQEAVADIIESLRKIKHNDAEQKLIDS
                     DSNAITIHWEDIWRMGDKTKHWDPLLLNINHTEIERTGNTSREESVILKQLGELAKQA
                     TDKSKA"
     gene            complement(<390494..>391117)
                     /gene="TPHA0D01870"
                     /locus_tag="TPHA_0D01870"
                     /db_xref="GeneID:11531064"
     mRNA            complement(<390494..>391117)
                     /gene="TPHA0D01870"
                     /locus_tag="TPHA_0D01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685212.1"
                     /db_xref="GeneID:11531064"
     CDS             complement(390494..391117)
                     /gene="TPHA0D01870"
                     /locus_tag="TPHA_0D01870"
                     /inference="similar to DNA sequence:INSDC:YDR298C"
                     /note="similar to Saccharomyces cerevisiae ATP5 (YDR298C);
                     ancestral locus Anc_5.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685260.1"
                     /db_xref="GeneID:11531064"
                     /db_xref="GOA:G8BSK5"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/TrEMBL:G8BSK5"
                     /translation="MSGRLFIRSLATNARSIRSPVQLFGLDGTYATALFTASAKATSV
                     EDASTSLSKLSEVIKSDENLTKDILDNPALSSQQREIVVEQLVKLTNVNDASVKNLLS
                     LLAENNRLALLPKISKQFQTLVDAHNGLVQGFVTTAQPLDAKNFKRIEKSLTQSALVG
                     KGKTLKLINLVKPEIKGGLIIEIDQKTVDLSVATKLQKLNKALKEDI"
     gene            <391907..>393496
                     /gene="TPHA0D01880"
                     /locus_tag="TPHA_0D01880"
                     /db_xref="GeneID:11530964"
     mRNA            <391907..>393496
                     /gene="TPHA0D01880"
                     /locus_tag="TPHA_0D01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685213.1"
                     /db_xref="GeneID:11530964"
     CDS             391907..393496
                     /gene="TPHA0D01880"
                     /locus_tag="TPHA_0D01880"
                     /inference="similar to DNA sequence:INSDC:YDR299W"
                     /note="similar to Saccharomyces cerevisiae BFR2 (YDR299W);
                     ancestral locus Anc_5.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685261.1"
                     /db_xref="GeneID:11530964"
                     /db_xref="GOA:G8BSK6"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /db_xref="UniProtKB/TrEMBL:G8BSK6"
                     /translation="MGKSLSEQILDIANKPINEDIDIENEDVAFRNEGDSDSQVSDVE
                     DEESETVKGTGHYVSVGKSKLRNEVKDVVTDAKYTGQKGSRADLYSDGNDDDADENEG
                     ESDAMSFVTDSEDQEVSADDDEEEENDNEEAEEEEDEDQELKRERLTRLVNQETKKAI
                     SGLSQGTKRDAAKGLSILKQNRVFESTIDVRIKLQKALSSANLLPLTRDSWDVYLAND
                     NKTIKLLEKTNKKLNKVFNKLVSFRTEFQLNDHITTEESDNTDKKRSYTDLVEETDRL
                     DNSLKEYRDAVLNKWSIKIASASGNTALNATKFQNINQSADIQVNNQLADLPRLIKRT
                     CLNRRNTQPLNFNEDLNSGKLSHIKNSSVENAEDDGEDNIDIPSNYDPRRKNNTKLDT
                     SENPYIFDDEDFYRVLLNDLVDKKISNAQNLQSNGANIAITSRSNNKLKKNIDTKASK
                     GRKLNYSVQESIANYEAPANDGYKWSDEHIDEFFAGLFGQKINFEENENEDNNKEDSE
                     NHEQDEQVLEAIKNDEIQIFG"
     gene            <393912..>394952
                     /gene="TPHA0D01890"
                     /locus_tag="TPHA_0D01890"
                     /db_xref="GeneID:11534400"
     mRNA            <393912..>394952
                     /gene="TPHA0D01890"
                     /locus_tag="TPHA_0D01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685214.1"
                     /db_xref="GeneID:11534400"
     CDS             393912..394952
                     /gene="TPHA0D01890"
                     /locus_tag="TPHA_0D01890"
                     /inference="similar to DNA sequence:INSDC:YHR034C"
                     /note="similar to Saccharomyces cerevisiae PIH1 (YHR034C);
                     ancestral locus Anc_5.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685262.1"
                     /db_xref="GeneID:11534400"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:G8BSK7"
                     /translation="MSFLLKEVNESNRKDVVLLKPTPAFVIKSKVIGYNQQVVRTIKL
                     ESNVKIFINLCYDDQVPQPDVPFNPNIVYPLIMNNKWEIPIVTSSIRSDVDKKGNNCY
                     VCDCCINTECIDWIVKDLQLREILIEWCLESCEIRESLEISRDHIAFPKLKLKGDSIP
                     SIEILNDELTTDVDKKISDALKPELFSDPSSFFKMKRSLIDDVDDQVMGDTDGELPPL
                     FPRAEIETMSKPLIQELTELDLDKNIKRNNNTQVVERKEVTFDVTMRKTKATDVYKLK
                     IEVVSNINSSLDVDLNYSEINNELIVLNTNLIDFKPKEVKIPLPDIFSKENVSNMKVF
                     FIKSERKMIIYI"
     gene            complement(<395128..>397812)
                     /gene="TPHA0D01900"
                     /locus_tag="TPHA_0D01900"
                     /db_xref="GeneID:11534403"
     mRNA            complement(<395128..>397812)
                     /gene="TPHA0D01900"
                     /locus_tag="TPHA_0D01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685215.1"
                     /db_xref="GeneID:11534403"
     CDS             complement(395128..397812)
                     /gene="TPHA0D01900"
                     /locus_tag="TPHA_0D01900"
                     /inference="similar to DNA sequence:INSDC:YDR303C,YHR056C"
                     /note="similar to Saccharomyces cerevisiae RSC3 (YDR303C)
                     and RSC30 (YHR056C); ancestral locus Anc_5.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685263.1"
                     /db_xref="GeneID:11534403"
                     /db_xref="GOA:G8BSK8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BSK8"
                     /translation="MFDSQGRRFRKPPACRQCRKRKIGCDRVKPICGNCFRSGKHDCA
                     YPELIGGSFEDTGSGYDDNGSSHNNGGSSNFNQGVQIYRSKETSQLLKDNPELASMEQ
                     IREYNTRQQLLNSQNANKNETPISLETAKFIPRTTTKLTSSMKHLLTTKKVISANDDD
                     LGLNWIQGPAIMDLSHSNYVTRDLILKEYNFIKLRLLELQEITGKKIRVDLDMLDRDG
                     NNNGTQSESDKRSPDGSASTMDNNSSIGKQMGDNLADNHLHKKKKIKLLQSTSNSFAM
                     DELSNYGSELLDPKDLFTILDNNSDNGITNNMNNNNSENETNDALIIVDNPNLLFSTN
                     YLVKRDKFLENYYKKIENVVGVSFNHLLPSIVENNNKNKYSQGYNDHISFPSKIIMRD
                     VLDQFHDIFSADDIASMFFIDDLESINNNINKFGRDPKFSRKSLNIESLVSLGELSVI
                     ALLVQEYISLMDENSMGKNLKELLKNLMTYNDLFLKNILLIKNILPKREGFLNTLQSL
                     QFFSLLQFFEMISVNNVDFGLTNYDDIFLARKFSLNYETENINLNKFWNFIFKNYCYR
                     NVLKGDIPAMVMSNDFNTSIISDPQLLTDIKLLESQTKLLKYMHLPANAVSIKKVELM
                     RNNLEHLSADLKNKDIYKVLDSGINGPTEFLSNYVNMSKMINAKYMLRLEFMLLLQYN
                     KLKDAVKLETTILSLFGHITEIFEKVATYLNSDSVQTRLLTSKCCLNIIDDMLSYCIS
                     IFQQILFSFTLQSTNASVDEASKLSLGKCLDEFGLLFKGIKFTLEEVTRKYQQSTAIL
                     SKILCRAVVALKYWTLCNQDYQSRTIVNQHSAFDGISTYDKLEEGRINNIDEILKKFK
                     SAMKTPEVNSTEETASNDARTLGITESNVSDVYASFFM"
     gene            complement(<398527..>399087)
                     /gene="TPHA0D01910"
                     /locus_tag="TPHA_0D01910"
                     /db_xref="GeneID:11531129"
     mRNA            complement(<398527..>399087)
                     /gene="TPHA0D01910"
                     /locus_tag="TPHA_0D01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685216.1"
                     /db_xref="GeneID:11531129"
     CDS             complement(398527..399087)
                     /gene="TPHA0D01910"
                     /locus_tag="TPHA_0D01910"
                     /inference="similar to DNA sequence:INSDC:YDR305C"
                     /note="similar to Saccharomyces cerevisiae HNT2 (YDR305C);
                     ancestral locus Anc_5.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685264.1"
                     /db_xref="GeneID:11531129"
                     /db_xref="GOA:G8BSK9"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:G8BSK9"
                     /translation="MSSPIYFSKFIVTDQVFYVSKFCYALVNLKPLVPGHVLIVPLRT
                     SVQNLSQLSKEESSDFFNTVQLMQNFIYHTYQADAMNIAIQDGPEAGQSVPHLHTHII
                     PRYRLNNIGDQIYNKLDSWDGSEWEKRRETYLSANGRMGRKELAKPEDQRVERTAEVM
                     KKEAITLNEKLQNYITQNPDMKKWID"
     gene            complement(<399432..>399902)
                     /gene="TPHA0D01920"
                     /locus_tag="TPHA_0D01920"
                     /db_xref="GeneID:11531110"
     mRNA            complement(<399432..>399902)
                     /gene="TPHA0D01920"
                     /locus_tag="TPHA_0D01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685217.1"
                     /db_xref="GeneID:11531110"
     CDS             complement(399432..399902)
                     /gene="TPHA0D01920"
                     /locus_tag="TPHA_0D01920"
                     /inference="similar to DNA sequence:INSDC:YDR308C"
                     /note="similar to Saccharomyces cerevisiae SRB7 (YDR308C);
                     ancestral locus Anc_5.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685265.1"
                     /db_xref="GeneID:11531110"
                     /db_xref="InterPro:IPR021384"
                     /db_xref="UniProtKB/TrEMBL:G8BSL0"
                     /translation="MTDRLTQLQICLDQMMEQFCATLNYIDKKHDFETIGEFEHKMTD
                     KHATVASAEEFSNTIDELSTDIILKTRQISKLIDSLPGVDVSEDEQLRKIDILQKQLL
                     KEEDEKVEAVKEKEKLLSNLNEVTSLFVAGISKAGTTVDSKDDPLHNDKDTSQI"
     gene            <400219..>400779
                     /gene="TPHA0D01930"
                     /locus_tag="TPHA_0D01930"
                     /db_xref="GeneID:11534289"
     mRNA            <400219..>400779
                     /gene="TPHA0D01930"
                     /locus_tag="TPHA_0D01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685218.1"
                     /db_xref="GeneID:11534289"
     CDS             400219..400779
                     /gene="TPHA0D01930"
                     /locus_tag="TPHA_0D01930"
                     /inference="similar to DNA sequence:INSDC:YHR060W"
                     /note="similar to Saccharomyces cerevisiae VMA22
                     (YHR060W); ancestral locus Anc_5.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685266.1"
                     /db_xref="GeneID:11534289"
                     /db_xref="UniProtKB/TrEMBL:G8BSL1"
                     /translation="MIEEDKDILDLLENLSKYNLLLEQLQNSMRDGYSNLSRANYHNK
                     DSIRGRYGKDYWDYSYTGNKTVKVDLTSGEDTISIFKTKLLNSDSIEIKEDDQSSSNT
                     IIDEKNDNVLKNRKEKTTSKTKTSKSSNEVKPVIEKNPITMFGSAFTIPQSLRDSQTN
                     FESIIPLLQELINTKNKINKITNDAL"
     gene            complement(<401008..>402279)
                     /gene="TPHA0D01950"
                     /locus_tag="TPHA_0D01950"
                     /db_xref="GeneID:11530962"
     mRNA            complement(<401008..>402279)
                     /gene="TPHA0D01950"
                     /locus_tag="TPHA_0D01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685219.1"
                     /db_xref="GeneID:11530962"
     CDS             complement(401008..402279)
                     /gene="TPHA0D01950"
                     /locus_tag="TPHA_0D01950"
                     /inference="similar to DNA sequence:INSDC:YDR309C,YHR061C"
                     /note="similar to Saccharomyces cerevisiae GIC2 (YDR309C)
                     and GIC1 (YHR061C); ancestral locus Anc_5.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685267.1"
                     /db_xref="GeneID:11530962"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="UniProtKB/TrEMBL:G8BSL2"
                     /translation="MFNKINKLPELHSIWLDDDKDVEKLYGLQNQQCLDIADLKTSHL
                     NHSMHSLTESAKVKESSEKYAQDKFSSSDSTVFDHTKATKYNIKVINSDELCLPNKNN
                     IILPKRGSKTTTLAETSVSPSTSMSRSSSFRRSISMKSINIFRSQSYDGEKKQTNSKA
                     TSNTSSIRNSEAVSKEIKAARRISVPYDFKHISHADVKAMDNDSTSGKAAGNEIPKIP
                     ETTSSKNLANAPERFSCAFVTESIPDYQFRLSRDDSFYNERPKAIKNLESIKIKRVSS
                     AQTFKMVNESLSSEYHLSAMQMGRSHSAKSSDAGLSIYSGSSIDQSRSMRRSFSTPPK
                     VTPYNSPRHMKLNSLSNFEYPTILEDQSTDYERSSVSTKDTAESLKTPTIASKLFQIS
                     ATESIDGSKTTMSPSYTIEARKEEHYTPLYL"
     gene            complement(<404011..>406731)
                     /gene="TPHA0D01960"
                     /locus_tag="TPHA_0D01960"
                     /db_xref="GeneID:11534447"
     mRNA            complement(<404011..>406731)
                     /gene="TPHA0D01960"
                     /locus_tag="TPHA_0D01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685220.1"
                     /db_xref="GeneID:11534447"
     CDS             complement(404011..406731)
                     /gene="TPHA0D01960"
                     /locus_tag="TPHA_0D01960"
                     /inference="similar to DNA sequence:INSDC:YDR310C"
                     /note="similar to Saccharomyces cerevisiae SUM1 (YDR310C);
                     ancestral locus Anc_5.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685268.1"
                     /db_xref="GeneID:11534447"
                     /db_xref="GOA:G8BSL3"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:G8BSL3"
                     /translation="MDQSNQVALAADASDSSHVVDKIDTILNKNGVVKASDDELTDIR
                     TQVQETSARIEKVEKFLQSKDQSVINSMEELFNSVKIISHNQSTLENKLDDLLNNQMN
                     TDTIINKFKDFLDKLNVQMKHSNNNLSGNSSLLHALIGNSPSPLASYSNDSLRRGPGR
                     PRKEESPLINDLLSTIPSSFKKVLPSDNIQISKSRRYFNDPLKEDDYDSSATTKSGKS
                     SKQSKSKKTSSLQSENGSIKRRGRPPKKRTVDSVLVKVDYASDKKKPFEKSTMNSIDK
                     DSEDLDTNGATEDEYEEIEDSNTIVKDDLDDNSLENSIIHTTRSNSKLKLLKDARSMK
                     HDDDPLAMNNLTTNQEKELDKRRDDREKMLVNLKYNDRDRAKSFMESHKKLLNAMKEE
                     ERRKKLNPLNYSAAQKSPDYPSDGAVPSPSIDTITNSKDGVEMDDVSGTKEVFSSLAK
                     ADDSTANQPIDESKMSVNADISANVSDISKNEEVDESDLKNGTTDIHNTKRTVPNEFE
                     DDFEDSSNLDSPKSRHLRKRKLSGNGDESISLGQTSTAESANIMNKSHLMTSSADHIL
                     NDKSFTILTDHPIELFCKGGLFYLRNSLDRPITIGEYLKYKYRDKENELIKVNMAGGE
                     ALDMSKQERMNAHTFKKDIDAETKEAFDILGSTILTEKYVNSLEYFLLEFRWENSLVG
                     LGLKLKESKRTWQRRKALFALFEFWRDQSRQKRNFQGYTILHSVKEMESYRIFINRSV
                     SWFYNHITLLKMILYDLCDNVKSHWREWMFPRNQPLPVIGTNNIDSNNINTAIDSILT
                     LDFLQHDTTDEALALTSSKRSHKSSMKIEEPLTEIPLSNMEVSADDDLKTEPSRAEQS
                     ITQSSENNDKPQDEQAAALVTEAYVTNIDVANDDDDERDTLNISHLNSSP"
     gene            complement(<407703..>409316)
                     /gene="TPHA0D01970"
                     /locus_tag="TPHA_0D01970"
                     /db_xref="GeneID:11534461"
     mRNA            complement(<407703..>409316)
                     /gene="TPHA0D01970"
                     /locus_tag="TPHA_0D01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685221.1"
                     /db_xref="GeneID:11534461"
     CDS             complement(407703..409316)
                     /gene="TPHA0D01970"
                     /locus_tag="TPHA_0D01970"
                     /inference="similar to DNA sequence:INSDC:YHR064C"
                     /note="similar to Saccharomyces cerevisiae SSZ1 (YHR064C);
                     ancestral locus Anc_5.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685269.1"
                     /db_xref="GeneID:11534461"
                     /db_xref="GOA:G8BSL4"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:G8BSL4"
                     /translation="MSSPIIGISFGNTSSSIAYINPKNDVDVIANPDGERSIPSVLSY
                     VGEDEYHGGQALQQLVRNPKNTIVNFRDFIGLPFSECDASRCESGAPVVDVNGKAGFV
                     ISRGEGKEETISVDEVVSRHLNQLKLAAEDYIGTTISQAVLTVPTNFTDEQKAALKAS
                     AAAVGLNIVQFINEPSSSLLAHVEQYKFEDDVNVVVADFGGVRSDAAVIAIRGGIFTI
                     LATEHDKKLGGENLDAELVEYFAQDFQKKNQANPRKNARSLAKLKANASITKKTLSNA
                     TSATISIDSLADGFDYHFSINRMRYELVTNKVFSKFSAFIESVIAKAGLDLLDINAVL
                     LTGGVAFTPKLSSNLEFLFPESVEILGPQNANATNYPNELSSSGAALQAGLLSAYDAD
                     ELAEALQPIVINTPHLPKAIGLAGANGDFLPVFLPETSFPVQKKVVLKAATGDLLVGV
                     YEGESFIEEKTVEPTPVEQDEDDSEEWSDEEPEVVREKHYKLGNKLIELGVKGVSKGV
                     EIIFNIDKDGKLRVVAKDLKSGSTVKGEL"
     gene            <409682..>411499
                     /gene="TPHA0D01980"
                     /locus_tag="TPHA_0D01980"
                     /db_xref="GeneID:11534262"
     mRNA            <409682..>411499
                     /gene="TPHA0D01980"
                     /locus_tag="TPHA_0D01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685222.1"
                     /db_xref="GeneID:11534262"
     CDS             409682..411499
                     /gene="TPHA0D01980"
                     /locus_tag="TPHA_0D01980"
                     /inference="similar to DNA sequence:INSDC:YDR311W"
                     /note="similar to Saccharomyces cerevisiae TFB1 (YDR311W);
                     ancestral locus Anc_5.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685270.1"
                     /db_xref="GeneID:11534262"
                     /db_xref="GOA:G8BSL5"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013876"
                     /db_xref="InterPro:IPR027079"
                     /db_xref="UniProtKB/TrEMBL:G8BSL5"
                     /translation="MSHSGAAVFKKVSGIITIDEDHSPAILTWRSTDGDKTSVIELDG
                     IDKLQATPASSEKMMLRLIGIVDESKKIKDNDGNEVLPKPVTYMFMFNNRIVMDNIKV
                     TLQHIISRYKDTQAYEEKSRRETGGESVDSTPVVSTPLINTRKLDDSLSRKKLLSNFK
                     LQQSLLRENKTLMKTFQETVMSSGLPADEFWSTRIALLRAFALSTSQKVGPYNVLSSI
                     KPVASSDNKVNVNIPREKIMSIFQTFPIVNKAYMDNVPKNFKEPEFWARFFASKLFRK
                     LRGERISPNDRGDVIIDRYLTLDEDYDRQDDISLQHAVKKTIDINANAEDDPVLKGNR
                     PDMTMQPGKDVNGNSDGVVDILRGMNRLGEKMMRSLENEYSRTKLKNTDMETEEKEEL
                     DIGDLRDAKVAEYAVIKLKYKTNQPVSKSIDENVTGISKDNLIKSIEEATNSLSSQID
                     LSLVVSNKDYITKSNNAVMEAVKINAKQAEHNSFDTVLGAFVSKGATEDEEAKSDIPI
                     ELLDGCRLLHGTCCEFLKHFYIHFQSGEAKQADSVKKLYEHLKTCRGKIKELLSDVHN
                     GDGEAMANSCKIYLDPVLTSINLAISKYDEIVKAIIESQ"
     gene            complement(<411607..>413103)
                     /gene="TPHA0D01990"
                     /locus_tag="TPHA_0D01990"
                     /db_xref="GeneID:11534243"
     mRNA            complement(<411607..>413103)
                     /gene="TPHA0D01990"
                     /locus_tag="TPHA_0D01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685223.1"
                     /db_xref="GeneID:11534243"
     CDS             complement(411607..413103)
                     /gene="TPHA0D01990"
                     /locus_tag="TPHA_0D01990"
                     /inference="similar to DNA sequence:INSDC:YHR065C"
                     /note="similar to Saccharomyces cerevisiae RRP3 (YHR065C);
                     ancestral locus Anc_5.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685271.1"
                     /db_xref="GeneID:11534243"
                     /db_xref="GOA:G8BSL6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSL6"
                     /translation="MSNKVSKKTSTKADSNGPAALAAKIRAKALENQKKLKETGTTSM
                     NESDEETGNTKRQVIRTEADIEENTSEKTFTSFNELDLVPELIQACHNLNFSKPTPIQ
                     SKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNKLWEDQQPYYACILAPTRELAQQIK
                     ETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRKPHIIIATPGRLMDHLENTKGFSLRK
                     LKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTTYLFSATMTSKIEKLQRASLTNPV
                     KCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEFIGKSIIVFTRTKANAERLSAL
                     SNLLEFSSTALHGDLNQNQRTGALDLFKAGKRQILVAIDVAARGLDIPSVDIVINYDI
                     PVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKKLPKENVDKNTIMM
                     FRDSVDKANGEVVMEMNRRNKEKQARGKGTQKSRSRARETWIEVNVEY"
     gene            <413644..>415023
                     /gene="TPHA0D02000"
                     /locus_tag="TPHA_0D02000"
                     /db_xref="GeneID:11534229"
     mRNA            <413644..>415023
                     /gene="TPHA0D02000"
                     /locus_tag="TPHA_0D02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685224.1"
                     /db_xref="GeneID:11534229"
     CDS             413644..415023
                     /gene="TPHA0D02000"
                     /locus_tag="TPHA_0D02000"
                     /inference="similar to DNA sequence:INSDC:YDR312W,YHR066W"
                     /note="similar to Saccharomyces cerevisiae SSF2 (YDR312W)
                     and SSF1 (YHR066W); ancestral locus Anc_5.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685272.1"
                     /db_xref="GeneID:11534229"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:G8BSL7"
                     /translation="MAKRRQKKRTHAVVTPEQTQGIPKSMVIRVGQTSLSNHSLNQLV
                     KDFRQIMQPHTAIKLKERKSNKLKDFIVMSGPLGVSHLFMFTQSEKTGNVSLKIARTP
                     HGPTISFQVLDYSLGKDIKKFLKRPKSLKASDVLDPPLLVLNGFTNIKNKNKTSDDNE
                     DITNENVEKVVVSMFQNILPPLNPSRIQLSSIKRVFLINRDQATGEISMRHYFIDIRE
                     VDISKNLKRLYKAKNNIHKSIPNLHRKEDISSLILDHDLGAYTSESEIEDDSIVKVID
                     QNRISTQNLAKANKKQKNDENDAEEEAEDENIEDNIKQAFHQNIPTPKKKAVKLTEVG
                     PRLTLKLVKIEEGICSGKVLHHEYVRKTSAEIKLLEKRHAEKMRLKEQRRSEQEKNIE
                     RKKSVKEAKKQRKLARREQRKLDEQNGETNMHQDSESDNGSDSEDDENNYQDVPEDID
                     SDLFSEVEE"
     gene            complement(<415214..>416065)
                     /gene="TPHA0D02010"
                     /locus_tag="TPHA_0D02010"
                     /db_xref="GeneID:11531048"
     mRNA            complement(<415214..>416065)
                     /gene="TPHA0D02010"
                     /locus_tag="TPHA_0D02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685225.1"
                     /db_xref="GeneID:11531048"
     CDS             complement(415214..416065)
                     /gene="TPHA0D02010"
                     /locus_tag="TPHA_0D02010"
                     /inference="similar to DNA sequence:INSDC:YDR315C"
                     /note="similar to Saccharomyces cerevisiae IPK1 (YDR315C);
                     ancestral locus Anc_5.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685273.1"
                     /db_xref="GeneID:11531048"
                     /db_xref="GOA:G8BSL8"
                     /db_xref="InterPro:IPR009286"
                     /db_xref="UniProtKB/TrEMBL:G8BSL8"
                     /translation="MKVIAKGNANIIIDYDDPLYLYRCLVRDSSLKINNLNTVENFKF
                     LQKFKADEDNRLSYYLCTVELLQLQVNEIRDLLEEYITKFDTEVVYVFKLENLKPNYY
                     DSLLWNDHFTRVYFSKEFSNKILIELKPKWIYYQSPYCRNCTHNQLKSRSNINYCYSH
                     LVNNESYFFTNILGDLKHSLPPEFIISMESYMRGPKNIFKLLYETQKSLYVPLGTLNH
                     SSEVDYNLLLLMALRDVTLFIEWDTSKDQHIYINFIDLDRKPSSKLSYWLKTHEKLEM
                     FPDKVYH"
     gene            <416538..>417701
                     /gene="TPHA0D02020"
                     /locus_tag="TPHA_0D02020"
                     /db_xref="GeneID:11534285"
     mRNA            <416538..>417701
                     /gene="TPHA0D02020"
                     /locus_tag="TPHA_0D02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685226.1"
                     /db_xref="GeneID:11534285"
     CDS             416538..417701
                     /gene="TPHA0D02020"
                     /locus_tag="TPHA_0D02020"
                     /inference="similar to DNA sequence:INSDC:YHR068W"
                     /note="similar to Saccharomyces cerevisiae DYS1 (YHR068W);
                     ancestral locus Anc_5.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685274.1"
                     /db_xref="GeneID:11534285"
                     /db_xref="GOA:G8BSL9"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8BSL9"
                     /translation="MSNLDGKLPDTLNDAILKASVPIPDDYIKIEGIDYSKPEAVDMK
                     ASDLIENMKRMGFQASSLGQACDIINNMRSWRGKHVDNLNENETKGCFDDEGYQKTTI
                     FMGYTSNLISSGLRETLRFLVQHKMVDALVASAGGIEEDLIKCLAPTYLGEFALKGSS
                     LREQGLNRIGNLLVPNDNYCKFEEWIVPIFDKMLEEQEEYVNKHGNSCMDANQDLDSP
                     VWTPSKLCDRLGKEINDESSVLYWAHKNKIPIFCPSITDGSIGDMLFFHTFKASPKQL
                     RVDIVADIRKINSMSMEASRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFD
                     GSDAGARPDEAVSWGKIKAEAKSVKVYADATIVFPLVVAATFASGKKIEKKSD"
     gene            complement(<417956..>419053)
                     /gene="TPHA0D02030"
                     /locus_tag="TPHA_0D02030"
                     /db_xref="GeneID:11531006"
     mRNA            complement(<417956..>419053)
                     /gene="TPHA0D02030"
                     /locus_tag="TPHA_0D02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685227.1"
                     /db_xref="GeneID:11531006"
     CDS             complement(417956..419053)
                     /gene="TPHA0D02030"
                     /locus_tag="TPHA_0D02030"
                     /inference="similar to DNA sequence:INSDC:YHR069C"
                     /note="similar to Saccharomyces cerevisiae RRP4 (YHR069C);
                     ancestral locus Anc_5.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685275.1"
                     /db_xref="GeneID:11531006"
                     /db_xref="GOA:G8BSM0"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR025721"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:G8BSM0"
                     /translation="MSDVISVIKRQSGLKYASIDNDEMENFSSDEDVPMVDIDGKSNG
                     GKRNEAAAGEIVTPGELITEDPIWMRGHGTYFLENSTYSSAAGTISRVNRLLSVIPLK
                     GRYTPETGDHIVGRITDVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQM
                     RTFLKEGDVLNAEVQSLFQDGSASLHTRSLKYGKLRDGLLIQVPSSLVVRSKNHTHNL
                     PGNVTVLLGVNGFIWLRKTSKMDVARETPSAGPASDISEGPTGAKSLNPTNSVSITRL
                     EEESSWKIYSDKNDPSITPSIRQNISRYANVIKALAFCEIGLTHERIVIGYEASIAYS
                     NIGELIEREVMESIGDDVINIEKMRGNGATE"
     gene            <419427..>421016
                     /gene="TPHA0D02040"
                     /locus_tag="TPHA_0D02040"
                     /db_xref="GeneID:11531094"
     mRNA            <419427..>421016
                     /gene="TPHA0D02040"
                     /locus_tag="TPHA_0D02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685228.1"
                     /db_xref="GeneID:11531094"
     CDS             419427..421016
                     /gene="TPHA0D02040"
                     /locus_tag="TPHA_0D02040"
                     /inference="similar to DNA sequence:INSDC:YHR070W"
                     /note="similar to Saccharomyces cerevisiae TRM5 (YHR070W);
                     ancestral locus Anc_5.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685276.1"
                     /db_xref="GeneID:11531094"
                     /db_xref="GOA:G8BSM1"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR025792"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BSM1"
                     /translation="MLSNWTRKVSIASVKYNQIVRNSTMSLQTMFKYSPPVDRNMKVL
                     DRSYFVTKIPLCVVKFSDPRNISVFAKDFKSDILRIPRIPHVVKLDKEQGLNEIATQS
                     ALNENKKVKTLACDNGIIPKGVLLNESIKEIKDIDSKLSPGALEFLKTTNAEILPYEY
                     ILDYDFWKSEEILRSVLPEEFLDEIPTGFTITGHVAHLNLRKEFKPFDALIGQVILDK
                     NNKIECVVDKVSSIATKFRTFPMKIIAGTTDNLVVEQKESNCTFSFDFSKVYWNSRLH
                     TEHDRLVTQYFKPEQVICDVFGGVGPFSIPAGKKECIVLANDLNPESYKYLLENIRLN
                     KVEELVKPFNCDGGEFITESVKFLNNLRNETDTHTIKVPIKRSNNNRKKIRHKAQTEG
                     SAAETVATHKDIQVPLQIHHYIMNLPDSAIEFLGRFNGVFDEFRNLVTSEEDVNEIEM
                     PWVHVHCFEKYGNDETELSDEEIQGRVHDRIIKSLNTTKEILPVNQLNFHLVRKVSPT
                     KPMFCVSFKLPKEIAYTKYNK"
     gene            <421367..>422335
                     /gene="TPHA0D02050"
                     /locus_tag="TPHA_0D02050"
                     /db_xref="GeneID:11531118"
     mRNA            <421367..>422335
                     /gene="TPHA0D02050"
                     /locus_tag="TPHA_0D02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685229.1"
                     /db_xref="GeneID:11531118"
     CDS             421367..422335
                     /gene="TPHA0D02050"
                     /locus_tag="TPHA_0D02050"
                     /inference="similar to DNA sequence:INSDC:YHR071W"
                     /note="similar to Saccharomyces cerevisiae PCL5 (YHR071W);
                     ancestral locus Anc_5.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685277.1"
                     /db_xref="GeneID:11531118"
                     /db_xref="GOA:G8BSM2"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8BSM2"
                     /translation="MNKQDDRRRQERQRRTITPDLLNDLSLELPSDLGFDLTVDTNLY
                     LDLDLELDTKGLVSKNSNEIRNSKNVYHTPPYEFNDNGPQPKPKPTITIKNEVNVYNS
                     IINDNDNSEQKKILIQLSKLLSKFSSNITESNIISNDSIVHFITEVIGRSKCNKQTLL
                     LATLYFKNIYSSFTNDKLKASNVPEFIKCIKRTYLSCLIVSHKFLNDNTYSLKSWNKI
                     TGLSAKTLSMMEKYSLMTLNFNLHLDNSEVNDLNNEIMLMVVDQDLMDSVNMVTINPP
                     SNEQEVNNKKRSHGEIDEHINSDVDGLFASYLRPQEIAQNKRLCSV"
     gene            complement(422539..422628)
                     /gene="TPHA0Dtrna7F"
                     /locus_tag="TPHA_0Dtrna7F"
                     /db_xref="GeneID:11534594"
     tRNA            complement(join(422539..422575,422591..422628))
                     /gene="TPHA0Dtrna7F"
                     /locus_tag="TPHA_0Dtrna7F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11534594"
     gene            <424797..>426287
                     /gene="TPHA0D02060"
                     /locus_tag="TPHA_0D02060"
                     /db_xref="GeneID:11531000"
     mRNA            <424797..>426287
                     /gene="TPHA0D02060"
                     /locus_tag="TPHA_0D02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685230.1"
                     /db_xref="GeneID:11531000"
     CDS             424797..426287
                     /gene="TPHA0D02060"
                     /locus_tag="TPHA_0D02060"
                     /inference="similar to DNA sequence:INSDC:YDR317W"
                     /note="similar to Saccharomyces cerevisiae HIM1 (YDR317W);
                     ancestral locus Anc_5.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685278.1"
                     /db_xref="GeneID:11531000"
                     /db_xref="InterPro:IPR014843"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BSM3"
                     /translation="MTGDQSNIEIIKHTEEIINPDVPIESSIDRFSDNILVVGSTGLI
                     GRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKEVTIKKTAYSLTRKRQSVELF
                     KNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKG
                     VKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFN
                     LQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLI
                     ENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKV
                     IIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIP
                     GLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTS
                     LLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLLLE"
     gene            <426798..>427919
                     /gene="TPHA0D02070"
                     /locus_tag="TPHA_0D02070"
                     /db_xref="GeneID:11531075"
     mRNA            <426798..>427919
                     /gene="TPHA0D02070"
                     /locus_tag="TPHA_0D02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685231.1"
                     /db_xref="GeneID:11531075"
     CDS             426798..427919
                     /gene="TPHA0D02070"
                     /locus_tag="TPHA_0D02070"
                     /inference="similar to DNA sequence:INSDC:YDR318W"
                     /note="similar to Saccharomyces cerevisiae MCM21
                     (YDR318W); ancestral locus Anc_5.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685279.1"
                     /db_xref="GeneID:11531075"
                     /db_xref="GOA:G8BSM4"
                     /db_xref="InterPro:IPR018464"
                     /db_xref="UniProtKB/TrEMBL:G8BSM4"
                     /translation="MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEP
                     LLQEFNVLFNQFPDLFELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDD
                     NMPEHEWILNKQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYK
                     NPNLNEELERKIIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFD
                     DTLGVFEKPHYILLKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFA
                     KQVYIQLLLIQNRKKNLMQLQEANIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKV
                     TSVSIYSETLDIHSQKRWKLTLLGPVSGISRKIRYLSQM"
     gene            <428268..>428447
                     /gene="TPHA0D02080"
                     /locus_tag="TPHA_0D02080"
                     /db_xref="GeneID:11531092"
     mRNA            <428268..>428447
                     /gene="TPHA0D02080"
                     /locus_tag="TPHA_0D02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685232.1"
                     /db_xref="GeneID:11531092"
     CDS             428268..428447
                     /gene="TPHA0D02080"
                     /locus_tag="TPHA_0D02080"
                     /inference="similar to DNA sequence:INSDC:YHR072W-A"
                     /note="similar to Saccharomyces cerevisiae NOP10
                     (YHR072W-A); ancestral locus Anc_5.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685280.1"
                     /db_xref="GeneID:11531092"
                     /db_xref="GOA:G8BSM5"
                     /db_xref="InterPro:IPR007264"
                     /db_xref="UniProtKB/TrEMBL:G8BSM5"
                     /translation="MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQ
                     RVTLKKRFSLLPNQQ"
     gene            <428969..>430117
                     /gene="TPHA0D02090"
                     /locus_tag="TPHA_0D02090"
                     /db_xref="GeneID:11534384"
     mRNA            <428969..>430117
                     /gene="TPHA0D02090"
                     /locus_tag="TPHA_0D02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685233.1"
                     /db_xref="GeneID:11534384"
     CDS             428969..430117
                     /gene="TPHA0D02090"
                     /locus_tag="TPHA_0D02090"
                     /inference="similar to DNA sequence:INSDC:YDR321W"
                     /note="similar to Saccharomyces cerevisiae ASP1 (YDR321W);
                     ancestral locus Anc_5.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685281.1"
                     /db_xref="GeneID:11534384"
                     /db_xref="GOA:G8BSM6"
                     /db_xref="InterPro:IPR004550"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR020827"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="InterPro:IPR027475"
                     /db_xref="UniProtKB/TrEMBL:G8BSM6"
                     /translation="MPNNSVEITTICPDVENSKFIIQSLSSNGSKSNDNTKGLPADDI
                     ITPTLPRIKILGTGGTIAAKGSSGTQTAGYHVDLTIQELLDAIPDISNVCDIEYEQLC
                     NVDSKDIDESILYKIYKAVSESLQGFDGIVIIHGTDTLSETAFFIESTIDTGDVPIVF
                     VGSMRPSTSISADGPMNLYQAICIAASPKSRGRSVLVSLNDQISAGYYITKTNANSLD
                     SFNVRQGYLGNFVNNEIHYYYPPVKPQGCHRFKLKIDLSQPNQTFSFPKVCILYSHQS
                     FPTSLLDMVEKSYDGIIIATMGAGSLPDAANNKALKMNIPVIYSKRSRDGMIPISNLP
                     KTADGTFGNIISSGYLNPEKSRILLQLCLFGNYTISEIRQVFGGVYGG"
     gene            <430578..>432722
                     /gene="TPHA0D02100"
                     /locus_tag="TPHA_0D02100"
                     /db_xref="GeneID:11530935"
     mRNA            <430578..>432722
                     /gene="TPHA0D02100"
                     /locus_tag="TPHA_0D02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685234.1"
                     /db_xref="GeneID:11530935"
     CDS             430578..432722
                     /gene="TPHA0D02100"
                     /locus_tag="TPHA_0D02100"
                     /inference="similar to DNA sequence:INSDC:YHR074W"
                     /note="similar to Saccharomyces cerevisiae QNS1 (YHR074W);
                     ancestral locus Anc_5.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685282.1"
                     /db_xref="GeneID:11530935"
                     /db_xref="GOA:G8BSM7"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR003694"
                     /db_xref="InterPro:IPR014445"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:G8BSM7"
                     /translation="MSQLITVATCNLNQWALDFEGNRDRILESIKIAKQKGARLRVGP
                     ELEITGYGCLDHFLESDVCLHSWEMYAQIIKSPETHDILLDIGMPVLYKNVRYNCRLI
                     SLDGKILVIRPKIWLANDGNYREMRFFTPWLKPGHVEEFKLPPEIQKITQQVYVPFGD
                     AVVNTVDTTIGAETCEELFTPQTPTIAMSLDGVEIITNSSGSHHELRKLNKRLDLILN
                     ATSRCGGIYLYANQRGCDGDRLYYDGCALIAVNGKIVAQGSQFSLNDVEVVTATVDLE
                     DVRNYRAAIMSRGMQATLNEVKFKRVDVDFELAPMATRFDPSISPSKTHDPFYHLPEE
                     EIALGPACWMWDYLRRSNGTGFFLPLSGGIDSCATAVIVYSMCNLVVNAALEGNQQVI
                     KDAIKITRSDENWIPSDPVELASKLFHTCFMGTENSSTETRSRAKELAQRVGSYHVDL
                     NMDVLVSSTVSLFEVATGKKPIFKIFGGSQIENLALQNIQARLRMVIAYLFAQLLPWV
                     RNIPNSGGLLVLGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIAYSANKYE
                     MPILTDFLNATPTAELEPITKEYVQSDEADMGMTYEELSAFGALRKVEKCGPYSMFLK
                     LLHEWTPRLTPAQVAEKVKKFFFFYAINRHKQTVLTPSYHAENYSPDDNRFDLRPFLI
                     NPRFTWASKKIAEVVAQCEHKTDKELNIMSID"
     gene            <433197..>434267
                     /gene="TPHA0D02110"
                     /locus_tag="TPHA_0D02110"
                     /db_xref="GeneID:11534232"
     mRNA            <433197..>434267
                     /gene="TPHA0D02110"
                     /locus_tag="TPHA_0D02110"
                     /product="mitochondrial 54S ribosomal protein YmL35"
                     /transcript_id="XM_003685235.1"
                     /db_xref="GeneID:11534232"
     CDS             433197..434267
                     /gene="TPHA0D02110"
                     /locus_tag="TPHA_0D02110"
                     /inference="similar to DNA sequence:INSDC:YDR322W"
                     /note="similar to Saccharomyces cerevisiae MRPL35
                     (YDR322W); ancestral locus Anc_5.360"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL35"
                     /protein_id="XP_003685283.1"
                     /db_xref="GeneID:11534232"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:G8BSM8"
                     /translation="MLSRSFHTSRLLKNGKVWSNFAFRSKSLGINSDVVKKAVLDGML
                     ASGPPSIKRKFNRTKYNSPENIDSMFKLSYDFLQNKAAALYEELEKIKDPTLKDDLLV
                     KAEINNPEVQYNFEFHDKIDNDPAIIDYEQPVYRYLGRENWKSYRQMLLMQRLETLKA
                     IPDTLPTLEPKADVHVKFPYSTGINKWINSGETLSTLATSLPPVFKVQEYDSINVDKQ
                     LYTILVVNPDVPDLINDTYCTCLNYGLTNLKLKYNDNIIDLRNIEKEHSIIADYLPPV
                     PEENIGLQRFIVWVFRNKESININNLDIDRNNFNIRKFAKDNELEAIGSEIWRSEFDS
                     NVSKVREMYGLPKGRLFTKTRN"
     gene            complement(<434681..>434968)
                     /gene="TPHA0D02120"
                     /locus_tag="TPHA_0D02120"
                     /db_xref="GeneID:11530943"
     mRNA            complement(<434681..>434968)
                     /gene="TPHA0D02120"
                     /locus_tag="TPHA_0D02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685236.1"
                     /db_xref="GeneID:11530943"
     CDS             complement(434681..434968)
                     /gene="TPHA0D02120"
                     /locus_tag="TPHA_0D02120"
                     /inference="similar to DNA sequence:INSDC:YDR322C-A"
                     /note="similar to Saccharomyces cerevisiae TIM11
                     (YDR322C-A); ancestral locus Anc_5.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685284.1"
                     /db_xref="GeneID:11530943"
                     /db_xref="GOA:G8BSM9"
                     /db_xref="InterPro:IPR008386"
                     /db_xref="UniProtKB/TrEMBL:G8BSM9"
                     /translation="MSTANVLKYSALGLGLFVGIKNDLILKKDATKKAKEHERQAQLD
                     LIEKAKREYASLHNKTKKNKSVNVDTTNINWEDPKLDYGSVIMKFVDAQKE"
     gene            complement(<435589..>438836)
                     /gene="TPHA0D02130"
                     /locus_tag="TPHA_0D02130"
                     /db_xref="GeneID:11531009"
     mRNA            complement(join(<435589..438723,438831..>438836))
                     /gene="TPHA0D02130"
                     /locus_tag="TPHA_0D02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685237.1"
                     /db_xref="GeneID:11531009"
     CDS             complement(join(435589..438723,438831..438836))
                     /gene="TPHA0D02130"
                     /locus_tag="TPHA_0D02130"
                     /inference="similar to DNA sequence:INSDC:YHR077C"
                     /note="similar to Saccharomyces cerevisiae NMD2 (YHR077C);
                     ancestral locus Anc_5.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685285.1"
                     /db_xref="GeneID:11531009"
                     /db_xref="GOA:G8BSN0"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR007193"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BSN0"
                     /translation="MENGRRLELYGLNSKAWMDIDQFSSGNKKLDSSIKRNTGFIKKL
                     KLGITKENLPSLVKDLSEVLLSKYLSEIIITSNEALSNLNNKNDDIIAAVEVISILHQ
                     RFKSQFSEKLFELFLSNFTNPSTELDNEKDELTRISKINCNLRIFTELYLVGIFSLKV
                     DSISKIIFHLFYPKKMVKKDAILFSLLKEILNHRFRTGYSTIIATSYCKKFPTFFNSD
                     DKSWDSIISDPDLKNSIQMLFKIFVEAAFTRTVDMNKKLRKLLREHKKCQIRTGKVRD
                     EYIDEYDELLPCFERFNSASLAFALIFNLEGPVLESDDAEASKEVTPMITNQSDSTNQ
                     IFDNEDTRRFYEALPDLTDTLEQAKGDQREPLKDAVDEFMDRLIIADTKDSIDQLCHD
                     YWLNHIDNKATRKRLLKFFIETQDWSKLNLYARFVAANKDHMPDLSTQLVNYLDTGFS
                     SQLHSDRINFKNIIFFSQFVKFNMVPQFMIFHKIRTLIINLQVPNNIEILTVLFENLG
                     KLLINHPQSKENMEKMMSLVREKSKDRQINMNLKSAVNNLITLVYPPSIKSLNTEKRE
                     LSGEEMFYITLIRKELHNVSVKLVTKLIKKASWKDENVVATLLSLFTEPEKVHYQSLP
                     VLSKILAELYSQRKNFVVKIVDQLLYEIDLGLETDNYENNVSRIASIRYLTELYNASI
                     IKSDLLMQTLYSILRYGYPQGLPNPLIKNAVDLKDNYFRIQLVSTSLLNIERITQDLQ
                     KSMPKFLRFFEFYTFCKDQPVPVETEFRLSNVFNNSKLDPNFERSRSFEECYSKIMIL
                     MQSNQNITEKIPSKTVISENEIGTESEDDILDYSESDESNCDDDDDDELDEESDLSSN
                     ELDNRASINDTDDNLSDSSKDDDDSYESSSSDSDSDSDDDDDDDFKDIEADRDIEKKR
                     IYEEYQERLKGDDETKIEQELEKQFQILMQESVDSRKNERVATNNIPIITNGRVFSKQ
                     TLLSKSNNDGNVSESKTSNKVQFSFLTKAGKKTQFRTLVLPTDVKFVSNVLKNEEKLK
                     NEREKIKNIVLQRAYE"
     gene            complement(<439364..>441001)
                     /gene="TPHA0D02140"
                     /locus_tag="TPHA_0D02140"
                     /db_xref="GeneID:11534240"
     mRNA            complement(<439364..>441001)
                     /gene="TPHA0D02140"
                     /locus_tag="TPHA_0D02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685238.1"
                     /db_xref="GeneID:11534240"
     CDS             complement(439364..441001)
                     /gene="TPHA0D02140"
                     /locus_tag="TPHA_0D02140"
                     /inference="similar to DNA sequence:INSDC:YDR323C"
                     /note="similar to Saccharomyces cerevisiae PEP7 (YDR323C);
                     ancestral locus Anc_5.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685286.1"
                     /db_xref="GeneID:11534240"
                     /db_xref="GOA:G8BSN1"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR021565"
                     /db_xref="UniProtKB/TrEMBL:G8BSN1"
                     /translation="MSTTEEPPNDPLQQSNAYASFADIEVICPVCSHSFLNLNSLNVH
                     LDKDHGFSSEAIKEPTNSNKTASDHLLSKHGSNIKSNTSGILPNKGSKSNPNKQFITH
                     KHFKQPLDGKPKCYKCNTTITNHSNLINCNKCGEIFCKRDCKNVIKLDKNAKYDPRSG
                     KFYLCCNNCFTSKTGYKDMGRTVDLTGDFTQFRNLMIGDKMLTTLQLENRLVKLIDGS
                     ITIYRKYKDSLFFAVKVRLEIAKLESSVTPWKYDYNVSDCYICLQPFNITNRKHHCRL
                     CGNIVCEKETTNCSNNVTIETLMNASSDLSYKETNLTSEEADQHIRVCSRCIHSLFIP
                     RKFKQESNNPPPLLIKLLEKLNDIASVIINTLPIFKERVKIIELGDKDPSITKDENLI
                     KVAQLRNKLLRAFALYNDTSRQINLLKPQTLEETKIQNSIKQVSTKFITDNILPLKSL
                     PGIFTDATNNTNNSPPELNSLTEVTFNNNLTIKEVKQYREELMVLKEQSFLVQGMIDT
                     AKKQRQFEEVGSLNKNLSELKTRESHIEKLLGDKSFT"
     gene            complement(<441410..>443737)
                     /gene="TPHA0D02150"
                     /locus_tag="TPHA_0D02150"
                     /db_xref="GeneID:11530944"
     mRNA            complement(<441410..>443737)
                     /gene="TPHA0D02150"
                     /locus_tag="TPHA_0D02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685239.1"
                     /db_xref="GeneID:11530944"
     CDS             complement(441410..443737)
                     /gene="TPHA0D02150"
                     /locus_tag="TPHA_0D02150"
                     /inference="similar to DNA sequence:INSDC:YDR324C"
                     /note="similar to Saccharomyces cerevisiae UTP4 (YDR324C);
                     ancestral locus Anc_5.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685287.1"
                     /db_xref="GeneID:11530944"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BSN2"
                     /translation="MTSQERLTIHRARFLDLATANITVLAFSHDSDVAGSEKRLDNLN
                     NINNNKSKLTPSDLRLAVGRSNGNIEIWNPRNGWFQELVIQGGKGRSIEGLVWRNVPG
                     EPLRLFSIGGSTVVTEWNLATGLPLKNFDGNAGVIWSIAINSSKDKLALGCDNGTIVI
                     VNISGGQGVLEYETILMRQDARILSLTWNKDEFVIGGCSDGRIRIWSVNNNGRITHTM
                     KVDKAKSESTLIWSVIYLPASNQIVSGDSTGSVKFWDFHYATLNQSFKTHESDVLTLT
                     TDCTNTQVFSAGIDRKIYQYSQVKDSKNSKSGANNKWTVASNRLLHSNDIRSLCSYQA
                     KGADFLASGGSEQSVVISSLSSFADGNYKKIPPIVPFSKNFLINREQRLVVMWYESTV
                     KIWTIGDDVEDDKNYKLVCKLNLKDEQNISTCGISPDGTVLVVGRSSTTKVFHLQPMD
                     SKLKVTKLDNNLLLKTGTRFVKFIDNSKLLICSVEDEVFTIDLESDDDEEMTEIELPE
                     IQQTKSGLKLPFINNINNIDINGKYAVVSYGYGVIVLIDIETKRSRVLANLMNYVTSI
                     IINPKRKSIISVTADNKIYEFNLTKLEDNEENNTGEDSSEEQLLSEWSKNNTDNLPKQ
                     FQELKEKCVGIFLDENSPSKVWFWTVSCLCRLDFSVDLPISNRKKTKKRSRDGLTITD
                     ESNFLNDGEDEDEDMDIDSNELPSITNDNYPRVKNDDSKRVNDEGEAFFITEKYKSIL
                     FTDFISKDEIFIVEKPQLLSSSSQKGAFNLSKLRF"
     gene            <444306..>447380
                     /gene="TPHA0D02160"
                     /locus_tag="TPHA_0D02160"
                     /db_xref="GeneID:11531104"
     mRNA            <444306..>447380
                     /gene="TPHA0D02160"
                     /locus_tag="TPHA_0D02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685240.1"
                     /db_xref="GeneID:11531104"
     CDS             444306..447380
                     /gene="TPHA0D02160"
                     /locus_tag="TPHA_0D02160"
                     /inference="similar to DNA sequence:INSDC:YDR325W"
                     /note="similar to Saccharomyces cerevisiae YCG1 (YDR325W);
                     ancestral locus Anc_5.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685288.1"
                     /db_xref="GeneID:11531104"
                     /db_xref="GOA:G8BSN3"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025977"
                     /db_xref="InterPro:IPR027165"
                     /db_xref="UniProtKB/TrEMBL:G8BSN3"
                     /translation="METDISMKVDGPDGNSEKNQLNDENSNIFHAIADVFQKAQSTYV
                     GHRRHVAVLKKIQKKANAQGHGEEFIYWFNKLVSKVLPLKKNKVIGDRIIKLVAAFVA
                     SLDRDLENIKQQDSDKAMKQSDGLTQEAFNQFVNRFIRHILRGVESKDRNVRLRSLQI
                     LAVLMDNIREIDEELYDLIMWSLNKRVYDKEANVRIQAVFCLTKFQDESMSNNSNDNK
                     KNKDEIVLDNATHKLMTIIQNDPSAEVRRASLLNLVNNKLTRAHILERSRDVNQINRR
                     LIYSRVLKSMGMTCFDVDTRIMNQLLKWGLEDREESVRSACARLISFDWLNWLKGDLI
                     ELIERLNVIKSDIADKVMEIIFNTRPDIISKVKFPEEIWTDFTVEIAFLSKCFYLHCA
                     NNNLVDIIEQNYPEGTKLAEYLTSYLRNRYDIQETQLSKLEKMHLDFIIEQLLVIATK
                     YDYSDEIGRRHMLTVIRNMLSLVDLSESLIKIGLEVLKILSINERDFVSMSIEIINDI
                     RDDDIDLQEKSEHKGNPNKEYDSDDEDDDNIENFKNAVEDLVDGKNSAIEEGINVKHA
                     EREATPETMIRCLTRSCNLLQLVENPLEQNVLITSLIDTLITPAVRNSDQKIRVIGIR
                     NLGLCCLLDRQLAAENMYILGMCVSKGQEELKEVALQAIVDIFSVFGLSVVDGENMVD
                     SLSLHKIFYKVLKNGSLPNCQVIAAEGLCKLYLADIFTDDDLFETLVLSYFTPQNSSN
                     ERLIQAFAFCIPVYCYSHPAHQQRMGRIAADVLLRLCIIWDDIQTNDDPESELQKMLK
                     PNILFQQFIDWTDSRKLISSSSRFHNQDHYNVQLDFLLDVLKVFPKFEKKEIKKLLLI
                     NVNAVYISVEQDLARLQEILTYVEDIIENETLDYMSSNSLSKFKNTLIETITTLREDG
                     KQTEVGSNSDEEFSQVLDSTYNKSDIDSIAEGDMDDDSAVDLKSKVESPVDESALKKR
                     TIDDVEIENESNIEEISSTLLKSENLKNVSFILPEDNESDSMSVDDKLYIDD"
     gene            complement(<447487..>447843)
                     /gene="TPHA0D02170"
                     /locus_tag="TPHA_0D02170"
                     /db_xref="GeneID:11534287"
     mRNA            complement(join(<447487..447652,447731..>447843))
                     /gene="TPHA0D02170"
                     /locus_tag="TPHA_0D02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685241.1"
                     /db_xref="GeneID:11534287"
     CDS             complement(join(447487..447652,447731..447843))
                     /gene="TPHA0D02170"
                     /locus_tag="TPHA_0D02170"
                     /inference="similar to DNA sequence:INSDC:YHR079C-A"
                     /note="similar to Saccharomyces cerevisiae SAE3
                     (YHR079C-A); ancestral locus Anc_5.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685289.1"
                     /db_xref="GeneID:11534287"
                     /db_xref="InterPro:IPR010760"
                     /db_xref="UniProtKB/TrEMBL:G8BSN4"
                     /translation="MTDYITLIKKKEQLLKEQEAEYESLLKSYGQSCLKHGITIPPKQ
                     ILATHISKLKEYNELRDTGLKLIQLIANEKNCPLKTIFEEMGHQMKDT"
     gene            complement(<448155..>452642)
                     /gene="TPHA0D02180"
                     /locus_tag="TPHA_0D02180"
                     /db_xref="GeneID:11534600"
     mRNA            complement(<448155..>452642)
                     /gene="TPHA0D02180"
                     /locus_tag="TPHA_0D02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685242.1"
                     /db_xref="GeneID:11534600"
     CDS             complement(448155..452642)
                     /gene="TPHA0D02180"
                     /locus_tag="TPHA_0D02180"
                     /inference="similar to DNA sequence:INSDC:YDR326C,YHR080C"
                     /note="similar to Saccharomyces cerevisiae YSP2 (YDR326C)
                     and YHR080C; ancestral locus Anc_5.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685290.1"
                     /db_xref="GeneID:11534600"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G8BSN5"
                     /translation="MGGTNNDKRSVSDSSFFKIFKKLGSSSKKNGSTRSTNRNFKNKN
                     VTSSNRSSGKKQSTSLRHLKNDFLSKKRTADSQTNALELPDIVSIKSGRSSNKSMDLG
                     WHPRRSIHNSTRGFNKLNSNNVPGISDIYVSLENPSNGTNNGTNNVPDDSTNNTYNGN
                     ANNNGKANGKNMHVAGSINFKHLNKHNISANDDHQGTGTNLSSRITNQSLTHLNTSNN
                     VTNTSLATNNKEHDSEHTIFGTLMALANNVSSSRLLPHESDSISKLPTDTVLSNNENI
                     IINGTEISTNTTSDSELAEPPKISVVTENGKPTNDNTLELDHKTGTNSEEHSIKNGKD
                     RMTTGTAIRQALSSVDRSNSFLRHLDFLLASPEASSPDAHSTDKLNSATNTDTNTNSH
                     GLFEKLVHGNGSQKLNGSSSDITKPDMTQVSTQSRLSHDRIAKVKFQSLSEAEPALNT
                     FGKGNLTLDALARSSNSDSSVTESERHYTNHSGENIVMSYEGSNKTNEVPKIEVTNTN
                     SSSSKNQPYGVKNSVMDSSVNNSKTNLSKNLKRNSGSFSNLLSLRTRSKTLPGNNEDT
                     DEKDPKKVPRLTWSYEESQNTNNNNNNNNNNNNNSIQDDSIATDSDERQPRRLSRKFL
                     DRRSFSPSIGMKVLPPMKNLASTLNRRGGSISDPSLSQANNGNGDSTRARASTAASAV
                     MSPTLNVEIDDKIELQGIDYASEKKNAEFHKFFKDITEIKQNERLILELSCALSRDIL
                     IQGKMYVTDQNICFNSNILGWISSVIIPFKEIVQIKKKSTAGIFPNGIVIDTLHTKYV
                     FASFISRDSTFDIITDIWNQIILGRRHFNLRGGDDLNSKMSIDIGSDSDISDFEDETH
                     RRSSDDANYLQTEENAAYDDDSLGSLIDSTEMTSTDEADDEKPKTTKGTSDLNEGPKK
                     HGPTTVDYKMSDNQKLINETVFDAPLGKVVNMLYGSDTSYLSNILKAQKNYNISSLSG
                     LLGKKTREFNYTKPISGPIGPNKTVCNITETLDNYNLQDNVQVTQISKTPDVPSGSSF
                     FVKAVHVFTWAPNNATKMQVYLSVEWTGKSWVKGAVEKGTFDGVTATTNTMATELTKF
                     VQDIKSSLTESKDVAEEEEEVLKLPTLEPATHAPTDNGYKKEKDDKIIDENVNFNAPL
                     GTVFQVLFGNDTSYMTRIIKTKNIELSAVPKFVNNAREYNYVKPLNNSLGPKQTKCLL
                     TEKIEHMDTNGYIMVRQITKTPDVPSGNSFSIHTRIFLSWGPNNTTDMTVVTNIIWEG
                     RSFIKGAIEKGSIEGQKSSNQILIEELKDIIASSVSSGKKRKRSKSKRRRSTKETSIP
                     QDVIPTTAATKNQGIFSSIFSIFENFDITSINGIITLVVTFIVCVLFLQKLFGRSQSK
                     IQVLRPGKMLIDGQEYNFVPNVKTLYDVYENDIKSSSKRKNSGSVDLLQETEGDIWNW
                     INERGDNSLHSTFEDISFDMDKLQGKAPNYKLQQLQEAIKITELQLSKMRNLLDNLQN
                     S"
     gene            complement(<453657..>454214)
                     /gene="TPHA0D02190"
                     /locus_tag="TPHA_0D02190"
                     /db_xref="GeneID:11534389"
     mRNA            complement(<453657..>454214)
                     /gene="TPHA0D02190"
                     /locus_tag="TPHA_0D02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685243.1"
                     /db_xref="GeneID:11534389"
     CDS             complement(453657..454214)
                     /gene="TPHA0D02190"
                     /locus_tag="TPHA_0D02190"
                     /inference="similar to DNA sequence:INSDC:YDR328C"
                     /note="similar to Saccharomyces cerevisiae SKP1 (YDR328C);
                     ancestral locus Anc_5.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685291.1"
                     /db_xref="GeneID:11534389"
                     /db_xref="GOA:G8BSN6"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="InterPro:IPR016897"
                     /db_xref="UniProtKB/TrEMBL:G8BSN6"
                     /translation="MSTASKTQKVVLISGEGERFTVERSVAERSLLLKNYLNDMHDND
                     LNNESDEDEDADDDDDDDDDEIVMPVPNVRSSVLQKVIEWADHHKDSNFPDEDDDDSR
                     KSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRT
                     FNIVNDFTPEEEAAIRRENEWAEDR"
     gene            complement(<454720..>456270)
                     /gene="TPHA0D02200"
                     /locus_tag="TPHA_0D02200"
                     /db_xref="GeneID:11531090"
     mRNA            complement(<454720..>456270)
                     /gene="TPHA0D02200"
                     /locus_tag="TPHA_0D02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685244.1"
                     /db_xref="GeneID:11531090"
     CDS             complement(454720..456270)
                     /gene="TPHA0D02200"
                     /locus_tag="TPHA_0D02200"
                     /inference="similar to DNA sequence:INSDC:YDR329C"
                     /note="similar to Saccharomyces cerevisiae PEX3 (YDR329C);
                     ancestral locus Anc_5.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685292.1"
                     /db_xref="GeneID:11531090"
                     /db_xref="GOA:G8BSN7"
                     /db_xref="InterPro:IPR006966"
                     /db_xref="UniProtKB/TrEMBL:G8BSN7"
                     /translation="MNNKNIKQISFLQRNRKRFITAAALSTVIFATGSIFLYFLKSWL
                     YKQQLKITEQHFIREQIKRRFTQTQHDSLIVLYELLPVFVLILAKDYNLDELVIALRD
                     KKLKKSQISAEKNATVEDGNVAGTSGSSIPGGTISEVTVDTNLPPYNLTLGDSQLESS
                     EKYADFTKAQLWHELQLKSLVKLITISYTISSLFLLTRLQLNILTRREYLATAVNIAI
                     EQENAKQKNNSISNSVFNWFSGFIYKSPDDNKDKLSSEGENIEAADSKTKLMYINEQA
                     FLSTSWWILNNGYLVFSELATRKVDEYFSNYNPKDTLSLMEFSNNMSNIFHSINKELF
                     TNNISEIETSQPINNISDIFLPEDSKIDYMLQRTMDENSLKELSSDSLILSQLLSETA
                     EYLNDKSSIISLELLLNESFQFIMNEIENSVLSKIKKSNKKVNNETVENDATQESDIK
                     NKKVQLALIAMAGKDCCTKMLINNNDLVPFRNTTSTQTVKNEYLKRLDTVTSLNDLSA
                     SVYGKVDF"
     gene            <456696..>458246
                     /gene="TPHA0D02210"
                     /locus_tag="TPHA_0D02210"
                     /db_xref="GeneID:11531106"
     mRNA            <456696..>458246
                     /gene="TPHA0D02210"
                     /locus_tag="TPHA_0D02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685245.1"
                     /db_xref="GeneID:11531106"
     CDS             456696..458246
                     /gene="TPHA0D02210"
                     /locus_tag="TPHA_0D02210"
                     /inference="similar to DNA sequence:INSDC:YDR330W"
                     /note="similar to Saccharomyces cerevisiae UBX5 (YDR330W);
                     ancestral locus Anc_5.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685293.1"
                     /db_xref="GeneID:11531106"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BSN8"
                     /translation="MSTDEINNFMMITGTGDSELASQFLEMAGFNLDTAISLYFEHGG
                     KSLLNSNTNNQNDNNNDEAPSNIVNVDSDAELAQRLQNEAYNTPQPGDTGYIRPPDEA
                     RHETLAETHIFPGTYGGVGGAFQHLRRQVNDSSDIFDSSRPVGVFNQRFESNDSDSDS
                     DSDSDSDVSIQEDAENLYEYVEEPAIEITEDGEVREYTKLIKKTRNITKEERLAMLFR
                     PPFEIMSKIDLDRAKNKAMKKKKWMMINIQDVGIFQCQALNRDLWSSKIVKKFIKKKF
                     IFLQYQYDSRNAQQYIQFYNLQNKENLPHIAILDPITGERLKQWNAIVPKENEFINEV
                     EEFLSNFSLDPSTVNPIVNEPAPKLDPTILSEEQQMEFAIRQSMGLSSEETSEEYKPS
                     LKTDNVKDNEPVEENDEQFDEKESSILASINPVEHIEPPNRPGITTRIQIRMGNGQKI
                     VRRFNATEDKVRTIYEFIKHDLTEYSDVEFTLSDHQRHDLIDKLVMTIDEAGLKNSSL
                     LLEKVQED"
     gene            <458556..>459536
                     /gene="TPHA0D02220"
                     /locus_tag="TPHA_0D02220"
                     /db_xref="GeneID:11534558"
     mRNA            <458556..>459536
                     /gene="TPHA0D02220"
                     /locus_tag="TPHA_0D02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685246.1"
                     /db_xref="GeneID:11534558"
     CDS             458556..459536
                     /gene="TPHA0D02220"
                     /locus_tag="TPHA_0D02220"
                     /inference="similar to DNA sequence:INSDC:YHR083W"
                     /note="similar to Saccharomyces cerevisiae SAM35
                     (YHR083W); ancestral locus Anc_5.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685294.1"
                     /db_xref="GeneID:11534558"
                     /db_xref="InterPro:IPR021211"
                     /db_xref="UniProtKB/TrEMBL:G8BSN9"
                     /translation="MANIFQIPTPLKYIFNGFPLKTYGPISNTDKSMVKEIESRRYYF
                     RGTNSIKTTLDDTFLLGVYNVFEDEQTNSILATDPICLFVEIVLCQQNSLKLPQANVN
                     RDTERDAYTCSLACLSPLSNKGEELPILAEGFKKRFIRSSFLINESIKIKMQHNQSNT
                     EMLYVELLDSSIYDGWISHVLFTLDKTGFSKLYLFDTNQSVFSVKESLIKSNGFSLRH
                     RRLSEYLSKKVTIHTKTEDIQKELIQPIVSNCEETLLKFEEIIKKEPTLWSNNKYDTI
                     INYLNIKIISYVKCLLNLPDTSSLRLFLVERCPNLIKYAEDSIIKYIDEQ"
     gene            <461420..>463780
                     /gene="TPHA0D02230"
                     /locus_tag="TPHA_0D02230"
                     /db_xref="GeneID:11534573"
     mRNA            <461420..>463780
                     /gene="TPHA0D02230"
                     /locus_tag="TPHA_0D02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685247.1"
                     /db_xref="GeneID:11534573"
     CDS             461420..463780
                     /gene="TPHA0D02230"
                     /locus_tag="TPHA_0D02230"
                     /inference="similar to DNA sequence:INSDC:YHR084W"
                     /note="similar to Saccharomyces cerevisiae STE12
                     (YHR084W); ancestral locus Anc_5.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685295.1"
                     /db_xref="GeneID:11534573"
                     /db_xref="GOA:G8BSP0"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="UniProtKB/TrEMBL:G8BSP0"
                     /translation="MNAYNQMDRTETIMKSSSGMQNSKMESSPEEIEEAFRLIEDLKF
                     FLATAPVNWQENQVIRRYYLNNDQGFASCVFWNNLFYITGTDIVKCCIYRMQQFGREI
                     IQKKKFEEGIFSDLRHLKCGIDAALEQPKSEFLSFLFRNMCLKTQKKQKVFFWFSVPH
                     DRIFADALERDLKREASNQPSTTRPVREPAISFKYNFVSDVSLYDQLKAQTSSKITQP
                     EMSPSFEIDTESNAELETKEDPPDFKVEVDLQEQLFTKNELELDTVSEEIFNKQPESL
                     KTLDESETKVNSEFTEKEGDITSQVLVLDYDDNVELNDNYETQEEKRKTDLINKLVEI
                     DEDDFPLDYIPVEIEYPNQENILLHGFNSQFPDTSNQKNPIYDNYTMPMNNLNQYNYP
                     EDELIQPNNIVSYQLMPPLTASQPMFPMGWAVPATARTPFMSNSDFYNTVRREPGVTN
                     YSNKNNETFNGNALSRENSRQEEVLEDNDTENNKQLDNDDFYNERNINNENTNKKDNA
                     SSTTSNRSSLPNETEENTDSIARSQSDNKTHQRNNSNIYGMNGSNPERNYYNNQTKGL
                     DHEEQYQPFPVYPNMHPIQLSYINGMVPPGMQMNFPGYPMNKPMTVAENGDLPVSDDL
                     PQSEDMMYDEYHYSGMDQYGWYCGMPGGMPPSTNFYSQFHTTPVVKQNGIPSRNGYIQ
                     TLSSPWKSQKKYPPAMNSKEQARTNQRSVNLAPDERWRHYRTKTQTNPNNKFTFSKTN
                     KIPKYNGNNNNRIHKNNASIKIKRTYTNADLTNDNNSNEKDSKGKR"
     gene            complement(<464064..>466289)
                     /gene="TPHA0D02240"
                     /locus_tag="TPHA_0D02240"
                     /db_xref="GeneID:11530983"
     mRNA            complement(<464064..>466289)
                     /gene="TPHA0D02240"
                     /locus_tag="TPHA_0D02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685248.1"
                     /db_xref="GeneID:11530983"
     CDS             complement(464064..466289)
                     /gene="TPHA0D02240"
                     /locus_tag="TPHA_0D02240"
                     /inference="similar to DNA sequence:INSDC:YDR333C"
                     /note="similar to Saccharomyces cerevisiae YDR333C;
                     ancestral locus Anc_5.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685296.1"
                     /db_xref="GeneID:11530983"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:G8BSP1"
                     /translation="MSSRALRKLQDDNDLLESLLSSASKKNLTSAVKKDNKANSGSNM
                     FSLMNDNNSSDNYNETDISNEEDQLDLIETDIKKEVEEPKKITIATKSQKKKKNKLNK
                     KKKSITKANHENNNTNSDDEITESHDDEFDQIIQQFQKRNVLEYGSMINNFQLDSDDN
                     AIGNDDNLDVDSDEFMTASDNEDYITGKDSKSFVLSDFFFDTSFSKFPVHILKNYSWA
                     FNTNVKNLDPHTEFKLLFDDISAESLEDIDSLSSAHISPQQLKQIQRLKRLVRNWDGQ
                     DHRTVPNGPGGSVHKLLFTKIRPDWLPTQRGELSMTLLKHEDVCDWQLIQRPTEWKDM
                     ISEDVTNWRKHISFFKFEPLNSETNKKALTEFYLSVVLHPDHESLINLISSKYPYHVP
                     GLLQVALIMLRQGDKSNTNALIQRALFVFDRALKSGLKFNSTSVQLPFIYFYNRQFYF
                     AIFRNIQMLSQRGAVGTASEWTKVLWSLSPLEDPVGCRYFIDQYLLLNNEYHYIIKLS
                     NSPLIKTYRQWYTFSFGMAVVLSYLRIDESKKALKELRNVFKYHAKSLAYIFKEKLLG
                     DSKLVDNFQVEDNSLAHIEAKAYITRFPSIWKESSDLSFLLAELQQLFTDYKKNAFDI
                     IPEPNYSDFKGTHHPFYIDSLPVNLLRFVFLSDESSVAAAIPSNIWSDNQIYEFDVLP
                     PESIDRETADIVEKITSFIDGQELEMYQMALLQDETLLDQIRQLSLDQYLEENPNMEI
                     E"
     gene            <466791..>467690
                     /gene="TPHA0D02250"
                     /locus_tag="TPHA_0D02250"
                     /db_xref="GeneID:11534131"
     mRNA            <466791..>467690
                     /gene="TPHA0D02250"
                     /locus_tag="TPHA_0D02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685249.1"
                     /db_xref="GeneID:11534131"
     CDS             466791..467690
                     /gene="TPHA0D02250"
                     /locus_tag="TPHA_0D02250"
                     /inference="similar to DNA sequence:INSDC:YHR085W"
                     /note="similar to Saccharomyces cerevisiae IPI1 (YHR085W);
                     ancestral locus Anc_5.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685297.1"
                     /db_xref="GeneID:11534131"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="UniProtKB/TrEMBL:G8BSP2"
                     /translation="MGNSHRKQKLKIQDFKKKKLKVGKPQDKPSNLTDASFSSRTINI
                     KKQYLETNSDLSKRLPLLKHHNNTVRKETIQLFQKMLPKIINSTLLSPLITKSIPLIC
                     DESRQVREAYVEFIDEIGKINPQVLQLHSKIFVLYISMSMTHIVPSIQADSSKVLGVL
                     LKYCGEEICKQSWTKLLTGLLSVLGWGTVGKNEKSSIAHTRKKDAKTTNIHLQTLCEF
                     IRWGCTDLTALNEEIDEEGNSVIENIKNPYLISKHPNPYEFLRLFDKVLTNKNKNENN
                     ADNNKTNESNNPRDSSSQHLTDP"
     gene            <468476..>473050
                     /gene="TPHA0D02260"
                     /locus_tag="TPHA_0D02260"
                     /db_xref="GeneID:11534292"
     mRNA            <468476..>473050
                     /gene="TPHA0D02260"
                     /locus_tag="TPHA_0D02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685250.1"
                     /db_xref="GeneID:11534292"
     CDS             468476..473050
                     /gene="TPHA0D02260"
                     /locus_tag="TPHA_0D02260"
                     /inference="similar to DNA sequence:INSDC:YDR334W"
                     /note="similar to Saccharomyces cerevisiae SWR1 (YDR334W);
                     ancestral locus Anc_5.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685298.1"
                     /db_xref="GeneID:11534292"
                     /db_xref="GOA:G8BSP3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BSP3"
                     /translation="MNKKTTNTVNKEDERRNSLAQLAYEYEVLCNELFHLKEYISLLE
                     FDPSYRNSSNSYDTFIKENDLSLKSLDIKKENGSTSRSEVSNTALRVRKRQLRQSGNE
                     QPQAKDTYWFDDIKPLVDKKYDALSTEIDVVDKDNKINTKPTVLKAVKENETTSSSKK
                     KSESEKQKNTNETQVPFKPETHLHNSTRKHKIRNHDVVDKNSNNETIKQKVAFTASQN
                     NKLGSEELKLMKKEEKPKTARVNIEKNENEDGNDEDSDDYYFTTSSDESDTPFTKRKK
                     RNLTIPTIKLVVHPPKQTITNPGHVVKSEYGGVSNFLSSFRSMDEDMTNEEFEDYISE
                     QRKVLSQLRKGLESGALKYDEETDSIQPITTKDTKVAQVNKTHAISYLYKEQNVQVFQ
                     DTLVKHGVQWSKLFQNNKRSRILRARKVSQMIEQHFRHIAGAEERKIKEEEKHRKLLA
                     RSAMQAVKKRWNMAERAYKVLKKDEEQELKRIQGKEHLSKVLKQSSELLDAQLRNITS
                     RDSKGDLNSSEMEQSSEDDLSNEDDVTSSSEEESDGQTDFSEKKEVDKDLSVEQLKEK
                     YKFINEVSNAETLETLVPEIASGNDESSPESSYANTASKDDGLKALFDSISTDDEDAD
                     INESFTVSSDENVNFSASDELNITSSEEEEEDANESGDNNNPEIDEKHSSTEFDKPST
                     TETKTFEPEKTIPTTVVDVPTPSLLRGTLRIYQKQGLNWLASLYNNNTNGILADEMGL
                     GKTIQTISLLSYLACEKQNWGPHLVVVPTSVLLNWEMEFKKFAPGFKVLTYYGNPQQR
                     KEKRKGWNKQDSFNVCIVSYQLVVQDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALL
                     NFNTQRRLLLTGTPLQNNIGELWSLLYFLMPQTVTNGNGVSGFADLDAFQQWFGKPVN
                     QIIESGQAVEEDSETKDTVEKLHKVLRPYLLRRLKADVEKQMPGKYEHIVYCKLSKRQ
                     RFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPDLFEVRPIMSSFSIDNSAV
                     STYNDTQRYVHNLLHANDYKENVDLQTLNFVFTKNDEYLSSNNSKTISTSKCIKEFVD
                     EVDKLRSNIDLEQRKNSDNFDFTLEFFKNLGIRKIQELVNSIEHRKYLNNLRCDKSPV
                     YGKNLINLLVVKDDRLEDVSFSAELIKPLQTRIISSRDMIQNFAVITPNVVTLDIRPI
                     SLGLDNGSSIAEQNRAVVINKLHNTTNPFHQLQTKLTLAFPDKSLLQYDCGKLQRLAT
                     LLHELKDNGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNSD
                     PRVTVFILSSRSGGLGINLTGADSVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRF
                     VSEHTIESNILQKANQKRHLDNLVIQQGDFTTDYLTKLSVKDILRNDDSDDSAPENDK
                     PLLFNTLGSGVKGSQKLESLLAHAEDEEDVKAANLAMKEIEVDNEDFDENADQNSKDE
                     PGPDSELVLYEGTKHVEEYMLRFIANGYYY"
     gene            <473891..>474226
                     /gene="TPHA0D02270"
                     /locus_tag="TPHA_0D02270"
                     /db_xref="GeneID:11531019"
     mRNA            <473891..>474226
                     /gene="TPHA0D02270"
                     /locus_tag="TPHA_0D02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685251.1"
                     /db_xref="GeneID:11531019"
     CDS             473891..474226
                     /gene="TPHA0D02270"
                     /locus_tag="TPHA_0D02270"
                     /inference="similar to DNA sequence:INSDC:YHR087W"
                     /note="similar to Saccharomyces cerevisiae YHR087W;
                     ancestral locus Anc_5.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685299.1"
                     /db_xref="GeneID:11531019"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:G8BSP4"
                     /translation="MSQLSRCFYKGEDTDFVVYIKSKDSLDDYLKEPSVTKLTDTVEL
                     FQIFSNHEGKGSDGQLGEASHAQLENEFGRGKKPEEVIDLILKNGQYKGNNRMKENTF
                     RGARTNARQ"
     gene            complement(<474697..>475344)
                     /gene="TPHA0D02280"
                     /locus_tag="TPHA_0D02280"
                     /db_xref="GeneID:11530970"
     mRNA            complement(<474697..>475344)
                     /gene="TPHA0D02280"
                     /locus_tag="TPHA_0D02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685252.1"
                     /db_xref="GeneID:11530970"
     CDS             complement(474697..475344)
                     /gene="TPHA0D02280"
                     /locus_tag="TPHA_0D02280"
                     /inference="similar to DNA sequence:INSDC:YHR089C"
                     /note="similar to Saccharomyces cerevisiae GAR1 (YHR089C);
                     ancestral locus Anc_5.388"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685300.1"
                     /db_xref="GeneID:11530970"
                     /db_xref="GOA:G8BSP5"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR021154"
                     /db_xref="UniProtKB/TrEMBL:G8BSP5"
                     /translation="MSFRGGARGGSRGGFRGGRGGGFSRGGGNGGRSFQQGPPDSVLE
                     MGAFMHDCENDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCSEG
                     VQATSFKEGDKFYIAPDKLLPIERFIPQPKIAGPPKPKSKKKRTGAPGGRGGFSSGGS
                     RGGFSRGGSRGGFSRGGSRGGFSRGGSRGGFSRGGGRGGSRGGFSRGGGRGGSRY"
     gene            <476042..>476968
                     /gene="TPHA0D02290"
                     /locus_tag="TPHA_0D02290"
                     /db_xref="GeneID:11534418"
     mRNA            <476042..>476968
                     /gene="TPHA0D02290"
                     /locus_tag="TPHA_0D02290"
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /transcript_id="XM_003685253.1"
                     /db_xref="GeneID:11534418"
     CDS             476042..476968
                     /gene="TPHA0D02290"
                     /locus_tag="TPHA_0D02290"
                     /inference="similar to DNA sequence:INSDC:YDR337W"
                     /note="similar to Saccharomyces cerevisiae MRPS28
                     (YDR337W); ancestral locus Anc_5.389"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /protein_id="XP_003685301.1"
                     /db_xref="GeneID:11534418"
                     /db_xref="GOA:G8BSP6"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:G8BSP6"
                     /translation="MLRYGLLGLKPALNASIKRNLSGTGAVEGQKAIRYLKSQKIRQK
                     NEAIQASIKNALDTVDPVLGKADTPFINRILSELEEKNVLAGGHTKDEVEKLIAAIEA
                     KNIDESTRNVQGSLLTQNDTTSLLLKPDEKMFATRREAILRILNIKNSDSKNRVKLAT
                     RLAIKEFQRFEGDVGSSEVQAACMTIRIYNMARNLKEHHKNFAMIRSLRMLVQQRQSI
                     LRYLKRDNPEKYFWTIQKLGLSDLSVTKEFNMDRQYMQDFKFYGDKILVKESKNETER
                     KRKEVRKQKKLSKNSASIVEENSNIVEIGMKQ"
     gene            complement(<477320..>478204)
                     /gene="TPHA0D02300"
                     /locus_tag="TPHA_0D02300"
                     /db_xref="GeneID:11534256"
     mRNA            complement(<477320..>478204)
                     /gene="TPHA0D02300"
                     /locus_tag="TPHA_0D02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685254.1"
                     /db_xref="GeneID:11534256"
     CDS             complement(477320..478204)
                     /gene="TPHA0D02300"
                     /locus_tag="TPHA_0D02300"
                     /inference="similar to DNA sequence:INSDC:YHR090C"
                     /note="similar to Saccharomyces cerevisiae YNG2 (YHR090C);
                     ancestral locus Anc_5.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685302.1"
                     /db_xref="GeneID:11534256"
                     /db_xref="GOA:G8BSP7"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:G8BSP7"
                     /translation="MDPSALFEQTINDVSNLQAEFKYLLEEIKNHDNSIYDMKSHYNK
                     LDSDIQKFIKQNGSLKEYPKEAEVTKQIKNEMEKAKDIQKIKAMKANTMLYLITKHLK
                     KLEKGVELLEDDGLLVPLEEELDSDMETSRGASIASATSTEKKRKASTPLGTTGENTK
                     KKRQTNRLSSNKLENTKSNIKEDIRPPNGVGSTEGAESTSLATKNSEVYGLGDISSAN
                     IFTGMNNGGDEEEDKTLYCFCQSVSYGEMVACDGANCKYEWFHYGCVNLNEPPQGAWY
                     CPDCRQELAKNTLKKKRS"
     gene            complement(<478545..>479114)
                     /gene="TPHA0D02310"
                     /locus_tag="TPHA_0D02310"
                     /db_xref="GeneID:11534396"
     mRNA            complement(<478545..>479114)
                     /gene="TPHA0D02310"
                     /locus_tag="TPHA_0D02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685255.1"
                     /db_xref="GeneID:11534396"
     CDS             complement(478545..479114)
                     /gene="TPHA0D02310"
                     /locus_tag="TPHA_0D02310"
                     /inference="similar to DNA sequence:INSDC:YDR339C"
                     /note="similar to Saccharomyces cerevisiae FCF1 (YDR339C);
                     ancestral locus Anc_5.392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685303.1"
                     /db_xref="GeneID:11534396"
                     /db_xref="GOA:G8BSP8"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8BSP8"
                     /translation="MGKAKKTRKFALVKRTIDTKKDQRLKANQKKNVQKDDPELTRNI
                     PQVSSALFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCV
                     MAELEKLGPKYRIALRLARDPRIKRLSCSHKGTYADDCIVNRVLQHKCYIVATNDQGL
                     KQRVRKIPGIPLMSVGGHAYVIEKLPDVF"
     gene            complement(479746..479846)
                     /gene="TPHA0Dtrna8S"
                     /locus_tag="TPHA_0Dtrna8S"
                     /db_xref="GeneID:11531131"
     tRNA            complement(join(479746..479791,479809..479846))
                     /gene="TPHA0Dtrna8S"
                     /locus_tag="TPHA_0Dtrna8S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11531131"
     gene            <480590..>482281
                     /gene="TPHA0D02330"
                     /locus_tag="TPHA_0D02330"
                     /db_xref="GeneID:11530979"
     mRNA            <480590..>482281
                     /gene="TPHA0D02330"
                     /locus_tag="TPHA_0D02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685256.1"
                     /db_xref="GeneID:11530979"
     CDS             480590..482281
                     /gene="TPHA0D02330"
                     /locus_tag="TPHA_0D02330"
                     /inference="similar to DNA sequence:INSDC:YBR223C"
                     /note="similar to Saccharomyces cerevisiae TDP1 (YBR223C);
                     ancestral locus Anc_6.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685304.1"
                     /db_xref="GeneID:11530979"
                     /db_xref="GOA:G8BSP9"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:G8BSP9"
                     /translation="MKEEKRSEVRRKVAEKWCNFGVKTKLQKTGVSTDEQSNRNYRQV
                     IDLTNSSEDDTDIETSNMADNCEVITDSAELENEHSQFKLVESQLYEQNESNESNNSF
                     TKSPYFIRMKDIFGDNRLKTSILFSFQFEMNFLLSQFNLDTIENIYVIAQKNTVVPPT
                     LKKFNSVFDRLNIVEFYMPPFSCHHSKMVINIYEDKSCKLFIPSNNFTFYETNLPQQV
                     CWEGPTLPYDINSKNQKISFKENLISYFQSYPSEVKIMNRTIIPMISNIDFSKLNNVE
                     FLYSSPNDKDSGISKLLYLLEKNDLLGCSDDINKRTHFLCQSSTIGGSLSKTVPLNIF
                     THLMIPEFSGIQKSNKKLKTSQELIDIYREKRISPYIVYPTVEELRNSPSGWKCSNWF
                     HFNYKNKAEYYEVLAKDFKLFYKQKDQLTSKYRKATPSHSKFYIRCTENDSKVPARFS
                     KLDWCIFTSSNLSFNAWGKLSSKPRNYEVGILLCSNEGQQINCSSFSRKIDEHQGCSR
                     LSDSNNTKNDGKKNINVMVPFTLPLEPYDIKYDTAFCIQKSYNLPDCFGEVNDPY"
     gene            complement(<483713..>485233)
                     /gene="TPHA0D02340"
                     /locus_tag="TPHA_0D02340"
                     /db_xref="GeneID:11534455"
     mRNA            complement(<483713..>485233)
                     /gene="TPHA0D02340"
                     /locus_tag="TPHA_0D02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685257.1"
                     /db_xref="GeneID:11534455"
     CDS             complement(483713..485233)
                     /gene="TPHA0D02340"
                     /locus_tag="TPHA_0D02340"
                     /inference="similar to DNA sequence:INSDC:YML007W,YDR423C"
                     /note="similar to Saccharomyces cerevisiae YAP1 (YML007W)
                     and CAD1 (YDR423C); ancestral locus Anc_5.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685305.1"
                     /db_xref="GeneID:11534455"
                     /db_xref="GOA:G8BSQ0"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ0"
                     /translation="MEEYLDTGKDKEQNNADYRMKRIAQNRAAQKAFRERKEKKMKEL
                     QEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYRIDKNDDFRLKKIGSQLKHEKLN
                     LNKLTKSSSSSSRLSSLMEDLNSNKIDTITKTLTNSSFASMNGSTHSPTSDFAINNID
                     IVSPHSASGSFTNQTTAGTSYSHFSSELNSPTSVSNYFAGNAGTTWPEAFSMTDLMVN
                     SGHMMGGSANNQQSNINSLSVTMDDEKVSSLVDEKSSILQQDSNLFSTEFDFANEFDE
                     QVSTFCAKMNKTFENRKEMIKQFYTEKVRNSNNKPRTVSIKQEPTTTLQANIQPSDSN
                     DVTESLVAASIAFPEQYNMVKSDSLYNFLKQNNNNIGYGDVRGNISTQPNSIMTNNLS
                     NNEQNYNFSKDAQFIVSQQNTVRNIQTANEYPNIYETDDSSDGGDEVVGQIVPLTDGR
                     LLECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLSRRLV"
     gene            <486887..>488023
                     /gene="TPHA0D02350"
                     /locus_tag="TPHA_0D02350"
                     /db_xref="GeneID:11531070"
     mRNA            <486887..>488023
                     /gene="TPHA0D02350"
                     /locus_tag="TPHA_0D02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685258.1"
                     /db_xref="GeneID:11531070"
     CDS             486887..488023
                     /gene="TPHA0D02350"
                     /locus_tag="TPHA_0D02350"
                     /inference="similar to DNA sequence:INSDC:YML008C"
                     /note="similar to Saccharomyces cerevisiae ERG6 (YML008C);
                     ancestral locus Anc_5.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685306.1"
                     /db_xref="GeneID:11531070"
                     /db_xref="GOA:G8BSQ1"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ1"
                     /translation="MSGTTQEETTELRKRQAQFAKELHGEDAGSKTGLTALFSKNKSA
                     QKEAVAKYLKHWDGKTDAEAEDRRLEDYNESTHSYYNVVTDFYEYGWGSSFHFSRFYK
                     GETFFASVARHEHYLAYKAGIKEGDLVLDVGCGVGGPAREIARFTGANIIGLNNNDYQ
                     IAKAKYYSKKFHLEDQLDFVKGDFMNMDFEPATFDKVYAIEATCHAPKLEGVYGEIYK
                     VLKPGGVFAVYEWVMTDKYDASNPEHRKIAYEIELGDGIPKMFECDVARKALKNVGFE
                     VLVDDDLADNDDEIPWYAPLSGDWKYIQNISDLSTFVRTSYLGRKLTNAMVSVMERLG
                     FAPEGSVKVTQALEEAAVGLVAGGEAKLFTPMMLFVAKKPLDAK"
     gene            <489783..>491492
                     /gene="TPHA0D02360"
                     /locus_tag="TPHA_0D02360"
                     /db_xref="GeneID:11534264"
     mRNA            <489783..>491492
                     /gene="TPHA0D02360"
                     /locus_tag="TPHA_0D02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685259.1"
                     /db_xref="GeneID:11534264"
     CDS             489783..491492
                     /gene="TPHA0D02360"
                     /locus_tag="TPHA_0D02360"
                     /note="ancestral locus Anc_5.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685307.1"
                     /db_xref="GeneID:11534264"
                     /db_xref="GOA:G8BSQ2"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ2"
                     /translation="MIQDDKHVTNPIFRDLPTNVNEWKKQLYLQQYNEITCLRPDFNL
                     SDFNSPADDDQKLSQVLEYVDGFDSASTSTEKKMILQQISLKKNTNEEEETVASSSVA
                     KYWPIFTAGAGLFSDGYINSSIGTVSLCLSKIYGDTYSESTAIQNVSSIAFAGTVVGQ
                     LLFGYLSDNYNRKFSMLLGTSLLILFSILCAGAWGVHTSGTEPGGLFAAITAYRFFLG
                     IAIGSEYSSSSPAAAEASNLLPKEKRNRYFIWFTNFMIDFGFVIAAFVPLVLVWICGE
                     KHLTPVWRITIGLGAIPPFSLFFMRLKYKESERFNKSKFQSHPPYWLVIKFYWFRTLV
                     IATLWFIYDFSAYSFGTYSSIIIDHVLGKNPPLYQTLGWNVVFNVFYLPGAFLGAYFA
                     DYFGTRNTLAVFLVLQGAVGYIMAGLLEHLKKHIGGFVVIYGIFSTLGEVSGGDNIGC
                     IASKSNATPVRGQVYAVSAAIGKVGAFVGSYVFPDIIKNAGGYDTTKGLQAPYLVSSS
                     LCIFSAVLAYFCLPPLDPQSVVDEDIKFIEYLKSQGYDISKMGNSQEPTSRSRRTELL
                     EKI"
     gene            complement(<491900..>492178)
                     /gene="TPHA0D02370"
                     /locus_tag="TPHA_0D02370"
                     /db_xref="GeneID:11534401"
     mRNA            complement(<491900..>492178)
                     /gene="TPHA0D02370"
                     /locus_tag="TPHA_0D02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685260.1"
                     /db_xref="GeneID:11534401"
     CDS             complement(491900..492178)
                     /gene="TPHA0D02370"
                     /locus_tag="TPHA_0D02370"
                     /inference="similar to DNA sequence:INSDC:YDR424C"
                     /note="similar to Saccharomyces cerevisiae DYN2 (YDR424C);
                     ancestral locus Anc_5.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685308.1"
                     /db_xref="GeneID:11534401"
                     /db_xref="GOA:G8BSQ3"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ3"
                     /translation="MSNAVDESPILKASDINDDMKDEIFKISTEAFNEFKVERDIAGS
                     IKKQLDTKFGNTWHVIVGKNFGSYVTHEKGHFIYFYIGSTALLVFKTT"
     gene            <493047..>495077
                     /gene="TPHA0D02380"
                     /locus_tag="TPHA_0D02380"
                     /db_xref="GeneID:11531054"
     mRNA            <493047..>495077
                     /gene="TPHA0D02380"
                     /locus_tag="TPHA_0D02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685261.1"
                     /db_xref="GeneID:11531054"
     CDS             493047..495077
                     /gene="TPHA0D02380"
                     /locus_tag="TPHA_0D02380"
                     /inference="similar to DNA sequence:INSDC:YDR425W"
                     /note="similar to Saccharomyces cerevisiae SNX41
                     (YDR425W); ancestral locus Anc_5.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685309.1"
                     /db_xref="GeneID:11531054"
                     /db_xref="GOA:G8BSQ4"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ4"
                     /translation="MNYIDSSDGEDNNPFRGTDHLFASGIGTNPASQSGSSVEINDTL
                     EDNGDKLIDAKDVDTHRSSRSGKLLKRKNNILGSLDEDPKYYADVLDLPGRRSDGDTT
                     QSNSVSNSESPSNFEEEDIDVLNPQQLENVSDKNENDEDSNLNHDNVDKKSDGSSFEP
                     YVSLSMSVIDLTSNNRHNYVIEIVKAGDYKDPWGKHAIGYVIQYEGEEIIRRYSEFDS
                     LRKGLIKLLPTIVIPPIPSKHSLVKYFLNPINAENDKRIINKRKRMLQYFLNHCYDVE
                     EIKEHIIFKKFLDKEYNWKDVLFSPPLSLIPANNLLAPPLNPTKPSPMHLLLPSPTSI
                     SKVDLLKHSDEPSENDSNNTIIIEKELSRLEEFFNKYKYHLQNLHKSLHQNKAHNKSF
                     SKSLSDMGAYYNSLSIENSVISKQNTLNGVKLLSSSIESIGHSFDVNYLNTEILSENL
                     LISFEEPIEEMIQLLDDAQRVFNFRDLKKTQYQIIKNTITKRNSRIKSLQETEEQLKR
                     FQDASKRIALNSPTAAYAITQNNSSSFSSDISWDHVSEIQEQHSDNNESNDSPVSVNK
                     SKRYNSKKTNKKVEVSSKIEPYLLTAEQRHDEIQKLKKEVEKLTSCYKLIEKDMEEIN
                     VSSSNSLKNLSIFLDKQWYAILQSVSKAICQWLQESITSWKSTKEIIQRFDS"
     gene            complement(<495261..>496049)
                     /gene="TPHA0D02390"
                     /locus_tag="TPHA_0D02390"
                     /db_xref="GeneID:11531076"
     mRNA            complement(<495261..>496049)
                     /gene="TPHA0D02390"
                     /locus_tag="TPHA_0D02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685262.1"
                     /db_xref="GeneID:11531076"
     CDS             complement(495261..496049)
                     /gene="TPHA0D02390"
                     /locus_tag="TPHA_0D02390"
                     /inference="similar to DNA sequence:INSDC:YDR428C"
                     /note="similar to Saccharomyces cerevisiae YDR428C;
                     ancestral locus Anc_5.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685310.1"
                     /db_xref="GeneID:11531076"
                     /db_xref="GOA:G8BSQ5"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ5"
                     /translation="MNFCNQYQTVCFRDVKLGELSKEVISIIFIHGGAWVDPTNTAND
                     FKEFSGYLNNLFDQLKMSEDSLISMFGINYRLSPRVKHPVHLLDVINSIFNIVKNHKI
                     NNIYLVGHSVGATLIWQILSFDFTSNLANSELSSKVKYIIKNVRGVFLLDGIYSIDNL
                     LKEFPDYSSFVSKAFTTTQDFIEPAPAIESFKNNTTEHIKIYLVHSYQDELLSLNQIK
                     LFMQVLMDNDIPFQLELSNFGLHNEVYKNKLVAQYIYHNIIHVQ"
     gene            complement(<496366..>497247)
                     /gene="TPHA0D02400"
                     /locus_tag="TPHA_0D02400"
                     /db_xref="GeneID:11531059"
     mRNA            complement(<496366..>497247)
                     /gene="TPHA0D02400"
                     /locus_tag="TPHA_0D02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685263.1"
                     /db_xref="GeneID:11531059"
     CDS             complement(496366..497247)
                     /gene="TPHA0D02400"
                     /locus_tag="TPHA_0D02400"
                     /inference="similar to DNA sequence:INSDC:YDR429C"
                     /note="similar to Saccharomyces cerevisiae TIF35
                     (YDR429C); ancestral locus Anc_5.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685311.1"
                     /db_xref="GeneID:11531059"
                     /db_xref="GOA:G8BSQ6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ6"
                     /translation="MIIPRTVHEVVENPDETVSYITYKETTVNGNTEKSKLTQKIRNI
                     FALQYINSSVLARKKWKKYGSETNSPPGPNHSTTQLGEEVYLLLGTNWRELEEEQTKI
                     ERKKKQDKLVSCRYCAGPHFSIHCPNKAESRNVSNKSLNNTTASSSKSVSDVSSDDVR
                     SSPSKKPLKVSDTNSVASSKTNPTINLETNNLESSDEGINNDKYSEQEEETFIIKISQ
                     LNTHATEEMIRDELLYAYDNIQRVAVIRNRETGKSRGFAFITFTDEKSAEDALYGLDG
                     KGFMNLILRVEWSVPRD"
     gene            <497891..>498415
                     /gene="TPHA0D02410"
                     /locus_tag="TPHA_0D02410"
                     /db_xref="GeneID:11530934"
     mRNA            <497891..>498415
                     /gene="TPHA0D02410"
                     /locus_tag="TPHA_0D02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685264.1"
                     /db_xref="GeneID:11530934"
     CDS             497891..498415
                     /gene="TPHA0D02410"
                     /locus_tag="TPHA_0D02410"
                     /inference="similar to DNA sequence:INSDC:YML011C"
                     /note="similar to Saccharomyces cerevisiae RAD33
                     (YML011C); ancestral locus Anc_5.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685312.1"
                     /db_xref="GeneID:11530934"
                     /db_xref="InterPro:IPR014841"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ7"
                     /translation="MAKLSYKQVEKFMNAKIPDEIEDSILETFAKYSIEEDMTVANLK
                     DYFNNLELPEILWSKIPSDEFCIEGTSIIDFDLLMKKTYHILIFMDNEDIIDELWGLF
                     VKQSGRGAQFTNVKLKNHVFGVKDIMKVCNTVAMKQNDRIIEMVSVATSGRRLYITYI
                     DFAYIMGKLGLLRF"
     gene            complement(<498558..>499199)
                     /gene="TPHA0D02420"
                     /locus_tag="TPHA_0D02420"
                     /db_xref="GeneID:11534249"
     mRNA            complement(<498558..>499199)
                     /gene="TPHA0D02420"
                     /locus_tag="TPHA_0D02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685265.1"
                     /db_xref="GeneID:11534249"
     CDS             complement(498558..499199)
                     /gene="TPHA0D02420"
                     /locus_tag="TPHA_0D02420"
                     /inference="similar to DNA sequence:INSDC:YML012W"
                     /note="similar to Saccharomyces cerevisiae ERV25
                     (YML012W); ancestral locus Anc_5.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685313.1"
                     /db_xref="GeneID:11534249"
                     /db_xref="GOA:G8BSQ8"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ8"
                     /translation="MKNSIFNLCFALFLVLAKVSQALLFDLPAELNPEPFCIRDFVSE
                     GQLVVIEVTSDGSSGDNQEVTLTVRDTNGNEYRRVKDLVGDARVVFTASMSTTFDVCL
                     TNKAKVSGRSLSRSIEVDVESGSEARDWNKVSSSEKLKPIELDLRKIEELADDIVDEF
                     SYMKNREARLRDTNESTNARVVNFSFLIIIALMGLGSLQVYYLRDFFRAKHII"
     gene            complement(<499608..>502574)
                     /gene="TPHA0D02430"
                     /locus_tag="TPHA_0D02430"
                     /db_xref="GeneID:11534259"
     mRNA            complement(<499608..>502574)
                     /gene="TPHA0D02430"
                     /locus_tag="TPHA_0D02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685266.1"
                     /db_xref="GeneID:11534259"
     CDS             complement(499608..502574)
                     /gene="TPHA0D02430"
                     /locus_tag="TPHA_0D02430"
                     /inference="similar to DNA sequence:INSDC:YDR430C"
                     /note="similar to Saccharomyces cerevisiae CYM1 (YDR430C);
                     ancestral locus Anc_5.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685314.1"
                     /db_xref="GeneID:11534259"
                     /db_xref="GOA:G8BSQ9"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="InterPro:IPR013578"
                     /db_xref="UniProtKB/TrEMBL:G8BSQ9"
                     /translation="MLSFRRFGSTYAQSQILRKYPIGGILHGYEIRRVLPVPELKLIA
                     VDLKHEVTGAEHLHVDRDDKNNVFSIGFKTNPPDSTGVPHILEHTTLCGSVKYPVRDP
                     FFKMLNRSLSNFMNAMTAHDYTFFPFATTNQNDFKNLRDVYIDATLRPLLKAEDFFQE
                     GWRLENKDLTDPKSDLQFKGVVYNEMKGQISNANYYFWTKFQESLYPSLNNSGGDPTK
                     ITNLRYEDLVEFHEKNYHPSNSKTFTYGNFPLIDSLKYLNSELKGYGKRSNKTPALLP
                     IDIKENISVPEVGQMDPMLPPEKQLTSSLTWVCGDPHDTYEVFLLGVLGNLLLDGHSS
                     PFYKNLIESGIGTDFSVNTGMETTTAKNFFTVGVQGLENIDRFKNAVKDTFKMIIDTP
                     FDDKKVDAIIQQIELSKKDQKVDFGLQILYSILPGWMNSRDPFANLSIDNILNRFKEE
                     WSSQGDALFKNLLKKYLIDTPSFEFTMKGVPNFTDMLEKEESERLLRKTANLNEQDKK
                     VIFERGLLLQEKQNEKQDLSCLPSLSVDDISRNGDDFALAKDSTMYTRLTDTNGLTYV
                     RGKINLKNVISKDLYPYLSLFADSLTHLGTSTEDYSEIENEIKLFTGGISASIDVVSN
                     PVDMSPELFFKFNGWSLNSKVEHITDLWSKVLLNTDFKKHSNKLKVLIKSTVSSNTSS
                     IAESGHSYAKLYSSAQIRAKNSIEECFGGIEQVNFMNKLNSLIDDDALLQTEVIDKLI
                     EIQKLVITSNKLEFLITTDTNEQIDSVKKLLKSFAGNFPTFGEKSVNGIEGKNFPLLK
                     STSPMSNTLIKFPFQVHYTSKALPGVSYNNKDGASLQVLANMLTYKHLHKEVREKGGA
                     YGGGSTYNALDGVFSYYSYRDPNPLQSLETFDNCPQYILQDSKWTINDINEAKLTIFQ
                     QVDAPMPRKNEGVSLFNSGVTDAMRQKRREALLDVKLSDVYAAAEKYLVNSNTKSTVI
                     GPLIDDKITDPTWEIK"
     gap             502665..502684
                     /estimated_length=20
     gene            complement(<503054..>504976)
                     /gene="TPHA0D02440"
                     /locus_tag="TPHA_0D02440"
                     /db_xref="GeneID:11534615"
     mRNA            complement(<503054..>504976)
                     /gene="TPHA0D02440"
                     /locus_tag="TPHA_0D02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685267.1"
                     /db_xref="GeneID:11534615"
     CDS             complement(503054..504976)
                     /gene="TPHA0D02440"
                     /locus_tag="TPHA_0D02440"
                     /inference="similar to DNA sequence:INSDC:YML013W"
                     /note="similar to Saccharomyces cerevisiae UBX2 (YML013W);
                     ancestral locus Anc_5.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685315.1"
                     /db_xref="GeneID:11534615"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:G8BSR0"
                     /translation="MIIKDDNNEFHLSHDEEDKLNQFQLITSFPEDELSGIVNLLRNH
                     GWNLEAAIGRYFDGTWKETARFESVPESDIFATEPPEVPERIPNSSFIGDSITNDFAV
                     NSGSVENLRDTGPFVDDIIRNRFLASQVVPKLPIVEALHPNFKQKYSVVGLNKALISH
                     ESTFQNNPFNVILMFVPKLLFRIAYNILSLLWGVLTMGFSFKSSDNSQMVCKIPARPS
                     HDEVSINETILNLVESPENKQKLESIITSKNDHQKSFNTLLTECKDDFQFILVIVLGN
                     LKEKEEHEADINSKRFISKVLSNTSVLNLLEDYVVKQKSLSVYIKSAIELEPWLVAKK
                     LAIRHTPEVLLVGNVLNSNGSINGITRPSVLNKVRINSPNKFISSFKVAMDRFGSEII
                     VSKTEKEELRVAREIKELQNRAYETSLEQDRIKEEKKQLENEEKRLEQLEVEQREKEI
                     KLFNTLKSLNWLKACVDILQDAISNNETGFLDTVKCANLQVRLAGGNRLIKKIRGDDS
                     LYSLYVNIGCHLFLEDFSKNISNWVKILPLKIKELSEDDTLLCFKENNGFDIDFEINN
                     LMNLINNELTKFETSLETSNYELDIDFELISPYPRVKIPISTDTKIHDTTELWPNGSL
                     LVEEIINDEYTDDDSE"
     gene            <505488..>507056
                     /gene="TPHA0D02450"
                     /locus_tag="TPHA_0D02450"
                     /db_xref="GeneID:11534420"
     mRNA            <505488..>507056
                     /gene="TPHA0D02450"
                     /locus_tag="TPHA_0D02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685268.1"
                     /db_xref="GeneID:11534420"
     CDS             505488..507056
                     /gene="TPHA0D02450"
                     /locus_tag="TPHA_0D02450"
                     /inference="similar to DNA sequence:INSDC:YDR434W"
                     /note="similar to Saccharomyces cerevisiae GPI17
                     (YDR434W); ancestral locus Anc_5.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685316.1"
                     /db_xref="GeneID:11534420"
                     /db_xref="GOA:G8BSR1"
                     /db_xref="InterPro:IPR019540"
                     /db_xref="UniProtKB/TrEMBL:G8BSR1"
                     /translation="MNNNYKLRLFVLFSYLSVFFLLGVPLWYKLTTIHRADLPITYIK
                     ELVDNKLNDVHLKLPIYVDSQINDIKESAILLKDIQSEINDILGKNNAGLDISVNVLD
                     YVKENLDSKNENANQILKIVKGDNNLKMVENRDFFSSTATTVEVNDLSTDYQKSIREL
                     SNIILNNILGVNAKNINTVIASTKDINDGEKTGVSIPYIQDIHLSAILLSGDGDALGW
                     DIESSMSKYITPLREMLSSVYHFTVDSDIVYYNDLNLHSQHAVNESTLAHILDISEIS
                     TSDEYSEQIGLTLAIVFPSREVGNNGLEFIKPKSIEKLDGSEKVSNDINWEKYLIPRW
                     GSLIINKYPLKANSYLDEEFLHPIMHKFSIDLLEILGIGSDMMSPYNSLHMFKRSVVL
                     RNLLKSVDTLQSLVRLTESFKQMAVPEQVLADVNTAIGIRYEIINKINHFGTSNGINN
                     NIVWDELVLLSNKLVTVCENAFFDNEMVQQNFFPDEHKTAVYFPFLGPIAMVLFLGIV
                     NMIKDRSHIVDSIK"
     gene            <507413..>508633
                     /gene="TPHA0D02460"
                     /locus_tag="TPHA_0D02460"
                     /db_xref="GeneID:11534250"
     mRNA            <507413..>508633
                     /gene="TPHA0D02460"
                     /locus_tag="TPHA_0D02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685269.1"
                     /db_xref="GeneID:11534250"
     CDS             507413..508633
                     /gene="TPHA0D02460"
                     /locus_tag="TPHA_0D02460"
                     /inference="similar to DNA sequence:INSDC:YML015C"
                     /note="similar to Saccharomyces cerevisiae TAF11
                     (YML015C); ancestral locus Anc_5.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685317.1"
                     /db_xref="GeneID:11534250"
                     /db_xref="GOA:G8BSR2"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BSR2"
                     /translation="MSNYKSETKGPINLIPKTNYISTLTVANYLLTKQTIDQALNEDH
                     EYVLNKNIEMRTGGTLNSFFATGNYKLNYKNNDEENSEPEKKRRKIIYNNGKAQEPDE
                     LINEVPGNIKFAKDIRDEKAKELVFSHVLDQNEQFRLLVNNLDEDQTNRFEVFHRTSL
                     NKAQVKKLANTVLNQNISENIRVFLQSIGKVFAGEIIELAMQVRMKWLVGQLTINYNK
                     RKRIGKQLKKFLKKLTMLVQKSNSTNSSTSLTAAEENNEDIEILNSNSEFNDSIDECE
                     SDSFYDDDEEEEPFVKAGNELLKYNKQVTQDIKTELVKHYNILAKRFNSLNMNIDKFL
                     GSVEDSSSVTSESIGEGSTKNQPQNTKSKVINTSPLLSEHIREAWRLYQLQSDSLPSA
                     TWRQQGEGNGWMFR"
     gene            <509332..>511470
                     /gene="TPHA0D02470"
                     /locus_tag="TPHA_0D02470"
                     /db_xref="GeneID:11531082"
     mRNA            <509332..>511470
                     /gene="TPHA0D02470"
                     /locus_tag="TPHA_0D02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685270.1"
                     /db_xref="GeneID:11531082"
     CDS             509332..511470
                     /gene="TPHA0D02470"
                     /locus_tag="TPHA_0D02470"
                     /inference="similar to DNA sequence:INSDC:YDR436W,YML016C"
                     /note="similar to Saccharomyces cerevisiae PPZ2 (YDR436W)
                     and PPZ1 (YML016C); ancestral locus Anc_5.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685318.1"
                     /db_xref="GeneID:11531082"
                     /db_xref="GOA:G8BSR3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BSR3"
                     /translation="MGNSGSKPRKKGSGKANNAPPTTQTKPTKLQSKQKSSSESDSNK
                     DTSTRNKATDDSVMKENLSRTETMQSTKSNRSLRSLRSKKSQTSISGNSNVDIQEKYR
                     DDDHLPPRTKEIQRVHSSGSQMYSHSRSHSLSRVPTDVQSNKSNNNLLPGINSGRADS
                     RKSSFNGSYDIPPSMIQVKPKSPILRNRNYTSSSVSSFQENAITDDENDDSNNNIAYS
                     NSRKRVDILRHSHSSGTSRGSPFASRSRRKSDNSVSENDLSPGADHLPMHSMSRTGSH
                     NSMHSRRSSTNSVGTNTFVTPMNSPGIKITDTDQERNDYFSHSNDSNNYRYNNETGLD
                     IQNNQYIGDHSSELAGEAMYFPNADNSYDALHSTSHDRNINDDSTISKKKKSTKMLDI
                     DETIQKLLDAGYASKRTKNVCLKNSEIAQICQRSREIFLSQPPLLELSPPVKIVGDVH
                     GQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGN
                     HECANVTRVYGFYDECKRRCNIKTWKVFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNS
                     MDEIRHVSRPTDIPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFD
                     FDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVNEGLLCSFELLDP
                     LDSVALKQVMKKGRHERKFANQQQQQYIQN"
     gene            <511816..>512235
                     /gene="TPHA0D02480"
                     /locus_tag="TPHA_0D02480"
                     /db_xref="GeneID:11530981"
     mRNA            <511816..>512235
                     /gene="TPHA0D02480"
                     /locus_tag="TPHA_0D02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685271.1"
                     /db_xref="GeneID:11530981"
     CDS             511816..512235
                     /gene="TPHA0D02480"
                     /locus_tag="TPHA_0D02480"
                     /inference="similar to DNA sequence:INSDC:YDR437W"
                     /note="similar to Saccharomyces cerevisiae GPI19
                     (YDR437W); ancestral locus Anc_5.549"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685319.1"
                     /db_xref="GeneID:11530981"
                     /db_xref="InterPro:IPR013717"
                     /db_xref="UniProtKB/TrEMBL:G8BSR4"
                     /translation="MIQGSFSNEYYWFSRHFITCSATIFIIIWTFIPEDIDILFIKKD
                     FIRSILDILPDRRWVIYFQCFVLMGMLWCYTALMMYNEDVLTPNLDDLSTITDSRANV
                     VIVSDKEKFLNEYAYNATSGVFDLPITDVCKILYSDD"
     gene            complement(<512293..>514038)
                     /gene="TPHA0D02490"
                     /locus_tag="TPHA_0D02490"
                     /db_xref="GeneID:11534290"
     mRNA            complement(<512293..>514038)
                     /gene="TPHA0D02490"
                     /locus_tag="TPHA_0D02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685272.1"
                     /db_xref="GeneID:11534290"
     CDS             complement(512293..514038)
                     /gene="TPHA0D02490"
                     /locus_tag="TPHA_0D02490"
                     /inference="similar to DNA sequence:INSDC:YML017W"
                     /note="similar to Saccharomyces cerevisiae PSP2 (YML017W);
                     ancestral locus Anc_5.550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685320.1"
                     /db_xref="GeneID:11534290"
                     /db_xref="UniProtKB/TrEMBL:G8BSR5"
                     /translation="MTTNNSTMKKMSLEEFLGNDTLSDTLWDEDDINLDAISSTTNID
                     LLKKSSGNSHHVNKSASGPPYIVKFSNLSSDFSDFEMKDLFNSKFTNFIKFKMFWVLN
                     PNPTMADIQNPNKFYEYFKLSSKVCFVELYSVRDMDKILKGWYDPLKEIYNIIVSPAD
                     FVDFKNYMDRTESVKSFKIPSPEAPLPKNMIQNSHDNQPKERRKSNPFGAAKPVDTQS
                     KILKLEEQIATLHVEDTTTLRRFSNTMNNLNSKHATKVKILKNENNDITTSDNIRSLA
                     TATITTKESLLPTNTHVNTTIPVTKTLNYSHIVKKETQQAEKAKVNANDNTKFNESES
                     ALEDEEDNGEGMHGSDEVKANDRDNKNTNKNKDRLVTENVEELKDLSKEENDVEEHKS
                     DVKDQSENYNYKREGNYKSNRGNYTGRGGNRGNIRGGSRGRGNNNYGNRSNNSNGNYT
                     GKPNNSQPEERYSLFRPAAGFLHSSNSGNDEESFNRTSKYNNNNTNSTSSNSSNRNGS
                     YGYSNTSRGRGNYTNNRRFTNQRGSSRGNGHRGGSGSCRGGNGPHRGRFHDTGRNHEG
                     NENSESTESHTNVAE"
     gene            <515403..>516755
                     /gene="TPHA0D02500"
                     /locus_tag="TPHA_0D02500"
                     /db_xref="GeneID:11530947"
     mRNA            <515403..>516755
                     /gene="TPHA0D02500"
                     /locus_tag="TPHA_0D02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685273.1"
                     /db_xref="GeneID:11530947"
     CDS             515403..516755
                     /gene="TPHA0D02500"
                     /locus_tag="TPHA_0D02500"
                     /inference="similar to DNA sequence:INSDC:YDR438W,YML018C"
                     /note="similar to Saccharomyces cerevisiae THI74 (YDR438W)
                     and YML018C; ancestral locus Anc_5.551"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685321.1"
                     /db_xref="GeneID:11530947"
                     /db_xref="GOA:G8BSR6"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G8BSR6"
                     /translation="MSTKTLNNKRWSMGLIMLSAVVVLWVLSSFLINIIFRDNSYRKP
                     FLITYINTVSFIFYLLPLIKTILVNFYYNGVRNEIPNILNELIIAQEGPDSTTVNPLH
                     PEPSGASNVSSVANDIAEGSSQTLPNEATSLLSSSSKDDTDSKQTLTPKNRMTLKETI
                     LLSLEFCSLWFLANLMTNSSLAYTSVASQTILSSTSSFFTLFIGYIWNIEKITKSKTL
                     GSLVSFIGIILVTHSDYYHYDDNYPPRTNPHSSLITFAKEIINILTTSDNDEEYGNSP
                     FRMFIGNLLALAGALLYSVYSILLKKKVQDESRLNMHVFFGFVGFFTLVLFWPVIVLL
                     QYYGWETIELPPTNTIAIIVLINCLITFVSDYCWANAMLLTTPLTVTVGLSLTIPLAM
                     FGDLLFVNKKMNWVYIFGAILIMGSFFVINNESGIEQNELSEQQEQQNSQSQNVENQV
                     "
     gene            complement(<516961..>517938)
                     /gene="TPHA0D02510"
                     /locus_tag="TPHA_0D02510"
                     /db_xref="GeneID:11530939"
     mRNA            complement(<516961..>517938)
                     /gene="TPHA0D02510"
                     /locus_tag="TPHA_0D02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685274.1"
                     /db_xref="GeneID:11530939"
     CDS             complement(516961..517938)
                     /gene="TPHA0D02510"
                     /locus_tag="TPHA_0D02510"
                     /inference="similar to DNA sequence:INSDC:YML019W"
                     /note="similar to Saccharomyces cerevisiae OST6 (YML019W);
                     ancestral locus Anc_5.552"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685322.1"
                     /db_xref="GeneID:11530939"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:G8BSR7"
                     /translation="MLCRYLSILLITLLRVVVGDDELNHVLSFQNEKGLIEVNDYNYE
                     SLSTIGIEGYYSILFITMRGVTSNGRKCEMCLDFEDTLENVYDAVKSQHPNLNVLFYV
                     ADTNENSKLVRDLKLQSVPHLLVYPPTTHESSKNFSWLVNQFYQYELKNIHAKDVMRF
                     ADFLGKTMNILVLIQEPFDTNAFSLYFIICMAFFIIIKRVILPRVTNKAKFFCFFLIF
                     GIMLPSLTGYKFTQIKGIPFIARGEDGKIMFFSGGTSWQFGIEIFTMSMLYLLLSLEI
                     YALITLPTLEISPKNKILYTSVLACILFYSTQYYMQIYAIKSPGYPFMF"
     gene            <518308..>519174
                     /gene="TPHA0D02520"
                     /locus_tag="TPHA_0D02520"
                     /db_xref="GeneID:11531001"
     mRNA            <518308..>519174
                     /gene="TPHA0D02520"
                     /locus_tag="TPHA_0D02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685275.1"
                     /db_xref="GeneID:11531001"
     CDS             518308..519174
                     /gene="TPHA0D02520"
                     /locus_tag="TPHA_0D02520"
                     /inference="similar to DNA sequence:INSDC:YDR439W"
                     /note="similar to Saccharomyces cerevisiae LRS4 (YDR439W);
                     ancestral locus Anc_5.553"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685323.1"
                     /db_xref="GeneID:11531001"
                     /db_xref="InterPro:IPR018479"
                     /db_xref="UniProtKB/TrEMBL:G8BSR8"
                     /translation="MTSLLQLLYNYQMSVIESERFYYTHLLEEKELNTKNEALIKNND
                     NTAVLVDDITGKQQEHSLSKELISLQRQLTKVSIELQTMKLSNEQLKEAQKVTKNTMN
                     QKLNNSLKTIERLKSELSVNNSSHGDEDASSVTPPKIFNTFKNNEIKQKNNIHLLSPV
                     TRKESGHLESNNKIEKLSGIRNIVNSKKHTLFDMDTESEADNSLNSIENVLKINTLKR
                     NEVLANMVLPKDALPESSDINSSQNILSVDIPLIKGNTVEEKQVKNHHETKKRTLTKT
                     RIQKLDSDDSLL"
     gene            complement(<519393..>521465)
                     /gene="TPHA0D02530"
                     /locus_tag="TPHA_0D02530"
                     /db_xref="GeneID:11530997"
     mRNA            complement(<519393..>521465)
                     /gene="TPHA0D02530"
                     /locus_tag="TPHA_0D02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685276.1"
                     /db_xref="GeneID:11530997"
     CDS             complement(519393..521465)
                     /gene="TPHA0D02530"
                     /locus_tag="TPHA_0D02530"
                     /inference="similar to DNA sequence:INSDC:YML020W"
                     /note="similar to Saccharomyces cerevisiae YML020W;
                     ancestral locus Anc_5.554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685324.1"
                     /db_xref="GeneID:11530997"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BSR9"
                     /translation="MIQIDDIPIVKINEQTRFTKNNDKVFNSTILKELSSTSLSKNFI
                     SQRGSANDTMPATNIKSLTDAAVNTVETNSNDVSNSTSNSTSTSNLIGNLDNVSNSKS
                     NSIINGNPELLSVSKNAHSRNWSLWSNNSSDDINKQYNLPLPTKSNDNTDSQSATKVE
                     IGSQPNDDNQNRSRGWSLLSMYKGTQFHNDNDTIIESQESPSNSNPLPIINLTKPLTN
                     SIIHESEYDLTKTQSKIDCTLTSDKEFQKLDATIEHPNIVVPQFNVLPESTVWSSISY
                     SLSSLASNLNIISHEKKEMSLQIQSPKQNFYQLSDSASRPINILIVGVHGFFPTKMLR
                     PFIGEPTGTSLKFVNEAEVIVRRYFEKHNTTFEINKIALEKEGKIFERVDYFFEVMKR
                     YQTELNSADFIYFVAHSQGSPVTMILLGKLLEAGILKTTSVSFETNSYTSSTRGKKII
                     SVLAMAGINNGPFFGADRTLFVRAYSTIESDSLRELFEFQNPESTPSKSYIKYFRILI
                     ANNVKVTFVGSINDQLVPLYSSICLFARHPNVFRATFIDKGSRTPSFITRVVDMTETL
                     LNLGYDDHGIIKEISEALAGTLTGGGHSTIYNEAQVYELGLKFSLETTDLKKPVPVTY
                     MPYAIAQLKTNPYNLPWCMRGLLSETNKTIHKEDIETLIKEFELWKPVNKNLKEMKYR
                     LNGLISKF"
     gene            <522013..>523017
                     /gene="TPHA0D02540"
                     /locus_tag="TPHA_0D02540"
                     /db_xref="GeneID:11534404"
     mRNA            <522013..>523017
                     /gene="TPHA0D02540"
                     /locus_tag="TPHA_0D02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685277.1"
                     /db_xref="GeneID:11534404"
     CDS             522013..523017
                     /gene="TPHA0D02540"
                     /locus_tag="TPHA_0D02540"
                     /inference="similar to DNA sequence:INSDC:YML021C"
                     /note="similar to Saccharomyces cerevisiae UNG1 (YML021C);
                     ancestral locus Anc_5.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685325.1"
                     /db_xref="GeneID:11534404"
                     /db_xref="GOA:G8BSS0"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="UniProtKB/TrEMBL:G8BSS0"
                     /translation="MTVPEKKRGQSTIESFFKNTPVKRAKVTVSKEETIAISKIRNES
                     AVTVGVGSKIVNKGMDKKSFKGSCSSMLLNLLQLEIDTIEDSWFERLSHEFKKPYFIQ
                     LKKFIDGEQSKSTVFPPADDIYSWSRLTPFRQVKVVIIGQDPYHNYNQAHGLAFSVKS
                     PTPAPPSLKNIYKELKNEYPDYEIDNNVGDLTPWAKQGVLLLNTALTVKAHNANSHSK
                     AGWSDFTKEVVQTLINDRIESKEPIAFLLWGNNAIRLVETILTESRKINKSNLPDNFK
                     LLKSVHPSPLSASRGFFGTQHFKQINDWLYTEQKTDMIDWSVVPGSKLAGIKKYCNMH
                     "
     gene            <523687..>525456
                     /gene="TPHA0D02550"
                     /locus_tag="TPHA_0D02550"
                     /db_xref="GeneID:11531112"
     mRNA            <523687..>525456
                     /gene="TPHA0D02550"
                     /locus_tag="TPHA_0D02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685278.1"
                     /db_xref="GeneID:11531112"
     CDS             523687..525456
                     /gene="TPHA0D02550"
                     /locus_tag="TPHA_0D02550"
                     /inference="similar to DNA sequence:INSDC:YDR440W"
                     /note="similar to Saccharomyces cerevisiae DOT1 (YDR440W);
                     ancestral locus Anc_5.556"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685326.1"
                     /db_xref="GeneID:11531112"
                     /db_xref="GOA:G8BSS1"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR021162"
                     /db_xref="InterPro:IPR025789"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BSS1"
                     /translation="MNELTSDIDTDSIFSSVSKDMTPEEVVVDKTEERINKKGIKKLS
                     SVQSLLNDAYKYSSHTEYTLPESFLRTRNKPKIIEDVEYEAPRPKKKIQIKTQRKKLK
                     VEKPVKPKKIKKVKAKLEGKTIKSNGEVQISYRGRKKGSKNKKTITKLEKDNKLNENT
                     LQNERIKETQINQQETNQKEPTDFIDLSLEPFPLKYDFFDIDYLKSNTELNELPNPST
                     SLTNKYYSPTASQMNSEGSQVYKIVKLRYPLFTNYSEEFHVDFLNKHFDTIYNPMVEL
                     GKLIEYFAKVYIPDAYYNEISREIIKPMNHAFDIKDVEKFTDAINKYNTFILTIPRDE
                     IIKKLECTKELPKYFIQDLLHVVYTRSIHPKAKTLKKYAAFSSYVYGELLPSFLSEIY
                     SNCSLSSDKIFMDLGSGVGNCVVQAALEYGCKLSFGCEIMENASDLTEAQYSELTKRC
                     KLFGIKLSPIKYSLRKSFIDNDEVSKLIKECDVLLINNFLFDAKINNAVTKILQSCKP
                     GCKLISLKSLRPVSYTIDFNDTENILNRMKITKHNLKENSVSWTHSGGEYYISEVMTE
                     LDESLFTLNAGHRKTHKVIKYTR"
     gene            complement(<525673..>526236)
                     /gene="TPHA0D02560"
                     /locus_tag="TPHA_0D02560"
                     /db_xref="GeneID:11530971"
     mRNA            complement(<525673..>526236)
                     /gene="TPHA0D02560"
                     /locus_tag="TPHA_0D02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685279.1"
                     /db_xref="GeneID:11530971"
     CDS             complement(525673..526236)
                     /gene="TPHA0D02560"
                     /locus_tag="TPHA_0D02560"
                     /inference="similar to DNA sequence:INSDC:YDR441C,YML022W"
                     /note="similar to Saccharomyces cerevisiae APT2 (YDR441C)
                     and APT1 (YML022W); ancestral locus Anc_5.557"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685327.1"
                     /db_xref="GeneID:11530971"
                     /db_xref="GOA:G8BSS2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8BSS2"
                     /translation="MPLQAYANDLKATLRQYPNFPSEGILFEDFLPIFRDPVTFQKLV
                     DAFKLHLQEAFPNTKVNYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECVQAT
                     YQKEYGSDVFEMQKDAIPQGSNVIIVDDIIATGGSAKAAGELIEKIGSKVLEYNFVME
                     LDFLKGRDQLNAPVFTLLSGQEDKLQN"
     gene            complement(<526819..>531282)
                     /gene="TPHA0D02570"
                     /locus_tag="TPHA_0D02570"
                     /db_xref="GeneID:11534398"
     mRNA            complement(<526819..>531282)
                     /gene="TPHA0D02570"
                     /locus_tag="TPHA_0D02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685280.1"
                     /db_xref="GeneID:11534398"
     CDS             complement(526819..531282)
                     /gene="TPHA0D02570"
                     /locus_tag="TPHA_0D02570"
                     /inference="similar to DNA sequence:INSDC:YDR443C"
                     /note="similar to Saccharomyces cerevisiae SSN2 (YDR443C);
                     ancestral locus Anc_5.559"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685328.1"
                     /db_xref="GeneID:11534398"
                     /db_xref="GOA:G8BSS3"
                     /db_xref="InterPro:IPR009401"
                     /db_xref="UniProtKB/TrEMBL:G8BSS3"
                     /translation="MSTEEVSYRLEDVLTNFYKIEKIEKINYAQYTCKNRDDQWALKT
                     EMILRKNDPKCLIASLSRELWCFSMNDDPLPIIHSTASDTLNNTKQKNNSGNSNDTDN
                     LTLDLTNTKVPSTTDDTIVHPDKSDVFDANYSKPNLPPSYAIFLKALRRMIYLNLTSK
                     SNRNLLPIGNGCIISYFDYNKENKYMPKSLINIDDENLRSKTYLHNKSDRTVKTYILQ
                     IEPHLFENGDLTLSLSLKHSDLLPLNIGSIPPANDQNGFIHKSFVKENAIYILPSGTR
                     AYLPSLQLKDCLTTQPENSEVLLKTLAISHGVDLLERKKEIEWIKIIPNLTNFNGQLP
                     TIASFNKPSDDTRTISWPLDLIYIQPASNNKSASPLHETYSNSQSAKLEGNKTKSQQC
                     NNTSSGSNNNSSNIFPSDLDDAFNIIDNYIQLRQSSAYRTPGIFGALSTNNPSSSGGA
                     YTDQFQIFNRSTASNSNSVSIATANAHSTSEMNPRSAQPFSTTNSYSNIDMKFTPTLD
                     QTLVNKTAPVTSQPGKIIRSLSENPIAAKSTSSIDMLTNEGTDNKIRDVIEQPPFSSK
                     ESSNFESVSIDSVEDKELFGEDYEDFENEENNNSFNETRTVSDKPNKTRNASDEITED
                     MFEMSDDEEGENTNSRNRMFTNSLESDNKRFFKENIEKIQRDPTKRSTLKRQYLDIPL
                     EEITLSNSPLYMDPGAPLPVETPRERRKSVFAPLNFNPIIESNVDNKYKSGGKFSFEP
                     SQSEEALNFDISKNSISESGDDSDGSDDLEDLEYKGEDKNEFNTIDLNFPITNGTMHD
                     LQGQLSSGLVKNDQISSTFPNTNEDTKYAINSIWRSPPSDGLNVNSPVRMNEPQASYI
                     YPESKMAIDIFPKFSLQQNRTKDRKPLDKNSNDEVFPESLKNTSPSRVINESKNSNYE
                     FATSSIASLPFLFRHMPISSIPEEYTTSNPIVKLNSPKQDILNLIAEQIIFDWDKLDN
                     LHYPDKSYIGVTSCSDGLIKSTVSDLFTSFERVNGNILIEKMYKTQSPSIYLKRRNEI
                     IKIRADCQPFSKYLNLKPVNAIKNFKLLLLTTSNKLDCPAFVSSLCQTYISHEFGFCE
                     RLKLNNEDTEGMVYLDDYQDSRLLLLATQLVAYCLTTQNSSRAIPILLIFPLKSNSLS
                     DLVLMTSKFQIIYDEVKAKIPNAELYFKTVLMDFIKDPLTLIDDYHDLSVSIYNNLPK
                     KSVKFTSIVPKHPDKIKFRTSQSNNIPSAIHYDTYIHLAYSRSIDKEWIFAAFSDSFG
                     KDTSTRVWYVGRSKTKFDQACTEIWANALKLASTKYGKICLILTRLNSILPDDELMNW
                     RRLSGRNIHLAVVCVNDTSKISFVDEDQLYPTFKPSFKDDSFSTPINPHKLGDYELRD
                     ISQELYSIIFEYPFPLSNSQHRCAIKSGALVKFNQRRGSLLPKFEINLLNCPHSDSTQ
                     LLQTILSDFTNLAALNPWFGISKGEYSHIPWHVLAVKKMMKMMVHINVETE"
     gene            <532920..>535127
                     /gene="TPHA0D02580"
                     /locus_tag="TPHA_0D02580"
                     /db_xref="GeneID:11531030"
     mRNA            <532920..>535127
                     /gene="TPHA0D02580"
                     /locus_tag="TPHA_0D02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685281.1"
                     /db_xref="GeneID:11531030"
     CDS             532920..535127
                     /gene="TPHA0D02580"
                     /locus_tag="TPHA_0D02580"
                     /inference="similar to DNA sequence:INSDC:YDR444W"
                     /note="similar to Saccharomyces cerevisiae YDR444W;
                     ancestral locus Anc_5.560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685329.1"
                     /db_xref="GeneID:11531030"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BSS4"
                     /translation="MSNIEVENEQSSSVVAVKSSLVLDSSKSTNASISKKDVITEKIM
                     IYNVSNVFSIGDVMRFRIDINKKKLFSYFGINDEHTYLEVIVKNKENPMLRPLYIAGP
                     YAVYTDIRPHNYNENIKFNTYTGQNNVVEDIQYTGDLKPDETFKGILLMNPNSKVDED
                     ENYGWTVDILSQIAVTTLLKLDISMKIRIITEKLRRETTMSFNTNANLERNQNNSTSS
                     ISKMYYKMKDRVNSSLKTDNIIDPHKENETGFRVISWDTDELWNLMPKYEKKPVHLVL
                     LTHGIFSNIGCDMLYIKDKIEEMTYNMDEEFNPNVVIRGCMENMGKSSHGVYKLGVTI
                     GEYIVKEVKKLNDLGYNINKISFIGHSLGGLTQSMAIHYISVIYPDFFDPVKGIKPVN
                     FITMASPMIGMPADFPKYVTLALDFGALGITGRDLTLKNTPWTSKTGIGLTYSTTTNS
                     SKKKLKSILEILPQPPARSIFERFINRTLYANIVHDGIVPLKTAALLYLDWQGLNRVK
                     LLKDSLDNTTHHDIAKISQDTTQDDKNNNAENNISETKSNMAEIPDQAHDKKAALQWL
                     APLGLTNSSKYRSYERTQTIVKGEKKDGLIELEFKPPPTASPALAALSVLTSAEPSQE
                     YIRDPSKRTDAIIHDKIYSPDELPPRHYQGRSIIKKIIHPNERINRAQERIARSWQET
                     MIWRKVLVNLKPDSHNNIVVRRRFLNLFGNVAVMHMVNEHFGVEACKTYAKIE"
     gene            <535378..>536325
                     /gene="TPHA0D02590"
                     /locus_tag="TPHA_0D02590"
                     /db_xref="GeneID:11531098"
     mRNA            <535378..>536325
                     /gene="TPHA0D02590"
                     /locus_tag="TPHA_0D02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685282.1"
                     /db_xref="GeneID:11531098"
     CDS             535378..536325
                     /gene="TPHA0D02590"
                     /locus_tag="TPHA_0D02590"
                     /inference="similar to DNA sequence:INSDC:YDR446W"
                     /note="similar to Saccharomyces cerevisiae ECM11
                     (YDR446W); ancestral locus Anc_5.561"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685330.1"
                     /db_xref="GeneID:11531098"
                     /db_xref="InterPro:IPR029178"
                     /db_xref="UniProtKB/TrEMBL:G8BSS5"
                     /translation="MALIKRESDTYLNNIVVKQEKSSGNHYNNEEQQKKFDVTSAKES
                     RPALDEVSTNKKSIKARDTNSDQKQKYLNYLLKTDTYTRTPANQKIVSAHPPPSRHQE
                     NRSFNEGQNLDTSKEISKNKRCNSMSNDGKTKEDFETISKQRKKNSVNSIKDINDFSS
                     QCLQKEGLYESKNLQDKNDTTQIINKNPKEIKCVSPGPYKPSTSFLYEIANSEQLEYT
                     ELKDIFQNINETEDKDYVFDVSNMTLDTWVEEGQKNISEYRELISQLVKKRIEFSIRF
                     QLITDIINQRANALNEKGLLLDDKLKKIKEIGDEILNII"
     gene            complement(<536577..>537619)
                     /gene="TPHA0D02600"
                     /locus_tag="TPHA_0D02600"
                     /db_xref="GeneID:11534572"
     mRNA            complement(join(<536577..536984,537617..>537619))
                     /gene="TPHA0D02600"
                     /locus_tag="TPHA_0D02600"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_003685283.1"
                     /db_xref="GeneID:11534572"
     CDS             complement(join(536577..536984,537617..537619))
                     /gene="TPHA0D02600"
                     /locus_tag="TPHA_0D02600"
                     /inference="similar to DNA sequence:INSDC:YDR447C,YML024W"
                     /note="similar to Saccharomyces cerevisiae RPS17B
                     (YDR447C) and RPS17A (YML024W); ancestral locus Anc_5.562"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_003685331.1"
                     /db_xref="GeneID:11534572"
                     /db_xref="GOA:G8BSS6"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="InterPro:IPR018273"
                     /db_xref="UniProtKB/TrEMBL:G8BSS6"
                     /translation="MGRVRTKTVKRASKALIEKYYPKLTLDFQINKRLCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSHSKGVLNV
                     DNQTADLVKSLGLKLPLSVVSVSANNTRRFRRRA"
     gene            <538583..>539401
                     /gene="TPHA0D02610"
                     /locus_tag="TPHA_0D02610"
                     /db_xref="GeneID:11531036"
     mRNA            <538583..>539401
                     /gene="TPHA0D02610"
                     /locus_tag="TPHA_0D02610"
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /transcript_id="XM_003685284.1"
                     /db_xref="GeneID:11531036"
     CDS             538583..539401
                     /gene="TPHA0D02610"
                     /locus_tag="TPHA_0D02610"
                     /inference="similar to DNA sequence:INSDC:YML025C"
                     /note="similar to Saccharomyces cerevisiae YML6 (YML025C);
                     ancestral locus Anc_5.565"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /protein_id="XP_003685332.1"
                     /db_xref="GeneID:11531036"
                     /db_xref="GOA:G8BSS7"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/TrEMBL:G8BSS7"
                     /translation="MIRANFRKFAVQSRRQTTQAASNAISENTLFPNAALPAKYVLTT
                     IRSFPSLEPISFAPIPSSVLNAPLRRDILWSAVVYENDNKRVGSSNPPGRSENGYSRR
                     KLAPQKGTGRARVGDANSPTRHNGARALARSAPNDYTTKLTNKLYNQAILNALSHQYR
                     SNNLFVIGGGNTLASTNDLDLNELEVTQSNLDTDDSEIIFERFLEEYKLRGKKLLFIT
                     DSPRPNLMAVTDKYKNQIDLVQKEFIDVNDLLRAKKIFIDLKALEFLSVTHSPN"
     gene            <540278..>541217
                     /gene="TPHA0D02620"
                     /locus_tag="TPHA_0D02620"
                     /db_xref="GeneID:11534597"
     mRNA            join(<540278..540324,540824..>541217)
                     /gene="TPHA0D02620"
                     /locus_tag="TPHA_0D02620"
                     /product="40S ribosomal protein S18"
                     /transcript_id="XM_003685285.1"
                     /db_xref="GeneID:11534597"
     CDS             join(540278..540324,540824..541217)
                     /gene="TPHA0D02620"
                     /locus_tag="TPHA_0D02620"
                     /inference="similar to DNA sequence:INSDC:YDR450W,YML026C"
                     /note="similar to Saccharomyces cerevisiae RPS18A
                     (YDR450W) and RPS18B (YML026C); ancestral locus Anc_5.566"
                     /codon_start=1
                     /product="40S ribosomal protein S18"
                     /protein_id="XP_003685333.1"
                     /db_xref="GeneID:11534597"
                     /db_xref="GOA:G8BSS8"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:G8BSS8"
                     /translation="MSLVVSEQGSFQHILRLLNTNVDGNIKIVYALTYIKGVGRRYAN
                     LVCKKADVSLNKRAGELTQEELERVVQIMQNPTNFKIPAWFLNRQKDVNDGKDYHNLA
                     NNVESKLRDDLERLKKIRSHRGIRHFWGLRVRGQHTKTTGRRRS"
     gene            complement(<541517..>542800)
                     /gene="TPHA0D02630"
                     /locus_tag="TPHA_0D02630"
                     /db_xref="GeneID:11534241"
     mRNA            complement(<541517..>542800)
                     /gene="TPHA0D02630"
                     /locus_tag="TPHA_0D02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685286.1"
                     /db_xref="GeneID:11534241"
     CDS             complement(541517..542800)
                     /gene="TPHA0D02630"
                     /locus_tag="TPHA_0D02630"
                     /inference="similar to DNA sequence:INSDC:YDR451C,YML027W"
                     /note="similar to Saccharomyces cerevisiae YHP1 (YDR451C)
                     and YOX1 (YML027W); ancestral locus Anc_5.567"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685334.1"
                     /db_xref="GeneID:11534241"
                     /db_xref="GOA:G8BSS9"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8BSS9"
                     /translation="MMQGGQQYLPSVSKLMLNNNIHTETSGQHFNALEIPSLATPSSS
                     FNNDRHGVIRLPPLSSTISRPKSVDSALRYTAADTGTEKSQLSSSKSLLDFDINGLRS
                     NKTSPYPLNSIDLKTPSKLAFKYDPYLNTPKTPNVTKRKESILDFKNSQKQHIKSKPA
                     SSTNLKFSKNPNTNTQSRDQYIISPIHAVKAIITPTSSDKKRAFAFITHSQETFPTKE
                     PKIDNAPLARRKRRKTSTQELNILQNEFAKCTTPDRLKRIELGERCKMSEKAVQIWFQ
                     NKRQAVKRHKLANEKLHNVNEPKDNDNSSSFSIMQDTQSKNIDDSSVINNSIPSINIP
                     FDGYHSTPKKSDIDSHNSSSDISQINEGIQVASPTPMKGSSAPNFRRGQALTFHLNRE
                     NASALLSNTPSKQAKTNKEINRSPLKSLSVNIAQK"
     gene            complement(<544462..>545052)
                     /gene="TPHA0D02640"
                     /locus_tag="TPHA_0D02640"
                     /db_xref="GeneID:11534255"
     mRNA            complement(<544462..>545052)
                     /gene="TPHA0D02640"
                     /locus_tag="TPHA_0D02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685287.1"
                     /db_xref="GeneID:11534255"
     CDS             complement(544462..545052)
                     /gene="TPHA0D02640"
                     /locus_tag="TPHA_0D02640"
                     /inference="similar to DNA sequence:INSDC:YDR453C,YML028W"
                     /note="similar to Saccharomyces cerevisiae TSA2 (YDR453C)
                     and TSA1 (YML028W); ancestral locus Anc_5.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685335.1"
                     /db_xref="GeneID:11534255"
                     /db_xref="GOA:G8BST0"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:G8BST0"
                     /translation="MVAQVQKEAPAFKKTAVVDGVFDEVSLEQYRGKYVVLGFIPLAF
                     TFVCPTEIVAFSDAVKRFRDLGAEVLFASTDSEYSLLAWTNIARKDGGLGPVDIPLLA
                     DTNHSLSRDYGVLIEEEGIALRGLFVIDPKGIIRHITINDLPVGRNVEEALRIVEGFQ
                     WTDKHGTVLPCNWTPGSATIKPTVDESKEYFNEANK"
     gene            complement(<546838..>549123)
                     /gene="TPHA0D02650"
                     /locus_tag="TPHA_0D02650"
                     /db_xref="GeneID:11534251"
     mRNA            complement(<546838..>549123)
                     /gene="TPHA0D02650"
                     /locus_tag="TPHA_0D02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685288.1"
                     /db_xref="GeneID:11534251"
     CDS             complement(546838..549123)
                     /gene="TPHA0D02650"
                     /locus_tag="TPHA_0D02650"
                     /inference="similar to DNA sequence:INSDC:YML029W"
                     /note="similar to Saccharomyces cerevisiae USA1 (YML029W);
                     ancestral locus Anc_5.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685336.1"
                     /db_xref="GeneID:11534251"
                     /db_xref="UniProtKB/TrEMBL:G8BST1"
                     /translation="MEANVCSPIQIFVTSSDKDLVPTSFVVTSHPASSALRLLQYIHF
                     KIYEQLQASTTEFLVIDSNSDNVENDISRLGHVSEYRLVYKQQTLRLSTSLKDLSRNH
                     IQTFLKIQIEKSDKKIKYLQNLNYNLYSEFNNLRIKLVVNLDSKASSFLEIIEDDIPL
                     KTTLNILKSRIIADIRKYETVQKGKTDCGIKSKHIESDLTELRINGKKNTIYLNESQQ
                     KDLYNDLTLGELLEFDYSPSKNAYFVMEYKMIHGKNRYNKNEYYTIHFNTDVQLLAYT
                     MQITDDTTVDDIKDYICEAYSNALRLYHRDISLYYKGHRCNSTNAMGEFLKVTEYIEN
                     PNGAHIDVVIEQEFIEPGPGFWAELFNSPYRFNFMHSGSYWDPHGEENVPNSSDNESR
                     HNISDSQSVEEAELNKNIKFITELGSEIVRKDEYYIKCTTSNNEEVYVKEENLTLETY
                     SLEVEDGKLLNINNNNVNVFQNEIYLESKTVNMFSKINDKSMDVELEVPKLSDITSLQ
                     SSGTDYFSSDAGESYLRSQDRRSRRRATSQVNRNNKYIDNVGIFLSILRSKYIKVYPI
                     LIICLKTSSLIFFNILFPIYIIYQTEVYFSRILSISISLFLIFKMFISGQEIIKLWRK
                     HLIKSKILNDTTFNMIIRYIREGKLSSEFYINNKDNFNVIDILLTPSLKSKRHHALLK
                     IKQELGEDNLNLNNIDDLKNLKVVFNSISVNKEWKKLLDSLYISWIINYRKQIEENGP
                     EDINDFIILLYQEINGIQLPI"
     gene            complement(<549820..>551520)
                     /gene="TPHA0D02660"
                     /locus_tag="TPHA_0D02660"
                     /db_xref="GeneID:11534294"
     mRNA            complement(<549820..>551520)
                     /gene="TPHA0D02660"
                     /locus_tag="TPHA_0D02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685289.1"
                     /db_xref="GeneID:11534294"
     CDS             complement(549820..551520)
                     /gene="TPHA0D02660"
                     /locus_tag="TPHA_0D02660"
                     /inference="similar to DNA sequence:INSDC:YML031W"
                     /note="similar to Saccharomyces cerevisiae NDC1 (YML031W);
                     ancestral locus Anc_5.574"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685337.1"
                     /db_xref="GeneID:11534294"
                     /db_xref="InterPro:IPR019049"
                     /db_xref="UniProtKB/TrEMBL:G8BST2"
                     /translation="MNGSILSYRLIFNDVSKTRFHNLATRLLIISSCIEALFWSLVTS
                     NNNQLLIWIPKFFLKLVLSYIINICIITTRKQYLYVQSRDHSNIAVALIKEMFTVRCI
                     IYEFIYIISCMLISLVMKDTIGPAFLDYDFLNYFQIYIWFIIPSTYTFQHMCLNVDKL
                     SFLFGYSIQDPQDYIVGRFHKIVIKSAILGLSCNFISLIIFFSFTDLSIVNFKFQGYL
                     IILSFYIFMKFEFANLTFSAYMSIGCLYKGKPISLLSRTPIETLLSGLLSGHEFTKLT
                     AFQELLYRSTLSSPHYRYPIYDLAIDNPIIWNQLLESCLVIIQATNEPVESYIHAVRN
                     NYIPFHKYREPKNNITTGSYYKVSTKNQSMMNNGFNEKYLRNESTNDNSYTLLPDLVN
                     ILYQSLASKIWYFFFPSIYNKPENSYKLTLFEAWTMSKSRQANRLVKSPILHANSVIA
                     LTGLLINAKEEDGFGRVKQSIGSVLTCLEKSMYSLGKFNDLEIPSHQIVPFAKKIANA
                     NEEATPSSPAPDIISILYDLSVSAFLELVLKYDTVLDDVYLDTEVRRLSEWILNIYRN
                     "
     gene            complement(<551923..>554321)
                     /gene="TPHA0D02670"
                     /locus_tag="TPHA_0D02670"
                     /db_xref="GeneID:11534561"
     mRNA            complement(join(<551923..552495,552594..>554321))
                     /gene="TPHA0D02670"
                     /locus_tag="TPHA_0D02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685290.1"
                     /db_xref="GeneID:11534561"
     CDS             complement(join(551923..552495,552594..554321))
                     /gene="TPHA0D02670"
                     /locus_tag="TPHA_0D02670"
                     /inference="similar to DNA sequence:INSDC:YDR458C,YML034W"
                     /note="similar to Saccharomyces cerevisiae YDR458C and
                     SRC1 (YML034W); ancestral locus Anc_5.577"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685338.1"
                     /db_xref="GeneID:11534561"
                     /db_xref="GOA:G8BST3"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="UniProtKB/TrEMBL:G8BST3"
                     /translation="MKIIGIVSVSAYIQLFLISYTRLQVDGIERCCSLRSKKEYKNRK
                     RKTKYLIMETKLYLNKHFKYKNLKVSELKEILAENNVEFPSKAKKSTLLNIYRTNIYK
                     KIPHLRKIYNLSLKNDVNNNSYSGESSESESLMTSDPITREPSLSYSPDISSSSKKRK
                     HIELSEKTPIKTIGKLSNKEKDTAIDQAEDYSTPKKKKQKHLSNDNRISETSIIHEKL
                     ANKSPIKIESPMKIFKSDTSENSIDTSNDSFISNSTVLNTNTKLSNKDDAKMAFRKGS
                     QKNDHKIRRSIPPDLALLKSSKLLKNELKKSAEERSLTLSEDHVIDGKSPGKILQKNS
                     DSESISKDEKKEINPSTAKSAVSDNSSNNSIMNIKKNLQDECTNKKQSKLVHYFYQIN
                     LFLIIMLPVLFSLWYREQRILMGFCGHELPTRQIIPAKLNNEYPALSNVNAWLESLTP
                     SCLECPANTICYEELNVKCKPDFYLTSNFYTLYGLLPIPRQCIKDDKRTKIVDEVIKK
                     SLEILRAKNAQIDCGENSDEQVSGFAEDELYDMFKESKDSWITDEEFDKIWEIVITKL
                     KMEPEISWRQIDDLNTINKQTISNDEANEVQRQKGNLSKSNVEENKRFFRSSSKKYIG
                     LKCQFERQIYQTYLTYKLIIWCSIITLVIAKYTEYKLRKYFHEKQSIDIITKKVLIYL
                     KECKAKHIEDFSCTPYASTVQLRDVFLSDIVNLQYKNAVWRQVVKNIEHNNTNIKSSL
                     LEIHGEIMKCWEWIGDTNLNKIDASV"
     gene            <554676..>556127
                     /gene="TPHA0D02680"
                     /locus_tag="TPHA_0D02680"
                     /db_xref="GeneID:11534548"
     mRNA            <554676..>556127
                     /gene="TPHA0D02680"
                     /locus_tag="TPHA_0D02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685291.1"
                     /db_xref="GeneID:11534548"
     CDS             554676..556127
                     /gene="TPHA0D02680"
                     /locus_tag="TPHA_0D02680"
                     /inference="similar to DNA sequence:INSDC:YML037C"
                     /note="similar to Saccharomyces cerevisiae YML037C;
                     ancestral locus Anc_5.582"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685339.1"
                     /db_xref="GeneID:11534548"
                     /db_xref="UniProtKB/TrEMBL:G8BST4"
                     /translation="MDYEDNKDGSVVETDAIEDLDIDTEVVAKYLNELEVGCLYNTED
                     DDEVVNNHDENLMDKQEPYNLYQLLDQIPNGRKTMNSLFYTTFNVGKEFNNIHFSNFQ
                     MSKKVEQYAVEWYIEEKNGLQSGTTTSLVDNDTPIKFSWSSTNTIPKNSVMYKHLTKS
                     TRELTHETTNQKLMKIVDSKLDNIKKEVMGWKIYDKPDPLTKNNELDEKCDETEDVEA
                     DYSVEYNSDISNSYSIDRSKPSEFSVSSFKVDPLQEFVVTTLPKERKKKVKPVKKKQG
                     LFWLFSGSKKKDKNKTVTKGDTDDTTKTNITNRDANDESMNQRRILSNNLNTDSTVAF
                     VGQHQERLNSIDNKIVYQADSEKDIITESSIRPDLNKTDQDVENIQNKTVNNVDVLEL
                     EEVNKAVSNGGKTYQHQDQGQGTLGHGVTVDSHSHSHSESDNDFGDFAAAVIPITLPP
                     KAPNNDSNLSPGHNDSSISLMNTFVPLQPKKKT"
     gene            <556598..>557968
                     /gene="TPHA0D02700"
                     /locus_tag="TPHA_0D02700"
                     /db_xref="GeneID:11534275"
     mRNA            <556598..>557968
                     /gene="TPHA0D02700"
                     /locus_tag="TPHA_0D02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685292.1"
                     /db_xref="GeneID:11534275"
     CDS             556598..557968
                     /gene="TPHA0D02700"
                     /locus_tag="TPHA_0D02700"
                     /inference="similar to DNA sequence:INSDC:YML038C"
                     /note="similar to Saccharomyces cerevisiae YMD8 (YML038C);
                     ancestral locus Anc_5.585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685340.1"
                     /db_xref="GeneID:11534275"
                     /db_xref="GOA:G8BST5"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G8BST5"
                     /translation="MSTQLLLLYIGGWYLSSISISLFHKWLFDPLRGFHIPYPLLITS
                     LQQITLWICAYIFIKAKHLKDTRKVEQGSSRLKYYLKYILPTAIATGGDIGCSNFSYK
                     YVPLTIVTIIKSSSIAFVLLFGCLFKVERFHKKLLLIVIIMFFGVILMVYDPSHKNEE
                     NRKQYSNLLFGCFLVLIGSCLSGLRWVYTQVVLRKSNTGASGKESNINSVEGDIITDN
                     QNEIVIDGSVVIDAERLQVKSIDQKDSDDKPHSIIIIQKLTPSIGVVCLIASLIFEKP
                     FPGFFHLSIFKFKSVIGSETEYITTFMSILRGIALIGLPGVDIFFLTLCEFSILQISQ
                     VLTLSVAGIVKEVLTIIFSLVILNERIKGLHSWIGMAVILLDVVYYNYYRYNEKKKDE
                     YMKIIDDRNPHEVPNDDYFIINHEKEEVNTSQQNNQKGSTVTYSIASDPVVQEYELSN
                     LINSSK"
     gene            complement(<558487..>560079)
                     /gene="TPHA0D02710"
                     /locus_tag="TPHA_0D02710"
                     /db_xref="GeneID:11534553"
     mRNA            complement(<558487..>560079)
                     /gene="TPHA0D02710"
                     /locus_tag="TPHA_0D02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685293.1"
                     /db_xref="GeneID:11534553"
     CDS             complement(558487..560079)
                     /gene="TPHA0D02710"
                     /locus_tag="TPHA_0D02710"
                     /inference="similar to DNA sequence:INSDC:YHR007C"
                     /note="similar to Saccharomyces cerevisiae ERG11
                     (YHR007C); ancestral locus Anc_5.588"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685341.1"
                     /db_xref="GeneID:11534553"
                     /db_xref="GOA:G8BST6"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:G8BST6"
                     /translation="MSDTSLVGTLIEYVQVAIGAFLALPLAQRASIVILAPFVYHITW
                     QLLYSLRKDRAPLVFSWIPWVGSAVDYGSRPYEFFGENKKKYGDIYSFLLLGRIMTVY
                     LGPKGHEFIFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNHRLMDQKKFVKGALTKD
                     AFVKYIPLMIEEMEQYFRTSPFFDINKKKSNTVNVLATQSEMTIFTASRSLLGKELRD
                     MLNTDFAYLFGDLDKGFTPINFVFPNLPLEHYRKRDNAQRVISSTYLKLIKKRRDNND
                     IQDRDLIDTLLKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPD
                     VQKELYDEQMRVLDGGKKELTYELLNDHMPLLNQTIKEVLRLHHPLHSILRKVMRDMQ
                     VPNSSYVVPKDYYVLVSPGFTHLEDAFFPNAKEMNIHRWDNDSNSSYSVGDEVDYGFG
                     VVTKGVSSPYLPFGGGRHRCIGEHYAYLQIGVIMSVFVRTFTWKFPEGITLPKPDFQS
                     MVTLPLNPAEITWEKRNPDQVI"
     gene            complement(<562623..>563945)
                     /gene="TPHA0D02720"
                     /locus_tag="TPHA_0D02720"
                     /db_xref="GeneID:11534559"
     mRNA            complement(<562623..>563945)
                     /gene="TPHA0D02720"
                     /locus_tag="TPHA_0D02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685294.1"
                     /db_xref="GeneID:11534559"
     CDS             complement(562623..563945)
                     /gene="TPHA0D02720"
                     /locus_tag="TPHA_0D02720"
                     /inference="similar to DNA sequence:INSDC:YDR465C"
                     /note="similar to Saccharomyces cerevisiae RMT2 (YDR465C);
                     ancestral locus Anc_5.589"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685342.1"
                     /db_xref="GeneID:11534559"
                     /db_xref="GOA:G8BST7"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BST7"
                     /translation="MSELHHLLTFPEKPITAEVYVTKLKHYLSNGIPATYTLEQVKEY
                     ELNQAKENGETVDERSEEEEETSNTTPLHILARSIPKNLTPAELSVVLELINILFEYG
                     AGWNFIDYEDKTVGDLLIENGYSVNSSLYKRIVEAGVSAELLLRKINDNVEFLDDDEI
                     IQEALGMEDNEIPTEENIKIVNEDATAGNQEVYLQTELEYTANTLLTKENKDGVMMDW
                     ETGIMKLASDTITSSFDKDDDSIAILNIGFGMGIIDTFIEKDLQEKYPNKKVKHYISE
                     AHPDVLKKLKNDGWYDKKNIIILEGRWQDSLNTLLDYGNVFFDGIYYDTFSEYYENIL
                     ELLDIIVGLLKPHGIFSFFNGLGADRQLCYEVYKNIVAIDVSNYGMKCEYSTIRVGDN
                     NNQNGSEHGGDDATVNGIENTTDKPNWQNVKRSYYNCDYYYHPCITFM"
     gene            complement(<564289..>564978)
                     /gene="TPHA0D02730"
                     /locus_tag="TPHA_0D02730"
                     /db_xref="GeneID:11534549"
     mRNA            complement(<564289..>564978)
                     /gene="TPHA0D02730"
                     /locus_tag="TPHA_0D02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685295.1"
                     /db_xref="GeneID:11534549"
     CDS             complement(564289..564978)
                     /gene="TPHA0D02730"
                     /locus_tag="TPHA_0D02730"
                     /inference="similar to DNA sequence:INSDC:YHR008C"
                     /note="similar to Saccharomyces cerevisiae SOD2 (YHR008C);
                     ancestral locus Anc_5.590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685343.1"
                     /db_xref="GeneID:11534549"
                     /db_xref="GOA:G8BST8"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:G8BST8"
                     /translation="MFTRSVTVKRLASSAVFKRTKITLPELKWDFDALEPYVSGKINE
                     LHYTKHHQTYVNGFNSSIDQFKDVTEKLAKDPNSLELANKLIAIQQNIKFHGGGYKNH
                     CLFWENLSPASGSGVGGELPTGNLLKQIEKQYKSLDNLIKLANAKLMGIQGSGWIFLV
                     KNLNNGGKLDIVQTYNQDTVSDPTIVPLLAIDAWEHAYYLQYENRKAEYFGAIWNVIN
                     WKEAEKRFNAA"
     gene            <566279..>568819
                     /gene="TPHA0D02740"
                     /locus_tag="TPHA_0D02740"
                     /db_xref="GeneID:11531071"
     mRNA            <566279..>568819
                     /gene="TPHA0D02740"
                     /locus_tag="TPHA_0D02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685296.1"
                     /db_xref="GeneID:11531071"
     CDS             566279..568819
                     /gene="TPHA0D02740"
                     /locus_tag="TPHA_0D02740"
                     /inference="similar to DNA sequence:INSDC:YDR466W"
                     /note="similar to Saccharomyces cerevisiae PKH3 (YDR466W);
                     ancestral locus Anc_5.591"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685344.1"
                     /db_xref="GeneID:11531071"
                     /db_xref="GOA:G8BST9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BST9"
                     /translation="MSNKIKKHSPSDYTFKEELGHGSYSTVYKAVDKRNVKQCYAIKV
                     CSKKHIIKENKVKYVSIEKNVLNILRKGNHPGIIKLYYTFHDEENLYFVLSYAINGEL
                     LQLLHKYRSFNEELTIRFTVQIIDILEFIHKNGIIHRDVKPENILLNRNYNLILTDFG
                     AASLIDNDEDKENSNNSNATYNDIHVNRASSFVGTAEYVSPELLLYNQCGYCSDVWAL
                     GCMIFQFLKGYPPFRGANELNTFEKIVALDYHWNDPNNLVSQSWKDLVSKILITNSEK
                     RMNLENVKKHPLFKNINWNDKEKIWLGTNKLPPSNVPLNNTTMSSYNGNDNNQNTKSI
                     NDRQLHIIDVPLRDIAITKQKQKKKPKMVSSTTGNIVEWRKRLGISSLGLTNNTENHN
                     LRGSISDMMKRDNIGTNKPFDRKDAHLVNNNNFTTNITLDNIRNDTTSKPLILKNKYN
                     TNYIEQTKKSNLNNDVIKQQPAFIHEISYDANGPDMSMFAYKRIDNDLITNLVTNNGV
                     TLRSIEGAIPSILTLYKDGSLVYNTIDPVSQNTIPIKMVNIADSDLSMYDFEFNEMTK
                     TGFLILEKYRFKLWFICLPQEPLIDFAAAMSFPVVNDNDTWVDCLFKSRQIIEDNYIA
                     NMTNGLKLGESSKTSRSSSLDLLDFTSETIIEQDIKQLNNIPKSAHQKATASVMLKQK
                     GDSPRNQPVSDTKDNKDELNNNLVESTKNYVHSRQASGYSNTKKILKKNNEASMENKV
                     SSAASPILPISSHNASFANTSLRTGNTKPQVKKYSVPSNMIISSSRYEVLYTLRRDGP
                     IDPNYYKEKAHMNSSRKDSSKSQHSTIIASSGASAAFKNLQKRKLSDK"
     gene            complement(569025..569096)
                     /gene="TPHA0Dtrna8E"
                     /locus_tag="TPHA_0Dtrna8E"
                     /db_xref="GeneID:11534141"
     tRNA            complement(569025..569096)
                     /gene="TPHA0Dtrna8E"
                     /locus_tag="TPHA_0Dtrna8E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11534141"
     gene            complement(<570624..>572186)
                     /gene="TPHA0D02750"
                     /locus_tag="TPHA_0D02750"
                     /db_xref="GeneID:11534416"
     mRNA            complement(<570624..>572186)
                     /gene="TPHA0D02750"
                     /locus_tag="TPHA_0D02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685297.1"
                     /db_xref="GeneID:11534416"
     CDS             complement(570624..572186)
                     /gene="TPHA0D02750"
                     /locus_tag="TPHA_0D02750"
                     /inference="similar to DNA sequence:INSDC:YHR009C"
                     /note="similar to Saccharomyces cerevisiae YHR009C;
                     ancestral locus Anc_5.592"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685345.1"
                     /db_xref="GeneID:11534416"
                     /db_xref="GOA:G8BSU0"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:G8BSU0"
                     /translation="MSNPGDHLKEPLVYQDLPSNRSDGKEHIIIVGGGIIGVTTAYYL
                     TQHPKFSPSTHYITIIESTEVACGASGKAGGLIASWAFPDQIVPLSFKLHSQLNQQFD
                     GEANWGYRRLNALSVEADIKNVKEAQEQRHLRFQRRFIKMRDKSSTSPNSPNSEGQTN
                     VHGNPKDYIANTTSIPCPQETKATGESVELTRDSSESNSLKETMASSVSMTTAESSSS
                     IPADLGTGGLMMRTTQNVLPTAFNWIKSTLVKTWTFIGEPTTTAQIHPLQFTLFLLKK
                     AMDTGAVDLIRGKVIDFKKNDKGEIIGVGYMPKAGKHKDEVVNIVNASKVLLALGPWT
                     SKLLKNCPVTTLKVHSVIVKPHKAEGTIISPYSMFSELQIDENQTFSPEIYPRKDEIY
                     ICGEGESLDVIPDEQTDVVTNAEKCDELFYYVSKLSSSVSQGDVTESFASYVPVVNIP
                     SGSGPLLGETDLKNLFIAAGHSCWGINNAPATGVIMSQLLLEGICTCADITEFNPKLY
                     FKASGNKSVVKA"
     gene            complement(<575033..>575686)
                     /gene="TPHA0D02760"
                     /locus_tag="TPHA_0D02760"
                     /db_xref="GeneID:11530958"
     mRNA            complement(<575033..>575686)
                     /gene="TPHA0D02760"
                     /locus_tag="TPHA_0D02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685298.1"
                     /db_xref="GeneID:11530958"
     CDS             complement(575033..575686)
                     /gene="TPHA0D02760"
                     /locus_tag="TPHA_0D02760"
                     /inference="similar to DNA sequence:INSDC:YDR468C"
                     /note="similar to Saccharomyces cerevisiae TLG1 (YDR468C);
                     ancestral locus Anc_5.593"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685346.1"
                     /db_xref="GeneID:11530958"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:G8BSU1"
                     /translation="MSDNRSEDIFDQVASDIREQIERLKSIDYVSKAEIEEYNEGVED
                     IKDTINDLQKSAEVIRRNDPASAQVKEVEVASLRKLLKDLENDKINKRKNYNEENKVS
                     NFMDGEQNDTSRTTGNVENAVQTQMFQEQSDQLDVIHLTMDQLQQQARTMGDELLDQG
                     ELLDQMDDGMDTLGGKLNRGKKQLEWIYEKNRERWNDCCIVLLIIALIVLLVVAVVL"
     gene            <576150..>576467
                     /gene="TPHA0D02770"
                     /locus_tag="TPHA_0D02770"
                     /db_xref="GeneID:11531010"
     mRNA            <576150..>576467
                     /gene="TPHA0D02770"
                     /locus_tag="TPHA_0D02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685299.1"
                     /db_xref="GeneID:11531010"
     CDS             576150..576467
                     /gene="TPHA0D02770"
                     /locus_tag="TPHA_0D02770"
                     /inference="similar to DNA sequence:INSDC:YDR469W"
                     /note="similar to Saccharomyces cerevisiae SDC1 (YDR469W);
                     ancestral locus Anc_5.594"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685347.1"
                     /db_xref="GeneID:11531010"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:G8BSU2"
                     /translation="MSNTSESVEPTDLKNTSEIPIPILTTSESVNGTVPNLENRLKDE
                     SLNNINLTETIGGSETRKYLNQNVTQQLLNGMKIIAKEKPKDPLRVLGEYLIEQSDLM
                     KKP"
     gene            complement(<576524..>578179)
                     /gene="TPHA0D02780"
                     /locus_tag="TPHA_0D02780"
                     /db_xref="GeneID:11534278"
     mRNA            complement(<576524..>578179)
                     /gene="TPHA0D02780"
                     /locus_tag="TPHA_0D02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685300.1"
                     /db_xref="GeneID:11534278"
     CDS             complement(576524..578179)
                     /gene="TPHA0D02780"
                     /locus_tag="TPHA_0D02780"
                     /inference="similar to DNA sequence:INSDC:YDR470C"
                     /note="similar to Saccharomyces cerevisiae UGO1 (YDR470C);
                     ancestral locus Anc_5.595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685348.1"
                     /db_xref="GeneID:11534278"
                     /db_xref="GOA:G8BSU3"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BSU3"
                     /translation="MNEEIIRSQARPYYEPDTFDAGYSAVFRPDKGVVDPYGFNIASK
                     LKIVQSNNGGLADLKNVSKSNGILWNFIPKWFTWSSHNNKNINKLSSSNKILLSDTDQ
                     NINKNLDALEWPDLLDIDVGKRILNQLLGELTKMYLRHLVQQPFEVSKVLLQVGDFTS
                     ISAENNRNKFKDSSAENPGILLEDQENDTDAELEFFSKKPINASNEVENKKAIKGRVG
                     KTDKVIVENRINPESLHIMDIINSLIEKEGLRGVWRANNTTFIYNFLNMTCNIWFIGL
                     LSPFFGISDPHFFDTILQTATSYSTIDDIKISLGLTICSNILTNILLVPLDLIKIKLI
                     TTSIEGFTVNKDIDTEFPAEEVKELEILPIEKSRSLRNIIKSWSWKEDLLKLPADIWF
                     FTILNSLVSINRSSSTVFGEKLFTLLWVHYLRQTKESSKLKLYNLSFCCFQILGIFLK
                     LPIETILHRCQVKYLLNRNKEREDQLCIRSDELIIKPIPYDNGLFDNLITNSTTSDEK
                     ENNLASKKIKALWNGWRISVVSLLCDYSLKVLQKNDKSIEFEF"
     gene            <579665..>580674
                     /gene="TPHA0D02790"
                     /locus_tag="TPHA_0D02790"
                     /db_xref="GeneID:11530969"
     mRNA            join(<579665..579695,580295..>580674)
                     /gene="TPHA0D02790"
                     /locus_tag="TPHA_0D02790"
                     /product="60S ribosomal protein L27"
                     /transcript_id="XM_003685301.1"
                     /db_xref="GeneID:11530969"
     CDS             join(579665..579695,580295..580674)
                     /gene="TPHA0D02790"
                     /locus_tag="TPHA_0D02790"
                     /inference="similar to DNA sequence:INSDC:YDR471W,YHR010W"
                     /note="similar to Saccharomyces cerevisiae RPL27B
                     (YDR471W) and RPL27A (YHR010W); ancestral locus Anc_5.597"
                     /codon_start=1
                     /product="60S ribosomal protein L27"
                     /protein_id="XP_003685349.1"
                     /db_xref="GeneID:11530969"
                     /db_xref="GOA:G8BSU4"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR018262"
                     /db_xref="UniProtKB/TrEMBL:G8BSU4"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVA
                     GIERYPLKVTKKHTAKKIAKRTKIKPFIKVINYNHLLPTRYSLDVESFKSVVSTETFE
                     EPTQREEAKKVIKKAFEERHQAGKNQWFFSKLRF"
     gene            <582050..>582892
                     /gene="TPHA0D02800"
                     /locus_tag="TPHA_0D02800"
                     /db_xref="GeneID:11531122"
     mRNA            <582050..>582892
                     /gene="TPHA0D02800"
                     /locus_tag="TPHA_0D02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685302.1"
                     /db_xref="GeneID:11531122"
     CDS             582050..582892
                     /gene="TPHA0D02800"
                     /locus_tag="TPHA_0D02800"
                     /inference="similar to DNA sequence:INSDC:YDR472W"
                     /note="similar to Saccharomyces cerevisiae TRS31
                     (YDR472W); ancestral locus Anc_5.601"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685350.1"
                     /db_xref="GeneID:11531122"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:G8BSU5"
                     /translation="MTDKLILTGMPEEQNVHSTTGYEYIIGPKQSLPNEANAPYIPSK
                     IYSESILYKKQQVSLMSMAFLYQELISQIYKNSKTSTEFETKLSNHGSNIGFKLLDLL
                     NLRASVPSSARSSTFLPSNASLTGGNTGETGGASTNTNTSTILTGYIDKSYESNESLS
                     NMISQLRRRDLKIIDILQFIHGSVWSYLFGAPSNDLVKSSERENEYMIVDNEPVLTQF
                     ISGNFSCNYFMCGLIKGFLSQAGFECTVSPHPDVDEIYPNRVVYLIKFEKQVLEREAL
                     KFGA"
     gene            <583643..>585409
                     /gene="TPHA0D02810"
                     /locus_tag="TPHA_0D02810"
                     /db_xref="GeneID:11531108"
     mRNA            <583643..>585409
                     /gene="TPHA0D02810"
                     /locus_tag="TPHA_0D02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685303.1"
                     /db_xref="GeneID:11531108"
     CDS             583643..585409
                     /gene="TPHA0D02810"
                     /locus_tag="TPHA_0D02810"
                     /inference="similar to DNA sequence:INSDC:YOR023C"
                     /note="similar to Saccharomyces cerevisiae AHC1 (YOR023C);
                     ancestral locus Anc_5.603"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685351.1"
                     /db_xref="GeneID:11531108"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BSU6"
                     /translation="MDRHNISHTLENTLELSDVNETDQPSPSQVLLMGSHEVTSRIST
                     RVPSTGYYQVATPKSPHESTLENELQHLPDHDPCVISGDSEETERFKYVTAKKEIMNN
                     IHLYSLVNNKEMQNIQLELERVNAKMTLLKEVHQDKKFIDNVEDYQTKDNERKKLELE
                     RLKNISSTFNEKESSILYSMNSNNHMSSHSNNVTHHYYQTRSKSQGNINELPLLRPAN
                     STIMDMRLTGLKSIPNDISANESNTFDIYKTSPSLESLQDKQQQLNTHHKRNYSSTCL
                     TSNSGLVGKTEDNEPIFKRYDGILVVISCSFCGRTGFSSAQGIVNHTRLKHSKTYSSQ
                     PLAVLHNQTLLESSKQKPKILEQFKSLGLDPAKDYLPNKVVLPNLERKNSSKNSNNNQ
                     LFTGINATKSNEISTKYLGMLYDDKEDFENLLSMVKKAPKDLEVFLKQTESESELSLQ
                     EDLSEIDVSKIEKEEEDDDEVTGIGDLENRSPDYTPSSVDNLSSSNSTPKPQENYLGS
                     DSQIETDDRQKTPVELGRRLRKRKNDEDDVAPLKERLRASSNNMESEGIAVPEVPAHE
                     KRSIHYNLRARSKLKSQHLELD"
     gene            <585827..>587887
                     /gene="TPHA0D02820"
                     /locus_tag="TPHA_0D02820"
                     /db_xref="GeneID:11531130"
     mRNA            <585827..>587887
                     /gene="TPHA0D02820"
                     /locus_tag="TPHA_0D02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685304.1"
                     /db_xref="GeneID:11531130"
     CDS             585827..587887
                     /gene="TPHA0D02820"
                     /locus_tag="TPHA_0D02820"
                     /inference="similar to DNA sequence:INSDC:YOR022C"
                     /note="similar to Saccharomyces cerevisiae YOR022C;
                     ancestral locus Anc_5.604"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685352.1"
                     /db_xref="GeneID:11531130"
                     /db_xref="GOA:G8BSU7"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BSU7"
                     /translation="MFKKANITLLAQGEKVTSKMTIPVQNLKARWFFATDLPKKKPYD
                     LNYKPTRSPKRFIPFSKFDSSRIETTYLSSFSKDAKKDDKILSNIPVNEDYLFEVNLY
                     DMEIRPVYWSGPIYEIRRGIWFDTKGNPLSHDLTEELEALYQQLKFNKDGVIENQTKD
                     IYNLEGDYEEGSIAMFLDNKSAFLLNDISGGVFQLKFLRSSFGQNVPTNAIKVTREYS
                     NIVSRKVSDKKLGETNGEITDVNANNSLGKIGEMIGLQLTDIFSGTAPEDNGKIETDS
                     KVKSKENEFLSSEMENDYNNSNSTILENPSNNRNVKHLVLCIHGIGQTLGKQYQYVNF
                     AHTINLLRINMKKVYCQSPDMKQINKDAGNNDWQTNCDVQVLPVDWRHDIDFKTDDID
                     ALTTDSMIPNLTEITLRGITPFRKLLGDVGLDVLLYDDPLYKEQILNNTVSKLNGIYN
                     IFKKQNPEFNGKVHIIGHSLGSVIAFDTLSNLSRYKLDFPVEKLFCIGSPVGVYKLVQ
                     KTNDWRSKKHATSQINFQAPKVNDLYNIYHINDPIAYRMEPLIDRDLATYEEVYLPHL
                     PVEGITNKMLALGNTLIKDLPMSEKANVTSRKKVILPEVLVKKLKEINSNGRVDYVLT
                     PNLLDMDIISALKSHVSYFEDIDIAGFILKETIKTSEQTNEINAIRIIDTARNKGKSF
                     DKLG"
     gene            complement(<587995..>590655)
                     /gene="TPHA0D02830"
                     /locus_tag="TPHA_0D02830"
                     /db_xref="GeneID:11530942"
     mRNA            complement(<587995..>590655)
                     /gene="TPHA0D02830"
                     /locus_tag="TPHA_0D02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685305.1"
                     /db_xref="GeneID:11530942"
     CDS             complement(587995..590655)
                     /gene="TPHA0D02830"
                     /locus_tag="TPHA_0D02830"
                     /inference="similar to DNA sequence:INSDC:YDR475C,YOR019W"
                     /note="similar to Saccharomyces cerevisiae JIP4 (YDR475C)
                     and YOR019W; ancestral locus Anc_5.609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685353.1"
                     /db_xref="GeneID:11530942"
                     /db_xref="UniProtKB/TrEMBL:G8BSU8"
                     /translation="MLDLNERNIYRKIKIYTTIDDLSSEENQFNNKPLKESNNISNYK
                     QTVSFDTVPKFLGYSQNDLNPNETSNELDLDYVTSDTLTDNSDYFNYKYSQDRSKSPP
                     PKKAIDKFSPNGASPSFPIIQKKKSLNDIFKIGHNGKLVRIDYPTRPSIESYAIIINK
                     YQLHWLKMWNRRKKIIESRYFNKNKYFLKPDILFDAGENKNTSRSTKGSSTMMYSMDL
                     TKRQRKLKTLRIQENDDVYNKMSTQPKTYLVHISGRKHTWVSLDYTITKLINDTDHLI
                     VIANLPNIRNKKRHNYNEILYTYDPSVQQTNYAPTAVERSGSPEAFNKDEDDKVLNYF
                     KENRHYADENFNFRSRSRSRSRLRYGNRPASSTSKSMTRNFSSESNPANGDIVWITGY
                     SQNEIDTKLNDIFDYIMVLLPKGKKIKITIEIVINKTLRTLIDATNIYNPDFIVLSTL
                     KWRRTDDLVKWKSTYINDKVATEFPVPVFLVPVKRLNDFEINLQNKHQMLAKQSKALN
                     KQISVNANIIGTNDKSNVPGAIMYDNVNASGSSQASQTDASVDSGVSSPSINMVPRLQ
                     KKLSNLTIDFLKNKTEQKKLYEKVEGIDLSKYQLSKNDSLTTDIINSYNKHSDKVESD
                     PEFESDFEDTEYESSDGDSADLKSFRSVISTTKEKLHNFAAVHRMIMLTNLSEVRIDR
                     KLTDAEKKLKKIDVIMSTSLEFVMDLENFSDEEVDGHGEEFLELKTVLTGGAVRPTTT
                     SKRSMLDVGTSNKLEKGRRSRRSSGSENTLDPSKIRFASNVKPNDGINVLGNTSRSDS
                     VVASVHDSPALSPVSSNGLKQSKNDYRSHLNLPHHPQAMRVFSEFEKRNKAKKSNELR
                     KVKSATQVNKVSSSSSSSSKKKKKKKFFFF"
     gene            <591733..>593637
                     /gene="TPHA0D02840"
                     /locus_tag="TPHA_0D02840"
                     /db_xref="GeneID:11534237"
     mRNA            <591733..>593637
                     /gene="TPHA0D02840"
                     /locus_tag="TPHA_0D02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685306.1"
                     /db_xref="GeneID:11534237"
     CDS             591733..593637
                     /gene="TPHA0D02840"
                     /locus_tag="TPHA_0D02840"
                     /inference="similar to DNA sequence:INSDC:YDR477W"
                     /note="similar to Saccharomyces cerevisiae SNF1 (YDR477W);
                     ancestral locus Anc_5.611"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685354.1"
                     /db_xref="GeneID:11534237"
                     /db_xref="GOA:G8BSU9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:G8BSU9"
                     /translation="MHIVSPMNALHPKDNKSNGMHLHGSFNGYRQSHQQNDQQSPKGN
                     GLNHVINPNMVFGTLSDGARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKK
                     VLAKSDMQGRVEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYANNELFEYIVQRD
                     KMTENEARKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDG
                     NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDDSIPALFKN
                     ISNGIYTLPKFLSEGAANLIKKMLIVNPLNRISMTEIIHDEWFKVDFPEYLLESQANS
                     TSEELMKKANKDNQIDDRLVDALSKIMGYDKNEIYNCLRTEIAEDSNSPNSSMVSEIK
                     NAYTLLKENEQIMESHADNSNFDTILSQTLPSFQQRTLNKGNSTTPDEERTPMFLTQH
                     MNEGNSGVAILPTSLPQLHRANMLSSGLLQNSNIHPLVSKKSKTKWHFGIRSRSYPLD
                     VMGEIYIALKNLGAEWAKPSEEDLWTIRVRWKYSGSNQIANNEANNSQNQNNEKIPDL
                     LKIVIQLFQIETNNYLVDFKFDGWEDSSGAPVTPSDITSDEISAFSAYPFLHLTTRLI
                     MELAVNSQNV"
     gene            complement(<594020..>595735)
                     /gene="TPHA0D02850"
                     /locus_tag="TPHA_0D02850"
                     /db_xref="GeneID:11534543"
     mRNA            complement(<594020..>595735)
                     /gene="TPHA0D02850"
                     /locus_tag="TPHA_0D02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685307.1"
                     /db_xref="GeneID:11534543"
     CDS             complement(594020..595735)
                     /gene="TPHA0D02850"
                     /locus_tag="TPHA_0D02850"
                     /inference="similar to DNA sequence:INSDC:YDR479C"
                     /note="similar to Saccharomyces cerevisiae PEX29
                     (YDR479C); ancestral locus Anc_5.614"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685355.1"
                     /db_xref="GeneID:11534543"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G8BSV0"
                     /translation="MDSVTSFLWNEAAKNDFLNDLITEESVYAKDPNKPKGLGEQHGD
                     SSKNTDSPSQKDSDEVFDNKSKKVTFSSGSSIQQMMADVLVENLLKIAIPPSSEMGST
                     NLDKRMQMIKDRPRLSAPLMTANFIQTNARLSFPFNLTNEFLNIFSWTNPAYTLSITL
                     LYSFIILKPLPTITLLPMLYILCAVMTPQYLYMHKPETTPLLDYNPTPAQGPPLRKAV
                     VPVPAPHLSQEFLINMTDLQNHMLLYVEVYDFIASIIGSFAFFTNEVVSSFIYILLIG
                     IIILNCFFTDVLLQFIPFKQLFLIFGWIIILLCHPSNRDYFLKVINSEEIRLKLLTVT
                     NKVEDELHEELKLVEAREKRQVVIFEIQKLSDEGEWITLGFSNDAYTLFSDIRIKEAH
                     IEDHCVSDIDDIEPPHDWTWYGENNWVLDLDPLKWVEQELIQLVEIDTSTKWVYDIDL
                     EGNRGEYRRRMWINVCLRKIYDSVPEGDVNKNEIEVENPVRMGNNTSHIHGVSRNSLA
                     GNIKKKETPASKPINTLLNITDSNPEIKVIKHKKNKDSITVIEKDEPDTILSKSMEYL
                     KENLK"
     gene            <596215..>597192
                     /gene="TPHA0D02860"
                     /locus_tag="TPHA_0D02860"
                     /db_xref="GeneID:11534421"
     mRNA            <596215..>597192
                     /gene="TPHA0D02860"
                     /locus_tag="TPHA_0D02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685308.1"
                     /db_xref="GeneID:11534421"
     CDS             596215..597192
                     /gene="TPHA0D02860"
                     /locus_tag="TPHA_0D02860"
                     /inference="similar to DNA sequence:INSDC:YOR026W"
                     /note="similar to Saccharomyces cerevisiae BUB3 (YOR026W);
                     ancestral locus Anc_5.615"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685356.1"
                     /db_xref="GeneID:11534421"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BSV1"
                     /translation="MAPSNEIEELKIHSSDYISDIKFFKDLKKFMVTSWDGSLGIYNY
                     SNRDNVYIENVIHYVHPILCCCEVIINGKRKLYAGTVQGEILLLDEINNEFVKLNGIE
                     INKGIPSLCAYRDKLICGSWNGSLHIIDCHTNSVDFKIQLDGRKIFKMSSNDEKLILY
                     ATNNTTLYFDLPLQKNSEGIKVESGLKFQTRDIALTPGGCGYVSSSVDGRVAVEYFDD
                     ESKKFAFRCHRMTLSDSQFVFPVNTICFIPNSNILYTGGSDGCVSCWNISSKRKVGQL
                     PKINETSIVKLASNGDILLIATSDDSYKTNSSIPENLELQPSMFYLLYL"
     gene            complement(<597270..>598757)
                     /gene="TPHA0D02870"
                     /locus_tag="TPHA_0D02870"
                     /db_xref="GeneID:11534144"
     mRNA            complement(<597270..>598757)
                     /gene="TPHA0D02870"
                     /locus_tag="TPHA_0D02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685309.1"
                     /db_xref="GeneID:11534144"
     CDS             complement(597270..598757)
                     /gene="TPHA0D02870"
                     /locus_tag="TPHA_0D02870"
                     /inference="similar to DNA sequence:INSDC:YDR257C"
                     /note="similar to Saccharomyces cerevisiae SET7 (YDR257C);
                     ancestral locus Anc_5.616"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685357.1"
                     /db_xref="GeneID:11534144"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:G8BSV2"
                     /translation="MVDHEYKNCTDEFWRWLHCVAKYSVSPKVRIEDFREINEGRCVV
                     ASEHIEKDEVLFEIPRDSILNVDTSELFKNHYEGYIDGKTVIEEIGLWETLILCLFYE
                     MFVKKEESFWSQYFAVLPKATDFNTLMYWEDRELENLKPSFILERIGKDKSVAMHEKL
                     MEFVEKNLDVIETSSFTWDRFLLVASIIMAYSFDIERGECDADEEEEEEEEDIERSLI
                     KSMIPLADTLNADTKRCNANLIYDSGVLKMCAIKPIKANEQIYNTYGNHANFELLRRY
                     GYVEVDGTLNDCGEISLTTIIDATIKYFGLNDSYKPVLQKVVNIIAESECIRELTEGE
                     ELCLDTYDLFENGEIMMEMVVMIQILCMFPQINCLDTMDKLDLENYVFRTTKLSIQLI
                     TGRSMVTKACDNVWQCALELRLKQYPIHSRREPMPVKGSVEKSELREFMAHKTLQSEF
                     KSISNCILSIHKRFKIIPDAKLMKNIEKRKQNQNDDDNAKKRVKL"
     gene            <599288..>601045
                     /gene="TPHA0D02880"
                     /locus_tag="TPHA_0D02880"
                     /db_xref="GeneID:11534577"
     mRNA            <599288..>601045
                     /gene="TPHA0D02880"
                     /locus_tag="TPHA_0D02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685310.1"
                     /db_xref="GeneID:11534577"
     CDS             599288..601045
                     /gene="TPHA0D02880"
                     /locus_tag="TPHA_0D02880"
                     /inference="similar to DNA sequence:INSDC:YOR027W"
                     /note="similar to Saccharomyces cerevisiae STI1 (YOR027W);
                     ancestral locus Anc_5.617"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685358.1"
                     /db_xref="GeneID:11534577"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BSV3"
                     /translation="MSLSADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYS
                     NRSACYTSLKKFTDALNDANECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALE
                     LDASNKVAQEGLEQVKRTQEARKAQPDMGLTSMFNDPNLIEKLKSNPKTAEMMNDPQL
                     VAKLLSYRSNSQALSTELFSDPRLMTIMATLLGVDLNMGDLNGSNSMPPTAEKTPEAP
                     VAATKETKTETVPESKEKEPVAANPENMEVDDADVQKKLADAEKDEGNKLYKAHKFDE
                     AIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKIIAKA
                     FTRMGNAYEKLNDLKKAAEFFNKSLTEFRTPATLTKLRSLEKKIKVQEAEAYINPEKA
                     EEARIQGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCE
                     KALEKDPNFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNNGSNIREINQLYAK
                     ATQQRFEPASSNETPEQTYQRAMKDPEVAAIMQDPVMQSILQQAQTNPAALQEHMKNP
                     EIFKKIQTLISAGIIRTGP"
     gene            complement(<601295..>603706)
                     /gene="TPHA0D02890"
                     /locus_tag="TPHA_0D02890"
                     /db_xref="GeneID:11534569"
     mRNA            complement(<601295..>603706)
                     /gene="TPHA0D02890"
                     /locus_tag="TPHA_0D02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685311.1"
                     /db_xref="GeneID:11534569"
     CDS             complement(601295..603706)
                     /gene="TPHA0D02890"
                     /locus_tag="TPHA_0D02890"
                     /inference="similar to DNA sequence:INSDC:YDR258C"
                     /note="similar to Saccharomyces cerevisiae HSP78
                     (YDR258C); ancestral locus Anc_5.618"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685359.1"
                     /db_xref="GeneID:11534569"
                     /db_xref="GOA:G8BSV4"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:G8BSV4"
                     /translation="MMLRQFSKSNLKSASYKKLLLSSKASVVPVVGTVPTERLLPGSR
                     FTGRYNESGSIITSNPFYGKRYYVQMRMNPNQQEKDVPALEKFGTNLTKLAAEGKLDP
                     VIGRDEEISRAIQILSRRTKNNPVLIGKAGVGKTSLIDGLAQRIVAGEVPDSLKNKQL
                     IALDLGSLIAGAKYRGEFEERLKNVLKEIDDSNGEIIMFIDEVHMLLGLGKTDGSMDA
                     SNILKPKLAKGLRCISATTLDEFKIIEKDPALTRRFQPILLTEPTVADTISILRGLKE
                     RYEVHHGVRITDTALVSAAVLSNRYITDRFLPDKAIDLIDESCAALRLQHESKPDEIQ
                     KLDRNIMTMQIELESLKKETDPVSVERRETIENDLNLKNSELKRLTEIWEAEREEIDK
                     IKNAKVDLEQARIELEISQREGDYTKASELRYSKIPELEKRVKLSSQKKVEENSDDPS
                     SIVLLHDAVTSQDISKVVAKMTGIPPDTLMKGDKDRLLFMEQTLKERVVGQDEAIDVI
                     SDAVRLQRAGLTSDKRPIASFMFLGPTGTGKTELTKALAEFLFDDETNIVRFDMSEYQ
                     EKHSVSKLIGAPPGYVMSESGGQLTEAVRRKPYSVILFDEFEKAHPDVCKILLQVLDE
                     GKLSDSLGHHVDFRNTIIVMTSNIGQDILLTDTTATEDGIVGEKTKNLVIDRMKKQYP
                     PEFINRIDDILVFNRLSKKVLRSIVDIRLKEIQERLSDKRITLNLDGPAKNWLTDYGY
                     DPLYGARPLNRLIHRKILNPMATFLLKGQILNDETVNVTVKDKELKVEPNHKEGDAQK
                     KPDEE"
     gene            complement(<604522..>605304)
                     /gene="TPHA0D02900"
                     /locus_tag="TPHA_0D02900"
                     /db_xref="GeneID:11534137"
     mRNA            complement(<604522..>605304)
                     /gene="TPHA0D02900"
                     /locus_tag="TPHA_0D02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685312.1"
                     /db_xref="GeneID:11534137"
     CDS             complement(604522..605304)
                     /gene="TPHA0D02900"
                     /locus_tag="TPHA_0D02900"
                     /inference="similar to DNA sequence:INSDC:YDR259C,YOR028C"
                     /note="similar to Saccharomyces cerevisiae YAP6 (YDR259C)
                     and CIN5 (YOR028C); ancestral locus Anc_5.619"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685360.1"
                     /db_xref="GeneID:11534137"
                     /db_xref="GOA:G8BSV5"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BSV5"
                     /translation="MNYSYMHLPQQHFVQNEQFGGSDMTKAHYMQNNYRNGNNTSITY
                     KPAATETNMDMPPSIVNAVYNSPSGGSIDGARNGNINSNDIRTSIETASVNIEQKTTN
                     SRNTNEICGLNTPAVRLSQFPKHLTNHNTFEYTYNNVQNGQPTYTNTGYQDCNATTIK
                     LGLPTITASTDSSNTMVLSNYYRGTSSTHIPTQLTSYSLQNKSVKRAIQNRNAQKAFR
                     QRKKKYIQELESKASKYDNLVIENNNLKIQIKELTSLIRSLK"
     gene            <607803..>609539
                     /gene="TPHA0D02910"
                     /locus_tag="TPHA_0D02910"
                     /db_xref="GeneID:11534604"
     mRNA            <607803..>609539
                     /gene="TPHA0D02910"
                     /locus_tag="TPHA_0D02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685313.1"
                     /db_xref="GeneID:11534604"
     CDS             607803..609539
                     /gene="TPHA0D02910"
                     /locus_tag="TPHA_0D02910"
                     /inference="similar to DNA sequence:INSDC:YDR261C"
                     /note="similar to Saccharomyces cerevisiae EXG2 (YDR261C);
                     ancestral locus Anc_5.621"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685361.1"
                     /db_xref="GeneID:11534604"
                     /db_xref="GOA:G8BSV6"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:G8BSV6"
                     /translation="MFSFLSHILFTLYCLSFISVSEASNDGLDLIQLKVINDKLNLLK
                     KKSSNSTTSNIKVGEIRGISLGGWLVTEPYITPSLYHNATEIYTSSNSSYSNLTDPII
                     DEHTFCEKLGYETAGKLLQAHYESFITEDDFRQISEDGFNLVRIPIGYWAWKQNNETN
                     EYIDGVYFEDPYFSNGIQLQYLSKAIGWASKYNLSIWVDLHGAPGSQNGFDNSGKRDL
                     YGTPGWLSVDNSTELTLAIWNDIFETYVINEDQDTTPIIGIEIMNEPLSSKVSIYDIT
                     KAYYEGFGNFERLKESNSNTTYNTTFVIHDAFEGIGHWNLEFNPQYQNVSSQYVNISD
                     LSFKSQDILVDHHHYEVFSDYQLANSQFRRIYDIIEYGESIFDELAYHPALVGEWSGA
                     ITDCATWLNGVGIGARYDGSYYDTTNFTTDSDITGQCTSQLSFEQWSEEYKINVRQFI
                     EAQLATYTSQTTGWIFWNWKTEDAIEWDYLKLKEAGLFPVPLDNYTYFNNDGSIKNSV
                     SRSLSVSAYPKMSSTTTKTTKTTSSTKLKSLATSLTKSTMYVTKLTTTAVSSSTSVLA
                     IMTIIAISLIWL"
     gene            <609950..>610774
                     /gene="TPHA0D02920"
                     /locus_tag="TPHA_0D02920"
                     /db_xref="GeneID:11534142"
     mRNA            <609950..>610774
                     /gene="TPHA0D02920"
                     /locus_tag="TPHA_0D02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685314.1"
                     /db_xref="GeneID:11534142"
     CDS             609950..610774
                     /gene="TPHA0D02920"
                     /locus_tag="TPHA_0D02920"
                     /inference="similar to DNA sequence:INSDC:YDR272W,YOR040W"
                     /note="similar to Saccharomyces cerevisiae GLO2 (YDR272W)
                     and GLO4 (YOR040W); ancestral locus Anc_5.637"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685362.1"
                     /db_xref="GeneID:11534142"
                     /db_xref="GOA:G8BSV7"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR017782"
                     /db_xref="UniProtKB/TrEMBL:G8BSV7"
                     /translation="MLVKFIKMRWATGGVNYSYLLSTADKTKSWLIDPAEPDEVLAAL
                     SDSQKRSVQAIVNTHHHYDHAGGNSKILDSLVRFSGNKIAVIGSSTECQSVTDVTENL
                     RTYTLGSINILSIRTPCHTKDSVCYYVNDSATKEEAVFTGDTLFTAGCGRFFEGTGAE
                     MDTALNKLLISNIGKENLTSTKVYPGHEYTKSNCKFVRSMIYKKEGDNIAFDRLEKFA
                     NSNEVTTGNFTIQDELDFNPFMRLHDPLVRNAVGDTNSTFPEAKVMEILRKLKNSM"
     gene            complement(<610951..>611619)
                     /gene="TPHA0D02930"
                     /locus_tag="TPHA_0D02930"
                     /db_xref="GeneID:11534260"
     mRNA            complement(<610951..>611619)
                     /gene="TPHA0D02930"
                     /locus_tag="TPHA_0D02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685315.1"
                     /db_xref="GeneID:11534260"
     CDS             complement(610951..611619)
                     /gene="TPHA0D02930"
                     /locus_tag="TPHA_0D02930"
                     /inference="similar to DNA sequence:INSDC:YGR095C"
                     /note="similar to Saccharomyces cerevisiae RRP46
                     (YGR095C); ancestral locus Anc_3.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685363.1"
                     /db_xref="GeneID:11534260"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:G8BSV8"
                     /translation="MSIEAVCGVLTHVDGSSQVEWNDTKVLCSVTGPIEPKARQELPS
                     QLALEVIIRPAKGVSSTREKLMEDKLRSVLTPIITLYQYPRQLCQITCQILESGESEY
                     EFSEKELSCCINAAFLALIDAGIALKSTVSSISLVISQNNEVIVNPTGAQLLNSRSVH
                     ILALELIKEMNIVNNVLLLDSNGDFNEKELFQVLETGEKSCLALGQDLRKVIQNNVDS
                     NIIQ"
     gene            <612128..>612775
                     /gene="TPHA0D02940"
                     /locus_tag="TPHA_0D02940"
                     /db_xref="GeneID:11531101"
     mRNA            <612128..>612775
                     /gene="TPHA0D02940"
                     /locus_tag="TPHA_0D02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685316.1"
                     /db_xref="GeneID:11531101"
     CDS             612128..612775
                     /gene="TPHA0D02940"
                     /locus_tag="TPHA_0D02940"
                     /inference="similar to DNA sequence:INSDC:YPR113W"
                     /note="similar to Saccharomyces cerevisiae PIS1 (YPR113W);
                     ancestral locus Anc_3.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685364.1"
                     /db_xref="GeneID:11531101"
                     /db_xref="GOA:G8BSV9"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014387"
                     /db_xref="UniProtKB/TrEMBL:G8BSV9"
                     /translation="MAYSEPRDIFRYIPNKIGYLRVVTALISFITMTNYPLITVFFYG
                     MSCLLDAVDGFLARKYNQCSKFGAVLDMVADRSTTSALICWLSSVYPRQIIIFQVLLA
                     LDLSSHYMHMNASLQSGRESHKSVDENSSKILYFYYSRRDVLFCVCAFNELFYLGLYL
                     MHFHKLLTTIGKYIVILCFPGFAFKQYANMIQLIRASYILAQIDSDDVNQTVADV"
     gene            <613698..>614603
                     /gene="TPHA0D02950"
                     /locus_tag="TPHA_0D02950"
                     /db_xref="GeneID:11534571"
     mRNA            <613698..>614603
                     /gene="TPHA0D02950"
                     /locus_tag="TPHA_0D02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685317.1"
                     /db_xref="GeneID:11534571"
     CDS             613698..614603
                     /gene="TPHA0D02950"
                     /locus_tag="TPHA_0D02950"
                     /inference="similar to DNA sequence:INSDC:YPR114W"
                     /note="similar to Saccharomyces cerevisiae YPR114W;
                     ancestral locus Anc_3.437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685365.1"
                     /db_xref="GeneID:11534571"
                     /db_xref="GOA:G8BSW0"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:G8BSW0"
                     /translation="MDFVVNGVVELPQPGFFNETIIPFLMENNVIQSERIAANLHSIF
                     YISIFYHLWFLFGTQIMFPKIANLLFDKKDETLTDKKKYNALMIQSGIHLVSFVQAII
                     VLYLSLKCMLYDEEYYQVYTDSFSRIFGSIRATEVICVYAIGYFVWDIYISSRYSELP
                     FILHGIISTVVYVIGLKPSIQYYAPVFLMFELSNPSLNIRWFLMKYFPNQKSLLTANN
                     LMLMVIFFFCRIAWGWLQIGKLCYDYYMTMDQPGVNQLDTIIIVGGNLVLDVLNIVWF
                     RSMLLAAIKVLKQKFVNKKENSKRD"
     gene            <616178..>619666
                     /gene="TPHA0D02960"
                     /locus_tag="TPHA_0D02960"
                     /db_xref="GeneID:11534435"
     mRNA            <616178..>619666
                     /gene="TPHA0D02960"
                     /locus_tag="TPHA_0D02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685318.1"
                     /db_xref="GeneID:11534435"
     CDS             616178..619666
                     /gene="TPHA0D02960"
                     /locus_tag="TPHA_0D02960"
                     /inference="similar to DNA sequence:INSDC:YGR097W,YPR115W"
                     /note="similar to Saccharomyces cerevisiae ASK10 (YGR097W)
                     and YPR115W; ancestral locus Anc_3.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685366.1"
                     /db_xref="GeneID:11534435"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="UniProtKB/TrEMBL:G8BSW1"
                     /translation="MSDYFSLDVPKNPDPLLTPSQILDQPLITASDLITSCEENEIHA
                     GQGPTQQDNNDHPQNQYDPNERRSSVPNVRYNPLMYGADSSLPNLSEGGNSYQQHARN
                     SSLPQSTFNYSLNNGSSTLTPQFNADMNLNSTEPSLFKDLATESMSLNTSALIDKMNY
                     TNNAVSKENKDYILPRSHRSSPFYTTVPIPKPVKISENDSVSGSEGYAEDEIYDESNH
                     FVKEYPTVLLADRFYKWGKILKALCFYLKEVAYSQEEFARINTQLKDSVKFKFLTDLD
                     ETTNSFVDPLTTKQLTKKQQPITLAEQKKLKNPNAKAVEYVEVPGSASAATGSSAALI
                     NHDFNSALAASGFMKFGSGSVQDLQIILKKYHLSQASQQYKISKEITTNIIPKLLDLR
                     KDLKIKVRDIKQLHDNFKTNISDHITITSQLLHKYIAACKVVQSPKYNTRVQKIKPKH
                     DPFLLKLQLDLQLKRQLKEENYLREAFINIQTAGLKLRKIVYSKIQDTLQSYSILIGS
                     EAQLMLKNLCQELHTGICSNPPAVEWDQFVACHTKGLMNWSSVDPIPSERQVSDIDYP
                     RRKSPLGKCVKSGYLKFKKDDLKVSDGYFVLTANFLHEFKSSNLYKSGNHSTTTSLQS
                     QKNTKAATPKSSKSSKNKAQTGNLPNAIPTTSKKKTLSPNFSIPLDLCTLVESTDRKL
                     VLRAPSIVPETVEVATHASEKTHILPSDIHLEHGKISGNFAPHISKDKKSGKASGFAK
                     FLRGPTHHKNKSSSSSKTQQQQAKVAAQHAANVSLEPRLWTFTLEEDVPTAQDLKYFR
                     KWVTDIKRLLSFKNVAERAEFIEECSIKNRAGLPHPMLSRSSSTGFVHSNSSSIPDFN
                     DPSKAYINSVTQSSLNIPDSRNASSGHVDNSFLMSPMLDDKGNLISPNRPSSIIQSIQ
                     NASISSRVPQQFQLDSSVLKTKRSTPNFSSVTPNRQPSDDSNGGYFALPLSHQRSISN
                     PTSPPYLERLEKKISGASSISNMNVSSNSSAIIPNFKSINSNSVPVSAESGNEDVNRI
                     PAMKVNDQHVPLHPPNFQRSTSASSLPTSKATGENEPSSTGLYKNSNTSGHSLSAIPS
                     AAATSRVANTRKHKKNVSFSSLSSLKFSKRSSTALGPFYNEQMMHNGIEEHDDDDADH
                     IPHTGKTVKLSQSLYS"
     gene            complement(<619854..>620480)
                     /gene="TPHA0D02970"
                     /locus_tag="TPHA_0D02970"
                     /db_xref="GeneID:11534413"
     mRNA            complement(<619854..>620480)
                     /gene="TPHA0D02970"
                     /locus_tag="TPHA_0D02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685319.1"
                     /db_xref="GeneID:11534413"
     CDS             complement(619854..620480)
                     /gene="TPHA0D02970"
                     /locus_tag="TPHA_0D02970"
                     /note="ancestral locus Anc_3.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685367.1"
                     /db_xref="GeneID:11534413"
                     /db_xref="GOA:G8BSW2"
                     /db_xref="InterPro:IPR002563"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:G8BSW2"
                     /translation="MLKTTHFVRYNSTIHKHVITQDRFKETMRKMATQVMLLSIANPI
                     GSPKSEFRGLVASSVTSLCVLPKPKLEFNLQLPSFTSIALHKYQYFAVHIMSPTKASV
                     DMGRLFSKGAITSKMDGSIQPSQPFMDLEENVTFENYSIENSNLQIPVLKMAEKTLIC
                     KKSDVFKTGDHEIWVGEVEDIIVNEEEEAQGGLLYYDRFFHMLGNKIQ"
     gene            <621078..>623186
                     /gene="TPHA0D02980"
                     /locus_tag="TPHA_0D02980"
                     /db_xref="GeneID:11534570"
     mRNA            <621078..>623186
                     /gene="TPHA0D02980"
                     /locus_tag="TPHA_0D02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685320.1"
                     /db_xref="GeneID:11534570"
     CDS             621078..623186
                     /gene="TPHA0D02980"
                     /locus_tag="TPHA_0D02980"
                     /inference="similar to DNA sequence:INSDC:YGR099W"
                     /note="similar to Saccharomyces cerevisiae TEL2 (YGR099W);
                     ancestral locus Anc_3.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685368.1"
                     /db_xref="GeneID:11534570"
                     /db_xref="InterPro:IPR019337"
                     /db_xref="UniProtKB/TrEMBL:G8BSW3"
                     /translation="MDRNLVNNLGKGANYEKLEAVLTGVLDEKIGLNLEVVMIIITVV
                     CPVYPSLQSSLKSKLLQIISNSYLLFSNMINYSSRLKDSSKNLERQIYLDILIDLLRY
                     HPTLLYNYMQLLKSSKEDLDILKSVFFGSRLFNLLSSSLSIVDYIEILTIHFKCFLDE
                     TSFDEINLYQKTGEMLTSFFSLNPLFTMDIILDKLLLSEDQYWIHFKNIITHSKRNVR
                     RNIIINTLFPYFDIRVIEKNYIEIFEILSQLQVHQSIDYQMLTNLKSTILIEIILKII
                     PEVMVTNFTDKALRRFSDVNVYDDEKTCQILCMLLSYRTTSEQRVKIAESTAFLNGVT
                     KRLTNNELTIRERTMFIAKMVTNGTLEYESSFDIIIPRHDFKNLQVAKTIKLENLKLE
                     TNRLVDQDTEGKLDAISKFNDLNLDTDSDDDEDSYTKKKIVFMKDLLLEFENIDKSKR
                     NDFVSLLKTTVKLVRQKRNFISEVSYYAAKLIVNICTLNNNFEEKDFEAWRINALETI
                     LFVTPESIKDILKLLFTTELSLQQRMSILSSLGLSARELRGYDDEYIVKYETDFFEQK
                     LPWSTNQSPISLQSAEQSTITEINPANNSIMENSQVTWKSKKLLKSNKTSRKNEFRKH
                     ASIFFYPLANQWLNGIDLGTYDKMFKLHYLKTLHIIHECAFPSNDYKDITALYEEVLA
                     DGLKQELPIEDLVISIKDRI"
     gene            <623732..>626620
                     /gene="TPHA0D02990"
                     /locus_tag="TPHA_0D02990"
                     /db_xref="GeneID:11530973"
     mRNA            <623732..>626620
                     /gene="TPHA0D02990"
                     /locus_tag="TPHA_0D02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685321.1"
                     /db_xref="GeneID:11530973"
     CDS             623732..626620
                     /gene="TPHA0D02990"
                     /locus_tag="TPHA_0D02990"
                     /inference="similar to DNA sequence:INSDC:YGR100W"
                     /note="similar to Saccharomyces cerevisiae MDR1 (YGR100W);
                     ancestral locus Anc_3.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685369.1"
                     /db_xref="GeneID:11530973"
                     /db_xref="GOA:G8BSW4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8BSW4"
                     /translation="MSFLGSLRQKATFIDKIAESFLPSLTRDEKFKLEYRLPDEELIV
                     DDINADLSFVGAHSKLREIQNHRTKEQNVGAYVFSGRLYLTKHFLVFRDAFDKKSCVL
                     LLNLSTIKRVERTPSEANNFSLTLTLYTGSEVLIQLMGLKYKSEQFSAQLKLHLKENI
                     ENARKLPQFLNTCYSEFILNKNIMHKTDLIPPKSGLGQQFKYPGNPSMEKEKLKLRLW
                     FDYFKENGENMGIVKNHIFHKLVRVGLPNRIRGEIWELCSGAMYLRYANAGEYQQILE
                     ENQGKTSQATDEIEKDLKRSLPEYKAYQTSEGLNRLRNVLTVYSWKNPDVGYCQAMNI
                     VVAGLLIYMTEEQAFWCLYNLCDVYVPGYYSKTMYGTLLDQKVFEYFVEDKIPVLWEH
                     IQKQDIQLSIVSLPWFLSLFFTSMPLEFSFRIMDIFFLNGSRTLFQVSLAILKVNGDA
                     LLASEEDGTFIAVLKNYFQTLGDSAYPDSDDPKLRSITKFQQLLVTAFKEFNVITSQI
                     ISQQRHKFEKEITLNIETFVKKTQIRQMPKTFYLHSTDLSNIYDIYYQSIETYNISLG
                     KGSSSMNYDVFVQFLGKFCDWCKPCEADNDSRFVEQKNEFLKKLFNYWDTNDSGELTL
                     NNVVAGLDKLKTDDLLIMINNFFNLYDKDGDGELHREEVLALSEGLLFLTEPWRSGRY
                     VDVLTKTAIENEIADRIVEQKAQEEDGDDTIELPNDVEVNEEKYKNEQSERYLKAASN
                     FLQRSIEYARSVDLPSDFNLIELSDDETGGSSESTDAIKKKNLNTLKANAALDPTHPK
                     RLDMATFRMIILADETYELFFSETWRCSTHVNKLIDTDNTRGKALRGMFDGFMADGRK
                     VAKQVRIRVDSVATTRSRGDSILSTDTNATSNTPMAKSLSSSTKEDKFEDIDDFTSEQ
                     QEERDDLLGNSWVEMDIDDTMIEPERKQVLSRPPMSNSISKDLIEFEA"
     gene            <627002..>628042
                     /gene="TPHA0D03000"
                     /locus_tag="TPHA_0D03000"
                     /db_xref="GeneID:11534300"
     mRNA            <627002..>628042
                     /gene="TPHA0D03000"
                     /locus_tag="TPHA_0D03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685322.1"
                     /db_xref="GeneID:11534300"
     CDS             627002..628042
                     /gene="TPHA0D03000"
                     /locus_tag="TPHA_0D03000"
                     /inference="similar to DNA sequence:INSDC:YGR101W"
                     /note="similar to Saccharomyces cerevisiae PCP1 (YGR101W);
                     ancestral locus Anc_3.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685370.1"
                     /db_xref="GeneID:11534300"
                     /db_xref="GOA:G8BSW5"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:G8BSW5"
                     /translation="MVFMLTPIGRASMIRSLASQRLYFTNNLIRSQRNILKSSFWSPN
                     IVLRKHEITKSSIINQLLARRTFSTKATSFAKWNSNENTASRYLRLNRFQQFQHLQGN
                     NNSLGKVTLTAVALMTGIFFLSPYIFEYVPPFTHFKKNPTHLIYTLLGINAVVFMMWQ
                     SPKSWRFLQRYMLLEKSNIYSKWSLIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGV
                     SNFFSLYMNSAIVGSLFSLWYPKIARIAMIGPSLGASGALFGVFGCFAYLFPKAKLLL
                     FFFPIPGGAWVAFLGAVGWNLAGCVLRWGSFDYAAHLGGSAIGVFYGWYISKIARQQR
                     DRRLHQQTGRWF"
     gene            complement(<628197..>628784)
                     /gene="TPHA0D03010"
                     /locus_tag="TPHA_0D03010"
                     /db_xref="GeneID:11534453"
     mRNA            complement(<628197..>628784)
                     /gene="TPHA0D03010"
                     /locus_tag="TPHA_0D03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685323.1"
                     /db_xref="GeneID:11534453"
     CDS             complement(628197..628784)
                     /gene="TPHA0D03010"
                     /locus_tag="TPHA_0D03010"
                     /inference="similar to DNA sequence:INSDC:YGR102C"
                     /note="similar to Saccharomyces cerevisiae YGR102C;
                     ancestral locus Anc_3.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685371.1"
                     /db_xref="GeneID:11534453"
                     /db_xref="GOA:G8BSW6"
                     /db_xref="InterPro:IPR027499"
                     /db_xref="UniProtKB/TrEMBL:G8BSW6"
                     /translation="MFTPMQQQMSLIRLTRIGRFSGSLRYFTRGLSGNSSMPLKQWIG
                     SKFNTLDEVKQFMQQDSASIEEYLNSDSARTTSSNLDISDETIRRLLKLSGLPTESVD
                     ILHIKKRLKYQMSFLNKLQEISYDTDKIDENNSRILPRNSKPLSYEELISKIERATKS
                     EDLGEVSNSWNPTELSALSRNKMYVLRGGLMKDRE"
     gene            <629502..>631268
                     /gene="TPHA0D03020"
                     /locus_tag="TPHA_0D03020"
                     /db_xref="GeneID:11531102"
     mRNA            <629502..>631268
                     /gene="TPHA0D03020"
                     /locus_tag="TPHA_0D03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685324.1"
                     /db_xref="GeneID:11531102"
     CDS             629502..631268
                     /gene="TPHA0D03020"
                     /locus_tag="TPHA_0D03020"
                     /inference="similar to DNA sequence:INSDC:YGR103W"
                     /note="similar to Saccharomyces cerevisiae NOP7 (YGR103W);
                     ancestral locus Anc_3.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685372.1"
                     /db_xref="GeneID:11531102"
                     /db_xref="GOA:G8BSW7"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /db_xref="UniProtKB/TrEMBL:G8BSW7"
                     /translation="MRIKKKNTSGNAKNFISRSQAVSKLQISLADFRRLCIFKGIYPR
                     EPRNKKKANKGSTAPTTFYFQKDIQYLMHEPVLAKFREHKTFSKKLTKALGRGEVGTA
                     KKLEENRSTYKLDHIIKERYPSFPDAIRDIDDALNMLFLFANLPATDQISAKITKDAN
                     VICNQWLAFVARERLVRKVFVSIKGIYYQATVRGEEVRWLVPYKFPENIPTDIDFRIM
                     LTFLEFYSTLLHFVLYKLYTDSGLVYPPKVDLNKSKIMSGLSTYILESQNEDSVLSAV
                     PKSTNNDKAAAIDSATLKSAMKADKENKDDEDDEGEEKDVNNVELDTFEDNNKNKGDE
                     LAQPSQFDSPIATLFSDFVFYVGREVPIDIVEFLILSSGGSVISEAALDQVDAKDLDF
                     SNVTHQIVDRPVLNNKVPGRTYVQPQWIFDCINKKSLVPANLYMPGETLPPHLSPWGD
                     ATGYDPNASEDDAEESESEEEVAEENSGEEADVVDEDGEDDEELAAQKELELEVKGIS
                     FNKAKEAGLEVQKKSKKRKVVDEAEAEKQLKMIMMSNKQRKLYKKMQYSNNKKEEQVE
                     NLKKKKKQIAKTKANLKKLEKK"
     gene            complement(<631430..>632290)
                     /gene="TPHA0D03030"
                     /locus_tag="TPHA_0D03030"
                     /db_xref="GeneID:11531109"
     mRNA            complement(<631430..>632290)
                     /gene="TPHA0D03030"
                     /locus_tag="TPHA_0D03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685325.1"
                     /db_xref="GeneID:11531109"
     CDS             complement(631430..632290)
                     /gene="TPHA0D03030"
                     /locus_tag="TPHA_0D03030"
                     /inference="similar to DNA sequence:INSDC:YGR104C"
                     /note="similar to Saccharomyces cerevisiae SRB5 (YGR104C);
                     ancestral locus Anc_3.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685373.1"
                     /db_xref="GeneID:11531109"
                     /db_xref="GOA:G8BSW8"
                     /db_xref="InterPro:IPR019095"
                     /db_xref="UniProtKB/TrEMBL:G8BSW8"
                     /translation="MVQQLSLFSAIDDPSYDLFISTIKTISGNPPVLFANVNTIWNLN
                     PDNEVQQINKKNQLVEPNRIKLSTNVPLDILADSDSSDSQSRAPRQLDYTLMKHLQTD
                     ALPVIEGELKSLLKNSGINLTSDSDMNVDSDVKQSNNNNQAWSLSMSDIPAAGTSKKV
                     SIQLISESSILFTDSNASSLTAFMNGLGYILDYSYITVGSKFFFPDNLILDAYKIWNF
                     DSDKSTQLTKGGLLLKAYINVSKNTDIERINQAEKSLLLLQKELQGFVEFSIPDRQSM
                     DSRSEAPDII"
     gene            <632708..>632941
                     /gene="TPHA0D03040"
                     /locus_tag="TPHA_0D03040"
                     /db_xref="GeneID:11531047"
     mRNA            <632708..>632941
                     /gene="TPHA0D03040"
                     /locus_tag="TPHA_0D03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685326.1"
                     /db_xref="GeneID:11531047"
     CDS             632708..632941
                     /gene="TPHA0D03040"
                     /locus_tag="TPHA_0D03040"
                     /inference="similar to DNA sequence:INSDC:YGR105W"
                     /note="similar to Saccharomyces cerevisiae VMA21
                     (YGR105W); ancestral locus Anc_3.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685374.1"
                     /db_xref="GeneID:11531047"
                     /db_xref="InterPro:IPR019013"
                     /db_xref="UniProtKB/TrEMBL:G8BSW9"
                     /translation="MAVDVPRSVITKLMFFTAAMVVCPLVTFFTIQQYTSNTLVSGGL
                     AAAMANVVLIGYIIIAFMEDTASDEELTIKKKE"
     gene            complement(<633163..>634131)
                     /gene="TPHA0D03050"
                     /locus_tag="TPHA_0D03050"
                     /db_xref="GeneID:11531097"
     mRNA            complement(<633163..>634131)
                     /gene="TPHA0D03050"
                     /locus_tag="TPHA_0D03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685327.1"
                     /db_xref="GeneID:11531097"
     CDS             complement(633163..634131)
                     /gene="TPHA0D03050"
                     /locus_tag="TPHA_0D03050"
                     /inference="similar to DNA sequence:INSDC:YGR106C"
                     /note="similar to Saccharomyces cerevisiae YGR106C;
                     ancestral locus Anc_3.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685375.1"
                     /db_xref="GeneID:11531097"
                     /db_xref="UniProtKB/TrEMBL:G8BSX0"
                     /translation="MVCFKSLFVLVFLQAALVNCLKTGVLFSNEHGFLKNTKESLLKF
                     TDKQPTVVFKFLDYSISDAFSSYNDKEKNKLKYLTSFFEDQVVGVKTIKKPKKYWNSI
                     KSTLKSNKEIDVKVITFKKLPETPYAIFHKIAIQDKDVIVLKFEDEVYDLSKLNDTLE
                     SVMNRLVEVLGKDIRVILFNYSNDEHKPHVIGKTGAVIGGKEVAFHRNMKFQKLKRDD
                     GEEVEEVEDIKDEEDTEDEVISYDEKVDEENAEDNVILYDEKEDEDNAEDNDILSKIW
                     TEGLLMCLLVSIFLFGLLAVALSWMTSLEISYGAFEKQSNPLKKTN"
     gene            <634811..>636079
                     /gene="TPHA0D03060"
                     /locus_tag="TPHA_0D03060"
                     /db_xref="GeneID:11531107"
     mRNA            <634811..>636079
                     /gene="TPHA0D03060"
                     /locus_tag="TPHA_0D03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685328.1"
                     /db_xref="GeneID:11531107"
     CDS             634811..636079
                     /gene="TPHA0D03060"
                     /locus_tag="TPHA_0D03060"
                     /inference="similar to DNA sequence:INSDC:YPR118W"
                     /note="similar to Saccharomyces cerevisiae YPR118W;
                     ancestral locus Anc_3.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685376.1"
                     /db_xref="GeneID:11531107"
                     /db_xref="GOA:G8BSX1"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR005251"
                     /db_xref="InterPro:IPR011559"
                     /db_xref="InterPro:IPR027363"
                     /db_xref="UniProtKB/TrEMBL:G8BSX1"
                     /translation="MSLQAIRFDRSNPLNVSVTVLDQLLLPYVTKYIPISTIEDGYTA
                     IKSMQVRGAPAIAIVGSLSVLMETQMMRTDLFARTQTYYDLNNWRNIKLRLIERLDWL
                     LESRPTAVNLSNSLMEIGHLLDASDDLTKFNSKLFNYVCDLSDDDLKNNIKLGDNGAK
                     FLLDSLKEENFSGDFAVLTICNTGSLATSGYGTALGVIRSLWKDSLAKGNVDSATETG
                     EPSQKKAKKLVDVKASLKHVYPLETRPYNQGSRLTAYELVQEKIPATLIPDSSIAYRI
                     KTSPYPIKAAFVGADRIVCNGDTANKIGTFQLALICKQFGIKFYVVAPKTTFDSKTKS
                     GEGIVIEERKPNEMKLVTGTAMDFNLETPLLDENKEPITAKVGIAPIDINVWNPSFDI
                     TPHEYIDGIVTENGVFTKDSSGNFIFTEGR"
     gene            <638114..>639496
                     /gene="TPHA0D03070"
                     /locus_tag="TPHA_0D03070"
                     /db_xref="GeneID:11534233"
     mRNA            <638114..>639496
                     /gene="TPHA0D03070"
                     /locus_tag="TPHA_0D03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685329.1"
                     /db_xref="GeneID:11534233"
     CDS             638114..639496
                     /gene="TPHA0D03070"
                     /locus_tag="TPHA_0D03070"
                     /inference="similar to DNA sequence:INSDC:YGR108W,YPR119W"
                     /note="similar to Saccharomyces cerevisiae CLB1 (YGR108W)
                     and CLB2 (YPR119W); ancestral locus Anc_3.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685377.1"
                     /db_xref="GeneID:11534233"
                     /db_xref="GOA:G8BSX2"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G8BSX2"
                     /translation="MLSSLSNIEKNHLQSGNNITKIKKNVLSNVTNNYQKSINKKSDL
                     KEISKLHSSKTLDPLSAKINQKSNDKEVKEDLESKRFIEKTSRLSIHDKENIDPNNEL
                     ETIKKGSDGSHINNYEKKVSTKEGGRTLELKERNTTNPSESFNVSDIQKKRPISTLSE
                     IGDLPKKLKYSDDIDNEKIEWDDLDAEDANDPFMASEYVSDIFDHLRELEMKTLPIKE
                     NLHIQKNIVQNRDILINWLVKIHNKFGLLPETLYLATNLMDRFLAKELVQLDKLQLVG
                     TSCLFIASKYEEVYSPSVAHFAGETDGACSVQEIKEGEKFILKVLEFDLSYPNPMNFL
                     RRISKADDYDIQSRTLAKFLLEISIVDFKFIGIPPSFCAAAAMFISRKMLGKSIWDGN
                     LIHYSGGYTKKQLEPVCNLMMDYLVSPIVHDEFIRKYQSRRYMKASIISVNWALKVKK
                     NKYDIMTLHE"
     gene            complement(<640044..>641420)
                     /gene="TPHA0D03080"
                     /locus_tag="TPHA_0D03080"
                     /db_xref="GeneID:11534231"
     mRNA            complement(<640044..>641420)
                     /gene="TPHA0D03080"
                     /locus_tag="TPHA_0D03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685330.1"
                     /db_xref="GeneID:11534231"
     CDS             complement(640044..641420)
                     /gene="TPHA0D03080"
                     /locus_tag="TPHA_0D03080"
                     /inference="similar to DNA sequence:INSDC:YGR109C,YPR120C"
                     /note="similar to Saccharomyces cerevisiae CLB6 (YGR109C)
                     and CLB5 (YPR120C); ancestral locus Anc_3.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685378.1"
                     /db_xref="GeneID:11534231"
                     /db_xref="GOA:G8BSX3"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G8BSX3"
                     /translation="MSHLTTIDNVPLDMTKTTDSENSKPLHSKSLNRNESIQKNNTSI
                     DANRIALSEVTVNTTQSVASKTSKKVSEKQLELSDDKRQVEKPIFLAKIPRIRRDASD
                     LTYVNLKKRKIYRDNDDTPVQENTTSNIINLDLSKIQEENEMNLTSKNENGRLLTKES
                     ATANINIDTVVPKKWKNLDSSEINDICMVVEYTDDIFEHLYKRELETTTEINYTTDPN
                     YTYQLRESLRTILVDWLVEVHEKFELYPETLFLAINLMDRFLSKNKVTLSKLQLLAIT
                     ALFISAKFEEINLPKLSDYSYITDGAASNDDIKSAEMFMLKSLEFNLGWPNPMNFIRR
                     LSKADGYDFKTRNLAKMILEFAICSNIFINVKPSRISAISMYIARRITNRNQIYWDST
                     FEHYSGGIDPLNDATFKKQCFSLINEMKKENNYDSLRRKFHHPKLFSLYNALQNWCNH
                     YEGKLFPN"
     gene            complement(642000..642071)
                     /gene="TPHA0Dtrna3C"
                     /locus_tag="TPHA_0Dtrna3C"
                     /db_xref="GeneID:11530988"
     tRNA            complement(642000..642071)
                     /gene="TPHA0Dtrna3C"
                     /locus_tag="TPHA_0Dtrna3C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:11530988"
     STS             643475..644616
                     /standard_name="ha2747"
                     /db_xref="UniSTS:515592"
     gene            <644272..>645297
                     /gene="TPHA0D03090"
                     /locus_tag="TPHA_0D03090"
                     /db_xref="GeneID:11534268"
     mRNA            <644272..>645297
                     /gene="TPHA0D03090"
                     /locus_tag="TPHA_0D03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685331.1"
                     /db_xref="GeneID:11534268"
     CDS             644272..645297
                     /gene="TPHA0D03090"
                     /locus_tag="TPHA_0D03090"
                     /inference="similar to DNA sequence:INSDC:YPR127W"
                     /note="similar to Saccharomyces cerevisiae YPR127W;
                     ancestral locus Anc_3.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685379.1"
                     /db_xref="GeneID:11534268"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8BSX4"
                     /translation="MSKVEQLRKDLDALSTGYGLMSLTWKAEPVPKDQAFAAMKQVVD
                     FALEKNVKAFFNVGEFYGPDYIMLKNFFEKYPELRQKVIVSCKGSMDVAKMAPLGKSD
                     DVKKSVEICSSILGGYIDIYEVARIDESIVEEGQDYPYETFEALAEMVDNGFIGGVSL
                     SEVTEKQIRAINKDWHKYLTCVEVELSLFSTQILHNNIAKTCGELGLIIIAYSPLGRG
                     LLTGQITSVKDIPKGDFRLMLKRFHGDAMAQNLVLVQFLRDEIIAKRDPADRITLPQL
                     ALGWIKHNSNRFGYGKIIPIPSGSSVSKVTENFDENKAKITDAEFDKINEFLKGFTTV
                     GDRYELA"
     gene            <645753..>646685
                     /gene="TPHA0D03100"
                     /locus_tag="TPHA_0D03100"
                     /db_xref="GeneID:11531127"
     mRNA            <645753..>646685
                     /gene="TPHA0D03100"
                     /locus_tag="TPHA_0D03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685332.1"
                     /db_xref="GeneID:11531127"
     CDS             645753..646685
                     /gene="TPHA0D03100"
                     /locus_tag="TPHA_0D03100"
                     /inference="similar to DNA sequence:INSDC:YPR129W"
                     /note="similar to Saccharomyces cerevisiae SCD6 (YPR129W);
                     ancestral locus Anc_3.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685380.1"
                     /db_xref="GeneID:11531127"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR019050"
                     /db_xref="InterPro:IPR025609"
                     /db_xref="InterPro:IPR025761"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="InterPro:IPR025768"
                     /db_xref="UniProtKB/TrEMBL:G8BSX5"
                     /translation="MSQYVGKTISLISVTENRYVGLLENIDSERGTVTLNNVRCFGTE
                     GRKNWGPEEIPPNATLYKSVKFNGNDVKDLNILDIKLEDAHPVLPPAGQQGQQQTQQQ
                     VNAAQMPHEPQQPNVPAAMAGYGVYQPAPGSEPIVGSDSTENKESTKESRKSNNQQNT
                     HRPPRNNTHHHKVEIPAEDFDFESNNAVFVKEAPEPNGQEINENTAIQETESKEQFYN
                     KSSSFFDSISTSTETNTNMKWNVEKELNLDTFGQASANRRFNSRGGHNFRGRGRGRGR
                     GNGRGRGNSRGNYNNNYNGNNYNSNSTFNADVEF"
     gene            complement(<646830..>647420)
                     /gene="TPHA0D03110"
                     /locus_tag="TPHA_0D03110"
                     /db_xref="GeneID:11534441"
     mRNA            complement(<646830..>647420)
                     /gene="TPHA0D03110"
                     /locus_tag="TPHA_0D03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685333.1"
                     /db_xref="GeneID:11534441"
     CDS             complement(646830..647420)
                     /gene="TPHA0D03110"
                     /locus_tag="TPHA_0D03110"
                     /inference="similar to DNA sequence:INSDC:YPR131C"
                     /note="similar to Saccharomyces cerevisiae NAT3 (YPR131C);
                     ancestral locus Anc_3.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685381.1"
                     /db_xref="GeneID:11534441"
                     /db_xref="GOA:G8BSX6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BSX6"
                     /translation="MSTLDPFEATDLFNLDNVNLDVLTENFPVEFYFEYLILWPGLFF
                     KTVEQTVDASITTNNISGYMMAKTEGHGNDWHSHITAVTVAPEFRRLFLASILCNTLE
                     KITDVLPHNVNFIDLFVKCDNALAIKLYEKLGYSVFRRVVGYYNTAGDGYPETLKKCN
                     DDKDAFDMRKGMIRDKGKSIRSDGRKHRCFPHDIKF"
     gene            complement(<647745..>649172)
                     /gene="TPHA0D03120"
                     /locus_tag="TPHA_0D03120"
                     /db_xref="GeneID:11534386"
     mRNA            complement(<647745..>649172)
                     /gene="TPHA0D03120"
                     /locus_tag="TPHA_0D03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685334.1"
                     /db_xref="GeneID:11534386"
     CDS             complement(647745..649172)
                     /gene="TPHA0D03120"
                     /locus_tag="TPHA_0D03120"
                     /inference="similar to DNA sequence:INSDC:YGR117C"
                     /note="similar to Saccharomyces cerevisiae YGR117C;
                     ancestral locus Anc_3.466"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685382.1"
                     /db_xref="GeneID:11534386"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BSX7"
                     /translation="MAAIENRTIDDYINLLIAKYLKAKGLDESLGVFAREMSLSRNLI
                     NSFDESNLENLFDIVSDRIQFNEYNVANSLKSLKLNEIVPQFSDKVIPYVPKWDFQDS
                     DFILDCIDSSVDGLTILARFTSNAGELLLSTSQKKVLVAETSDNAIEKIGEFDSNKEQ
                     IGIVKICGYLASGKFYYSCGLDGKLSLYDNSRMHLSSSDWKLHSRIITYLDIIPREDS
                     SSSWHVISCGFDNMLKLSILQRNNEGKYELRILSELKIASPVVTVKTTLIAIKDSFLT
                     PMVFLARSDYTRIVAYSVINDKLALSYEIALNNTQFSTHSFNVRDFEVLNTKTVNGVN
                     NVQTENSMLAICTSHTPYMRMILVKLPIEINEKEGIDQNSLTSTKTKVFYDKILFNMA
                     TEIEQDGYSQPIVKKMPNSNSIIIGTDNGIYASDIQNGETWFLDVPGNDVSKRIKSMD
                     TNNEMSKLVVAYADKSINLYSITGK"
     gene            <650204..>651301
                     /gene="TPHA0D03130"
                     /locus_tag="TPHA_0D03130"
                     /db_xref="GeneID:11534606"
     mRNA            join(<650204..650268,650929..>651301)
                     /gene="TPHA0D03130"
                     /locus_tag="TPHA_0D03130"
                     /product="40S ribosomal protein S23"
                     /transcript_id="XM_003685335.1"
                     /db_xref="GeneID:11534606"
     CDS             join(650204..650268,650929..651301)
                     /gene="TPHA0D03130"
                     /locus_tag="TPHA_0D03130"
                     /inference="similar to DNA sequence:INSDC:YGR118W,YPR132W"
                     /note="similar to Saccharomyces cerevisiae RPS23A
                     (YGR118W) and RPS23B (YPR132W); ancestral locus Anc_3.467"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="XP_003685383.1"
                     /db_xref="GeneID:11534606"
                     /db_xref="GOA:G8BSX8"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BSX8"
                     /translation="MGKGKPRGLNSARKLRIHRRNNRWAENNYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKIGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            complement(<651748..>652860)
                     /gene="TPHA0D03140"
                     /locus_tag="TPHA_0D03140"
                     /db_xref="GeneID:11531015"
     mRNA            complement(<651748..>652860)
                     /gene="TPHA0D03140"
                     /locus_tag="TPHA_0D03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685336.1"
                     /db_xref="GeneID:11531015"
     CDS             complement(651748..652860)
                     /gene="TPHA0D03140"
                     /locus_tag="TPHA_0D03140"
                     /inference="similar to DNA sequence:INSDC:YPR133C"
                     /note="similar to Saccharomyces cerevisiae SPN1 (YPR133C);
                     ancestral locus Anc_3.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685384.1"
                     /db_xref="GeneID:11531015"
                     /db_xref="GOA:G8BSX9"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:G8BSX9"
                     /translation="METVESATYVEQPAVVQNRDGDEDNVRVERKRKHIDVDGSDNDS
                     DVDINKINQMPGSNNVTAGSGNLSNDAELDSATRTRKELEDKLDKLLKKPKVRRSRQD
                     EDDLEQYLDEKILRLKDEMNIAAQMDIETLNKRIETNDKSLIAVQKVKLLPKVVSILS
                     KANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNKLPIKTEHLKESGLG
                     RVVIFYTKSKRVEAPLPRIAEKLIAEWTRPIIGASDNYRDKRILKLEFDAEKLRKKSA
                     LDNAKNRKKQKNGSEEPRSRSEGSSAQSLYEDAAARRGRAAAPAQTTTDYKYAPVSNA
                     GALSSNLRSNGVGSSLNNSETYKRLISRLNKSKKSK"
     gene            <653315..>653467
                     /gene="TPHA0D03150"
                     /locus_tag="TPHA_0D03150"
                     /db_xref="GeneID:11534127"
     mRNA            <653315..>653467
                     /gene="TPHA0D03150"
                     /locus_tag="TPHA_0D03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685337.1"
                     /db_xref="GeneID:11534127"
     CDS             653315..653467
                     /gene="TPHA0D03150"
                     /locus_tag="TPHA_0D03150"
                     /inference="similar to DNA sequence:INSDC:YPR133W-A"
                     /note="similar to Saccharomyces cerevisiae TOM5
                     (YPR133W-A); ancestral locus Anc_3.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685385.1"
                     /db_xref="GeneID:11534127"
                     /db_xref="InterPro:IPR019603"
                     /db_xref="UniProtKB/TrEMBL:G8BSY0"
                     /translation="MFGLPQGEPSEEEKQLHQQQTNATVRNSLCAAALLWVSPMVWNF
                     VKKQWK"
     gene            <653900..>654730
                     /gene="TPHA0D03160"
                     /locus_tag="TPHA_0D03160"
                     /db_xref="GeneID:11534390"
     mRNA            <653900..>654730
                     /gene="TPHA0D03160"
                     /locus_tag="TPHA_0D03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685338.1"
                     /db_xref="GeneID:11534390"
     CDS             653900..654730
                     /gene="TPHA0D03160"
                     /locus_tag="TPHA_0D03160"
                     /inference="similar to DNA sequence:INSDC:YPR134W"
                     /note="similar to Saccharomyces cerevisiae MSS18
                     (YPR134W); ancestral locus Anc_3.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685386.1"
                     /db_xref="GeneID:11534390"
                     /db_xref="UniProtKB/TrEMBL:G8BSY1"
                     /translation="MLKKFIQNNCLVFNYRLRYRKLSSQNELYVMRHVTKRLSEFGKL
                     LYVKPNFKTVESSIGNKPSSIDVVIASSNLESLSRVLFNIKAIQLPNLASVKPISHLN
                     IESADCENKQSLADLTNDNHEYLESVENSLLEEWSKYSFPSGNTTMRNYEASNSICEI
                     TLDNTIYFNSFPSKITKLDLEASNKETDSISFNKYRIDYFINQNRFEKLHDPRLQKDS
                     YQSSLKDSLKLFPYLFKDYETLPGSLKKWMSSIDQEGHGTEMSDREKHSLDILFHGFK
                     "
     gene            <655096..>656355
                     /gene="TPHA0D03170"
                     /locus_tag="TPHA_0D03170"
                     /db_xref="GeneID:11534583"
     mRNA            <655096..>656355
                     /gene="TPHA0D03170"
                     /locus_tag="TPHA_0D03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685339.1"
                     /db_xref="GeneID:11534583"
     CDS             655096..656355
                     /gene="TPHA0D03170"
                     /locus_tag="TPHA_0D03170"
                     /inference="similar to DNA sequence:INSDC:YGR122W"
                     /note="similar to Saccharomyces cerevisiae YGR122W;
                     ancestral locus Anc_3.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685387.1"
                     /db_xref="GeneID:11534583"
                     /db_xref="UniProtKB/TrEMBL:G8BSY2"
                     /translation="MSKRKLNLLKLPLQLEEHNQYSSSLTNEALFSRNNAIREINSVL
                     LHKTHQLSVCDSLIKYASELLTLLSNDEYRNSLSTEVSELVKIELVITVVNAAHVYKE
                     ISIDTMRRAYSSEAKDAFWSTSGVYLTYGLGLLEFLLQEQNQFQIIKIDQEYYELIIS
                     MESEFKVIQQLGIVTLTLSRLRKKMYNDSKDAVLDFQNEDITELSKNSNLYAKLVIGC
                     IDYAKTLRSSKHINKVLVTYLEALAFLLLSMDQFAKDETGIAVGMIEESFEKMSNFIS
                     NTKLHDSVLLKSRKRDKLKSMFQKKQSSTEANSINLDKNSKLSTILQRQLPIMQKEKL
                     SPLLENTIDDFLLPLSTLLYYRYKKTNDTLFFKPIINDHRELLSLFPQGKSPDLAGSK
                     WYFNNNEIQLMTEASKVSPNKVNITYF"
     gene            complement(<656468..>657328)
                     /gene="TPHA0D03180"
                     /locus_tag="TPHA_0D03180"
                     /db_xref="GeneID:11530974"
     mRNA            complement(<656468..>657328)
                     /gene="TPHA0D03180"
                     /locus_tag="TPHA_0D03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685340.1"
                     /db_xref="GeneID:11530974"
     CDS             complement(656468..657328)
                     /gene="TPHA0D03180"
                     /locus_tag="TPHA_0D03180"
                     /inference="similar to DNA sequence:INSDC:YPR139C"
                     /note="similar to Saccharomyces cerevisiae VPS66
                     (YPR139C); ancestral locus Anc_3.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685388.1"
                     /db_xref="GeneID:11530974"
                     /db_xref="UniProtKB/TrEMBL:G8BSY3"
                     /translation="MEKYTDWRDKGTGIAPFLPSAIKEPNLIECILYSVVLLVKVILT
                     SPIIFLYLLTKNKLLLAVLLKVLFSWKDEVAVQGVKRSEVNPQKHYPNINVLYFANIT
                     SILDGILLTLIAQRNKVIFCVPDESTIYILNLVQLIKFIANDSLNVKEYGKEVNNLAD
                     YNDSVIYMLAEGTCSNGKSVLPFNMKQTVLDEIIESNKFDIKVIQLKVNSSLVTPLGI
                     NSTFKYIIKCLSKGINYKCRMNDVSLKPDLDLIRVSLCDGGKYKLISKTLDLNAKRKF
                     IKEYNNYRRK"
     gene            <657904..>659010
                     /gene="TPHA0D03190"
                     /locus_tag="TPHA_0D03190"
                     /db_xref="GeneID:11534451"
     mRNA            <657904..>659010
                     /gene="TPHA0D03190"
                     /locus_tag="TPHA_0D03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685341.1"
                     /db_xref="GeneID:11534451"
     CDS             657904..659010
                     /gene="TPHA0D03190"
                     /locus_tag="TPHA_0D03190"
                     /inference="similar to DNA sequence:INSDC:YPR140W"
                     /note="similar to Saccharomyces cerevisiae TAZ1 (YPR140W);
                     ancestral locus Anc_3.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685389.1"
                     /db_xref="GeneID:11534451"
                     /db_xref="GOA:G8BSY4"
                     /db_xref="InterPro:IPR000872"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:G8BSY4"
                     /translation="MSQSDVLQRGDDFLMQYPRNSKVWKMFSHFTCLFTVGVSKLIIT
                     SLYNVELNHFDRLERAIDKAHDQNRGIMTVMNHMSVIDDPFIWAVFPWKTYRKLDNIR
                     WCLGAHNVCFTNKFISTYFSLGQTLSTERFGAGPFQGSIDATVRLLSPDETLKNMDTL
                     KSHFKMNRPAWVHVYPEGFVLQLQPPFSNSMRYFKWGITRMILESTRQPVIVPIFTTG
                     FENIAPEDTAESPVDRYLPAGYGTKINVTVGKEIDEHVIENYRAEWSALVEKYKNPDS
                     PHDLTDELKWGKEAQELRSRVAATLRENVAKIRHEERGFPQEDKRFKSPQWWKRYTTT
                     EGASDPDVKFIGKNWAIRRLQSCLTGKESKDSNK"
     gene            complement(<659182..>661356)
                     /gene="TPHA0D03200"
                     /locus_tag="TPHA_0D03200"
                     /db_xref="GeneID:11534411"
     mRNA            complement(<659182..>661356)
                     /gene="TPHA0D03200"
                     /locus_tag="TPHA_0D03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685342.1"
                     /db_xref="GeneID:11534411"
     CDS             complement(659182..661356)
                     /gene="TPHA0D03200"
                     /locus_tag="TPHA_0D03200"
                     /inference="similar to DNA sequence:INSDC:YPR141C"
                     /note="similar to Saccharomyces cerevisiae KAR3 (YPR141C);
                     ancestral locus Anc_3.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685390.1"
                     /db_xref="GeneID:11534411"
                     /db_xref="GOA:G8BSY5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8BSY5"
                     /translation="MSNVINDEDSNDHNENNLRSSYKNENQNSNDRKRSIGMTSIEQD
                     SLGNDSVSSSSKQLHRQVENGSNSKLQFGLTKIPSGSINKENQSILESLYQQNDPKLI
                     ELQNKLFGKKSILDSKKDEFEGYKVEFKNIQKKLDELREQKMAQHKELTLKTNELTKL
                     QYEFESKKDYKNREQELKLKQVRAINKANLNRLSSEYISDLDKLRFEKVRKFEDEKEI
                     LSEKLTNLRNDILTQPNVFITNQSIARKEVDKNREIWNNALQQQIITETKAEIDMKNI
                     LESKKNLLELKLKEELSKLTEEVKLSQDKLKKLKENYHVNTEDSNQLKVDIAAKENEV
                     LNTIEKNEQLKRYLENVKAEMIETNQILIKEETMRRVLHNRLQELRGNIRVFCRMRPP
                     LPDIEDPDISNIKIKRFDNNYGTQSMKVTKENGESQIYKFDRIFDQADSNTEVFKEIG
                     QLVQSSLDGHNVCIFAYGQTGSGKTYTMLNDNDGMIPATISHIFDWTESMKEKGWIYD
                     ISCQFIEIYNEGIIDLLRDNSTDGNEAGSPNKHEIRHDKETMTTSVTNINTIALNNKG
                     IVNNVLKKATKLRATAATNSNERSSRSHSVFMIYLKGKNEITGDSSEGILNLVDLAGS
                     ERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSL
                     TGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTKIGTKGN"
     gene            <661820..>662560
                     /gene="TPHA0D03210"
                     /locus_tag="TPHA_0D03210"
                     /db_xref="GeneID:11534296"
     mRNA            <661820..>662560
                     /gene="TPHA0D03210"
                     /locus_tag="TPHA_0D03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685343.1"
                     /db_xref="GeneID:11534296"
     CDS             661820..662560
                     /gene="TPHA0D03210"
                     /locus_tag="TPHA_0D03210"
                     /inference="similar to DNA sequence:INSDC:YPR143W"
                     /note="similar to Saccharomyces cerevisiae RRP15
                     (YPR143W); ancestral locus Anc_3.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685391.1"
                     /db_xref="GeneID:11534296"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="UniProtKB/TrEMBL:G8BSY6"
                     /translation="MSSKHSMSVQSKKRNINIMKRDNQAADVKVSDNVVSNTLEEDQD
                     EVDDDELDLENVSSRSDAEGDDEDDSDVIEKEESDDDFPRKRKSKMSKHDDGSNDFSS
                     AVTAILSSHLKAYDRKDPIMARNKKVLKKNEEDKLEQQARKQLLVEKKKLLSKSRKLD
                     IIPVASEDNSGEEIRKILEKEAKLRKVAQKGVIKLFNAILSTQVKTDKEVNSTLGDIT
                     NRNEKKQLITEVSKEKFLDLVKAAGDDA"
     gene            complement(<662868..>664409)
                     /gene="TPHA0D03220"
                     /locus_tag="TPHA_0D03220"
                     /db_xref="GeneID:11534429"
     mRNA            complement(<662868..>664409)
                     /gene="TPHA0D03220"
                     /locus_tag="TPHA_0D03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685344.1"
                     /db_xref="GeneID:11534429"
     CDS             complement(662868..664409)
                     /gene="TPHA0D03220"
                     /locus_tag="TPHA_0D03220"
                     /inference="similar to DNA sequence:INSDC:YGR123C"
                     /note="similar to Saccharomyces cerevisiae PPT1 (YGR123C);
                     ancestral locus Anc_3.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685392.1"
                     /db_xref="GeneID:11534429"
                     /db_xref="GOA:G8BSY7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011236"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013235"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BSY7"
                     /translation="MSSPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDST
                     QSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKND
                     LNVVLKAKPNDITASNALKVCENFIREERFKNAIGGSGDNAKSNICQTLNLESFNANA
                     DLKTYKGPKLNFKQLTDEKNSPAGVEVENMSQEFISGMVNDIFLKGKTIPKQYAAAII
                     SHVDRIFLSEPTLVELSNENTKEVKISVCGDTHGQFYDVLNIFKKFGKVSKDHIYLFN
                     GDLVDRGSWSCEVALLFYSLKILYPKNIYLNRGNHETDNMNKIYGFEDECKYKYSQRI
                     FDLFSLSFESLPLATLINNDYLVMHGGLPSDEKSTLDDIRNLDRFSQPPREGLFMELL
                     WSDPQAANGLGPSQRGLGFAFGPDITAKYLERNKLRKVFRSHEVRMTGVKYEHDGKLV
                     TVFSAPNYCDSQGNLGGIIHITPDNGVLLQNGNDDENLIVETFTAVEHPDVKPMAYSN
                     GGLGF"
     gene            665817..665890
                     /gene="TPHA0Dtrna7I"
                     /locus_tag="TPHA_0Dtrna7I"
                     /db_xref="GeneID:11534271"
     tRNA            665817..665890
                     /gene="TPHA0Dtrna7I"
                     /locus_tag="TPHA_0Dtrna7I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11534271"
     gene            complement(<666034..>667710)
                     /gene="TPHA0D03230"
                     /locus_tag="TPHA_0D03230"
                     /db_xref="GeneID:11531035"
     mRNA            complement(<666034..>667710)
                     /gene="TPHA0D03230"
                     /locus_tag="TPHA_0D03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685345.1"
                     /db_xref="GeneID:11531035"
     CDS             complement(666034..667710)
                     /gene="TPHA0D03230"
                     /locus_tag="TPHA_0D03230"
                     /inference="similar to DNA sequence:INSDC:YPR144C"
                     /note="similar to Saccharomyces cerevisiae NOC4 (YPR144C);
                     ancestral locus Anc_3.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685393.1"
                     /db_xref="GeneID:11531035"
                     /db_xref="GOA:G8BSY8"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR027193"
                     /db_xref="UniProtKB/TrEMBL:G8BSY8"
                     /translation="MSLTFEEIKRDAKSIISIDDKKNYKLIIPLINNLTIDENDLSSD
                     EFWDENEQRLRFIVVSLFQVFKQLFSREDMTIRSAKTDETKQLRTWCRKLFENFKDKL
                     LVILSSIPFETSIALDSLDVYMQCIELEAIYFSSNVDDPYFPTKTYQKLLVALWDSDF
                     GDEELKNGQSQNATLVEFKDNYYQKFADVQFYFNSEFNKLLTDSNEDERYTSSNSIGK
                     WLTVVNHDVHCDLPNNDDLEVYVANPPKLVEDVSKFKSNFEKNWLYILNGFLSVDQYK
                     TILLILHKRIIPHFHTPTKLMDFLTDSYNVNFGKKEANSGIIPILSLNGLFELMRRFN
                     LEYPNFYSKLYQCLTPDLMHVKYRSRFFRMLELFLSSTHISSHLVASFIKKLARLTLQ
                     APPSAIVTVIPFTYNLLKKHPTCMIMLHNPAFIDDPFGSDEQKAELKRLKLAYNDPYD
                     PEETNPELTNAIGSSLWELLTLVDHYHTNVASLAKIFAQPFRKLNYNMEDFLDWGYDS
                     LLKAEVDRKLKVSPSLEYDTFDDIFANDTSRTEKGDVLGSDSIFIEGVDW"
     gene            <668956..>670113
                     /gene="TPHA0D03240"
                     /locus_tag="TPHA_0D03240"
                     /db_xref="GeneID:11534610"
     mRNA            <668956..>670113
                     /gene="TPHA0D03240"
                     /locus_tag="TPHA_0D03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685346.1"
                     /db_xref="GeneID:11534610"
     CDS             668956..670113
                     /gene="TPHA0D03240"
                     /locus_tag="TPHA_0D03240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685394.1"
                     /db_xref="GeneID:11534610"
                     /db_xref="GOA:G8BSY9"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:G8BSY9"
                     /translation="MDIVTYTLDTVVKRANETADGTYNFYGNATPNLAFNVIMLVLYV
                     VLLITHLILLMYKQYFFSWMMIFSIILQFAGYCARVDSHSNPYSVASYAVQSTFLIVA
                     PVLFMGALYFQLAKLIEIYGHKYCLIRSPKLYSRTFISFDIFSFLIQAAGGGIVGSAA
                     SGSSDTTTGKNVFLAGDILQIVTMTVFIFFIFDFSYKVFYKARKIYQNTHSSALKLSE
                     ISQKMLEPQYRKKYYPIRQDPERFVFKYYVIAFSITVVLVYIRCFYRLVEFIEGQEGA
                     IHNHEGYFIGFDGVLMMTATLLMTVFHPGFVFLGRKYVIPVTPGRYDPEDIEDISNTD
                     EAVEETTSIEPVQKDLEANAVEYNYELPPYENLEDPESFKNYNKDPINYKN"
     gene            <670720..>671379
                     /gene="TPHA0D03250"
                     /locus_tag="TPHA_0D03250"
                     /db_xref="GeneID:11531062"
     mRNA            <670720..>671379
                     /gene="TPHA0D03250"
                     /locus_tag="TPHA_0D03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685347.1"
                     /db_xref="GeneID:11531062"
     CDS             670720..671379
                     /gene="TPHA0D03250"
                     /locus_tag="TPHA_0D03250"
                     /inference="similar to DNA sequence:INSDC:YGR126W"
                     /note="similar to Saccharomyces cerevisiae YGR126W;
                     ancestral locus Anc_3.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685395.1"
                     /db_xref="GeneID:11531062"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ0"
                     /translation="MVTDNYSKSTTDSENFDDVSSFNSDNSYTPQEFIGDTLGKESST
                     KMDDRASHLSHAIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLT
                     NMESRRADIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLV
                     SSELKASKSNNTVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF
                     Y"
     gene            <672002..>672946
                     /gene="TPHA0D03260"
                     /locus_tag="TPHA_0D03260"
                     /db_xref="GeneID:11534399"
     mRNA            <672002..>672946
                     /gene="TPHA0D03260"
                     /locus_tag="TPHA_0D03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685348.1"
                     /db_xref="GeneID:11534399"
     CDS             672002..672946
                     /gene="TPHA0D03260"
                     /locus_tag="TPHA_0D03260"
                     /inference="similar to DNA sequence:INSDC:YGR127W"
                     /note="similar to Saccharomyces cerevisiae YGR127W;
                     ancestral locus Anc_3.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685396.1"
                     /db_xref="GeneID:11534399"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ1"
                     /translation="MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLC
                     PYDLSRNETDPSKFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLD
                     NRKENSFNDWNSYSKFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKD
                     ENGKSSVVISNSEFISNDKERWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSE
                     LTNEYLHSHDDILDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNK
                     ERTTVRYMERVLYECDDDVSKAGIEKPINELNFEYNIL"
     gene            complement(<673063..>674229)
                     /gene="TPHA0D03270"
                     /locus_tag="TPHA_0D03270"
                     /db_xref="GeneID:11534605"
     mRNA            complement(<673063..>674229)
                     /gene="TPHA0D03270"
                     /locus_tag="TPHA_0D03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685349.1"
                     /db_xref="GeneID:11534605"
     CDS             complement(673063..674229)
                     /gene="TPHA0D03270"
                     /locus_tag="TPHA_0D03270"
                     /inference="similar to DNA sequence:INSDC:YPR148C"
                     /note="similar to Saccharomyces cerevisiae YPR148C;
                     ancestral locus Anc_3.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685397.1"
                     /db_xref="GeneID:11534605"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ2"
                     /translation="MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPN
                     TKLSIRARSRYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEG
                     YDYPPNLTESISDWWAEDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTS
                     PKNTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMI
                     VNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTD
                     KEIEKKESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVS
                     NTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLEILS"
     gene            <676013..>676567
                     /gene="TPHA0D03280"
                     /locus_tag="TPHA_0D03280"
                     /db_xref="GeneID:11531132"
     mRNA            <676013..>676567
                     /gene="TPHA0D03280"
                     /locus_tag="TPHA_0D03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685350.1"
                     /db_xref="GeneID:11531132"
     CDS             676013..676567
                     /gene="TPHA0D03280"
                     /locus_tag="TPHA_0D03280"
                     /inference="similar to DNA sequence:INSDC:YGR131W,YPR149W"
                     /note="similar to Saccharomyces cerevisiae YGR131W and
                     NCE102 (YPR149W); ancestral locus Anc_3.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685398.1"
                     /db_xref="GeneID:11531132"
                     /db_xref="GOA:G8BSZ3"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ3"
                     /translation="MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFV
                     PPFALVTDTFYGALANIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQ
                     SYLDSNNITQGSTDRCRKAQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRR
                     RGGAGVGVPGAASPQIGVPNISQV"
     gene            complement(<676982..>677839)
                     /gene="TPHA0D03290"
                     /locus_tag="TPHA_0D03290"
                     /db_xref="GeneID:11530938"
     mRNA            complement(<676982..>677839)
                     /gene="TPHA0D03290"
                     /locus_tag="TPHA_0D03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685351.1"
                     /db_xref="GeneID:11530938"
     CDS             complement(676982..677839)
                     /gene="TPHA0D03290"
                     /locus_tag="TPHA_0D03290"
                     /inference="similar to DNA sequence:INSDC:YGR132C"
                     /note="similar to Saccharomyces cerevisiae PHB1 (YGR132C);
                     ancestral locus Anc_3.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685399.1"
                     /db_xref="GeneID:11530938"
                     /db_xref="GOA:G8BSZ4"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ4"
                     /translation="MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSG
                     VKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQ
                     LPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNE
                     FGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEA
                     ESAEYISKALAKAGDGLLLIRRLEASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTP
                     NSLLLNLGR"
     gene            complement(<678395..>678985)
                     /gene="TPHA0D03300"
                     /locus_tag="TPHA_0D03300"
                     /db_xref="GeneID:11534566"
     mRNA            complement(<678395..>678985)
                     /gene="TPHA0D03300"
                     /locus_tag="TPHA_0D03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685352.1"
                     /db_xref="GeneID:11534566"
     CDS             complement(678395..678985)
                     /gene="TPHA0D03300"
                     /locus_tag="TPHA_0D03300"
                     /inference="similar to DNA sequence:INSDC:YPR151C"
                     /note="similar to Saccharomyces cerevisiae SUE1 (YPR151C);
                     ancestral locus Anc_3.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685400.1"
                     /db_xref="GeneID:11534566"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ5"
                     /translation="MKQRLYMMNSKMFFSSTNKSLWKRKSMSSSRAVDSSHSVTGHNS
                     ATFNSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLS
                     TQETQEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWS
                     TSIMGMEYYPEWNNVPRRFLKTLKPFEVNEPLRKKK"
     gene            complement(<680299..>682140)
                     /gene="TPHA0D03310"
                     /locus_tag="TPHA_0D03310"
                     /db_xref="GeneID:11531088"
     mRNA            complement(<680299..>682140)
                     /gene="TPHA0D03310"
                     /locus_tag="TPHA_0D03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685353.1"
                     /db_xref="GeneID:11531088"
     CDS             complement(680299..682140)
                     /gene="TPHA0D03310"
                     /locus_tag="TPHA_0D03310"
                     /inference="similar to DNA sequence:INSDC:YGR138C,YPR156C"
                     /note="similar to Saccharomyces cerevisiae TPO2 (YGR138C)
                     and TPO3 (YPR156C); ancestral locus Anc_3.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685401.1"
                     /db_xref="GeneID:11531088"
                     /db_xref="GOA:G8BSZ6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ6"
                     /translation="MSNEYEDIESFDSTESSTGVGNEEQPQQYVPSGDNGGAALNLSR
                     TETVKSLQDMGLTSDAPIPDVNAPTSNKHSIFPEEYTMETPTGLVPVATLHSLGRNST
                     TITRTRTKQMDRSQTHDSSSNSDSDLKEAEKTGTSGDEPELDPEIEFVTFVTGDPANP
                     HNWSLKLRWLYTITLSILVICVAYGSACIAGGLGTVQKHLHVGSEVAVLSVSLMVLGF
                     SFGPLIWSPVSDIYGRRVAYFVSMFLYVIFNIPCAVAKNPQTLMICRFFCGVWASSGL
                     CLVGGSIADMFPNDTRGRAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLIFWVNMAF
                     AGVMWIIVALIPETYAPVILKRKAAKLRKETGNPKIMTEQEAQGLSLNEMLKACCVRP
                     LYFAVTEPVLDLTCFYVMLIYSLLYGFFFAFPVIFGELYDYKDNLTGLMFIPILIGAS
                     LALCTTFYCENKYLAITRRRKPNPEDRLLGAMIGAPFAAISLWMLGATATKKVIWVAP
                     ASSGLPFGYGMVLIYYSLNNYIIDCYAQYASSALATKVFLRSAGGAAFPLFTTQMYHN
                     LGLHWASWLLAFIASGMVLIPYLFYTFGKGLRARLSKKDYSLDGVEE"
     gene            <686270..>688984
                     /gene="TPHA0D03320"
                     /locus_tag="TPHA_0D03320"
                     /db_xref="GeneID:11534443"
     mRNA            <686270..>688984
                     /gene="TPHA0D03320"
                     /locus_tag="TPHA_0D03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685354.1"
                     /db_xref="GeneID:11534443"
     CDS             686270..688984
                     /gene="TPHA0D03320"
                     /locus_tag="TPHA_0D03320"
                     /inference="similar to DNA sequence:INSDC:YGR140W"
                     /note="similar to Saccharomyces cerevisiae CBF2 (YGR140W);
                     ancestral locus Anc_3.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685402.1"
                     /db_xref="GeneID:11534443"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ7"
                     /translation="MGSAPNTHNAKAQQLFDALTERTKHQYKSYYGRYIKWCEENKLI
                     SKSLNENEIFEKLPLSSMLFHCFLLDLYISKDSNDNNDKITTTNDDKENLIAENIGVK
                     LSTLKKIISSLKFLVRVCTVYNNENVSKVDDKYLENITKLHSSWYDFIENINNTINLT
                     NTYPPLLRVSMNMWNPQTINLNEKVFKTTSEKLKFLIDFHFTNYLNLSYSERAELKLS
                     DLTTNNEKNIIEINKPNDPSQMNPMVLLPQDCPFLCPLTSLAASLFLRFYGIKNVYKG
                     DGFPDVSKISKPSQSDYDKEAKLSANVVHWQDLPLIRGKSPLDYPKDVTMSSYYNMIF
                     RYCHLPYKRREYFQDRQEVFPKWNKQEFEEESHQYESIAKQFFKYNVPHDFITILNHK
                     SPYNSFESLSKNFTNEEQLPSHLLVQLFPEIGYFKNSADNLNKEALEFIKVIEALRNT
                     LLKNLPYLYHFFPHHDLFNDTILTSPEFQKYFKEVIGKVQISNGVKLPFELLPGYDNF
                     TENDLYNILVEPPFRTSNNSSGQLVTLAATSDINQNGTVPDNGKKLIDGLQTIFNNIN
                     IDEESKKLAIKQLKSLGKSISIETEPVQKSIHYVKNENHATNGDNIIGDVKKAPSIGL
                     LDLDSSSDEESGNNFSNNDRNFGNKKVNPKINYDEREDESDDGDDNLQEEMRFMINEL
                     VGEKLRSTMKENMDRFEEKVEKMITTMVERKVNDIVKEQLDAFKEEFMKYQKKRPIGD
                     VEKDNSHNISTDKIEEPEVKKTTLNKKMTRYESITDEKNNKTIFKINPSITSIEDIIY
                     EWFTPNPSMDNECIHSMNKKFGKNWRTEFESVYKQKKIIIELYIYLVNQVGYENIKAV
                     HMIETLSEQVYNKDTSTYSRYEILAQYLKSWKRKHNNSFEGLKLLPIV"
     gene            <689484..>690371
                     /gene="TPHA0D03330"
                     /locus_tag="TPHA_0D03330"
                     /db_xref="GeneID:11534448"
     mRNA            <689484..>690371
                     /gene="TPHA0D03330"
                     /locus_tag="TPHA_0D03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685355.1"
                     /db_xref="GeneID:11534448"
     CDS             689484..690371
                     /gene="TPHA0D03330"
                     /locus_tag="TPHA_0D03330"
                     /inference="similar to DNA sequence:INSDC:YGR142W,YPR158W"
                     /note="similar to Saccharomyces cerevisiae BTN2 (YGR142W)
                     and YPR158W; ancestral locus Anc_3.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685403.1"
                     /db_xref="GeneID:11534448"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ8"
                     /translation="MFSSSLQFKFDPLSHNDMLFNFHKDGEPRQFKRRKTSMNHQHCN
                     SSSKENAKRKHKTKKIEIMKELHSKNDEHYVINLKKRIANKSVTEYVNQQIQLYKETH
                     YRPTYYIETDRFGNQYYIEDSMTSSTQRKLECDALDNLDMTRIGKEIAERSFNDYIIE
                     KGSRSNEIVLRSRKDLIDEEYSFDNDIDTFEVLGFDLEVNYKENERIAYEAVMIVELN
                     LMHTTNANSKNKNKTKHRHRRHHHHHLTNSNTKKSEIRNNSLIKYRPILEDIEDAEIQ
                     SFNESMNCNPQPSYIIEEV"
     gene            <691967..>694204
                     /gene="TPHA0D03340"
                     /locus_tag="TPHA_0D03340"
                     /db_xref="GeneID:11531096"
     mRNA            <691967..>694204
                     /gene="TPHA0D03340"
                     /locus_tag="TPHA_0D03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685356.1"
                     /db_xref="GeneID:11531096"
     CDS             691967..694204
                     /gene="TPHA0D03340"
                     /locus_tag="TPHA_0D03340"
                     /inference="similar to DNA sequence:INSDC:YGR143W,YPR159W"
                     /note="similar to Saccharomyces cerevisiae SKN1 (YGR143W)
                     and KRE6 (YPR159W); ancestral locus Anc_3.508"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685404.1"
                     /db_xref="GeneID:11531096"
                     /db_xref="InterPro:IPR005629"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8BSZ9"
                     /translation="MGFIRNLTNKNEAGLSKENSSGESVNQIKMNNRGKTDSDDVQNS
                     NSQSYTSSSANERLAYEKHDITYSQPNAISVEDVHTSDDSNSALPDYIISTPKAQTYE
                     LRGDYQGYYSNKTNLNSNSTPNAYNDNSLPPPISNSNSYSNLIMSPPSFDRYPIIASN
                     ISQLHNSFINHDTKIASAINNKNNLYESSHLHTNSSSSIGIKQQNSNVSLSQALQYSN
                     DLSPFGGFPTSAFPIFLEDKEDDDFFHNPDPEEEAKLDRKRIWMDIKHMNRRSMGGWL
                     GLFLLLAAGIFIFIVLPALTFAGVVDHHDPLSSGSAGGNRSDAVTYLSDYDYPTLAAI
                     RTTLVDPDTPSSASTRVARDGSKWKLVFSDEFNAVGRTFYDGDDQFWTAPDIHYDATK
                     DLEWYTPDAVTTANGTLSLRMDAYRNHDLYYRSGMVQSWNKMCFTEGALEISAKLPNY
                     GKVTGLWPGLWTMGNLARPGYLASTEGVWPYSYQACDAGITPNQSSNDGISYLPGQKL
                     NSCTCDGEDHPNQGTGRGAPEIDLLEGEVDTVIGVGLASQSLQVAPYDIWYIPDYNFI
                     EIHNFTTTTMNSYCGGPFQQAVSAVTTLNTSWYEFGPEAGYYQKFAIEYLNDKDAGYI
                     KWFVGDNPTMTLHSWALHPNGNIDWRPISKEPMSIIMNMGISNNWAYIDWQAIYFPVT
                     FRIDYVRLYQPSDSISLTCDPDDYPTYDYIQEHLNAYSNANLTSWAGAGYSFPSNSLT
                     GNCNA"
     gene            696295..696365
                     /gene="TPHA0Dtrna6G"
                     /locus_tag="TPHA_0Dtrna6G"
                     /db_xref="GeneID:11534438"
     tRNA            696295..696365
                     /gene="TPHA0Dtrna6G"
                     /locus_tag="TPHA_0Dtrna6G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11534438"
     gene            <696649..>699819
                     /gene="TPHA0D03350"
                     /locus_tag="TPHA_0D03350"
                     /db_xref="GeneID:11530999"
     mRNA            <696649..>699819
                     /gene="TPHA0D03350"
                     /locus_tag="TPHA_0D03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685357.1"
                     /db_xref="GeneID:11530999"
     CDS             696649..699819
                     /gene="TPHA0D03350"
                     /locus_tag="TPHA_0D03350"
                     /inference="similar to DNA sequence:INSDC:YGL201C"
                     /note="similar to Saccharomyces cerevisiae MCM6 (YGL201C);
                     ancestral locus Anc_3.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685405.1"
                     /db_xref="GeneID:11530999"
                     /db_xref="GOA:G8BT00"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8BT00"
                     /translation="MSSPFKNTPVGNDRPSSSSPPPSSLGTGFGSSMAVNNDSQSIID
                     PQFPSSSQPMGNMSGIGMDSTQFSSQRQYNAESPLPDDLPIQGMRRKNINHIKKVDDV
                     TGEKVREAFEQFLEDFSITNDEGEVDKVYLTQIEFMKIYYLNTIYIDYQHLSSRENGA
                     LAMAISEQYYRFLPFLQKGLRRIIRKYANSLLVDTESHHIDEIEGESQEDRTIRLSSV
                     TNTDGASAESHKTKISGDSVTTGSLRQVDRIFQISFFNLPIVNRIRDIKSEKIGHLLS
                     ISGTVTRTSEVRPELYKGSFTCDVCRAIVDNVDQAFKYTEPTFCPNPSCENRSTWTLN
                     VSRSKFLDWQKVRVQENANEIPTGSMPRTLDIILRGDCVERAKPGDRCKFTGTEIVVP
                     DVTQLGLPGVKASSSLDSRGVSRSSEGLNTGVTGIRGLGVRDLTYKISFWSCHVVSIG
                     SNVNSQDPAGQQKSENLINYMSSANVYEESSGVQSVFLNSLNSDEINELKNMVKDEHI
                     YDKLVRSIAPAVFGHESVKKGVLLQLLGGVHKSTVEGIKLRGDINICIVGDPSTSKSQ
                     FLKYVTSFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEF
                     DKMDLSDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPINGRYNRKLSLRGNL
                     NMTAPIMSRFDLFFVILDDCNEKIDTELATHIVDLHMKRDAAIDPPYTADQLRRYIKY
                     ARTFKPILTKEARDFLVSKYKELRNDDAQGYSRSSYRITVRQLESMIRLSEAIARANC
                     IDEITPAFVAEAFDLLKQSIIRVDVDDIEIDDDDIEEAGKTENNNNQDGGDSNNDNNS
                     REASADDKQDGDNDDDDKTNGDDPNNRGSRSAIDNGGSGSTTTTRKKISITYDKYIST
                     MNLIVRKIAEIEKADTNENVEGNQNFGSNINEQLTGNSIVDWYLSQRQDEFSDEQEYW
                     EERKLTFKIMKRLVKDRILMEIHGTSTNLNDVMDIDSINAVNNSNVDREKVVYVIHPN
                     CEILDILDPQDVINDNELIQNDTKTV"
     gene            <701891..>704587
                     /gene="TPHA0D03360"
                     /locus_tag="TPHA_0D03360"
                     /db_xref="GeneID:11531041"
     mRNA            <701891..>704587
                     /gene="TPHA0D03360"
                     /locus_tag="TPHA_0D03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685358.1"
                     /db_xref="GeneID:11531041"
     CDS             701891..704587
                     /gene="TPHA0D03360"
                     /locus_tag="TPHA_0D03360"
                     /inference="similar to DNA sequence:INSDC:YPR160W"
                     /note="similar to Saccharomyces cerevisiae GPH1 (YPR160W);
                     ancestral locus Anc_3.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685406.1"
                     /db_xref="GeneID:11531041"
                     /db_xref="GOA:G8BT01"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="InterPro:IPR011833"
                     /db_xref="UniProtKB/TrEMBL:G8BT01"
                     /translation="MSTGTNASNKAEQNVQQNIPQLKRRLTGFLPQEIKAIDSIIPLQ
                     SRSLWTKNKAKKIGSEEDFDEKFVNHVETTLARSLYNCDDMAAYEATSLSIRDNLVID
                     WNKTQQKFTARDPKRVYYLSLEFLMGRALDNALINMESPEGSTDKHANSRDMVSDSLQ
                     NLGFKLEDVLKQEPDAALGNGGLGRLAACFIDSLTTQNIPAWGYGLRYEYGIFAQKII
                     DGYQVETPDYWLNTGNRWEIERNEIQFPVTFYGYVDRQDGNRSTTEPSQWIGGERVIA
                     MAYDFPVPGYKTTTVNNLRLWKAIPTTEFDFAKFNSGDYKNSVAEQQKAESITACLYP
                     NDNFEAGKELRLKQQYFWCAASLHDILRRFKKTQRKWSEFPDQVAIQLNDTHPSLAIL
                     ELQRVLVDLEGLKWDEAWDIVTKTFAYTNHTVMQEALEKWPVSLFGKLLPRHLEILYD
                     VNWFFLQMVAKKYPNNAEILSSVSIIEEVNPERQVRMAFLAIVGSHKVNGVAELHSEL
                     IKTTIFKDFVDIFGASKFTNVTNGITPRRWLKQANPKLAQLIKDTLNDPDENYLLDMT
                     KLTKLADYVDDKDFRNKWNDVKLQNKNTLADLMKKFNDGKDVVDREKLDDTLFDIQVK
                     RIHEYKRQQMNIFGVIARYLDIKELLSEGKSIEEIEKVYPRKVSIFGGKSAPGYYMAK
                     LIIKLINSVADVINNDESINGILKVFFIPDYNVSKAEIIIPASDISEHISTAGTEASG
                     TSNMKFSMNGGLIIGTVDGANVEITREIGEDNIFLFGNLSEKVEDLRAAHRYKSDDFP
                     ESLDRVLSALESGIFSPDNSNEFKPLWDSIRYHGDYYLVSDDFESYLATQKLIDETYH
                     YQREDWVKKSILSVANIGYFNSDRCIEDYAETIWNVEPVVPE"
     gene            complement(<704980..>706473)
                     /gene="TPHA0D03370"
                     /locus_tag="TPHA_0D03370"
                     /db_xref="GeneID:11531013"
     mRNA            complement(<704980..>706473)
                     /gene="TPHA0D03370"
                     /locus_tag="TPHA_0D03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685359.1"
                     /db_xref="GeneID:11531013"
     CDS             complement(704980..706473)
                     /gene="TPHA0D03370"
                     /locus_tag="TPHA_0D03370"
                     /inference="similar to DNA sequence:INSDC:YGL202W"
                     /note="similar to Saccharomyces cerevisiae ARO8 (YGL202W);
                     ancestral locus Anc_3.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685407.1"
                     /db_xref="GeneID:11531013"
                     /db_xref="GOA:G8BT02"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8BT02"
                     /translation="MTLTESKDFSHLFSEETKARKPSPLKTCIHLFNDPNIVFLGGGL
                     PLSDYFPWDNIHSQSPLPPFKNGIGSKITGLKDDTLEYVVSRDEKVEKADIPFKKSLQ
                     YGATQGQPEILEFLREHNKLVHEFNYSDWDSILTTGNTNGWESTLRIFCNKGDVILAE
                     AHSFSSSLASAEAQGVITFPVPIDSDGIIPEKLESILDNWTPGSPKPKLLYTIPTGQN
                     PTGSSLSDERKEAIYKIACKHDFIIIEDEPYYFLQTGPYLKDLEQRKKYEDQQEQQNH
                     EQFLKSLAKTFLSLDTEGRVIRMDSFSKVLAPGARLGWLTGSKKILQYYVSLHEMTVQ
                     GASGFSQSIINGLLQRWGQDGYIDWLKGLRSEYVIKRNNAIDYLHEFLPASGPFTINP
                     PIAGMFFTVTIDATAHPDFKTKFNSNPKAVEQHIYETIVKNGVLLVPGCWFITEGETT
                     PPQPADSKQIQNPNEIFFRGTYAAVAAEKLREGLKRFSECLKEEFGF"
     gene            707703..707774
                     /gene="TPHA0Dtrna3H"
                     /locus_tag="TPHA_0Dtrna3H"
                     /db_xref="GeneID:11531105"
     tRNA            707703..707774
                     /gene="TPHA0Dtrna3H"
                     /locus_tag="TPHA_0Dtrna3H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:11531105"
     gene            <709300..>714243
                     /gene="TPHA0D03380"
                     /locus_tag="TPHA_0D03380"
                     /db_xref="GeneID:11534257"
     mRNA            <709300..>714243
                     /gene="TPHA0D03380"
                     /locus_tag="TPHA_0D03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685360.1"
                     /db_xref="GeneID:11534257"
     CDS             709300..714243
                     /gene="TPHA0D03380"
                     /locus_tag="TPHA_0D03380"
                     /inference="similar to DNA sequence:INSDC:YGL206C"
                     /note="similar to Saccharomyces cerevisiae CHC1 (YGL206C);
                     ancestral locus Anc_3.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685408.1"
                     /db_xref="GeneID:11534257"
                     /db_xref="GOA:G8BT03"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="UniProtKB/TrEMBL:G8BT03"
                     /translation="MSDLPIEFTELVDLTSLGISPQSLEFRSTTFESDHYVTVRESQD
                     GNNSVAIVDLSNGNLVTRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLKTKSKLKSF
                     TLDEPVLFWKWLNEETLGFITARSILTSNVFDGNVNAAPTVLTQRHQTLNNTQIINIV
                     SNKKMDWFAVVGILQDNGHIAGKIQLFSKQRNISQAIDGHVAMFSDITLEGNSTPVQV
                     FVTGNRNASSGTGELRIIEIDHDANLPVQYQKKNVEVFFPPDATNDFPISVQVSEKYG
                     IIYLLTKYGFIHLYELETGTNLFVNRITAESVFTATSYDNKNGIACINKKGQVLAVEI
                     STSQIVPYVINKLSNVSLALTMAKRGGLPGADDLIQKQFDTLLAQSDYQGAAKVAASS
                     QQLRNSNTINRLKTAQAEPGAISPLLLYFSILLDTSKLNKEETIELARPVLQQDRKQL
                     FEKWLKEDKLECSEELGDIVKPFDTTLALACYLRAECHPKVVASLAELQQFEKILPYC
                     QKVNYQANFLVLLSTVMRSSPDRASEFATSLIQNPETAAQLDIEKIADMFFSQNHIQQ
                     GTSLLLDALKSDTPDQGHLQTRVLEVNLLHAPQVADAILGNNIFSHYDKPVIASLAEK
                     AGLYQRALENYVDIRDIKRCIIHTNVLPVDWLVSYFGKLNVEQSMACLKALMDNDIKQ
                     NIQIVVQVATKYSELIGSTILIKLFEEYGATEGLYYYLASSVNLTEDKDLVYKYIEAA
                     AKTKQYTEIERVVKDNNVYDPERVKNFLKDINLEDQLPLITVCDRFNFVNELVIYLYN
                     QQNTKFIETYVQQVNPTKTPQVVGALLDVDCDENFIKSLLQSVFGQVPIKELTEEVEK
                     RNRLKLLLPYLEQCLTQGIQEQVIYNALAKIYIDSNNGPEKFLKENDQYDTLDVGRYC
                     EKRDPFLAYIAYDKGNNDQDLIRITNDNSMYKYQARYLLKRSDSELWNSVLSSENVHR
                     QQLIEAVNSVGIPELTDPQPVSVAVQAFMQNDLKLELIELLEKIVLEESAFSDNVALQ
                     GLLLLSAIKYEPNKVRRYIEKLENYDADEIASLCIEHDLKEEAFEIYDKHEMYSKALK
                     VIVEDIISLDRAQEYVEKINSKELWSQLGASQLAGLRVPEAIESYIKAEDSSNFEAVI
                     DTAAEAGNYEQLIPYLIMARKTLKESKIDGSLILAYAALDKINEVENIVSNSNAANLE
                     SVGDKLLASKSYKAAKLCFASISNYSKLASTLVFLGDYQNAVDTARKASNIKVWKQVN
                     DVCIDKKEFRLAQICGLNLIIHAEELNELVHKYESNGYFEELISLFEAGLGLESAHMG
                     MFTELAILYSKYEPAKTFENLKLVWSRINIPKVIRAVEEAHLWNEAVFLYAHYDEWDN
                     ATLTMIEKSTKSFDHDYFKEIVVKVSNLEIYYKAINFYVKEHPMLLIDLLTVLTPRLD
                     IPRTVKIFTKSDNLPLIKPFLINVLPKNNSVVSEAYHDLMIEEEDYKALTIAVDSYDK
                     FDQLGLASRLEQHDLIFFKKIAALLYRRNKKWAKSLTIFKQEKLWKDAIETAAISQDQ
                     KVVEDLLNYFVEIDNKEALVALLYTAYSLVKFDFVLELAWINSLENYIKPFEISIKKE
                     QATMIEKLSKELKSKGNVSNDDNNSDQPLMLTNGMGY"
     gene            complement(<714580..>715596)
                     /gene="TPHA0D03400"
                     /locus_tag="TPHA_0D03400"
                     /db_xref="GeneID:11534282"
     mRNA            complement(<714580..>715596)
                     /gene="TPHA0D03400"
                     /locus_tag="TPHA_0D03400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685361.1"
                     /db_xref="GeneID:11534282"
     CDS             complement(714580..715596)
                     /gene="TPHA0D03400"
                     /locus_tag="TPHA_0D03400"
                     /inference="similar to DNA sequence:INSDC:YER028C,YGL209W"
                     /note="similar to Saccharomyces cerevisiae MIG3 (YER028C)
                     and MIG2 (YGL209W); ancestral locus Anc_3.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685409.1"
                     /db_xref="GeneID:11534282"
                     /db_xref="GOA:G8BT04"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BT04"
                     /translation="MGFESVTEVDRPFICDICSKGFRRLEHKKRHIRTHTGEKPHHCT
                     FKGCVKKFSRSDELKRHLKIHVNKKKNRASKNRIMKRNILTPDGSFISLNDYHNNFIT
                     NIDKNTLLKIKESHAYNSASSSTSSASSTAGSPSPSLSSWNSSKHNEDDDKLKIPKKD
                     FKKIKSMTDLQKSNNNNNNNLSLPISPNASRTSLDNGSTPHSSYTNLPSSSSSLASIS
                     YNEKNGNFSFDNSLAIKNKSELNGFMRPNYSGFICSVTNHSNQNHSSRLSLIGLSKIP
                     HNKKVEFHLADQENDSEDNEPIRNNNGLESTAHTIGSNKVSLPSINTIFAQIEVFNEL
                     KQNV"
     gene            complement(<718159..>718698)
                     /gene="TPHA0D03410"
                     /locus_tag="TPHA_0D03410"
                     /db_xref="GeneID:11534550"
     mRNA            complement(<718159..>718698)
                     /gene="TPHA0D03410"
                     /locus_tag="TPHA_0D03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685362.1"
                     /db_xref="GeneID:11534550"
     CDS             complement(718159..718698)
                     /gene="TPHA0D03410"
                     /locus_tag="TPHA_0D03410"
                     /inference="similar to DNA sequence:INSDC:YER029C"
                     /note="similar to Saccharomyces cerevisiae SMB1 (YER029C);
                     ancestral locus Anc_3.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685410.1"
                     /db_xref="GeneID:11534550"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8BT05"
                     /translation="MSSTYGKVSVKQNSKLRNLINYRIRVVTKDGKLYLGELMAFDKH
                     MNVVLGDCVEERISKQQLQKIIQNRGKQDTSKENNVIKTEKRVLGLVILRGEQILSTV
                     VEDKPVLTKKDRIEETKKQKKQLNNQKRARKGKTDDSKGKIVKPTSSNGEKSTYNANN
                     TVIPGNLRKFQPPPGFKRK"
     gene            <719070..>719525
                     /gene="TPHA0D03420"
                     /locus_tag="TPHA_0D03420"
                     /db_xref="GeneID:11531126"
     mRNA            <719070..>719525
                     /gene="TPHA0D03420"
                     /locus_tag="TPHA_0D03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685363.1"
                     /db_xref="GeneID:11531126"
     CDS             719070..719525
                     /gene="TPHA0D03420"
                     /locus_tag="TPHA_0D03420"
                     /inference="similar to DNA sequence:INSDC:YER030W"
                     /note="similar to Saccharomyces cerevisiae CHZ1 (YER030W);
                     ancestral locus Anc_3.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685411.1"
                     /db_xref="GeneID:11531126"
                     /db_xref="InterPro:IPR019098"
                     /db_xref="UniProtKB/TrEMBL:G8BT06"
                     /translation="MAEEKRKLENESEVVGDAKTVSEKATEPVDTNSTKTKQKRRRRN
                     YDDYDAEVNKDEEKSKEESKTDDFKGEGDEDEISDERLDAMITLEDEFEDDLAEIDTS
                     NIITTGRRTRGKIIDYKKTAEKLDASTGKSAALDNENDEDEDEDVDFKE"
     gene            complement(<719751..>720422)
                     /gene="TPHA0D03430"
                     /locus_tag="TPHA_0D03430"
                     /db_xref="GeneID:11530957"
     mRNA            complement(<719751..>720422)
                     /gene="TPHA0D03430"
                     /locus_tag="TPHA_0D03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685364.1"
                     /db_xref="GeneID:11530957"
     CDS             complement(719751..720422)
                     /gene="TPHA0D03430"
                     /locus_tag="TPHA_0D03430"
                     /inference="similar to DNA sequence:INSDC:YER031C,YGL210W"
                     /note="similar to Saccharomyces cerevisiae YPT31 (YER031C)
                     and YPT32 (YGL210W); ancestral locus Anc_3.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685412.1"
                     /db_xref="GeneID:11530957"
                     /db_xref="GOA:G8BT07"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BT07"
                     /translation="MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNDFNLESKS
                     TIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKQSSYE
                     NCNHWLTELRENADDNVAVGLIGNKSDLSHLRAVPTEEAKNFAQENQLLFTETSALNS
                     ENVDQAFRELITSIYQMISKHQVDLGSDNNGSGNGASNNIKGPTISLTPTPNEKTKSS
                     SNNCC"
     gene            <720865..>721443
                     /gene="TPHA0D03440"
                     /locus_tag="TPHA_0D03440"
                     /db_xref="GeneID:11530937"
     mRNA            <720865..>721443
                     /gene="TPHA0D03440"
                     /locus_tag="TPHA_0D03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685365.1"
                     /db_xref="GeneID:11530937"
     CDS             720865..721443
                     /gene="TPHA0D03440"
                     /locus_tag="TPHA_0D03440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685413.1"
                     /db_xref="GeneID:11530937"
                     /db_xref="UniProtKB/TrEMBL:G8BT08"
                     /translation="MYSTNANFKTTHDGQILISFSSFCRVVGAGATTSSVETWKMGNW
                     LSERRRRWERGRGSEVRRNTVGKQGHREMAVQRWRCVACALLSVITTSAVVSTDILAD
                     ALASRSATYLQNNNATSANDAPPLTSAWVRACCACYPPRPRPLQQRSRRLYPDTLGLG
                     SSFHPQGWLAFRFRVTLFTRLPHSANSSKYQR"
     gene            <721754..>724822
                     /gene="TPHA0D03450"
                     /locus_tag="TPHA_0D03450"
                     /db_xref="GeneID:11530941"
     mRNA            <721754..>724822
                     /gene="TPHA0D03450"
                     /locus_tag="TPHA_0D03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685366.1"
                     /db_xref="GeneID:11530941"
     CDS             721754..724822
                     /gene="TPHA0D03450"
                     /locus_tag="TPHA_0D03450"
                     /inference="similar to DNA sequence:INSDC:YER032W"
                     /note="similar to Saccharomyces cerevisiae FIR1 (YER032W);
                     ancestral locus Anc_3.522"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685414.1"
                     /db_xref="GeneID:11530941"
                     /db_xref="UniProtKB/TrEMBL:G8BT09"
                     /translation="MVLPVTPSKNFHRQSNSQVRFSLPDLDDVKAPENIHDIKDSPTK
                     IVYPSVKLSGPIESFNTPQDQDPYKNRIGSASSMDRENTQLLDKQIMDLSSNIMIQVP
                     RDVWRYHNEKLNRNASNKNDSATYKHKKQKSLQSIIVNTINSLNTTTEDAEHTENSFD
                     VSDISNVSPLRLNSNSNHNRTKSLPLLTAHGAYALSPEKTPNLYLTTDSPLNKFNVPI
                     PLQISIPPYLSPKNKNKIPNTLVYDGAGYSTYEESYSESISELSNQDKQELNLQDSNC
                     SSILDASSIESIVSSIASAEHKITLNIFNEDNNNDDDIDNILGIDQYANVNLKLQNRN
                     LRNRNFKKQNENNQTQINMPPLPVLYSHSVDNKNITNQKIDEGIAQDEESNSLAVLST
                     PVKYINIPDLEKDKTTKTKNGTLRFFDNYESSMENISPKFKLSDNEGQLSKTFKFPNN
                     PKANEPDRGGTSSEVTRNNTIFPVINKDNNDFIKIDNSTVTDEFEKRRQMLQQNRLSP
                     NNKNMKHAHRRSRSIHNADDIFTSSPEEMEKSQKDVHSGDMYTNDVNAQKFDDKSTLN
                     FSEDSNITDNLYPETTTLSQEKIENKYHPQTGETYQTTKSKQLELAINEVSEAVAQKE
                     DKILTINVKDSNMQDIKNNVEVTSEISTDENIETEISSLYEDSDSNSIVPSFVAVTDN
                     SKYDSSLDNMTNYSYQSMDADVDNSKVLLSDISKEEPIHQNRGLPCSETLQEEKFDNY
                     KVSANIDKIDYKIKPLSSFNSFPIPLPSNRVQPITTVPISKMTLIENQVTEVNSSPTR
                     ALSDSDSLQSHNSEFSKTSYQTSVSSYNQTETMTVKIGKRNIVGTSRNIGNNNFEFPT
                     SRKANKSFKREIIRQNKKLEDLPYRSIEEHREGKPVEVIILDEINDTEDKLSHNNTVK
                     MHQNSKSLGQFENVKFTDINSKNHVKLKNRNSIIHKRTNSCPSREELLQLCETVAEEA
                     KGIIYGLVNQNINNATLSQNVQKPSLPNLTILKNHSWKVVSPNIEQLPSK"
     gene            complement(<725073..>727499)
                     /gene="TPHA0D03460"
                     /locus_tag="TPHA_0D03460"
                     /db_xref="GeneID:11531021"
     mRNA            complement(<725073..>727499)
                     /gene="TPHA0D03460"
                     /locus_tag="TPHA_0D03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685367.1"
                     /db_xref="GeneID:11531021"
     CDS             complement(725073..727499)
                     /gene="TPHA0D03460"
                     /locus_tag="TPHA_0D03460"
                     /inference="similar to DNA sequence:INSDC:YER033C"
                     /note="similar to Saccharomyces cerevisiae ZRG8 (YER033C);
                     ancestral locus Anc_3.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685415.1"
                     /db_xref="GeneID:11531021"
                     /db_xref="UniProtKB/TrEMBL:G8BT10"
                     /translation="MRSFIKSHRSSNSLDGGTGRFNDSNNQFSPKRHNNDLIDVSTNT
                     ADGSQDSTHWNQYFTSNVKDGEQSLRHAPSFDSFHRLTTNKMFSGILFKRNNTSGVTV
                     NNNSQTNIHYDKSPTVNVNSIPFQFKNDDIHSPTLGRANNNNTMNGINHGGTSISSGV
                     KGHAASKSEDLAIKGTITHSWGTKSDVGHSVIKLNEPIIEHEKSNGIKLNKVVNSSVK
                     QKSVLDTRNNTEQISKPIDESELKITKTRNRSVRIHSKDDLHKMNSASLIDIKDPTFD
                     KQYAEVISKGLPKTIFKEDTLNNLPDSEEEYITDDLESESGSEFSFEYGAVNGRTSSM
                     KYYSEQNPPKTVYINDMYEDENFDENMNFYEDGYDDELDFPSNKYDFYDEEDFNFEED
                     TYEHNDNNDNKNVVTNDKMLKTEEKEGKVRHKNLNNYNDLFELSDDDDDNDIINSDTD
                     EYPSTTYDDLNSTNDEHNILKNNTNEKDQNENVELESVNLLAKTKVKSQLTSMSDIFN
                     IDDEKSDIDEYNKFNFEEDQYDDENKLDSFNYSNTRNFENHRIKSKIKNNVPVNQIGI
                     TVTSENDSTIILKHTTPHLGFERLAQDSSNDGNTTLLISPTKSHSLKIHDINSNLDSD
                     IPGSTRDLFFIDETKEDAYLNNIKLEEESYLDEINIVPEDFDFSEPMGTLSCLTSISR
                     QSTGSFRRTHSFSEKPIGNVKENNPLQNKLEIKNKTITFFNNQWNTPVTNSIKRRSPR
                     KSSPVKLDSTSYIDNNNIPTTPKQYNDSESISFAVAHEFEKPKPEYIQDFSLSPIQEG
                     SSSVDSSPRL"
     gene            complement(<728505..>730028)
                     /gene="TPHA0D03470"
                     /locus_tag="TPHA_0D03470"
                     /db_xref="GeneID:11531038"
     mRNA            complement(<728505..>730028)
                     /gene="TPHA0D03470"
                     /locus_tag="TPHA_0D03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685368.1"
                     /db_xref="GeneID:11531038"
     CDS             complement(728505..730028)
                     /gene="TPHA0D03470"
                     /locus_tag="TPHA_0D03470"
                     /inference="similar to DNA sequence:INSDC:YGL215W"
                     /note="similar to Saccharomyces cerevisiae CLG1 (YGL215W);
                     ancestral locus Anc_3.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685416.1"
                     /db_xref="GeneID:11531038"
                     /db_xref="GOA:G8BT11"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8BT11"
                     /translation="MSGFIYPNQQQIPVQFNEGMNSHSHSQSLNANNGPTMVSSMIPP
                     TLSHHMGYMLNPNGQFGHQHSQSFNQPMMNLPPPPGFNYGNNFIKNNAVNNMVQYRQP
                     QMMLLTPVQEISHLKNSGAPVLSNNLNYPVIPKEHQIQRPVEQATNGGVNPVLDYDLE
                     VMTDYIVEFSILAFDAKDKFKENSKDNNQDSILTLFNKGVGSVLNATRLPSVTIFQGL
                     HFLSKYLSRLPNRHASIGGNSINIIYQHTMIGLILANKFNDDKTFTNKSWSEATGMQL
                     TIINEYERDWLKVFDWKLFDDKFILYNDYVTAYKTFVQESTFACEPIKLQSHFTTPTS
                     ATPLPHPSNEVRIPAFQSSEHLFSSPYFCISDDEYHHNAGNPTYSNQFQPQMSICMAP
                     SMQTQPQMSCEMNGNSNFNLSSSPLASSPIRQGQFNNSHNNLSCQSVENYNNYSHFND
                     FLSQSNNLVPSQNQVPGILPYQPNFYNNWNLNYQNNSTNSDVKFDYDTKYFINPISC"
     gene            complement(<731687..>734230)
                     /gene="TPHA0D03480"
                     /locus_tag="TPHA_0D03480"
                     /db_xref="GeneID:11534247"
     mRNA            complement(<731687..>734230)
                     /gene="TPHA0D03480"
                     /locus_tag="TPHA_0D03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685369.1"
                     /db_xref="GeneID:11534247"
     CDS             complement(731687..734230)
                     /gene="TPHA0D03480"
                     /locus_tag="TPHA_0D03480"
                     /inference="similar to DNA sequence:INSDC:YGL216W"
                     /note="similar to Saccharomyces cerevisiae KIP3 (YGL216W);
                     ancestral locus Anc_3.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685417.1"
                     /db_xref="GeneID:11534247"
                     /db_xref="GOA:G8BT12"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8BT12"
                     /translation="MNVSETRQSSIMVAVRVRPFSSEEAARLIKDENDHNNYPSMNDS
                     LLTLPNVDNNNTMTDKNESVTKKYLLKRNAIRKIVDCVDDKMLIFDPADTNPLNKLSD
                     NVLNAMYSKRQTGRRNLRRGGGELKFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFN
                     GTVFAYGATGCGKTFTISGTPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYN
                     ETIRDLLNPNVSSKKLVIREDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPT
                     DANETSSRSHAVLQIHIAQTDRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIE
                     GANINKSLLALGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIS
                     PSSTHYDETLNTLTYANRAKDIKTKIIRNQQSLNRHVGSYLKMITEQKKEIQELRHRE
                     NNMIDLHLKKYKLGREKVELAIEDCIQKIKNSLLQTPKFQNTRIIKSLILCKRRLLQL
                     VNLEISEVLEAVEDWTDVAIVENCRIIQEQLNKKTKELEEQFDTPAELEIIIENAKTI
                     EKQRLSEMEFWDPANDAYNFDIKLNYIAELIRNDILVKASMFTESLFENRKLISKFKF
                     LSKCLSSKQDIHECLKDLLDIDKEFDIFGKELMSYENSNITGFSDFENRISKANDYTK
                     TSIVSEANNVPPVNITNLKNSPTVANKIVTHNNSETPPSISKFPNKLKYNKYSSPLSE
                     KKKITAAKRISKNENGGNSNSNSPSPKNINKIKNPILSFKEGASNINVNSSKNNVLNI
                     HNSVMTKPFNLKSRMSLDPQDSTFGEPDVSMQDIYPNNKSSNLFHSENE"
     gene            complement(<734827..>735087)
                     /gene="TPHA0D03490"
                     /locus_tag="TPHA_0D03490"
                     /db_xref="GeneID:11531051"
     mRNA            complement(<734827..>735087)
                     /gene="TPHA0D03490"
                     /locus_tag="TPHA_0D03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685370.1"
                     /db_xref="GeneID:11531051"
     CDS             complement(734827..735087)
                     /gene="TPHA0D03490"
                     /locus_tag="TPHA_0D03490"
                     /inference="similar to DNA sequence:INSDC:YGL220W"
                     /note="similar to Saccharomyces cerevisiae YGL220W;
                     ancestral locus Anc_3.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685418.1"
                     /db_xref="GeneID:11531051"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:G8BT13"
                     /translation="MSVVTVELLKEKLNNGIPEVYNVIAIDTSAGCGQSFEVVVISNT
                     FQGKNNLARSRMVNKILCDEIAQIHAFGCKCYTEAEWSKIVL"
     gene            <735514..>736398
                     /gene="TPHA0D03500"
                     /locus_tag="TPHA_0D03500"
                     /db_xref="GeneID:11534586"
     mRNA            <735514..>736398
                     /gene="TPHA0D03500"
                     /locus_tag="TPHA_0D03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685371.1"
                     /db_xref="GeneID:11534586"
     CDS             735514..736398
                     /gene="TPHA0D03500"
                     /locus_tag="TPHA_0D03500"
                     /inference="similar to DNA sequence:INSDC:YGL221C"
                     /note="similar to Saccharomyces cerevisiae NIF3 (YGL221C);
                     ancestral locus Anc_3.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685419.1"
                     /db_xref="GeneID:11534586"
                     /db_xref="GOA:G8BT14"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="UniProtKB/TrEMBL:G8BT14"
                     /translation="MSRALTRVQLKEVVGIITKLFPPQYADNAWDNTGLHIDCSNDES
                     KNEQCKVLLTVDLTSSVAEEAIRNNCNLILSYHPFIFPSWKNITPYSNTQHGNAIKLI
                     QKGISVYCPHTAVDAVNGGVNDWLVNSIVDDREELIGSNVAIERVSNVEDNETIGYGR
                     LVKLEKSLPLNEVIVSLKKNLGIEHLQIASLTSDYKSIKISNVALCAGSGSGVFRSLK
                     NVQEIDLFLTGELSHHEILKFKEMGKVVIVCNHTNTERGYVRKGMLKALKTATESIGN
                     KNIQYIVSETDEDPLKTI"
     gene            <737105..>737779
                     /gene="TPHA0D03510"
                     /locus_tag="TPHA_0D03510"
                     /db_xref="GeneID:11531052"
     mRNA            <737105..>737779
                     /gene="TPHA0D03510"
                     /locus_tag="TPHA_0D03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685372.1"
                     /db_xref="GeneID:11531052"
     CDS             737105..737779
                     /gene="TPHA0D03510"
                     /locus_tag="TPHA_0D03510"
                     /inference="similar to DNA sequence:INSDC:YER035W,YGL222C"
                     /note="similar to Saccharomyces cerevisiae EDC2 (YER035W)
                     and EDC1 (YGL222C); ancestral locus Anc_3.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685420.1"
                     /db_xref="GeneID:11531052"
                     /db_xref="UniProtKB/TrEMBL:G8BT15"
                     /translation="MQRNDCHSTKIQTVHTVSGHGSVSHFSHPIHVKGAGNDMYYNNS
                     NNDGKSLLDGSFSMNYFAKQSDKSDLFMKSYPYGNNNMTLPITPPISASSSLTETKQL
                     FNNYITSSPNTTIQTPISANKNKQAKKNKNMNKSKNRNRSKNQSHAPAQNSYQGKNMH
                     PHPHPKQLPNSNLYSYTNSHFNTKSNSKFAMKPASVIPPNSNFAGASFATSLPDSNDL
                     PKPSFV"
     gene            <738302..>738904
                     /gene="TPHA0D03520"
                     /locus_tag="TPHA_0D03520"
                     /db_xref="GeneID:11531124"
     mRNA            <738302..>738904
                     /gene="TPHA0D03520"
                     /locus_tag="TPHA_0D03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685373.1"
                     /db_xref="GeneID:11531124"
     CDS             738302..738904
                     /gene="TPHA0D03520"
                     /locus_tag="TPHA_0D03520"
                     /inference="similar to DNA sequence:INSDC:YPL241C"
                     /note="similar to Saccharomyces cerevisiae CIN2 (YPL241C);
                     ancestral locus Anc_6.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685421.1"
                     /db_xref="GeneID:11531124"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:G8BT16"
                     /translation="MTVPTELDTQSQQSPLKSMQSNKDILIHPQNNTYNYLQNCTLSL
                     NWDSKILNQSSLLFENIKKSVIVLNRLYFENGNIFINDCEDTVIIVNMEKIDNSIQLR
                     FHNLVYCKIYIQRKHAALEPTVLQKVIIENFRGCTFHTDSKDYIMIENFSNLGMIKSG
                     IESTNSQGYTLNSDGSSAYNFQNFSYFDNDVLKLKENYVL"
     gene            <739349..>743872
                     /gene="TPHA0D03530"
                     /locus_tag="TPHA_0D03530"
                     /db_xref="GeneID:11530991"
     mRNA            <739349..>743872
                     /gene="TPHA0D03530"
                     /locus_tag="TPHA_0D03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685374.1"
                     /db_xref="GeneID:11530991"
     CDS             739349..743872
                     /gene="TPHA0D03530"
                     /locus_tag="TPHA_0D03530"
                     /inference="similar to DNA sequence:INSDC:YPL242C"
                     /note="similar to Saccharomyces cerevisiae IQG1 (YPL242C);
                     ancestral locus Anc_6.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685422.1"
                     /db_xref="GeneID:11530991"
                     /db_xref="GOA:G8BT17"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000593"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8BT17"
                     /translation="MPFSSPTRGSRNSFIDRYVNNVDVQDDIILKPLSPAKINASNST
                     KRPSINSNFKDAVSKFSNKSQMDIENSKENLPPFKKSGHVLKIKEPRVTPTTVAAKID
                     NSSLNAEQLKYYDFLCRVEEIKQWIESVIGETLPPAIELATGDSLRDGVFFGHSSTKI
                     NPNLIKSIFPSSDKLQFKHTQNINGFFSLVDHVGVPDSFRFELQDLYNKKDLPQVFET
                     LNIMISIINKKWPTDTPMLQNLTNQVSFSKDDINKCKRTWPKIRNFKSLATSPTASPK
                     RKADNLDKQALIQNFDIYSSPKRYLNDVAVTPIKEIPKEISYQTPVEETHMANQISPV
                     RNEDTEFTYSNYRGLYDSRVDNNTIASPHLKYNELKMSSLSYHSPSISRYHNVSSEFF
                     LRRSQQREQNLEYYQTYAYSPSRYSPRKRTVMSENDFLDKLIEIQSACRGVNTRFSLA
                     LRIRLANFYEDDILNFQSKIRGYSSRNEFATTKDVRVAQTSTGEIIQLQAYVKGERIR
                     NKLDKLRIKCYRHESSIMLVQNYSKGLSHREMAKARLQILSITKAPLTILQANIKGNK
                     IRKDIAPTIFMENAYEENLIQIQSVLKALLMRKELDNYTSTLHQSYENLELNFQSLCK
                     GSLIRRKLLNVKNKAKLNVTLNNSIVGLIKANFIRLGIKNSIKTANVYSPSTNVLQGY
                     IRGILVRYALDLVDDVVESKNIDQFQSYIRGSIVRSELNNRNSYFGKHSISIIKIQSW
                     IRMFNQRSAFRDLMNSPNPSLWSVKKFVHLLNDMPNVEDLQNKLESNQAALDSANMKK
                     EKLEKDMKQQMEMAEVLSRFDIDHSLVNKLSNVQTPTLKYGSFEKLFYLLQVEPNYWK
                     DMYIWEPEFAKMNIYVSYSTVNQRMGQREKVYFMKLIVAIAQQNLSECSSLVEFLNSD
                     NLFWQELLSNFLRREYPELIRLFIPVLDFLKNEEVEFTSDPIEIYRNIHLTESPTEAF
                     AIEDSETSNKFISNLSSIWHAVELIAEIFSSKSEDIPHEIKYMCTKLYSIASSTNEDS
                     REVLKMISKVLINAFCSEYLRNNNYYGFNTRFQESLDVKIEVLLKSLSTVFYLETFSG
                     FYEPLNQYSAEIKPFLQDLLRSLMLDKSYTLEYDHLIYEDMLSSRPKLEILTDKVFSI
                     SKMFQDYSKFFPSDDIILDALNQCRDEIKELRSGRLLLELNTSSYRFLANDDKMKGIY
                     EQVKRALIYMMQVEEVDTNLYDLAVSTVLPRDEPVFHDFIVSHPTVYSDDIVQDLESP
                     KYFSLKNLALTLINELENHGILNSSENYLQDVLNDIAAVIKDPNYTVEYIQGELEVTK
                     ITLNQLNEFNVQINKDVQFIKTLIQQILDKFCASKNFTSSSKGTFDSIKDVYKKTQVR
                     DQSSQRGLKFKWSTRQLYEAGVLKSIEGEKLGELTIKVFGSSGPKFPDINFKISTVNG
                     KHFTIKMSDKHKGSTKLYHNMVDSFAFFDLLNCQVGVKVSQWHLFDSKVTFNTSELLK
                     LISTNFYNREKDI"
     gene            complement(<743948..>745264)
                     /gene="TPHA0D03540"
                     /locus_tag="TPHA_0D03540"
                     /db_xref="GeneID:11531034"
     mRNA            complement(<743948..>745264)
                     /gene="TPHA0D03540"
                     /locus_tag="TPHA_0D03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685375.1"
                     /db_xref="GeneID:11531034"
     CDS             complement(743948..745264)
                     /gene="TPHA0D03540"
                     /locus_tag="TPHA_0D03540"
                     /inference="similar to DNA sequence:INSDC:YMR187C"
                     /note="similar to Saccharomyces cerevisiae YMR187C;
                     ancestral locus Anc_6.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685423.1"
                     /db_xref="GeneID:11531034"
                     /db_xref="UniProtKB/TrEMBL:G8BT18"
                     /translation="MIGLPFKRCHCWVCLDDSDFDSTWIIHQCGCQLQIHKKCYFKWL
                     YSLNKEHISQQLRNRSNGLISEETLYKRLCYLFDGHRDFYRNISFVENIVGIPIIGIP
                     CFTFICIPMIFSFETLGVNCFSKMITEYPLPPPITSVYCPQCKKYIKKSDLDITSDSI
                     ILKLSYWGKKLIRWGISLVAISLPIVNLGKLWFQLGLWQLRQVFPEEILTALCDISTT
                     KALDVYGGTVNGILSVPSSSKIVIFGFPLYLLGLAGDYDLFNRLRWLAPVVALKLKVS
                     NDQSLNIARTCINISYGFISLHSYIIKPLQNKYYYKMVKDAKPYYLHDNEDSEGDTIL
                     DSYRGKYGNILISTRIFDVFIEATLWPLLGRIVGEKIFCGFIWLQNNSYVTYQPDASP
                     NSLSMIFNFAGMGIVSLANQVFKGYVTRLRVQELKELQRNTMQLDD"
     gene            complement(<745588..>747447)
                     /gene="TPHA0D03550"
                     /locus_tag="TPHA_0D03550"
                     /db_xref="GeneID:11534129"
     mRNA            complement(<745588..>747447)
                     /gene="TPHA0D03550"
                     /locus_tag="TPHA_0D03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685376.1"
                     /db_xref="GeneID:11534129"
     CDS             complement(745588..747447)
                     /gene="TPHA0D03550"
                     /locus_tag="TPHA_0D03550"
                     /inference="similar to DNA sequence:INSDC:YPL243W"
                     /note="similar to Saccharomyces cerevisiae SRP68
                     (YPL243W); ancestral locus Anc_6.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685424.1"
                     /db_xref="GeneID:11534129"
                     /db_xref="UniProtKB/TrEMBL:G8BT19"
                     /translation="MGAYSPINATFGVRFAQILETDTDFIKYHLKLNRKLIKLRHILH
                     VVNKDTKHYQKGLTKINNGTTFSSSYYDNKNKLVGTYFLLSIERDLSYIELLKLRARN
                     RGKFFKNELKIIRTRLRKVLKLSHILINEITINEQNWITRLQYLIYSKLVNVEFLLLG
                     KKTKKKKSELIANELSCVFEGLNLLKNKKILDLSVVEEIKSKYNYYLKQYAGNIFSTV
                     DLNNFMINTISKIQKFESNTENGFTSILFSHGYKPVLLKEEAPSKNNSGENEIHWIDF
                     VTKVNDEEIFQLINDANNSKIKSIDDYDSKLLKWNDILNKQETNIAFKQHDEDNMDTD
                     VLENEQILLAYIKYNVLMTSVSRDNMVFESLLKQWNIITSNKSVATSKKLNKYKEIER
                     IVKNLTKFIKDLMELPGVFSSENLMNQLELLKTYYNVSLTSRCLGDLYQSKHDYLQAL
                     SLNINALKELENNLTELNDTDLEKLLLPSELINSNKVSNLRNSIKSSWNNIIALAEYD
                     KHMNKNQNRWAVTNDKYNLSLIERIDDGVKYIHPKYIKLNNLFPLRPVIRPVPSKPTL
                     FDLAFNYIEYEQDSNNNTEETSTSASTSPEEPETAKAEEVSTKKSGFLGLFRR"
     gene            <748315..>749412
                     /gene="TPHA0D03560"
                     /locus_tag="TPHA_0D03560"
                     /db_xref="GeneID:11531011"
     mRNA            <748315..>749412
                     /gene="TPHA0D03560"
                     /locus_tag="TPHA_0D03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685377.1"
                     /db_xref="GeneID:11531011"
     CDS             748315..749412
                     /gene="TPHA0D03560"
                     /locus_tag="TPHA_0D03560"
                     /inference="similar to DNA sequence:INSDC:YPL244C"
                     /note="similar to Saccharomyces cerevisiae HUT1 (YPL244C);
                     ancestral locus Anc_6.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685425.1"
                     /db_xref="GeneID:11531011"
                     /db_xref="GOA:G8BT20"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:G8BT20"
                     /translation="MAKQSEADIVEQNDTANGDFSVGKLLFCAVGIYCSFLTWALVQE
                     PLNTIHWPQSNEQFKSPNIIAISQAFVAMVIGFVYLSYKSNVTLVQLYHLIWNNKKYF
                     VIISVTQALSAPIASYSLQHVDYLTFMLAKSCKIIPILMVHMLLYRTTIANEKKIVAV
                     LVTLGVMVFTLGSKKTGPTMKVPDELEENMILTHFYGYSMLLLSLFLDGLTNATQDKM
                     LKLNKNSKKHELISGAHLMFALNLFIVIWNTLYLILVDRNQFKNALTLIEHDPIIIKY
                     LTTYSCCGAIGQIFIFYTLEYFGSIILVMITVTRKMMSMLLSIAVYKKSVNLIQWAGI
                     SIVFGGIIWEALHKTKKVIGNKTDNDDKKIL"
     gene            complement(<749561..>750934)
                     /gene="TPHA0D03570"
                     /locus_tag="TPHA_0D03570"
                     /db_xref="GeneID:11534385"
     mRNA            complement(<749561..>750934)
                     /gene="TPHA0D03570"
                     /locus_tag="TPHA_0D03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685378.1"
                     /db_xref="GeneID:11534385"
     CDS             complement(749561..750934)
                     /gene="TPHA0D03570"
                     /locus_tag="TPHA_0D03570"
                     /inference="similar to DNA sequence:INSDC:YPL245W"
                     /note="similar to Saccharomyces cerevisiae YPL245W;
                     ancestral locus Anc_6.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685426.1"
                     /db_xref="GeneID:11534385"
                     /db_xref="InterPro:IPR018647"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BT21"
                     /translation="MILKSITRTMTQSYRAAKRTKKSNYNGSNNGNNDKSSIAMDKLL
                     NAELSEEQTMLKEKVMSFIRTNIMNYDAQEKPPKCAMFVIEGDAGTGKSLILNSLFNE
                     IQKISNEKAFEKDPLYGRDNYLVVNHPEMLKLYVRMSKSFKYISRRSLERPTSLVNTL
                     TKNNSIADVVIVDEAHLLATSKDAFKRFYGENHLKDLMSLSKVLLLVYDDKQALRMGS
                     YWDENQKNGASLKSYYNTVHNDKKDWYRLKKQFRVCAPNDVLKWINDISVAGKIPKFP
                     SSAKENSKSDFDFKIWDDCGAMYEALKIKDQELGQCRLLATYDFPYRLDGNDYFVTCG
                     DNFKVRWDRYTPREVTPWSERKDTINEVGSVYTIQGFDLNYAGVILGRSVRYDKVNDA
                     IALEPKLYDDHAGFTKKPNIHDIDDVKRKIIMNSMNVLLTRGIHGLYVYAWDPELRER
                     LKATQCE"
     gene            <751346..>752203
                     /gene="TPHA0D03580"
                     /locus_tag="TPHA_0D03580"
                     /db_xref="GeneID:11534238"
     mRNA            <751346..>752203
                     /gene="TPHA0D03580"
                     /locus_tag="TPHA_0D03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685379.1"
                     /db_xref="GeneID:11534238"
     CDS             751346..752203
                     /gene="TPHA0D03580"
                     /locus_tag="TPHA_0D03580"
                     /inference="similar to DNA sequence:INSDC:YPL246C"
                     /note="similar to Saccharomyces cerevisiae RBD2 (YPL246C);
                     ancestral locus Anc_6.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685427.1"
                     /db_xref="GeneID:11534238"
                     /db_xref="UniProtKB/TrEMBL:G8BT22"
                     /translation="MLHWKSIYHAVYQDEKPSALTIGLPIFSIVFYFAIQYILSEESF
                     EWVVDDYYLHFDSLFKFKLNALSMHALFFSTMFEMIVCLLLITIPLNIYEREHGTVFT
                     GVFLNLITTFSSIFTCLIGKLLSKLGVIDLDQNYIPVAGMSGWLFVLLGFFTVRKKMK
                     NNSRNILIQLHRSSVHIPTVMPSILLLVLYNILQFFIYQKNSSLLSVYHTVCLGIGYL
                     ISSKETYFAVLVPPSGLIMAIERVLNKLINLIPLFVQYYKEKDMKRTFLNAEDAEVDE
                     LAELPTYQN"
     gene            <752790..>754586
                     /gene="TPHA0D03590"
                     /locus_tag="TPHA_0D03590"
                     /db_xref="GeneID:11534431"
     mRNA            <752790..>754586
                     /gene="TPHA0D03590"
                     /locus_tag="TPHA_0D03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685380.1"
                     /db_xref="GeneID:11534431"
     CDS             752790..754586
                     /gene="TPHA0D03590"
                     /locus_tag="TPHA_0D03590"
                     /inference="similar to DNA sequence:INSDC:YPL247C"
                     /note="similar to Saccharomyces cerevisiae YPL247C;
                     ancestral locus Anc_6.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685428.1"
                     /db_xref="GeneID:11534431"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BT23"
                     /translation="MDNYRSQRRSFISSGNFQRQQVGENNGNLMNQDMYPPIFNKNIN
                     YSENGVHQGNLAPADGNYSMNPNSPMYSPLNPAQPMQNMYSNSGMVSNPDALQNSTFS
                     QLNQYRSFGGNRNSDMASTNSIDNVTVNAGPQSVYNGFKENLIYNNRNVVCEYESSRQ
                     LFALDWSVDDYVTLSSYKEDSLNKLQVIHSNDLLTWEKVAECNVTYPVSNIQWLPSVP
                     NPRKLATSSECLRIWSLDDNSMDNSSVFNNNISNNSRHNTYKKSLTEQVNLSLCKYNE
                     QHQIINNSTNSVSNKSNARLLGQLPPVTSFHWNSIDTNLLISSSIDTTCIVWDLQSSN
                     YVKTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQG
                     NNTFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVP
                     VLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLNSELNPKVTHLARNHMEASN
                     NDANDHIDMNNSKQLNNNGVNSMNGNVDEQNMSSGNSDWKSQNEVKVLTVPSMCYSNK
                     KQEVNNIIWRPQDGEWFGCVAGKKFQNVRLST"
     gene            complement(<754714..>758556)
                     /gene="TPHA0D03600"
                     /locus_tag="TPHA_0D03600"
                     /db_xref="GeneID:11534123"
     mRNA            complement(<754714..>758556)
                     /gene="TPHA0D03600"
                     /locus_tag="TPHA_0D03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685381.1"
                     /db_xref="GeneID:11534123"
     CDS             complement(754714..758556)
                     /gene="TPHA0D03600"
                     /locus_tag="TPHA_0D03600"
                     /inference="similar to DNA sequence:INSDC:YMR190C"
                     /note="similar to Saccharomyces cerevisiae SGS1 (YMR190C);
                     ancestral locus Anc_6.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685429.1"
                     /db_xref="GeneID:11534123"
                     /db_xref="GOA:G8BT24"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR022758"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BT24"
                     /translation="MLNKPQNTLNKEYAWLKKNEDSVYETQSTYNIITGVLNNFDDVK
                     VNEKKKPALGLSNPSNLQEIINIQSIIIGLFEERDRMLSYKCDILGSTSLSPESKKFK
                     ILNEIQTKLLNLKNEIAEYQEILSNLKVIKNNDVPKLAAPDMNTQLCKEDIIKEEHIH
                     VSSNEITEDVKKDQDQKLDCDENFVDEDSQYSADTTTIYSDEEKMLMNGINITTATSV
                     NQTDAAPIINDVIIGSNTVVQLNSNHGKMPEYKSTITSNNKRTLRFKNTINYKIPDAD
                     DPFDYVMAASKPLKYSTITSGSIEKDEPDDYEKNYLATQNMNNTEDSVHDSDLEFVDG
                     SYYNTSHDFDYKESEHTVDNDDDEIIEASDADISVHENSHLPIIKESIILLSPSKTAY
                     EGNISNENVPIINVSDEDLNQDLIIEDSNLSAFSYNLIDQFSDVEMVESGSEKIHNTG
                     DSETEELPISQKELDREIFDLERENFSQKNNLKHIEDELQVISETCMSNEVTTTMVAK
                     EHSINIESNINDRSDAALSFPWSSEVLFRLKNSFNLNSFRPNQLEAINSTLNGRDVFV
                     LMPTGGGKSLCYQLPAIVKSGKTSGTTIVISPLISLMHDQVEHLLNINIKASMISSKS
                     PAAQRKKTFNLFINGLLDLVYISPEMMSASQQCKRAIKRLYETNKLARIVVDEAHCVS
                     NWGHDFRPDYKELKLFKREYPTIPLIALTATANEQVQLDIINNLGVRNPLLLKQSFNR
                     TNLDYIIRTKSKNTVNEICSSLKTDFKNQSGIIYCNSKISCEQVAQQIASQKIRTAFY
                     HAGMTPSERLKIQKAWQNNQVQVICATVAFGMGIDKPDVRFVIHFTIPRTLEGYYQET
                     GRAGRDGLPAQCITYFSFKDVRSLQTMIQRDKSLNKENKLKHLEKLQQVVSYCDNVTT
                     CRRQQVLKYFNEDIDPSVCLKQCDNCRNSGNFSIEERDVTNEAKMIINLIGTLKDERV
                     TRIYCQDIFKGSRSAKILQSGHNLIKDHAAGKHLSKLEIERIFSQLVTLRLLEEYPIV
                     NASGFASHYIKLGIAAKKFLKDNTTLKMEFIINNSSSRPNSNRSSSRTLITTNLNVTG
                     IERHQSDLQENNMIKKTTISTESNSIQDQPYLNSAYKKLKELSLSLGQHVNPPTTEFL
                     SEDILKKLAKELPKDEPSFKILVNNDPSYNQKFKYFKDTIMVLRSNFGLLNKAKKTNT
                     VTSSSALIIPHSHNFELEFSESSLNSEIIRQIRDTQDVDSQTNEESLLNSKGKKKRKS
                     TFSKGSRKYKSYKRFKKK"
     gene            <759933..>760709
                     /gene="TPHA0D03610"
                     /locus_tag="TPHA_0D03610"
                     /db_xref="GeneID:11531012"
     mRNA            <759933..>760709
                     /gene="TPHA0D03610"
                     /locus_tag="TPHA_0D03610"
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /transcript_id="XM_003685382.1"
                     /db_xref="GeneID:11531012"
     CDS             759933..760709
                     /gene="TPHA0D03610"
                     /locus_tag="TPHA_0D03610"
                     /inference="similar to DNA sequence:INSDC:YMR193W"
                     /note="similar to Saccharomyces cerevisiae MRPL24
                     (YMR193W); ancestral locus Anc_6.282"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /protein_id="XP_003685430.1"
                     /db_xref="GeneID:11531012"
                     /db_xref="GOA:G8BT25"
                     /db_xref="InterPro:IPR001383"
                     /db_xref="InterPro:IPR026569"
                     /db_xref="UniProtKB/TrEMBL:G8BT25"
                     /translation="MSVNNCPLTVKRHFSSSLIILREWKLVETRRIAKQPDFQIGGEK
                     PLYIPKKRKVFPDYKYGESNLFKQSNQGLFGGSFIQFGNNISESKIKTRRTWLPNIIK
                     KSLWSETLNKPITLKLTAKVLKTITKEGGIDNYLLKDKAARIKELGPTGWKLRYSILS
                     AKDKQLNPPHKDAKTVTTNSGEVKKIYYDVEVNGKPFKITVGRRQLLSLLFAKEQLNK
                     KCDGIVYSHKEFIEESQKSTISDILSKLDKYGYDLSTISL"
     gene            <761570..>762237
                     /gene="TPHA0D03620"
                     /locus_tag="TPHA_0D03620"
                     /db_xref="GeneID:11534138"
     mRNA            join(<761570..761585,761951..>762237)
                     /gene="TPHA0D03620"
                     /locus_tag="TPHA_0D03620"
                     /product="60S ribosomal protein L36"
                     /transcript_id="XM_003685383.1"
                     /db_xref="GeneID:11534138"
     CDS             join(761570..761585,761951..762237)
                     /gene="TPHA0D03620"
                     /locus_tag="TPHA_0D03620"
                     /inference="similar to DNA
                     sequence:INSDC:YMR194W,YPL249C-A"
                     /note="similar to Saccharomyces cerevisiae RPL36A
                     (YMR194W) and RPL36B (YPL249C-A); ancestral locus
                     Anc_6.283"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_003685431.1"
                     /db_xref="GeneID:11534138"
                     /db_xref="GOA:G8BT26"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:G8BT26"
                     /translation="MAVKTGIAVGLNKGKKVTSMTPAPKISYRKGAASKRTTFVRSIV
                     REFAGLAPYERRLMDVIRNVGEKRARKVAKKRLGSFKRAKAKVEEMTNIIAASRRH"
     gene            <764615..>764974
                     /gene="TPHA0D03630"
                     /locus_tag="TPHA_0D03630"
                     /db_xref="GeneID:11534545"
     mRNA            <764615..>764974
                     /gene="TPHA0D03630"
                     /locus_tag="TPHA_0D03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685384.1"
                     /db_xref="GeneID:11534545"
     CDS             764615..764974
                     /gene="TPHA0D03630"
                     /locus_tag="TPHA_0D03630"
                     /inference="similar to DNA sequence:INSDC:YPL250C,YMR195W"
                     /note="similar to Saccharomyces cerevisiae ICY2 (YPL250C)
                     and ICY1 (YMR195W); ancestral locus Anc_6.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685432.1"
                     /db_xref="GeneID:11534545"
                     /db_xref="UniProtKB/TrEMBL:G8BT27"
                     /translation="MAEAVQPNLDNSYLFYLSISDDRYLASACPDTKQSEKVPRMTSS
                     TAPATSSYNVDSIFEIDDENISACPELAHSGSTGAELTPGNSILSAPTSTVVPQDFIN
                     ATQLNYRKWLSMHLDCK"
     gene            <767043..>768638
                     /gene="TPHA0D03640"
                     /locus_tag="TPHA_0D03640"
                     /db_xref="GeneID:11534601"
     mRNA            <767043..>768638
                     /gene="TPHA0D03640"
                     /locus_tag="TPHA_0D03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685385.1"
                     /db_xref="GeneID:11534601"
     CDS             767043..768638
                     /gene="TPHA0D03640"
                     /locus_tag="TPHA_0D03640"
                     /inference="similar to DNA sequence:INSDC:YMR199W,YPL256C"
                     /note="similar to Saccharomyces cerevisiae CLN1 (YMR199W)
                     and CLN2 (YPL256C); ancestral locus Anc_6.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685433.1"
                     /db_xref="GeneID:11534601"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:G8BT28"
                     /translation="MQESKLGLVVTAKQTYYPIELSNSELLAHYETIQEYHQDIASNI
                     IEQSSKYKPDPKLIDQQPEMEPSATRSTIVSFLFELSVVTRVTDGIFFHAVRLYDRYC
                     SKRIVLKDQAQLVVATCLWLSAKTWGGCNHIINNVCVPTGGRFYGPNPRARIPRLSEL
                     VHHCGGLHVFDESMFVQMERHILDTLNWDVCEPTINDYILNVDENCLIQYELYKRQLE
                     YNKEWKAKRQSQSTQDSDSTINDLEAENNNEDSDEDGDLDSKIQLINLKRFLIDLSTW
                     QYSLLKYELFELSNGIFSIIDKFTNHDQGPFLMSPPISASYQVQLLNIYINAIINAPE
                     SLIEVYRKQTGVMEFISRVKDYHLDLQKKLQLASSLDLSRKMSATIPNGNGTFFDRNA
                     SPSSIYSSQSYTPLRNTSALSENSLFSTTSVDQSSPITPQMYMFGQFKTDSDCASTIS
                     VNSISNLKNSNNSNANINRIKMDNDDDKENVDPYRQIKMKNSVNSKNNSTTTFCSPSK
                     TKESLSNKPSIMSLTLINTTGMV"
     gene            complement(<768888..>769883)
                     /gene="TPHA0D03650"
                     /locus_tag="TPHA_0D03650"
                     /db_xref="GeneID:11531060"
     mRNA            complement(<768888..>769883)
                     /gene="TPHA0D03650"
                     /locus_tag="TPHA_0D03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685386.1"
                     /db_xref="GeneID:11531060"
     CDS             complement(768888..769883)
                     /gene="TPHA0D03650"
                     /locus_tag="TPHA_0D03650"
                     /inference="similar to DNA sequence:INSDC:YNR007C"
                     /note="similar to Saccharomyces cerevisiae ATG3 (YNR007C);
                     ancestral locus Anc_6.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685434.1"
                     /db_xref="GeneID:11531060"
                     /db_xref="GOA:G8BT29"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR019461"
                     /db_xref="UniProtKB/TrEMBL:G8BT29"
                     /translation="MLRSTIRNWREYLTPVSHKSTFLNTGEITPEEFIQAGDYLCHMF
                     PIWSWNEATKDISNRSFLPEDKQFLVVRKVPSSQRAQTFTSFKDDDKVADKSHIYYEE
                     GLSNKEGEEGEEEEGWLVSDEVNNVVNVTRHSLEDKKDQNSRPTASNDIDAMMESMGL
                     EDLTDDDDLIDNGMDRTNMRYYDLYITYSSSYKVPKMYLVGFSSNGSPLIANEMFEDI
                     TPDYRAKTATIEKLPFYKNSIASVSIHPCKHANVMRVLLEKVASVKQKKAEEDAKVEK
                     KHDCGGESESNQDDWEDVQIDMSNTIRVDMYLVVFLKFITSVTPGIEHDYTMEGW"
     gene            <770517..>772631
                     /gene="TPHA0D03660"
                     /locus_tag="TPHA_0D03660"
                     /db_xref="GeneID:11534552"
     mRNA            <770517..>772631
                     /gene="TPHA0D03660"
                     /locus_tag="TPHA_0D03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685387.1"
                     /db_xref="GeneID:11534552"
     CDS             770517..772631
                     /gene="TPHA0D03660"
                     /locus_tag="TPHA_0D03660"
                     /inference="similar to DNA sequence:INSDC:YNR008W"
                     /note="similar to Saccharomyces cerevisiae LRO1 (YNR008W);
                     ancestral locus Anc_6.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685435.1"
                     /db_xref="GeneID:11534552"
                     /db_xref="GOA:G8BT30"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BT30"
                     /translation="MPIKLRRGSTSSIKNRSRSGSSNRNSATGVNYNSNSPKYKAMQK
                     HYLEEFGDISDKGQIYGNDGDTYSHSSKNTGRNENKSNRKIPADNFGKHLRDSKRFIF
                     TLGAFLGVLIAFYFGATHVHSTNKDLFTNMVNFEFLNDYIDDWKDVIPQGFQSFIADF
                     PVNLDSEGSFQSNLSGDFAVGKQLKKELQLKAFHPVVMVPGVTSTGLENWGIEGDEEC
                     DSSPHFRKRLWGSFYMLRVMVLDKVCWLKHVMLDPETGLDPANFRLRAAQGFEASDFF
                     VAGYWIWNKIIQNLGVIGYDPDKMTTAAYDWRLSYQDLERRDKYFSKLKQQIELTFEL
                     NASKSVLIGHSMGAQVVFYFLKWVEAEGPNYGNGGPGWVNKYIDSFINVSGTLLGAPK
                     AVPALISGEMKDTIQLNAIAMYGLEKFFSRRERLNLLRTWGSIPSMFPKGGDLIWGNH
                     TFSYEDLASKNSTSILTSSFGPFIKLEKSKNPSSKKNKTKKHMKTTNDKTEIVDLSME
                     DSINLVKNISPSWLQKRIDEQNDYGYANSCEELLQHEKDHKYWTNPLQVPLPNATDMK
                     IYCIYGINNPTERAYIYKEGGDGDSLNMTIDYESANPVLFTDGDGTVPLMAHSLCHKW
                     AQGKSPYNPANMSVTIIEIQHQPDRFDIRGGPKSAEHVDILGSSELNEYVLKIASGLG
                     STVANKLLSPLKEWVEMIDFPM"
     gene            <773783..>774454
                     /gene="TPHA0D03670"
                     /locus_tag="TPHA_0D03670"
                     /db_xref="GeneID:11530984"
     mRNA            <773783..>774454
                     /gene="TPHA0D03670"
                     /locus_tag="TPHA_0D03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685388.1"
                     /db_xref="GeneID:11530984"
     CDS             773783..774454
                     /gene="TPHA0D03670"
                     /locus_tag="TPHA_0D03670"
                     /inference="similar to DNA sequence:INSDC:YMR202W"
                     /note="similar to Saccharomyces cerevisiae ERG2 (YMR202W);
                     ancestral locus Anc_6.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685436.1"
                     /db_xref="GeneID:11530984"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="UniProtKB/TrEMBL:G8BT31"
                     /translation="MKCISIIVLLGLLGYYMNTLYTTWLPTNYMFDPKTLNEICNGVI
                     SQYNTTDSKFDVKVMLKDIRNELASHYGEEYINKYVEEEWVFNNAGGAMGQMIILHAS
                     ISEYLIIFGSAVGTEGHTGVHFADDYFTILHGEQLAALPNALEPEVYKAGQTHHLRKG
                     FAKQYAMPSGSFALELAQGWIPCMLPFGFLDTFSSTLDVYTLYRTVYLTARDMGKNLI
                     QNGKF"
     gene            <775188..>776357
                     /gene="TPHA0D03680"
                     /locus_tag="TPHA_0D03680"
                     /db_xref="GeneID:11530936"
     mRNA            <775188..>776357
                     /gene="TPHA0D03680"
                     /locus_tag="TPHA_0D03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685389.1"
                     /db_xref="GeneID:11530936"
     CDS             775188..776357
                     /gene="TPHA0D03680"
                     /locus_tag="TPHA_0D03680"
                     /inference="similar to DNA sequence:INSDC:YMR203W"
                     /note="similar to Saccharomyces cerevisiae TOM40
                     (YMR203W); ancestral locus Anc_6.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685437.1"
                     /db_xref="GeneID:11530936"
                     /db_xref="GOA:G8BT32"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:G8BT32"
                     /translation="MSTPVNITDYTKIPTQAGVSPMTSDQTDESFWSSNPISSFFIDT
                     YRNVHQHRESLSLSNPGSVEDLNKEVARDVFLNQYAFTGLRADLNKAFSLNPAFQTSH
                     TFSIGSTNLPSYAFSALFANDDLFVQGNVDADFSLSGRLNYGWNKHNISKVNLQIAHG
                     QPTMCQLEQDIKGSDFSINFKTLNPTFQLLNASEIFTGVAVGSLLQNVTPNLALGLEV
                     LYSRSQSGTPADSGVSYLTRYVSTNKNWIFSGQLQANGAAIASFWRKVSPNVEAGIET
                     TLQAGMIPITDPVVGTPVGIQPTIEGSTTVGAKYEYRQSVYRGTIDSNGKIACFLEKK
                     ILPTLSILFSGEIDHFKQESKLGCGLQFETAGNQELLMMQQGLDADGNPLQAPPQ"
     gene            complement(<776694..>777638)
                     /gene="TPHA0D03690"
                     /locus_tag="TPHA_0D03690"
                     /db_xref="GeneID:11534433"
     mRNA            complement(<776694..>777638)
                     /gene="TPHA0D03690"
                     /locus_tag="TPHA_0D03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685390.1"
                     /db_xref="GeneID:11534433"
     CDS             complement(776694..777638)
                     /gene="TPHA0D03690"
                     /locus_tag="TPHA_0D03690"
                     /inference="similar to DNA sequence:INSDC:YML004C"
                     /note="similar to Saccharomyces cerevisiae GLO1 (YML004C);
                     ancestral locus Anc_6.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685438.1"
                     /db_xref="GeneID:11534433"
                     /db_xref="GOA:G8BT33"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:G8BT33"
                     /translation="MSLYTTKIESAQNDPSLLMNHTCYRIKDPVRSIEFYEKKLNMKL
                     YMKKDFPDMKFSLYFLKFPGEVEASVSGDNIFGYSGVLELTHNWGTEDDPDYKVNNGN
                     VEPHRGFGHTCISVYDIEKYCSELEAKNVVFKKKLEEGRQHNIAFILDPDGYWIELLA
                     YQSPQNLGPKLNHTMYRIKDPKQSVDFYTNVLGMKLIRTFDVPTAKFTNYFFSYKETE
                     GEGWRTTEGVVELCHNYGTEDDPDFHYHTGNAEPQGYGHICVVMDKPEVFCQEIENKY
                     GDAIQWAPKFNQGKMKNIAFLKDPDGYSIEVVLRNIKL"
     gene            complement(<778130..>780901)
                     /gene="TPHA0D03700"
                     /locus_tag="TPHA_0D03700"
                     /db_xref="GeneID:11534457"
     mRNA            complement(<778130..>780901)
                     /gene="TPHA0D03700"
                     /locus_tag="TPHA_0D03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685391.1"
                     /db_xref="GeneID:11534457"
     CDS             complement(778130..780901)
                     /gene="TPHA0D03700"
                     /locus_tag="TPHA_0D03700"
                     /inference="similar to DNA sequence:INSDC:YNR011C"
                     /note="similar to Saccharomyces cerevisiae PRP2 (YNR011C);
                     ancestral locus Anc_6.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685439.1"
                     /db_xref="GeneID:11534457"
                     /db_xref="GOA:G8BT34"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BT34"
                     /translation="MGNETKIWEGVGKRRVKARYESVEDDSVDGDAEVSRDALSEEKT
                     EKQDQGLERHQYASDHHGADAIRSKVNENMDELRVLARHEYLGRREKEKFVLLIRELE
                     ILEDDIKKYGWDNLSERERSEIILKRELVQLINSKRSIEDTNYYTLAHDDADNSSSPT
                     DKKRKTLYGNEYDGSKRQRNPGEIWEDNQIRNAVKTDAGHQIDNIQVKGSEKYDYVFD
                     EEAMIDFTSDQEDMLDDENDEDTSSGEEDAELENLREKLNMEENRIVAIQESRKLLPV
                     YKYRQSLLDAIKENQVLIVVGETGSGKTTQLPQYLIEENYTQNGKFQIAVTQPRRVAA
                     TSVASRVADEMNAVLGQEVGYTIRFDDKTTPNKTLLKYMTDGMLLREFLNDPMLSRYS
                     CIMIDEAHERTLATDILLGLLKNILLHRTDLKLIISSATMNSTKFSNFFNKCPIFNVP
                     GRRYPVDIHYTVQPEANYMNAAITTIFQIHTTQALPGDILVFLTGQEEIENVRENLEA
                     IIAKLGSSIPQMLITPIYANLPQEQQDRIFQKTPNGCRKVVLATNIAETSLTIDGIKY
                     VIDPGYVKENAYVPSTGMSQLLTVPCSKASVDQRAGRAGRVGPGKCFRLFTKWSYYNE
                     LEMMPKPEILRTNISNIVLLLLSLGVSDLIGFPLLDKPSIQSLSKALETLYILGALNS
                     NGSITRLGRIMCEFPCEPEFAKVIYTSATNETTKGVLEECVTIVAMLQEVSSMFIGSS
                     KEAMNRVVGDSNSDHLLYLKIYDQWSESDYSKFWCKDHKVQYKTLCRVRNIREQLWKC
                     SERLGLVALNIKARQEIPDITNMNITSKISKCFITGFPMNIAKLGTTGYRTIGKGKAN
                     NGLEVLIHPSSVVYQKSHMEEGRKPTKHILFQQLMLTTKEYARVILPIANESWLNEMV
                     PQLYKKLER"
     gene            <781456..>782943
                     /gene="TPHA0D03710"
                     /locus_tag="TPHA_0D03710"
                     /db_xref="GeneID:11534582"
     mRNA            <781456..>782943
                     /gene="TPHA0D03710"
                     /locus_tag="TPHA_0D03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685392.1"
                     /db_xref="GeneID:11534582"
     CDS             781456..782943
                     /gene="TPHA0D03710"
                     /locus_tag="TPHA_0D03710"
                     /inference="similar to DNA sequence:INSDC:YNR012W"
                     /note="similar to Saccharomyces cerevisiae URK1 (YNR012W);
                     ancestral locus Anc_6.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685440.1"
                     /db_xref="GeneID:11534582"
                     /db_xref="GOA:G8BT35"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8BT35"
                     /translation="MPLVDYISNEEAELMRVANASSQRRRSSVVSMESGKTKYMPPWT
                     TPYIIGIGGTSGSGKTSVASKLVSEIDVPWTVLISLDNFYKPLDKAQRKRAFENNYDF
                     DEPEAVDLDLAYRCILALKEGKKTEIPVYSFVHHNRVPDKNITIYGASVIVIEGIYAL
                     YDKRLLDLMDLKIYVDADLDICLARRLSRDIITRGRDLSGCIQQWERFVKPDADKYVK
                     PTMKNANAIIPSMADNQVAIKLLINHIKSKLKLKSEEHVEKLLKLGGLESKDSKPLSY
                     YKNIFQIPATNQVKALRTMLLDKNLSRDDFVFYFDRVATILLSSALNNINIQSRVTIE
                     TPEGHHEKNMIRCDFDSVIAVNIIRSGDCFMSSLKNTIPSIAIGKLLIQSDSQTGEPQ
                     LHAEFLPPNIHLCNSVLLMEAHVITGANAIMAIQVLLDNDISLKNIKLVVYMATEVGI
                     RRILNAFGSSIQIYVNFIISNEKIKSGNHNWAVTKFIDTKYFGCN"
     gene            <783409..>784578
                     /gene="TPHA0D03720"
                     /locus_tag="TPHA_0D03720"
                     /db_xref="GeneID:11534567"
     mRNA            <783409..>784578
                     /gene="TPHA0D03720"
                     /locus_tag="TPHA_0D03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685393.1"
                     /db_xref="GeneID:11534567"
     CDS             783409..784578
                     /gene="TPHA0D03720"
                     /locus_tag="TPHA_0D03720"
                     /inference="similar to DNA sequence:INSDC:YNR015W"
                     /note="similar to Saccharomyces cerevisiae SMM1 (YNR015W);
                     ancestral locus Anc_6.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685441.1"
                     /db_xref="GeneID:11534567"
                     /db_xref="GOA:G8BT36"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:G8BT36"
                     /translation="MVSYAGKLVLAPMVRAGELPTRLLSIQHGADLVWSPEIIDKKLI
                     QCQRNINDKLNTIDFIIPSNPNAAHNANKPPVLVFRTYPKIEKGKLIFQMGTASPNLA
                     VEAALKVIQDVDGIDVNAGCPKHFSIHSGMGAALLKTPEKLCSILTELVAKVGKPYNK
                     PISVKIRILDNESSTLGLVKSLCKTGIANLTVHCRTTPMRNREAPIRDYIPEIYKICA
                     FNNVSLIMNGAISNRKEFAEILEASQFPKDVGGMIAESAESNPSVFNRDPLEWYDVCK
                     EYIQITNDFENHVGNTKYMLTRIVPGKSKFFQYFAKCKTLEEINYVLQKMGKDGSVIE
                     DPMPYLDECREAEKQVKKNRIIKSHYKVKIINVHQAPLRTKNTQERKQKYKLFET"
     gene            complement(<784729..>791682)
                     /gene="TPHA0D03740"
                     /locus_tag="TPHA_0D03740"
                     /db_xref="GeneID:11534242"
     mRNA            complement(<784729..>791682)
                     /gene="TPHA0D03740"
                     /locus_tag="TPHA_0D03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685394.1"
                     /db_xref="GeneID:11534242"
     CDS             complement(784729..791682)
                     /gene="TPHA0D03740"
                     /locus_tag="TPHA_0D03740"
                     /inference="similar to DNA sequence:INSDC:YMR207C,YNR016C"
                     /note="similar to Saccharomyces cerevisiae HFA1 (YMR207C)
                     and ACC1 (YNR016C); ancestral locus Anc_6.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685442.1"
                     /db_xref="GeneID:11534242"
                     /db_xref="GOA:G8BT37"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8BT37"
                     /translation="MELMSRNNISNHSKALTSVLSRSCSKQARYYTVQNVWSSRYRYQ
                     HKLKTFGNYTIENKYYNRNFKRFHFNKCCRWFSSSRKHLKKALPKIRSKSFKELNDPK
                     FITNYSVKHRRLPPHFIGQNTIERANSSQLRDFIKIRGGHTVISKILIANNGIAAVKM
                     IRSIRKWAYETFGEEKAFRFVVMATPEDLDANSEYIRMADQYVEVPGGTNNHNYANVD
                     LIVDIAERFNVDAVWAGWGHASENQHLPEKLAQSRRKIVFIGPPSSAIRNIGDKVSSL
                     IVAQHAKVPCFPWSGSDIDSVKVDSKSGLVSVEKDLYFKACCSSPEDGLIQAKKIGFP
                     VMIKASEGGGGKGIRQVRKEEDFIRLYHQAVNEIPGSPMFIMKLAEDVRHLEVQLLAD
                     QYGTNITLFGRDCSVQRRHQKIIEEAPITIASQAKFEKMAEAAIRLGKLVGYVSAGTV
                     EYLYSSKEDQAYFLELNPRLQVEHPTTEMITGVNLPAAQLQIAMGIPMHRIGDIRHLY
                     GYDAESNSVIDFSLPSKTLTENHLKPKPKGHCISCRITAEDPDQGFKPSGGLLEELNF
                     RSSFNVWGYFSVANKGKIHSYSDSQFGHIFAFGENRQQARKRLIVSLKELSLRGEFKT
                     TVEYLIKLLESEDFEDNKISTGWLDDLISQKITSKKPEPILAALCAAATKAHIASKVN
                     HEQYTESLRRGIVQPENTMLTEFQIEFLHNDFKYKFTVTKSSVDTYILELNNSKCELR
                     VRELSDGGLLISLGGKSHTIYWKNEVDSIRLTIDSMTTIIKEENDPTQLRTPSPGKLV
                     KYLVENGAHINVDEPYAEVEIMKMQMPLLAPAAGTIHILKSPGSTISKGELVATLTLD
                     DVKMANPTLLFKGRFPNFGTAVIEGTKLAHRFQYLYYKLNNLLYGYDTQDSSKAILEE
                     LLEVLRNPALPYSEWQLQLSGLHPKIPKILDIQMQQIVTTYSKMDSSFPAVELRKKLE
                     DAINEKNSDSSMKQILEPLYDITESYLNGIKEHEYSVIIKLLGKYYDTERLFIGDKVQ
                     EEHVILKLRDENRKNLKTVSNIVLSHSKVLRKNELVMDILKYYYSQCHKFTLFTKLVE
                     PTLINLTKLGNDSNKVSLFARKLLIQCSLPSLKDKANMISSVISRALGDSKFLNNIDH
                     PQPDLKILEELIECDFAIFDSLFPFLVNDNTPVANAAANVYIRRAYRDFVISDLKFNY
                     IERECIWSWNFKQKPEFTELFPNISSFTTESHATRENDLSKNVFLGIEGILTYSKTFT
                     ELHSTITSLLAYIKSNDVKQSTTNGTIGHSKKRARILLLYVDSSSYIGNEEDVSSYFE
                     SILQKHQEQLKESNITQLTLIVGNDGKLYPKYFTFNGIDCKEEKALRNTDPAMVHGLE
                     IGKMAKFNISQISTGNATLHIFKGISKTLESDIRYFARGIIRKDRSINDFGSIRTYLR
                     NKADKLVNEMIDGLEVTRSEQSTLTHIFLHFSDIVTLSLKDLTGTFDFLFEKYLSRLN
                     KLKLTNIEIKIAIREFDKSTPLHLRIIIENPSGFVTNSQIYQEILNSEKKWIFKSIGN
                     PGPLNMMSIYAPYPQITSIQQKRQKVQRLGTSYVFDFPLLFEHVVINNWKKNFPIQTL
                     PSDMFTCCELIEDASGNLVESNRAPGNNQCGMVAFKISMKTPEYKDGRYIVIIANDLS
                     YQMGSFGPIEDKFFNNVTEYCLKHGLPRIYLSANSGARIGITEELVPLLNVDWKDLED
                     VTRGFNYLYLTESSFNDLKRMGKEKTVELEKITKNGEIRYIIKAIIGSSDDFGVESLK
                     GSGLIAGTTSRAYRDIFTITLVTGRSVGIGAYLVRLGQRTIQVENKPIILTGAAAINK
                     VLGRDVYSSNLQIGGSQIMYKNGISHLVSSDDLAGVESIVKWLSYIPKKRNNPVPIVN
                     SPDSWDRDVQYSPSSNDTYDIRWLIRGRTLEGIFEHGLFDKDSFFETLSGWANGVVVG
                     RARLGGIPVGVIGVDVRTVETVIPADPANPKSMESITHEAGQVWYPNSAFKTAQTIND
                     FNYGEQLPLIILANWRGFSGGQQDMYREILKYGSFIVDSLNDYKQPVMIYIPPNGELR
                     GGSWVVMEPSINPDHMELYADVTSRASVLEPEGMVGIKFRRNKLLKTMSQLDEQYRSL
                     QNELLTGSLSSERYRVLANRLQNRENEIMPVYKHIAAQFFDLHDKTSRMLAKNVIKKE
                     LVWVNSRRFLFWRLKRKLQEEYILRTMESSLGDSPRKDVTKLLYSWYPLDLDVEDDRS
                     VVTWLDSNTHEVEKKVKSLKTLSMSNFLTDSIEKNHEESLSGILSVLQDLPNEDKSYI
                     IGTLTKSINKT"
     gene            complement(<792115..>793938)
                     /gene="TPHA0D03760"
                     /locus_tag="TPHA_0D03760"
                     /db_xref="GeneID:11534452"
     mRNA            complement(<792115..>793938)
                     /gene="TPHA0D03760"
                     /locus_tag="TPHA_0D03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685395.1"
                     /db_xref="GeneID:11534452"
     CDS             complement(792115..793938)
                     /gene="TPHA0D03760"
                     /locus_tag="TPHA_0D03760"
                     /inference="similar to DNA sequence:INSDC:YCR045C"
                     /note="similar to Saccharomyces cerevisiae YCR045C;
                     ancestral locus Anc_6.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685443.1"
                     /db_xref="GeneID:11534452"
                     /db_xref="GOA:G8BT38"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:G8BT38"
                     /translation="MHLERYLWLCILINVVVAKEYIIRLKNNYSITKFMNSDVFNLPN
                     RKVSDFILDNGHQIKKVIEFGNFKCFIVDDSTDKRISLDLMERLRKHPFVQDITPNIK
                     VELYGDAEHQGADNDNHNDTDMVEETVWQDDDDSEDQDDDEYKGVDIQFGAPRHLGKL
                     SSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEFGNRVHFGGD
                     FIGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTSVLEGIEFAV
                     NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNNNFSACWTSP
                     ASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENGVIHSGTSMA
                     SPIVAGLVAILMEKGYKCDEIKQKLIDDSSKSIFSKLTLFFKYGTPNRVIYNGIEEVI
                     NVNKENIRQREETDESKEYDTIEDIDDSANETKTEEDDDNFEEHDPDYSNEPLNDDDD
                     TDVENTPDKDGFHDGSSNNGDKSSNEEEEDTSSDEDSSYYKPPLSHSRRKFFDKFHKI
                     GRFKYPSIKIHELAKYMRSYKPVKNVFEDSENLYLDVLWIS"
     gene            <795072..>795755
                     /gene="TPHA0D03770"
                     /locus_tag="TPHA_0D03770"
                     /db_xref="GeneID:11534245"
     mRNA            <795072..>795755
                     /gene="TPHA0D03770"
                     /locus_tag="TPHA_0D03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685396.1"
                     /db_xref="GeneID:11534245"
     CDS             795072..795755
                     /gene="TPHA0D03770"
                     /locus_tag="TPHA_0D03770"
                     /inference="similar to DNA sequence:INSDC:YNR018W"
                     /note="similar to Saccharomyces cerevisiae YNR018W;
                     ancestral locus Anc_6.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685444.1"
                     /db_xref="GeneID:11534245"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:G8BT39"
                     /translation="MKILTAEEIEGQRYYTLMGGLKGFLMGGAISFAGYKLLPRKFPH
                     LNLKALPWSIKTGFSIVPPVALTAIMAEEGSNKFDQLTYGSGTASEDAIEDAKRWSNL
                     SFKDRCLESFMNNRYKIVVGVWAASLWGSWELINRDKIMTVSQKAVQARMYAQFISVI
                     LLLGTMMISMYDNKLRPNQHELNEKKRWERVLKVAEESEKEQREFLNWCHGFASNAER
                     KEAKIFKYD"
     gene            complement(<796092..>796667)
                     /gene="TPHA0D03780"
                     /locus_tag="TPHA_0D03780"
                     /db_xref="GeneID:11530993"
     mRNA            complement(<796092..>796667)
                     /gene="TPHA0D03780"
                     /locus_tag="TPHA_0D03780"
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /transcript_id="XM_003685397.1"
                     /db_xref="GeneID:11530993"
     CDS             complement(796092..796667)
                     /gene="TPHA0D03780"
                     /locus_tag="TPHA_0D03780"
                     /inference="similar to DNA sequence:INSDC:YCR046C"
                     /note="similar to Saccharomyces cerevisiae IMG1 (YCR046C);
                     ancestral locus Anc_6.315"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /protein_id="XP_003685445.1"
                     /db_xref="GeneID:11530993"
                     /db_xref="GOA:G8BT40"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:G8BT40"
                     /translation="MFSVNSRAFLGIARVHAVRAYQIPATKRTIIPIYPAVEKLKNKN
                     SVIYDISKTDIEKSLDPEGWRRRLLNKGPKDVTKGQKSADRTTYIETGDIVRITYDKS
                     KCDDETFLGYVLGVYRKNLVQDSSLLLRNQVGKTFVEVRVPIFSPLIQSIDILKKCEI
                     GEKRRKRSKHYYIRGTKLDVGELELMLRKKR"
     gene            <797282..>797923
                     /gene="TPHA0D03790"
                     /locus_tag="TPHA_0D03790"
                     /db_xref="GeneID:11534617"
     mRNA            <797282..>797923
                     /gene="TPHA0D03790"
                     /locus_tag="TPHA_0D03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685398.1"
                     /db_xref="GeneID:11534617"
     CDS             797282..797923
                     /gene="TPHA0D03790"
                     /locus_tag="TPHA_0D03790"
                     /inference="similar to DNA sequence:INSDC:YCR051W"
                     /note="similar to Saccharomyces cerevisiae YCR051W;
                     ancestral locus Anc_6.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685446.1"
                     /db_xref="GeneID:11534617"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BT41"
                     /translation="MNIWIAASDGRIDLVEKFLNSNTGVTVNSKDENGYTPVHAAAAY
                     GHNDLLRKLCNEYNGDINIRDFDGDTPLHHVEDVNTAKVIIEELDGDFKLTNNEDKTA
                     LETFEEDSEFPELITYMREKMGVTVEDDARLSGIDAEQLAQFKDSVRYSLENDPVDEN
                     DVETMERRKKLEAIIQGENVEQELENYIRSIVRGQMIGSSMDNEENVPNKRQK"
     gene            complement(<798104..>798526)
                     /gene="TPHA0D03800"
                     /locus_tag="TPHA_0D03800"
                     /db_xref="GeneID:11534612"
     mRNA            complement(<798104..>798526)
                     /gene="TPHA0D03800"
                     /locus_tag="TPHA_0D03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685399.1"
                     /db_xref="GeneID:11534612"
     CDS             complement(798104..798526)
                     /gene="TPHA0D03800"
                     /locus_tag="TPHA_0D03800"
                     /inference="similar to DNA sequence:INSDC:YNR022C"
                     /note="similar to Saccharomyces cerevisiae MRPL50
                     (YNR022C); ancestral locus Anc_6.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685447.1"
                     /db_xref="GeneID:11534612"
                     /db_xref="UniProtKB/TrEMBL:G8BT42"
                     /translation="MFKPSYIMLSALSKRTNKVTVQVLKDFPDFQLFRGQVAEVKPSL
                     MRNYLHYNNGARYILKDTDIDSQLLKLNAQREADMKKLAAEALQDEQLLMKSNTKTQQ
                     KSVTEEKNTKRNEEKQSYKSVLDQDYSIENVKIPGLDL"
     gene            <799018..>800649
                     /gene="TPHA0D03810"
                     /locus_tag="TPHA_0D03810"
                     /db_xref="GeneID:11534236"
     mRNA            <799018..>800649
                     /gene="TPHA0D03810"
                     /locus_tag="TPHA_0D03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685400.1"
                     /db_xref="GeneID:11534236"
     CDS             799018..800649
                     /gene="TPHA0D03810"
                     /locus_tag="TPHA_0D03810"
                     /inference="similar to DNA sequence:INSDC:YCR052W,YNR023W"
                     /note="similar to Saccharomyces cerevisiae RSC6 (YCR052W)
                     and SNF12 (YNR023W); ancestral locus Anc_6.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685448.1"
                     /db_xref="GeneID:11534236"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:G8BT43"
                     /translation="MSYSKSGAKASSKKNDTSNVSGSKGSSKGGKNNGTVANNSSNNN
                     SSNDNTAAANNNTVKQQMNPISTQNPIDTYIPSYLSRLVPELNSYEQLLDAEKKIDIY
                     LARKKIDLNQNIMQWSATSDSMASSMNSDKKSFETKFLRVFIFNTAENQPWQDESQDL
                     SNASWTLRIEGRLLDSEDISSESRKKFSSYFQGIAVDFKKSKETAAPLQHKTESNTEE
                     AADVEMTDAETIENQKENIIDAVEWNFDAKNPVQFDGLDMKRPGSENLDCTITLQLQN
                     MTGSVLEYSSQLASIIGFAQGSIQDAVYFVYKYLLINNLLTKEPSLKSANNNSSASVN
                     STTNSNDQTNGDNTVIQIDSLLSELILPDPLQTEYGFTKPSTLTLNELLALINKHVSP
                     MKPIKVDYTIKVDKSSTYGDVVFDIAVQEPVDKNGKIQNKDSLSSEAISLLTSIDNQQ
                     SEMKSKLDELHYNSRLLHLQLNESAKKYQFFHKIAENPVPALKEYIESSSNALKVLSG
                     DEGYNEDMVRRSQFYKDNEDVLFENLGVLLANGRM"
     gene            complement(<800750..>802381)
                     /gene="TPHA0D03820"
                     /locus_tag="TPHA_0D03820"
                     /db_xref="GeneID:11531025"
     mRNA            complement(<800750..>802381)
                     /gene="TPHA0D03820"
                     /locus_tag="TPHA_0D03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685401.1"
                     /db_xref="GeneID:11531025"
     CDS             complement(800750..802381)
                     /gene="TPHA0D03820"
                     /locus_tag="TPHA_0D03820"
                     /inference="similar to DNA sequence:INSDC:YCR054C"
                     /note="similar to Saccharomyces cerevisiae CTR86
                     (YCR054C); ancestral locus Anc_6.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685449.1"
                     /db_xref="GeneID:11531025"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019156"
                     /db_xref="UniProtKB/TrEMBL:G8BT44"
                     /translation="MTEIDTIVKIGSLFENISLAEEDYEQAIQILNPIIIRSSQDEEY
                     RVQLSKRKEVWSSINICLSNYNVNELMHVDQLNIKTYNIRLLRGIIILLRNLSASNQD
                     IPNELLLQNTVIKLFLNLRNHYEGLEEIIMALYITILSFLHNISQNHSIFDKTILHQQ
                     LVFLMFPTLCNSNNREMLYPYLLYFYNIIKNDDFLYDFFRHKDVTPILHNIIIEEITQ
                     NHSNLYEHLKQVRTDDMETEAAPQLEDLDIILLKIFKRISANESFAPYLERIEKSDNM
                     IFMSILKIMQLIVTSTDDWDKFELTALMAWCYRIFEHTALEVKKYFENKLEDEPTSDS
                     LHDKLLISLDIISKLCQFEHAKKFMVFYKGIENIISLFQVLQDNLIKINFQKDIKGNV
                     KSMKTTNSLGDKISDETLLLKRVDFDNYHIKSTNFPECKLIIVEIITMLAYGNKEVQD
                     KIRELHGLQLVLSNCMIDDNDPFIKERAIVCIRVLLTENKENQDFVAQLESKKAVQNE
                     TLEEAGYEVKVSSDGSVKLESKDGTSSLNKRPKIK"
     gene            complement(<802754..>805492)
                     /gene="TPHA0D03830"
                     /locus_tag="TPHA_0D03830"
                     /db_xref="GeneID:11534234"
     mRNA            complement(<802754..>805492)
                     /gene="TPHA0D03830"
                     /locus_tag="TPHA_0D03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685402.1"
                     /db_xref="GeneID:11534234"
     CDS             complement(802754..805492)
                     /gene="TPHA0D03830"
                     /locus_tag="TPHA_0D03830"
                     /inference="similar to DNA sequence:INSDC:YCR057C"
                     /note="similar to Saccharomyces cerevisiae PWP2 (YCR057C);
                     ancestral locus Anc_6.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685450.1"
                     /db_xref="GeneID:11534234"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:G8BT45"
                     /translation="MRSDYEFTNLLGTVYRRGNILFSSDGTQLISPVGNRVSVFDLIN
                     NKSFTFEYEHRKNIASLDINKQGTLLLSIDEDGRAILVNFKSRQVLHHFNFKDKCQSI
                     KFSPDGKHFALGSGRFIQIWKTPDVNENRQFAPFIRQRVQAGHFQDVTSLTWSYDSRF
                     IISSSKDLTARIWSLDSEDKDLASMTFAGHRDYVMGAFFSADQEKIYTVSKDGALFTW
                     EYSSKEEEDDDDEPDLSKYSWRISEKNFFFQNHATVKCVTFHAKSNMLIVGFSNGEFR
                     LYELPSFALLQQLSMGQNPVNTVSVNETGEWLAFGSSSLGQLLVYEWQSESYILKQQG
                     HFDALNDLTYSPDGSRVVTSSEDGKIKIWDVVSGFCLATFEEHTSSVTAVQFAKRGQV
                     LFSASLDGTVRAWDLIRYRNFRTFTSTDRIQFNCLAVDPSGEVVCAGSLDNFEIHVWS
                     VQTGQLLDTLAGHEGPVSCLAFSQENGVLASASWDKTIRIWSIFARSQQVEPLEVYSD
                     IVALTIRPDGKHVAASTIRGQISIFDIEEGKQIGNIDCRKDIISGRYLEDRFTSKSSE
                     RSKFFTSIHYSFDGMAIIAGGNNNSLCLYDVTNEVLLRRFIVSQNMTLNGTQEFLNSS
                     KMTEAGALDLIDEDAENSDLEDRIDSSLPGSRRGGDMSTRRTRPEIRVTAVQFSPTAN
                     AFAAASTEGLLIYSLDNVVVFDPFDLDIDITPQNTIASLTNKEYLNSFVMSLRLNEVY
                     LINKVYESIPVSEIPLICSNIPVVYLPRILQFVGDFSMDSPHIEFNLIWIKSLFSSHG
                     SYINDNKHIFGSSMRSIQRFLSRIAKDAVVASVDNKYTYRFLSGTDGKLNDGSSDNET
                     EFTSAYEAEGASNSDDDVAMDVAESEDEGWEGLDKKENKLSLSAEIDESDDDKDLI"
     gene            <805962..>806531
                     /gene="TPHA0D03840"
                     /locus_tag="TPHA_0D03840"
                     /db_xref="GeneID:11534280"
     mRNA            <805962..>806531
                     /gene="TPHA0D03840"
                     /locus_tag="TPHA_0D03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685403.1"
                     /db_xref="GeneID:11534280"
     CDS             805962..806531
                     /gene="TPHA0D03840"
                     /locus_tag="TPHA_0D03840"
                     /inference="similar to DNA sequence:INSDC:YNR024W"
                     /note="similar to Saccharomyces cerevisiae YNR024W;
                     ancestral locus Anc_6.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685451.1"
                     /db_xref="GeneID:11534280"
                     /db_xref="UniProtKB/TrEMBL:G8BT46"
                     /translation="MSTPTPVTGKLTSRVMNMKFMKFANNGEELTDPRGNASGALNNA
                     NANHKGRDSAITKKFNEASEWKLERMKINPESSDKSVNTTLTRKIIKIKKTPTVVSNV
                     GVASLQRLRTPETNMLPVMRGRRVIGEPEVTLGKRKADEGNEEPSDSLQKEVDEDSYE
                     PSLDKIFKSSKKVDSKKNKNKKKKNSKKK"
     gene            complement(<806677..>807450)
                     /gene="TPHA0D03850"
                     /locus_tag="TPHA_0D03850"
                     /db_xref="GeneID:11531028"
     mRNA            complement(<806677..>807450)
                     /gene="TPHA0D03850"
                     /locus_tag="TPHA_0D03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685404.1"
                     /db_xref="GeneID:11531028"
     CDS             complement(806677..807450)
                     /gene="TPHA0D03850"
                     /locus_tag="TPHA_0D03850"
                     /inference="similar to DNA sequence:INSDC:YCR059C"
                     /note="similar to Saccharomyces cerevisiae YIH1 (YCR059C);
                     ancestral locus Anc_6.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685452.1"
                     /db_xref="GeneID:11531028"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020569"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:G8BT47"
                     /translation="MSMNHEELVQEIETIEAIYPDLLMEKLSDCTIIRIKIPQHEYVT
                     VQISFPKEYPSEQPPNVLEVNINKNSLSYDPKYILHLFQEVMNSVYHKEVCVFDFLTE
                     LDGVLYIEEDGDDNDYVEDTKMLVPLDPFEGWVSSEPITDRKSTFMGFATRVNSEEEA
                     FAKLEQLKMDPKIRKGNHIMSAWRVKQGDISFQDSDDDGETAAGSRMLHLVTIMGIWN
                     IMVVVVRWFGGTHIGPDRFKHINSTAREAILKAGFERKE"
     gene            <807913..>808275
                     /gene="TPHA0D03860"
                     /locus_tag="TPHA_0D03860"
                     /db_xref="GeneID:11530996"
     mRNA            <807913..>808275
                     /gene="TPHA0D03860"
                     /locus_tag="TPHA_0D03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685405.1"
                     /db_xref="GeneID:11530996"
     CDS             807913..808275
                     /gene="TPHA0D03860"
                     /locus_tag="TPHA_0D03860"
                     /inference="similar to DNA sequence:INSDC:YCR060W"
                     /note="similar to Saccharomyces cerevisiae TAH1 (YCR060W);
                     ancestral locus Anc_6.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685453.1"
                     /db_xref="GeneID:11530996"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BT48"
                     /translation="MSFEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKA
                     MALIKLGRYTEVVELCRKGLTFTPNTTDTVYKKLNYRLEMALKNMKHVNDQEQSNEHL
                     INIEINEVDRLPEEFINL"
     gene            complement(<808388..>812176)
                     /gene="TPHA0D03870"
                     /locus_tag="TPHA_0D03870"
                     /db_xref="GeneID:11534408"
     mRNA            complement(<808388..>812176)
                     /gene="TPHA0D03870"
                     /locus_tag="TPHA_0D03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685406.1"
                     /db_xref="GeneID:11534408"
     CDS             complement(808388..812176)
                     /gene="TPHA0D03870"
                     /locus_tag="TPHA_0D03870"
                     /inference="similar to DNA sequence:INSDC:YHR155W,YNL257C"
                     /note="similar to Saccharomyces cerevisiae YSP1 (YHR155W)
                     and SIP3 (YNL257C); ancestral locus Anc_1.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685454.1"
                     /db_xref="GeneID:11534408"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BT49"
                     /translation="MQNTLHPDRKVSQPDAGEVHDQETHSKDEIKLKLISVELKEASI
                     DSPAFRASVNYFHTRIELFETQLQMQLDYTDSQYKNSVKSFRSMYEILLTGFLPPSNL
                     IESTLTDNQAYLPNLIDNFSTDYYFFGIEIFKLVAGDLNTYTSLIINLIKTIIEPYKQ
                     KRTNFTYYQSKYDNMIATFQSINVLHNNLEPESIMEDSIHIYDIRKSYLEASLDLMAE
                     IFTMRVKFDKHLIDLVSVIRKSTRFNILDTKIKVNLLNIHKTFFFDNASEDFDAVDNF
                     IDINEFQAWIKKVMDVISTASDDLMVVKNQLYEHTLQRIAPSKDMRNYVIKDVSMGIL
                     DIVRSNNAMVTDMKESPNISGWLYMKTYVGEQNRLVWVRRWCFIQNSVFGIFALSTSK
                     VYVEETDKFGVLNIDLRYEPLSQRKFCFHLYISKEKKVQKKNLHSIAKETATTVEPDI
                     IVTLQAESYKELKNWFLVFKQAKAYASNLSVDNAEYTTARGRYPPRYLEFASKSITSK
                     DKELTTVNSDTISIKKTLNCEYSEFDFLTIFNKDSNTQEPAFHFMVTSPPITTRFTQL
                     ALLTRMIQAPPNYPDAVLINIWGTTDWHEHSVTRGASTTNNIIKKNNSYSYNSNNSEV
                     KYPKNYSERDMIITSQFKSIFYSFNDQYSFDEDEFVLFNYRGYWCPNKHQGFTLTCFI
                     TNKYFYHYMDTLGFISLMRKEIKDVISVEQDKITPNLLHFYYLNETSVSQYIYFEKAC
                     TVQAIYNFLLENNVSQTPKNINEVLQTLKDIQNNMNKTPRNISKVPKYSNLDCSYYAQ
                     VPKSFDPNGKLNIFKKQYHVHYRSSFDISPKGLLHCLLGDHSDIFKKCSLFTGNGSNY
                     SGKHFWREHWKSADSVELVKESKAPVEDSDDKMSGTKKVTRYYNINTVDTTLRLTMLI
                     DDKYYEIQQDPIILKFSFCRYCKIQLKYTISSKTAEDQQPKTLLVVFHDISFLDPKTN
                     EPVTDLSLQEKIIRELLYCTNEQLFLHVKKLLKYYLDKLGNHDRTTRAINYFGMIAVI
                     KSKKDNVHLEKSTEDHEHNIVDINISVVLALAFKVYVVRFCKIFKTYLRIGCILLAKQ
                     LLSLMSVNVLIYITLLFSSLTSIFYIGRGIKVHVSMKKSHNILHNFISSSDSWKMQRE
                     LNITTVKELIHNITVEDPDLAFGTFNKIDKANSRTYAETKKELNIKRNELLFDLNMLE
                     SLEQNLIQGNYRKFLIQEVNNCNKVKDELPSHWNNDTMLQDYCASCSVTLDKICSLLL
                     "
     gene            <813011..>815479
                     /gene="TPHA0D03880"
                     /locus_tag="TPHA_0D03880"
                     /db_xref="GeneID:11531093"
     mRNA            <813011..>815479
                     /gene="TPHA0D03880"
                     /locus_tag="TPHA_0D03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685407.1"
                     /db_xref="GeneID:11531093"
     CDS             813011..815479
                     /gene="TPHA0D03880"
                     /locus_tag="TPHA_0D03880"
                     /inference="similar to DNA sequence:INSDC:YNL243W"
                     /note="similar to Saccharomyces cerevisiae SLA2 (YNL243W);
                     ancestral locus Anc_1.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685455.1"
                     /db_xref="GeneID:11531093"
                     /db_xref="GOA:G8BT50"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8BT50"
                     /translation="MGRGAGDLSKAVKKACSIEETAPKRKHVRACIVYTWDTHSSKEF
                     FHILKNSTLFNDPVQLFKMLTLIHKVIQEGHPSALIEGIRNRSWIKSLARMSDGENMR
                     MHGDGDGYDRLIRKYVEFLVQKLNFHAHHRGFRNGTFEYKEYISLISINDLDQGYETI
                     LQLMALQDQVDEFSNFVFASINRGANNDLKISSLVPLISESYGIYKFITSMVRAINTQ
                     LDDDGVLDLLKEKVEQQHLRLFEFYADCSSIKLLSSLVTIPKLPRDPPNLTAQLDVVP
                     QTSESLAKPQETRRAPSPQKRSGTVSPQQPPRPQKATATGSTHTAPAVQPTPAQHMPA
                     TTIAPLVPMLTAAAFPQAAMMTGGSFINPVLTGGPNMFLNMHDQTTGNAGFGTAATGS
                     LSNAAAVNNMQLNTSLTGGNNITGTFPMQQQMPTTTFGATFNTSQMTGGMMPAQITGG
                     LVPAHMTGGMMPAQVTGGLVPAQATGGMVPAQATGGMVPAQLTGSYNNHVAGQVTGGM
                     VPAQLTGSFNSQMSSQLTSNVVSAQGTNGMISNQMTGGFQPQVQSQSQPPNNFNNSIP
                     AQVTGGFNSNMPAQLTGGVVPNMGMANTGFGNATTSTQQQFTHNNPMQTNTLAAGAAG
                     TMLNQLEENQKLLEQYDIQLQKNESEMNEIKERLSTTTKDLTSVQERYDALSKLYSQL
                     RQEHLRLLPRAQNSTPEETLDFVLQGAINSLQSTPSSKIISKYATDLATHMNNFIFSK
                     NDFNNVVYAATLFSSSITSLSSSAANSTNQTERDNVQRVAYQAQTYLNKLKSTTLAPL
                     STEAKTDAVINANIEMQRTLQLLG"
     gene            <815812..>816291
                     /gene="TPHA0D03890"
                     /locus_tag="TPHA_0D03890"
                     /db_xref="GeneID:11531095"
     mRNA            <815812..>816291
                     /gene="TPHA0D03890"
                     /locus_tag="TPHA_0D03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685408.1"
                     /db_xref="GeneID:11531095"
     CDS             815812..816291
                     /gene="TPHA0D03890"
                     /locus_tag="TPHA_0D03890"
                     /inference="similar to DNA sequence:INSDC:YCR063W"
                     /note="similar to Saccharomyces cerevisiae BUD31
                     (YCR063W); ancestral locus Anc_6.330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685456.1"
                     /db_xref="GeneID:11531095"
                     /db_xref="GOA:G8BT51"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="InterPro:IPR018230"
                     /db_xref="UniProtKB/TrEMBL:G8BT51"
                     /translation="MPRINLKTAKNAPKGFEDIKETLQEFQEELDDIQSSEKSSKLAA
                     RANVSLWEIMRIHNERSRYVYNLFYKRKAISRELYEWLLKNKYGDKYLISKWKKKGYE
                     KLCCLRCIQSAETVHGTTCICRVPRAQLERNAEKDGDSKVSFTQCVHCGCHGCSSTD"
     gene            <817569..>819248
                     /gene="TPHA0D03900"
                     /locus_tag="TPHA_0D03900"
                     /db_xref="GeneID:11534454"
     mRNA            <817569..>819248
                     /gene="TPHA0D03900"
                     /locus_tag="TPHA_0D03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685409.1"
                     /db_xref="GeneID:11534454"
     CDS             817569..819248
                     /gene="TPHA0D03900"
                     /locus_tag="TPHA_0D03900"
                     /inference="similar to DNA sequence:INSDC:YCR065W"
                     /note="similar to Saccharomyces cerevisiae HCM1 (YCR065W);
                     ancestral locus Anc_6.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685457.1"
                     /db_xref="GeneID:11534454"
                     /db_xref="GOA:G8BT52"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:G8BT52"
                     /translation="MNQGFAADFIAPNTISPIGNLRRTFSSEEHHMYGNGMVTSIDTK
                     EIITPPGSTVRGKNKKTTGSLKHPLSPEFSSPITHSKSKKQKSESNTTRSNGNLTLDE
                     LIESLAIRNSREELHTKPPYSYATLISLAILQSQDGKLTLAQIYNWISVHFTYYKQKD
                     SGWQNSIRHNLSLNEAFIKTTKADDGKGHYWELKPGYETKFFKNENRSVEQVKAKLQE
                     MEKYFQSGAVPHYSKSNQNDTDSEEYSAPSSARGGSNFRTSSSPLKFAAIHQDYNIVN
                     NEMEVTPSYPISMSPNTASLQPVPTLNFGVKFSSNEANTKDRFTAKRFHTTLGFQRNQ
                     DKNIALFDGGIAGNSLSSLGIPSGSDLLKSPQNIQRYTSSFNSSFETSPLPSIQRRKS
                     IAGVNTNDSTQLNTNEDYSGSSILLALPQPVGTDMLKTPKIKTTGMFEKTPVRFITTP
                     RDDGSLLKKWQTPSNIFEDFYCSPLFKGMGTPIKFSSTPNGASNKILSPSGKLSQDNV
                     LKDSNKSQLSSNGLFGVDVYSVWKRATENKSEAKILDEKLSKFSEVEEKKQ"
     gene            <819917..>821374
                     /gene="TPHA0D03910"
                     /locus_tag="TPHA_0D03910"
                     /db_xref="GeneID:11534596"
     mRNA            <819917..>821374
                     /gene="TPHA0D03910"
                     /locus_tag="TPHA_0D03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685410.1"
                     /db_xref="GeneID:11534596"
     CDS             819917..821374
                     /gene="TPHA0D03910"
                     /locus_tag="TPHA_0D03910"
                     /inference="similar to DNA sequence:INSDC:YCR066W"
                     /note="similar to Saccharomyces cerevisiae RAD18
                     (YCR066W); ancestral locus Anc_6.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685458.1"
                     /db_xref="GeneID:11534596"
                     /db_xref="GOA:G8BT53"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004580"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:G8BT53"
                     /translation="MNNSVSDPTDYAKSSIPKLSQLDSLLRCHICKNFLKNPVLTPCS
                     HTFCSICMRLYLSKEAKCPLCLKEVRESMLRSEYLVNEIVGSYTNIRDELLANLKKQE
                     ARQDGQDISIVEVESDSESLQVLDIEEDTKQYISKQLSNQRNRINNSHMTKKVTKKSN
                     DIHSFLKSKSNDIMLKNSQLIECPVCSKMVPKQTLESLHLDKCLEEQSSKQTDSSNNN
                     DDLTVLSENITEFESDNSKDKSKKITKHRAKINDSKLIPNEKTSNHFDRYLQSTAASE
                     HQRLPKINFSHMVTSQIKLKLASLNLPSTGTRQNMIERYNHYEILWNSNFCDSINPVA
                     ESELRRQLASWEVSQKKASNSSGNSISSLMEIAKASNHGLSYKTLMLKFRTDSFNKKA
                     WANIFAKEFNELKKEAMSKLKKGKIKSINEVPSETQNEEKKEQRNERNDITQNEIEPN
                     TCFDLLSSENVIELTQQSNSNDSIPDITISNTQEY"
     gene            complement(<821790..>822797)
                     /gene="TPHA0D03920"
                     /locus_tag="TPHA_0D03920"
                     /db_xref="GeneID:11530972"
     mRNA            complement(<821790..>822797)
                     /gene="TPHA0D03920"
                     /locus_tag="TPHA_0D03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685411.1"
                     /db_xref="GeneID:11530972"
     CDS             complement(821790..822797)
                     /gene="TPHA0D03920"
                     /locus_tag="TPHA_0D03920"
                     /inference="similar to DNA sequence:INSDC:YPR110C"
                     /note="similar to Saccharomyces cerevisiae RPC40
                     (YPR110C); ancestral locus Anc_3.428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685459.1"
                     /db_xref="GeneID:11530972"
                     /db_xref="GOA:G8BT54"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:G8BT54"
                     /translation="MSNIVGIEYNRVTNTTSTDFPGNYQSEGLEWDVEKFRESFDIHI
                     SSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVLAHRIG
                     LIPLRVDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVLYRNA
                     HVYARDLKFEPQGKQAELFADQPVEAIDPDILIAKLRPGQEISLRAHCILGIGGDHAK
                     FSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDARKDTVSR
                     EVLRHEEFQNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNKAEYLKNCAISQ
                     K"
     gene            <823320..>824735
                     /gene="TPHA0D03930"
                     /locus_tag="TPHA_0D03930"
                     /db_xref="GeneID:11531103"
     mRNA            <823320..>824735
                     /gene="TPHA0D03930"
                     /locus_tag="TPHA_0D03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685412.1"
                     /db_xref="GeneID:11531103"
     CDS             823320..824735
                     /gene="TPHA0D03930"
                     /locus_tag="TPHA_0D03930"
                     /inference="similar to DNA sequence:INSDC:YGR091W"
                     /note="similar to Saccharomyces cerevisiae PRP31
                     (YGR091W); ancestral locus Anc_3.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685460.1"
                     /db_xref="GeneID:11531103"
                     /db_xref="GOA:G8BT55"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="InterPro:IPR019175"
                     /db_xref="InterPro:IPR027105"
                     /db_xref="UniProtKB/TrEMBL:G8BT55"
                     /translation="MEEEDFFKDLENDLKGSDNEVGSEVGLEVEMHGANVDSDIENPI
                     EYLKEFLNGKKCLLIKDLEAMRNHEILNVINEYNVTIKLLDRIKLENGIVEVASILNK
                     YSKIIQEESSNVFAYIKILYKPRFPELETLLTNPIDFIEVLKLLEENITEISNDDYIA
                     TLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARGKLSSVLELLNILMNSKTEAVQ
                     YLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVPSCNLASIGKKKYSSSAQHI
                     TSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAARVDAGLQIAADTRTDNS
                     LGIKWKEEILDKVRKLNEAPNIALVKPLPVPQDSNKKKRSGRRFRKYKEQFQLSNIRK
                     LQNRMEFGKEEQTYMDSTGEEVGLGMINLSLKEASGMAQGITKRTNNSAKLTKKLKHR
                     LQDANMQTEDYINSLSNTLNQ"
     gene            <825250..>826989
                     /gene="TPHA0D03940"
                     /locus_tag="TPHA_0D03940"
                     /db_xref="GeneID:11531125"
     mRNA            <825250..>826989
                     /gene="TPHA0D03940"
                     /locus_tag="TPHA_0D03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685413.1"
                     /db_xref="GeneID:11531125"
     CDS             825250..826989
                     /gene="TPHA0D03940"
                     /locus_tag="TPHA_0D03940"
                     /inference="similar to DNA sequence:INSDC:YGR092W,YPR111W"
                     /note="similar to Saccharomyces cerevisiae DBF2 (YGR092W)
                     and DBF20 (YPR111W); ancestral locus Anc_3.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685461.1"
                     /db_xref="GeneID:11531125"
                     /db_xref="GOA:G8BT56"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:G8BT56"
                     /translation="MNNRAAYGKIDRDLDVLAGDISNLSFDVGNQSAFRDRKPDLGPS
                     KYNKENSSNSTPFASPAKSTIFFNEEDNSRMEVDDSTREEIDIANSPKKLPRGFYEKA
                     ASNKTQRLVSVCQMYFLDYYCDMFDYVISRRQRTKKVLEYLTQQKTVPSVTNESLTTE
                     WNSYLHKENEILRKRRLKPKNKDFEIVTQVGQGGYGQVYLARKRDTKEVCALKVLNKK
                     LLFKLNETNHVLTERDILTTTRSEWLVKLLYAFQDSESLYLAMEFVPGGDFRTLLINT
                     RYLKSAHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVS
                     NERIESMKIRLEEVKNLEFPAFTEKSIEDRRYMYTHLRETEVNYANSMVGSPDYMALE
                     VLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKQTLRRPRLENGR
                     PAFSDRTWDLITRLIADPINRIKSFEHVKRMAYFNEIQFNGLRDLPPPFTPQLDSETD
                     AGYFDDFTNEADMAKYADVFKRQNKLSALVDDSAVDSKLVGFTFRHRKGKQGSSGVLY
                     QGSENSDPFATFY"
     gene            <827439..>828944
                     /gene="TPHA0D03950"
                     /locus_tag="TPHA_0D03950"
                     /db_xref="GeneID:11531020"
     mRNA            <827439..>828944
                     /gene="TPHA0D03950"
                     /locus_tag="TPHA_0D03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685414.1"
                     /db_xref="GeneID:11531020"
     CDS             827439..828944
                     /gene="TPHA0D03950"
                     /locus_tag="TPHA_0D03950"
                     /inference="similar to DNA sequence:INSDC:YGR093W"
                     /note="similar to Saccharomyces cerevisiae YGR093W;
                     ancestral locus Anc_3.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685462.1"
                     /db_xref="GeneID:11531020"
                     /db_xref="GOA:G8BT57"
                     /db_xref="InterPro:IPR006767"
                     /db_xref="InterPro:IPR006768"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="UniProtKB/TrEMBL:G8BT57"
                     /translation="MASIKVLVAHSNVQNIDDALAKLTKLNSKQGPFDALFMLGDLHN
                     SIKEIHTDGLPPTFYPSYNDDVTNTSTDLENHVTLLNNFGIYQLATGLKVVYTPHNFK
                     QLDDRKELILQKLEMFNEKVDILISHIGGSKHSKEAGRNSGSDIIDAILRKVEPKYHF
                     SYNDQLKYYENAPFQWKKSGRITRCMNIPVFGSKEKWAYAVLIELDDNESAYEVPPNI
                     GSNPFEESKQNKRGREAKYTTDIKVNPFTKETQMKKPKIVLPNQCHFCFTNPNIEDHM
                     FISINKNSYLTTAKGPLSVPKDEMPFSGHCLIIPIKHIPKISQSKTQEELLELNKELN
                     DYELSIARMNFIKYDMSTIVFEISSSTSFHFHKQVIPVPKYLIFNFSSALDRQLYFNN
                     EKFKLNGNLNFKQYTVGSSEYNDIVNDKNIEYMQFKVYETSEEQPIVYLSTFLTGEKI
                     DLQFGRRVIAYVLRYPKRIMWNSPTCQQTKEQEIEDVKKFQSGYKNYDISN"
     gene            complement(<829035..>831653)
                     /gene="TPHA0D03960"
                     /locus_tag="TPHA_0D03960"
                     /db_xref="GeneID:11534388"
     mRNA            complement(<829035..>831653)
                     /gene="TPHA0D03960"
                     /locus_tag="TPHA_0D03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685415.1"
                     /db_xref="GeneID:11534388"
     CDS             complement(829035..831653)
                     /gene="TPHA0D03960"
                     /locus_tag="TPHA_0D03960"
                     /inference="similar to DNA sequence:INSDC:YPR112C"
                     /note="similar to Saccharomyces cerevisiae MRD1 (YPR112C);
                     ancestral locus Anc_3.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685463.1"
                     /db_xref="GeneID:11534388"
                     /db_xref="GOA:G8BT58"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BT58"
                     /translation="MSRIIVKGLPVYLTDDKLKEHFVARLKTTHPNTTSLVDSLITDV
                     KILKDKNGTSRRFAFIGFLTEDDARDAIRYFNGSFIDTARIQVSEATSFADPNRPKSV
                     KEKRMEALKRVREREQRLLEEEEANKKVKIDKNEKRHAIDAEIEKNKQLKEFMETMKP
                     NSQVSSWENASVSTSTNPLLAAVQNQDEDDRSNGSNPLLQHALSMKGDDIVADKESDD
                     EYEDFNKPTTVEDADEQMVSLDNFNSNTQDHQEVSNNEDEKNLGQDETVSDLDWLKQR
                     RIRIRDGENEEAKPRPINKENEGGNDTVEEEKIPGVEAEPEKSQEELAIEKISSTGRL
                     FLRNILYTSTEKDFRDLFEPFGELEEVHVALDTRTGQSKGFAYVLYKDSANAVQAYIN
                     LDKQIFQGRLLHILPGESKKSHRLDEFDIKNMPLKKQRELKRKDTASKQTFSWNSLYM
                     NQDAVLGSVASKLGIEKSQLIDAENSNSAVKQALAEAHVIGDVRKYFEDKGVDIASFS
                     VLRSTNKRDDTVILVKNFPFGTTVEELSDLFLPFGKIDRFLMPPAGTIAIIQYRDVTS
                     ARAAFRSLAYKRFKSGIIYLEKGPSNCFTRDANATDGVESSTPKEEEVKEIKPSIGDM
                     MEVKTSNNEEQDSTDNVVDGPTVSIFIKNLNFSTTSQQLSQQFKNFNGFIVAQVKTKS
                     DPKIEGKILSMGFGFAEFKTKEQALAAISAMDGSVIDGHKIQIKLSHRQGTASKSNVS
                     QRKPSGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKE
                     AENAMDQLQGVHLLGRRLVIQYAQAEAVDAEEEISRMTKKARKQMATREYGSLKSSGG
                     RKKLEMDDGDDGLDGP"
     gene            <832760..>836191
                     /gene="TPHA0D03970"
                     /locus_tag="TPHA_0D03970"
                     /db_xref="GeneID:11531135"
     mRNA            <832760..>836191
                     /gene="TPHA0D03970"
                     /locus_tag="TPHA_0D03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685416.1"
                     /db_xref="GeneID:11531135"
     CDS             832760..836191
                     /gene="TPHA0D03970"
                     /locus_tag="TPHA_0D03970"
                     /inference="similar to DNA sequence:INSDC:YGR094W"
                     /note="similar to Saccharomyces cerevisiae VAS1 (YGR094W);
                     ancestral locus Anc_3.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685464.1"
                     /db_xref="GeneID:11531135"
                     /db_xref="GOA:G8BT59"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BT59"
                     /translation="MLNFNNKLITFSSKRLLNFSYSKFSTNKTLINKDLYSLDSGFGA
                     RYYSLFSNNNNCYRSGVVNSSKKRNLLSTNFNQLRFFKMSDLDNLPPVDPVTGEVIIN
                     PLKEDGTEKTPKEIEKEKKKAEKLLKFAAKQAKKAATASTNDAKPKKPKAKKEVEPVP
                     EFVDKTVSGEKKILVSLDDPSLKSYNPANVESSWYDWWVKSGFFEPEFTEDGKIKSEG
                     LFCIPAPPPNVTGALHIGHALTISIQDALIRYNRMKGKTVLYLPGFDHAGIATQSVVE
                     KQIWAKEKKTRHDYGREAFIDKVWEWKEEYHNRIKNQIHYLGASYDWNREAFTLDPKL
                     SNAVVEAFVRLHDEGTIYRANRLVNWSVKLNTAISNLEVENKDIKGRTQLSVPNYDEK
                     VEFGVLTSYSYEVVDSPTNEKIIVATTRPETLFGDSAVAVHPEDPRYKHLHGKFVQHP
                     FLPRKMPIICDSEAVEMEFGTGAVKITPAHDQNDYNTGKRHNLEFINIFTDDGLLNEN
                     CGPEWQGMKRFDARTKVLEKLKETGAYIGQEDNEMTIPTCSRSGDIIEPLLKPQWWVS
                     QGEMAKDAIKAVRNGEITITPKSSEAEYFHWLENIQDWCISRQLWWGHRCPVYFIDIE
                     ERECDRSDGSFWVAGRSIEEAQEKAAAKFPDAKFSLEQDEDVLDTWFSSGLWPFSTLG
                     WPEKTKDLETFYPVSMLETGWDILFFWVSRMILLGIKLTGSVPFKEVFCHSLVRDAQG
                     RKMSKSLGNVVDPLDVIGGIKLEDLHSKLLVGNLDPREVEKAKLGQQESYPNGIPQCG
                     TDAMRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYQPPATEGL
                     SGSESLVEKWILSKLAHTSKTVNEALENRDFLNSTSAIYEFWYLICDIYIENSKYLIQ
                     EGTPAQQKSAKDTLYILIDNALKMIHPFMPFISEEMWQRLPKRATEKAESIVKASYPL
                     YKAEYDDVASAAAYELVLDITKEARSLLSEFNILKNGKVFVESSDESSFATATSQQDS
                     IVSLIKAIDEVVVVSSSSQIPQGCVLKSVNPEVNVHVLVKGHVDIESEISKVQKKLEK
                     ATKSKQGIEKTMSSKDYESKANEQAKEANNAKLENTIAEIEGLEATIRNLEALKL"
     gene            <836589..>837581
                     /gene="TPHA0D03980"
                     /locus_tag="TPHA_0D03980"
                     /db_xref="GeneID:11534425"
     mRNA            <836589..>837581
                     /gene="TPHA0D03980"
                     /locus_tag="TPHA_0D03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685417.1"
                     /db_xref="GeneID:11534425"
     CDS             836589..837581
                     /gene="TPHA0D03980"
                     /locus_tag="TPHA_0D03980"
                     /inference="similar to DNA sequence:INSDC:YGR096W"
                     /note="similar to Saccharomyces cerevisiae TPC1 (YGR096W);
                     ancestral locus Anc_3.435"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685465.1"
                     /db_xref="GeneID:11534425"
                     /db_xref="GOA:G8BT60"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BT60"
                     /translation="MAQHTDHLRKGEDVYVAMSIVAGGLAGLTARSLTAPLDTVKIRL
                     QLLYKSIELDPRIKVNNSILTSMITRMYKKEGILGFWKGNVPGSLMYIIYGATQFGSY
                     TYINSLFSHNHVLNQLPSQVYSTLVGALTGITSSTISYPFDVLRTRFAANQSTRNLRL
                     YATIKDIFRNEGTLGFFRGINSSILAITLSNAIIFGTYESIKIYSEEQLTLLENTSSN
                     SCYVPYKFAYQILNGSAGSLSGLISKLVTYPLDTIRRRIQVSTPHSIHLLAEHKNVYK
                     SYFKMNFIAVGMKIMRDEGKLSLFRGLGINLIKTVPNSAIYLYAYEYFVSQLKN"
     gene            <838412..>839089
                     /gene="TPHA0D03985"
                     /locus_tag="TPHA_0D03985"
                     /db_xref="GeneID:11534434"
     mRNA            <838412..>839089
                     /gene="TPHA0D03985"
                     /locus_tag="TPHA_0D03985"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685418.1"
                     /db_xref="GeneID:11534434"
     CDS             838412..839089
                     /gene="TPHA0D03985"
                     /locus_tag="TPHA_0D03985"
                     /inference="similar to DNA sequence:INSDC:YPR113W"
                     /note="similar to Saccharomyces cerevisiae PIS1 (YPR113W);
                     ancestral locus Anc_3.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685466.1"
                     /db_xref="GeneID:11534434"
                     /db_xref="GOA:G8BT61"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014387"
                     /db_xref="UniProtKB/TrEMBL:G8BT61"
                     /translation="MSSKQAKQEKKLVTSNDVFLYIPNLIGYSRVVTAVLSFMAMPNH
                     PMYTALIYTVSCLLDALDGTMARKYNQCSKFGAVLDMITDRSTTSSLLCFLSILYPKY
                     CIIFQILLSLDLSSHYIHMYSTLIDAKNETKSHKSIDENSNYFLKLYYSNRTVLFMIC
                     AFNEIVYGGIYLIGFQKYAKVGYFLFYISLPGFLFKQFTNILQLQRASIILASIDADD
                     ANKANKY"
     gene            <840525..>843173
                     /gene="TPHA0D03990"
                     /locus_tag="TPHA_0D03990"
                     /db_xref="GeneID:11534132"
     mRNA            <840525..>843173
                     /gene="TPHA0D03990"
                     /locus_tag="TPHA_0D03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685419.1"
                     /db_xref="GeneID:11534132"
     CDS             840525..843173
                     /gene="TPHA0D03990"
                     /locus_tag="TPHA_0D03990"
                     /inference="similar to DNA sequence:INSDC:YGR097W,YPR115W"
                     /note="similar to Saccharomyces cerevisiae ASK10 (YGR097W)
                     and YPR115W; ancestral locus Anc_3.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685467.1"
                     /db_xref="GeneID:11534132"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="UniProtKB/TrEMBL:G8BT62"
                     /translation="MTDVLNKQGTADATANYSVIYHSSVPAPVQYTENNVANNQAKTV
                     HVDAIEQLDEENAQAQLVHEYPTDLLIDRFTKYRNIIKALIVYFSEIAYTQEQLGRIN
                     QKIIDKSIKFDVLNDIDANSNKLMDPLVSKIPKKLQQPSTLMQITTLEDSDKKDISST
                     AVGENDTSLSSEELIIGNSGFVKFGSGSVQDLQVILKKYHLSLASQQYKISKEIMSTI
                     IPSLEKLKKNLALKIKEIKSLHDDFKTNLADHLEVTNKLLNKFVSSTHVFAETACENV
                     NGKDKLSNAEADPYLLKLQLELQLKRQLIEENYLKSAFINLQSSGMKLEKIVYTTIQN
                     SLNKYSALINSEARLIIKNLCHELNDGIHSKSPTYEWDHFISHHPNAFLNWKSSDPIP
                     QDRKLTDVQFPEMKSALSKCIRAGPLLKSSSLLPSKGGSKSTKEEETVHYFVLTSNYL
                     HEFENDGFFKSQIDDSTHPQPLSKNMIIQPLLSISLNDCEVIDFDEDSFTIIAKPLFN
                     SSLLLRSKVSSDLKSSVKKADGKGSNPGKIRKFLKGSNEKKQTSLTVKSNSPQVDFVL
                     QEIKAYEEMEKNNSEGEDIRVQWKISNTLLNPSELEIKKFKKWIFELKYLSAFNNNVE
                     RKEFIEDRLTLRDQAAVQAKGAHVGASNHSKSNKLGKMISNSSELAALSPLTNVNTPA
                     IDDTGNLITIGDRRMSHTAYSHSALRKPGESADGGASRSIGQAYVSSTPNTISSPRSV
                     PRSDYFNIVPSTSEGNTNSEESHSAVRPYTNQTVSSESKMFSSTEKMNRTNSNATSAS
                     TPPSITSLTVEHINDTESHPLKPILSNKSTVSQVKSQKGGKLNSFGKWISSRRSSVVS
                     QGSEDGRPENYISEAPIKLNQSIYQS"
     gene            <843641..>844309
                     /gene="TPHA0D04000"
                     /locus_tag="TPHA_0D04000"
                     /db_xref="GeneID:11534409"
     mRNA            <843641..>844309
                     /gene="TPHA0D04000"
                     /locus_tag="TPHA_0D04000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685420.1"
                     /db_xref="GeneID:11534409"
     CDS             843641..844309
                     /gene="TPHA0D04000"
                     /locus_tag="TPHA_0D04000"
                     /inference="similar to DNA sequence:INSDC:YPR116W"
                     /note="similar to Saccharomyces cerevisiae YPR116W;
                     ancestral locus Anc_3.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685468.1"
                     /db_xref="GeneID:11534409"
                     /db_xref="UniProtKB/TrEMBL:G8BT63"
                     /translation="MNKYGLKLNDISIKPIQSSRKVLYNIEAVKSPLITSFERWSGKR
                     KKILLNNKNFIDNFNLDTWKLTDNIFANLLSSDMRSELSTRTRLPKDFLLQLKATKIE
                     ESEREDSGKKVDFQTSLIQSKIGRNSYILNSKKLTSKLQFTYMKYIPNALLRNYIRVF
                     NVSDIKYCDEDNIEKYLDNINRLLKSTKRTLVKPVEFNEMYLKKDDIVINCCNDKVNL
                     ELKK"
     gene            complement(<844516..>849387)
                     /gene="TPHA0D04010"
                     /locus_tag="TPHA_0D04010"
                     /db_xref="GeneID:11534286"
     mRNA            complement(<844516..>849387)
                     /gene="TPHA0D04010"
                     /locus_tag="TPHA_0D04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685421.1"
                     /db_xref="GeneID:11534286"
     CDS             complement(844516..849387)
                     /gene="TPHA0D04010"
                     /locus_tag="TPHA_0D04010"
                     /inference="similar to DNA sequence:INSDC:YGR098C"
                     /note="similar to Saccharomyces cerevisiae ESP1 (YGR098C);
                     ancestral locus Anc_3.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685469.1"
                     /db_xref="GeneID:11534286"
                     /db_xref="GOA:G8BT64"
                     /db_xref="InterPro:IPR005314"
                     /db_xref="UniProtKB/TrEMBL:G8BT64"
                     /translation="MQDDPLMEMNVNSTPNLNMENTFHKNGENILRTTTCVTQTNISY
                     NDIEAQISRINVINQNFNASIQKYYDICLKFHNYQIKKVLIKKHLSCIVKLINSNNFD
                     RANVEILELYNTNNRQDQINNTRDILFVDFTVLNENYLQIIKILILQILLKTKKSFNE
                     IESERIVKLFMDDKRYMICSKTVDDSASRSKPTLSGIKIYHTLMKVILNFYNVLSPYK
                     LLFGLKFLEYLKAYDLKFENYITNISLAAFSNQLRCSVVNDNISKYLNSYYIQYSEYN
                     NNIDKIMISDILHETQLQKNDLNIQNRAFIELKCVSNTQLSIIFKYFQSVLLNKSIEK
                     TEINNVINQLDSIWRLIRLETFANNAKLIMKLFDLTIQFINLNVKNISSVNILETLLN
                     SLTEYTIIARNFKRLSNIIAVTYNCYMSLSYEIFLIKAAKLEIRRYILENNINSCSSF
                     LAKFSKFIMSTKDTKLRLELFQFLFNIDNLLENHTFTTILNFCKLTYIHCFSKMRLND
                     FLHFKNCSEVMLAVLYAYSSIRIPPNETWSNITNLLYYCISGILNAPSDAMSKFINIH
                     TPKSHALYKAELLIKSAYVLNLELSKHSTANLGTLTRSFIDKWMIKRVQSVSKEKISA
                     FEYDFVKLLLNYLTYNNFDPLTVELALLIKKHNYYANLHLQANYSLLHSFTNLRMLEE
                     IKLLNIEISTISMDFKNNSIDKILNYLNVKLQLQSQLNEKNEFEELFGKLLPATRPEL
                     FDINNSYNIPAPSYIKVLLFNIKLYNTASILQMNHNNVKEAIIEGKRSLKLAVSLIRK
                     SKILTENCRLELINLVSITYINLVNQYTKIGISRDSQFYITEFSHLLSQLGNPSVIYK
                     SLNFLHEYYSLSEQPDLADTVLQKANAAFEYIDGRYDINSLTSFLYRNKETSRVLESL
                     ELFFTNKLLNGKYLTIYWNLKLQNVTIDSVDLYYPDLIILNSINQFRASFLKVQKLMD
                     RDPFFKSIFDSVTSLPSCTFPKKEIPTSLNNGVSLKSSISSGICDSPRSSNMTPKGKS
                     MKQNFDRAVAIDTLLKSIEFVDNLDLSALSVHDLADIHSFYSLGTMLISNIQLQNTLT
                     KYEKKCFALADLSKTMPMQHEKDLAQIESNIYDSFSPMQITCNANIVENKINELIDYQ
                     KFIQSCSDVFNVISIDICPLTNHLLLSKIDSSSNKTIHVRLPLNRINSRELDTQCYTF
                     QDASDELNSIIKASNRSTSLEVTSNVSTKEEKKQWWKSRYDLDKRMEGLITKIDNSWF
                     SGFSSFFDPCPVNKQYFTEFQSKFYEILHDNLPTRKQYGNPKLFIKLEEWILELFIKL
                     DTSNESFLNMLEDLIYFVLDILLFHGEENAYDELDINMIFVQLEEEIKKYQSHQAKGD
                     FERSHTFLIISSVCHNFPFENLSFLEKRSVSRVPSFSNLITLIKNNNHKIFDKRYIDT
                     NISMVLNPNGDLIQTEERFKTQFSDIEATVPNSRFLCNDKPNEETFLQMLRTSNLFVY
                     VGHGSGEQFVRAREIMKLDMISPSFLLGCSSASIKYFGKLEPTSTIIAYLVGNCPMVI
                     GNLWDVTDKDIDLFSRKLFSNIKFIEDVEFGERKGAQRISLALSDARKVCYLRYLNGA
                     APVLYGLPIHFNK"
     gene            <850344..>858032
                     /gene="TPHA0D04030"
                     /locus_tag="TPHA_0D04030"
                     /db_xref="GeneID:11531065"
     mRNA            <850344..>858032
                     /gene="TPHA0D04030"
                     /locus_tag="TPHA_0D04030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685422.1"
                     /db_xref="GeneID:11531065"
     CDS             850344..858032
                     /gene="TPHA0D04030"
                     /locus_tag="TPHA_0D04030"
                     /inference="similar to DNA sequence:INSDC:YPR117W"
                     /note="similar to Saccharomyces cerevisiae YPR117W;
                     ancestral locus Anc_3.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685470.1"
                     /db_xref="GeneID:11531065"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:G8BT65"
                     /translation="MVFINDTLAFVEKQLTKMVSTCLWVIVAMLLFQLLLNLILKIVI
                     ANTSLKLGGIEYFYMGFFTLTSLRKIHIKTNKFSVNVDSISLEFKIFPYLLIKNILID
                     YYKPKHITGVNEPEDEFKKPFLPDEVAISKKIIKMVEWISFSRIRIHHLQVNIHDENN
                     PKTQVIDVDTITIGLPKFTTHHLKIDLLLYDFQSNDKLDAIKVITYSFSCKLHQHPKI
                     PGKLLLLHLDWSNSLKITDVKMHLSDKMVENMVTKMVETKQGTEMKTDIKNEGKNVFV
                     KGNLSHEEIESMIKSIICPYKVIIENLKVIDIKFENITFKNDFLKVKISISSTQVRLQ
                     AITDISTYNELLESTYISNNDENYDDDVNDNEFEDDTSKQEILNTQPIVKNTQKSKFE
                     DIELSLSFNSIHLSVNNKSLIRIPIINMLVTTDLMLYFLKNSHSYNDFKISFSINILN
                     PTLFISVDMIQKMAEYLNNTKTDLAKGNDSEFNNKSDSISKQVENNITTDENQLIEQI
                     NIDKTSLKNILEEVPSFLIELNISNFNIYLQISNDESINLKIYDIKLFLINNYTVITK
                     LKNSSKIVQNKNELFEQLPIKDPLTKDLNSFFKIINVSLAYKKNNTLSTAEVVPIYQF
                     ERYVVILDNLSPEKITSVATLRKSDFTLLDIEVLGKLINTYSVLKEYSQMIKSSIRKT
                     KSKSVKKKIIFSIEWSAKLRVKDMSFSVLISNYLPALLDPCANDDGNLSDVIRGFTLV
                     FHESIFEASNVQRQLSIAKIELIRVMDHCEAKNICDDVFKLGNLSFTDKYDDVLSKCI
                     HKVRVPEVYLKFDVNLIWIIFYLKKIYADHVTLLRSKKRKIVSKADKPSNSILHLSFS
                     KVIFDVNLPENVSLFFDIKDIYYSNHNKKLKILNILGYVRSVYVHDLPVNVELLNIKN
                     MVFCSNSHTEGKTFIVDTELIRLRTEYHFKFYEVVNNIISTFKSYKQLAYSFSDLSGF
                     HRFHPKVENPKKIPTINIRAKKFLIDVEEDPFEQELGLIFKIGVLEQRERLAKLEEFE
                     EQKSILREFENFNNNNNVQPDHKQNTNSFENLAKQRLYELFSTSWISRHRTAKLKFHG
                     MPYHIKPFQEFDKVYYRFTGKATTTVANLVVKDLDMTLKQPSFPVENFFDFIHEMGKG
                     VPKSMSYTILILLGIDIKTKLWQLKIRDYPVPVITIPDTRTTGDLVFAEKMPGDLALR
                     TTFVPFVPSATLSKYAETSSIYGSHVIGTMNSIKTYFNIHTKVTSNSGTNITWGKSFQ
                     PGYQSLMMWFDFLTKPQMDPSPKLGFWDKFRFLVHGSWRYEFGENSDLRLNIKGAHNP
                     YKITDDGAGLSFCWSGGTILNINGENNPREFLLINSASFKLVVPDFTDENKFDKILMN
                     LEGGVKWTLGLLFEEGKLALAGDEKRSTPVRPHYDVTLINPKYVYNREDYDSWRGFRS
                     NFIHMSFGIYSGKDASNNNIYLAPYTMSHFFKWWNLFDTYTSGPIRQGPLFPNMIQNN
                     NKFGRSLFTIKYQLYLAPLTITHIYRHATSEDDKGIHSSVKFTGIKCKTKSLKIDLHQ
                     KRIKLTHTNEKLNKSKPVWKLRMSKGEVDCEEADYRLISTTFDDANIEKTIASRLGLR
                     CKKEKQFASENINSLKDSEWYDINDYVDLNQISLEAATPIKIDIKPFVSTPRITYFRK
                     INDEGYDVRYPFGAEPSHRCIIGKNHPERTQEHLANQRSIEIQGQISELQQKISEIDK
                     LSEMHPDDNDITLKKNNLYAKFSNILTRYDMIDEILSDLKISESLPLDGDLHSNFNES
                     MISADLNSINDNNSLLRVNTLNSFVSMRRGSTIEAKSTYDNRFMIHNVTIKIDNDIKN
                     HLLEYASSSSERRSTQFYCTYKSVTIVKELLDNFFANTIPAITEYGLLNNDETCTSTE
                     FIERFDELTHKLPNENYDSIDSYLIQLISPQVQITSECEPDTALLITATEIETGIIDV
                     MQIMSKSGKIIDADVNTIVESRYCSVSKELQVFTLFKKDIPMFQNMGLLVPSEADKSQ
                     SLCWVPWLPLELCFDGSLLDEHMILKRRSLFLRYTSPNPLFVSDNAAADFSKDSRVDI
                     GFPNLVITCTSQQYNSVYNIAHELMSLGTSMDEKADKLSKLLLADEVRNNLEKLDISV
                     VVNLQRKLRELYYTREFLKTYDTKLYKSTEQELTLEIQATQLELSVLMSAVKRNYDSI
                     GSGNNSRKLLNWKVSTDELIWELSDSNNRQFITIGLGPSSFVRSQTADGSNSNVISIQ
                     SLQIYNQQQKLVYQQLIAPFEDNPHYTKDMPMLEIFWLLSSPVGGISVLEEMIVSFQP
                     IIFRMDHITADKLMNYLFPKNETADSAGARTLVREHHTAQMYNTSEANSETQSSSPVS
                     PVSERSGADSITSGKTTTVREMRKVSSTFIRPTEESINEMVKRSGTYINIKSVTIKKM
                     MMSISYKGAHSVLTNVDDLIVKVPTLQYHNKIWSREELFSAIKKDVIMVVLQHTGNII
                     GNKFIPHKKENKKKVSLEISKLLKSGDDKKNAPSKKSSYKIDHHSFHTSKQKPPVVNI
                     IIEEDEDGDEIKAFYPNDTTSNDG"
     gene            complement(858440..858521)
                     /gene="TPHA0Dtrna8L"
                     /locus_tag="TPHA_0Dtrna8L"
                     /db_xref="GeneID:11531087"
     tRNA            complement(858440..858521)
                     /gene="TPHA0Dtrna8L"
                     /locus_tag="TPHA_0Dtrna8L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUC"
                     /db_xref="GeneID:11531087"
     gap             859073..859257
                     /estimated_length=185
     gene            <861865..>863403
                     /gene="TPHA0D04040"
                     /locus_tag="TPHA_0D04040"
                     /db_xref="GeneID:11530978"
     mRNA            <861865..>863403
                     /gene="TPHA0D04040"
                     /locus_tag="TPHA_0D04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685423.1"
                     /db_xref="GeneID:11530978"
     CDS             861865..863403
                     /gene="TPHA0D04040"
                     /locus_tag="TPHA_0D04040"
                     /inference="similar to DNA sequence:INSDC:YGR108W,YPR119W"
                     /note="similar to Saccharomyces cerevisiae CLB1 (YGR108W)
                     and CLB2 (YPR119W); ancestral locus Anc_3.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685471.1"
                     /db_xref="GeneID:11530978"
                     /db_xref="GOA:G8BT66"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G8BT66"
                     /translation="MVVSIDSDEATNYNNHNGRATNLLRSIQRAALNNVTNTALSQEM
                     NLNNSNISNNNNALTSFKEALPGGRRDASKIPQLKKRTYPEPADIHVLERTASTYTSN
                     SIKSSPNSQSVTDSRNSNNYQNFEDKENIDPYYSASCTITASSDALSSIKEENEIENN
                     KELMDETNFQPTQEDIFTRENETVAGQNINSNYNIITEEDDINKKRPISQIAEYNIPK
                     KFKVCNENGEEEYVWEDLDAEDYNDPFMVNEYVNDIFDYLYHLEVITLPKKEDFYQHK
                     NIHQNRDILVNWLVKIHNKFGLLPESLFLAINLMDRFLCKELVQLDKLQLVGTSCLFI
                     ASKYEEVYSPSIKNFASETDGACTEEEIKEGEKFILKTLSFNLNYPNPMNFLRRISKA
                     ADYDIQSRTLAKFLLEISIVDFRFIGILPSLCSAAAMFLARKMLGKGEWDGNLIHYSG
                     GYVKSQIAPVCKMMMDYLVSPIVHDEFHRKYQSRRFMKASIISVQWALKVRKNGYDVM
                     TLHE"
     gene            complement(<863636..>864763)
                     /gene="TPHA0D04050"
                     /locus_tag="TPHA_0D04050"
                     /db_xref="GeneID:11534620"
     mRNA            complement(<863636..>864763)
                     /gene="TPHA0D04050"
                     /locus_tag="TPHA_0D04050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685424.1"
                     /db_xref="GeneID:11534620"
     CDS             complement(863636..864763)
                     /gene="TPHA0D04050"
                     /locus_tag="TPHA_0D04050"
                     /inference="similar to DNA sequence:INSDC:YGR109C,YPR120C"
                     /note="similar to Saccharomyces cerevisiae CLB6 (YGR109C)
                     and CLB5 (YPR120C); ancestral locus Anc_3.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685472.1"
                     /db_xref="GeneID:11534620"
                     /db_xref="GOA:G8BT67"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:G8BT67"
                     /translation="MENIEIIITSPESENSKVRLAQPASFKSSNDDFSATVRQCKENI
                     IKNNLTASLATKKRNYIHKTTHAATFTKDKKSSNAIETEITKRESLLRSIKNKDITLV
                     NEYSDDIFEYLYQHELNNLPTHNYSLAPDSQYYMRPAMRAILVDWLVEVHNRFEYTTE
                     TLLLAINLFDRFLSQNKVTMSKLQLLAITSLFVAAKFEEVNLPKVVNYSYLTDGAATE
                     EDIITAEKFMIQSLRFNISSPSPVSFMKRISNSDDLTDPSNMDSISQFLIEYTTCSSK
                     FIDLKPSLASSMSMYIARKINLQHSVWDDQIKKLSGNIDAMNDKQFQNLCKELIMEIV
                     TPSTKLTALTNKFQTSTYNEAYKKIENWCQHQISKDFAKLF"
     gene            complement(865859..865930)
                     /gene="TPHA0Dtrna4C"
                     /locus_tag="TPHA_0Dtrna4C"
                     /db_xref="GeneID:11531089"
     tRNA            complement(865859..865930)
                     /gene="TPHA0Dtrna4C"
                     /locus_tag="TPHA_0Dtrna4C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:11531089"
     gene            <867294..>870899
                     /gene="TPHA0D04060"
                     /locus_tag="TPHA_0D04060"
                     /db_xref="GeneID:11534584"
     mRNA            <867294..>870899
                     /gene="TPHA0D04060"
                     /locus_tag="TPHA_0D04060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685425.1"
                     /db_xref="GeneID:11534584"
     CDS             867294..870899
                     /gene="TPHA0D04060"
                     /locus_tag="TPHA_0D04060"
                     /inference="similar to DNA sequence:INSDC:YPR122W"
                     /note="similar to Saccharomyces cerevisiae AXL1 (YPR122W);
                     ancestral locus Anc_3.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685473.1"
                     /db_xref="GeneID:11534584"
                     /db_xref="GOA:G8BT68"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8BT68"
                     /translation="MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSRE
                     MASCSLSVATGSHNDPSVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAY
                     TTGEQTTFYFEIPCLFTSSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGN
                     TCNLTKILYHATRLLANSKHPFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNA
                     SNMTLCIKGPQSVNVLTKYALTYFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQ
                     ESAMSKGNEEDCRLEDFHILSNAYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFP
                     IDMDDDYFNKDDLLRFIMVWCELFGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVG
                     LVVELSLTGTGVKNQELIINSICNSAIEKLSEANDTELARFLSECNTIDIIRFINKGK
                     EDTSMDEISEISSRLQENLALNRPSFLLKEFPFINDYSETGISNFEENEWSKNWWLSK
                     AYNFQQFLKRYVNRKNLRILFLGDIETPKFTTLTEDLKVYSTDPFYDFEYITFKYKFK
                     ANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAILSANLEAILKRNESIGYPIIYNNSIE
                     SKPGLVLKNSNQETWVLNSPLQHSSTESSIFSFEITNWSIKPSPASTMHLEVLGQLLG
                     ILMTRELYPALRLGYTYEIGASVNGDVKLMITISGFQSGIMSLLQNIIKICNSISIKN
                     PTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIMLEKHMWTLEDRFDALEESDI
                     NSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLIYDHWILSDTISLNYFEKNNILST
                     CFLKPGENVYFQHPGDEGDINNCINYFIQTGERNNEYIATLTSLTDYIMQSNLVSELR
                     NRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLERSIDEYMWRLENDTIGSLNEST
                     FKLTFLLPFINTMQKDTNNPFNNVTNVNLVDDVVANVQAGDSVNFETQQMKLHNNLKK
                     RIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATISINSKNRSKISIHIISLMAK
                     EEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPSKLLKEIVKYFKKKDEAKK
                     LYFIIIKEIIKIISMTVINSSSITTKSTSKKNNWQTEPIKSALPLVLVNDIKAYK"
     gene            <871194..>872402
                     /gene="TPHA0D04070"
                     /locus_tag="TPHA_0D04070"
                     /db_xref="GeneID:11534607"
     mRNA            <871194..>872402
                     /gene="TPHA0D04070"
                     /locus_tag="TPHA_0D04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685426.1"
                     /db_xref="GeneID:11534607"
     CDS             871194..872402
                     /gene="TPHA0D04070"
                     /locus_tag="TPHA_0D04070"
                     /inference="similar to DNA sequence:INSDC:YGR111W"
                     /note="similar to Saccharomyces cerevisiae YGR111W;
                     ancestral locus Anc_3.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685474.1"
                     /db_xref="GeneID:11534607"
                     /db_xref="UniProtKB/TrEMBL:G8BT69"
                     /translation="MSAINNNNLSFELTSDWDIIHFTHLSNGVKWAGLLTLEEYADRE
                     YMLGTSEISTKNENDIFIQEHPTFAEWLGIKHFILKDTSLPIGNAKTDQIVSSCETLN
                     RLGYCINPKRGNSIEPALILCIGGVWTQENHRGKKYAEQMIASLNKFYDEIRNRHDAP
                     VAIKNMVITLYSEVGEYYKRVGYTSRHIPIHELTKLDQIGEEYCNGIQQPVGKFLGFS
                     DYEDLVKLHVSKYARTLLKLHVEHPNSFVFTVAADIDIYKWFQHRDEFIKNKTKKGES
                     GVSKFGFRFNDDNTHVIWHHNWNDDTLIIVTLFYGEESLSNDGSRMKQIMSLAIQECK
                     DQKLSKLEFWNEEIPIKEQYPELYSTLSRLEPEGHLFKENGSISAFKSPPGYGPEEVE
                     WANNTKFCWF"
     gene            <872760..>873911
                     /gene="TPHA0D04080"
                     /locus_tag="TPHA_0D04080"
                     /db_xref="GeneID:11534140"
     mRNA            <872760..>873911
                     /gene="TPHA0D04080"
                     /locus_tag="TPHA_0D04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685427.1"
                     /db_xref="GeneID:11534140"
     CDS             872760..873911
                     /gene="TPHA0D04080"
                     /locus_tag="TPHA_0D04080"
                     /inference="similar to DNA sequence:INSDC:YGR112W"
                     /note="similar to Saccharomyces cerevisiae SHY1 (YGR112W);
                     ancestral locus Anc_3.457"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685475.1"
                     /db_xref="GeneID:11534140"
                     /db_xref="GOA:G8BT70"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="UniProtKB/TrEMBL:G8BT70"
                     /translation="MISCRLPIFKTRIQPLLFKGTVSRLPLINRNNSNGVKQFNRTVI
                     TSIVDWKPLKSKKRPDEDEAKSSGIGKKIVLGLMFAMPIISFYLGTWQLRRLAWKNKL
                     IASCEDRLSYKVIPLPAHFKYEDCENWEYRRVSLKGHYVHQEEMFVGPRVKNGFKGYV
                     LYTPFIREDTGEKMIIERGWISEEKVAPSERSLRHLSLPQGTTEIVCLVRVPKHPSSM
                     QWEKADKNSRVWEVADIFDMAKVTNSVPVHLQFIYDMTDHVVFNNKNASNNGNLSWSW
                     EFWQNNKNDSPVPITSGNANANSKSGYTNAEVIEFSEEQFRRAGVPIGKLPKIDFKNN
                     HLQYIVTWYGLTFLSSIFLIVALVKMRKGNTASQAALKKEKLNHAKKYM"
     gene            <874264..>875379
                     /gene="TPHA0D04090"
                     /locus_tag="TPHA_0D04090"
                     /db_xref="GeneID:11534591"
     mRNA            <874264..>875379
                     /gene="TPHA0D04090"
                     /locus_tag="TPHA_0D04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685428.1"
                     /db_xref="GeneID:11534591"
     CDS             874264..875379
                     /gene="TPHA0D04090"
                     /locus_tag="TPHA_0D04090"
                     /inference="similar to DNA sequence:INSDC:YGR113W"
                     /note="similar to Saccharomyces cerevisiae DAM1 (YGR113W);
                     ancestral locus Anc_3.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685476.1"
                     /db_xref="GeneID:11534591"
                     /db_xref="GOA:G8BT71"
                     /db_xref="InterPro:IPR013962"
                     /db_xref="UniProtKB/TrEMBL:G8BT71"
                     /translation="MNQNKSKSVSARAPTEYKLSNSSNPSSRRTSLGKGLSESNGLYI
                     PGDNFFNTTGRIGNESINGGTTTNMSRNIATGGTSSELDFIKEFLLPSIRSLNDSMNT
                     LDKNFSDLNIIQENLIDFNESLSALLYGMMFNSWCVAYPSIPSDIKVELDKVNILDSI
                     TLERHELQRRIAALQNTHNNAASGDASIANNRFVQPSLTVEQVKKHNNRLQEMGYEDD
                     RLSDDAYINELHNYDEDDEVNSEASFVLNPINNVAGHASQPHTVNSLGPSNVSSNSHK
                     NKQRNSKLRRKSILHTIRNSIATQRNVTDARTGINDIGTSATRITGNNTRGQVRKPSN
                     RATSRTYPADNQPKDSEAHIATRGVNRSHTDARPPFR"
     gene            <876429..>877577
                     /gene="TPHA0D04100"
                     /locus_tag="TPHA_0D04100"
                     /db_xref="GeneID:11534574"
     mRNA            <876429..>877577
                     /gene="TPHA0D04100"
                     /locus_tag="TPHA_0D04100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685429.1"
                     /db_xref="GeneID:11534574"
     CDS             876429..877577
                     /gene="TPHA0D04100"
                     /locus_tag="TPHA_0D04100"
                     /inference="similar to DNA sequence:INSDC:YPR124W"
                     /note="similar to Saccharomyces cerevisiae CTR1 (YPR124W);
                     ancestral locus Anc_3.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685477.1"
                     /db_xref="GeneID:11534574"
                     /db_xref="GOA:G8BT72"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:G8BT72"
                     /translation="MDMTMASEAMSSSISSSMSSSMAMAMSSAMDEINASMSSMMAMT
                     MSGMSSSMGAMGSTATASAATSSSTSGMAMSGMDMGMDMDMEMNSYLTINYNKYPVLF
                     KNLYADTNAKAFGIFVLIMVACFFYKFLLFTSWCLEVHWFKTWNKNDKKNDVNALRYP
                     QQSAAQDGYLSDSTLYTPDIPRLPNILAEIFMPNVFEYGHDILRLVLTFCSTLLIYML
                     MLICMTFVLTYLFGVVLGLTLAEIFFNRCKLCLLKRWEIKKEIDRINKCPGSTNCECG
                     RHKNTAPGTKACKANAPIQPFGSNSSNMSSQFSLDNDKDLNFEGKQDGCCCTVEQGSL
                     KDETNEDRCECGDARDSISNELMGNVIPQQDQSDMMNSTLLPPEKVLK"
     gene            <878259..>882665
                     /gene="TPHA0D04110"
                     /locus_tag="TPHA_0D04110"
                     /db_xref="GeneID:11531083"
     mRNA            <878259..>882665
                     /gene="TPHA0D04110"
                     /locus_tag="TPHA_0D04110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685430.1"
                     /db_xref="GeneID:11531083"
     CDS             878259..882665
                     /gene="TPHA0D04110"
                     /locus_tag="TPHA_0D04110"
                     /inference="similar to DNA sequence:INSDC:YGR116W"
                     /note="similar to Saccharomyces cerevisiae SPT6 (YGR116W);
                     ancestral locus Anc_3.460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685478.1"
                     /db_xref="GeneID:11531083"
                     /db_xref="GOA:G8BT73"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017072"
                     /db_xref="InterPro:IPR023097"
                     /db_xref="InterPro:IPR023323"
                     /db_xref="InterPro:IPR027999"
                     /db_xref="InterPro:IPR028083"
                     /db_xref="InterPro:IPR028088"
                     /db_xref="InterPro:IPR028231"
                     /db_xref="UniProtKB/TrEMBL:G8BT73"
                     /translation="MSNEDLSLRGHENTAVTKDNEELIARDDEDNAPSDEEEGDDVFD
                     SSEDDADLDEDEDEARKIKEGFIVDEGEEDDGDDDELGAASGKKRRKGRRRREREEEE
                     DRLSEDDLDLLMENAGVKRTTESATSGGLKRLKRAGGNEETSEQEEAKVSSVTAESNK
                     LEDFFSDDEEEEEFNDSTARHHEEDEYDDEYGARESNHRQNTSDMTNKAGMLDELDDF
                     IEEDEFSDEDEETRKQRIEERKLLREQRMKQPVHVTGLSSDKIDEMYDIFGDGHDYDW
                     ALEIENEELEGNLDTEAVIEGNEDGESGIGPSKKKVSLQDIYDLQDLKKNLLTEEDMK
                     IRHTDIPERFQELRAGLVEYGNLSAEDKELEKNWISDKIAIEKNFPATYDLTEFKDAI
                     GNAIRFISEDNLEVPFIFAYRRNNISSTDRNGFVLTEDDLWEIVDLNIEFNSIIHKRD
                     YVKKFYEELQIQDSVVDEYFSNQSTASTAELNSLQDIYNYLEYKYAKEINDLLTKNTQ
                     KSGKKHLKNSNYEKFKASPLYAITKDIGITAEQIGENISSQHQINIPKDHETLKPMEV
                     IDNIITEHSSDLQVFVTNSKLSVDTVQKYTSMEISRNPKIREKVRNDFYKYYLVDVVL
                     TFKGRREIQRGSIYEDIKYAINRTPVHFRKDPDLFLRMLEAESLNLLTVKLHMSSHVQ
                     YADHLFQIALDTNNTSELGIEWNNFRKTAFNQALDTIFADISAEIKDDLSKSCKKLVA
                     RSVRHKFMSKLDQAPFVPNMENAKIPRILTITCGEGRFGSDAIIATYINRKGEFVRDF
                     KITDNPFDRSNPQKFENTFADIINNCQINAIGINGPNSKTQKFFKKLQDVIRQKKLLD
                     NNDKEIPIIYVEDEVAVRYQSSERAAQEFANKPPLVKYCVALARYMHSPLLEYANLSM
                     EELTSLSIHPNQSLLPRGLFVKAIETAFVDIVNLVGVEINKTTDNNYYANALRYISGF
                     GQRKAIDFLDSLQRLNEPLLARQQLITHNILHKTIFMNAAGFLYISWNEKRQRYEDLE
                     HDQLDSTRIHPEDYHLATKVAADALEYEPDAIAEKEDQGTMSEFIEILREDPDKKMKL
                     ESLNLEAYAKELENKTGQRKLNNLNTIVLELLNGFEELRNDFHPLQGDEIFQTLTGET
                     EKTFFKGSIIPVRVEFFRHNDIICITNSQVECVATAQQHSGAQYRRPANELYELGKTY
                     PAKVVFIDYENITAEISLLEQDVKHKYVPFNYSKDPTIWDLKQELEDAEYEKKITMEE
                     ARAKRTHRVINHPYYFPFNGHQAEEYLRSKDRGDFVIRQSSRGDDHLAITWKLDKDLF
                     QHIDIQELEKENPLALGRILVVEGQRYYDLDQIIVEYLQNKIRLLNEITSNEKFKTGN
                     KKDVIKFIEDYSKVNPNRSVYYFSLNYEKPGWFYLMFKINSQSKLYTWNVRLTHTGYF
                     LVNYNYPNVIQLCNGFKTLLKSNSSRSNGSGY"
     gene            <883147..>884445
                     /gene="TPHA0D04120"
                     /locus_tag="TPHA_0D04120"
                     /db_xref="GeneID:11534394"
     mRNA            <883147..>884445
                     /gene="TPHA0D04120"
                     /locus_tag="TPHA_0D04120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685431.1"
                     /db_xref="GeneID:11534394"
     CDS             883147..884445
                     /gene="TPHA0D04120"
                     /locus_tag="TPHA_0D04120"
                     /inference="similar to DNA sequence:INSDC:YPR125W"
                     /note="similar to Saccharomyces cerevisiae YLH47
                     (YPR125W); ancestral locus Anc_3.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685479.1"
                     /db_xref="GeneID:11534394"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:G8BT74"
                     /translation="MLNHGRLLGKQSLSNSTQLLYFKTTQATFVEKLSSRVAICSRSF
                     SNSHWVELEKLDKKKDILVTEKVVNPSLWVRIKQEASHYWHGTKLLGLEMKISSRLLT
                     KMTAGYRLTRREQLQFKRTTSDVIRLVPFAAFILIPFAELLLPVALKLFPNLLPSTYE
                     SKKDKQSKLDTLRKTRIDVSQMIKEQPSFLHPINITDGQKTMFKRFYKHVRETGEPES
                     REQLLQVARLFTDDTILDNVTRPYLVALAKYINLQPFGTDNMLRYRIRTKMSELKKDD
                     LTIYYEGLGQLSEAELRNACASRGMNIVGVPTSILKDNMSVWLQMRVRDKIPSSLLTM
                     ACAFNYGDAKSAKPLYEALCDVLSSIPDELYHEIKVNVIKEDKLSSKQKLVQLQEQNE
                     LMKEEAQQDKNSEISVNDDLSLDELDKSTEMKIKNTRKPN"
     gene            complement(<884607..>885575)
                     /gene="TPHA0D04130"
                     /locus_tag="TPHA_0D04130"
                     /db_xref="GeneID:11534547"
     mRNA            complement(<884607..>885575)
                     /gene="TPHA0D04130"
                     /locus_tag="TPHA_0D04130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685432.1"
                     /db_xref="GeneID:11534547"
     CDS             complement(884607..885575)
                     /gene="TPHA0D04130"
                     /locus_tag="TPHA_0D04130"
                     /inference="similar to DNA sequence:INSDC:YPR128C"
                     /note="similar to Saccharomyces cerevisiae ANT1 (YPR128C);
                     ancestral locus Anc_3.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685480.1"
                     /db_xref="GeneID:11534547"
                     /db_xref="GOA:G8BT75"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BT75"
                     /translation="MESFENALVGAVSSALANITVYPLDLTKTVIQSQIKFQKTEEKK
                     SEQGEEDVKSENEVYTGTLDCLRRIYMEKGIAGLYQGMSASIVNSFAQTFFYFFCYNV
                     IKSRYSKLRFLLKLTKKKRFSSIEELSLGIVAAILCQVFTTPIAVISTRQQTTGNTED
                     AKLENIIKDIIKENNGELHGFWKGLKVSMALSVNPSITYTAFGKLNELLIAARRATSK
                     DGNKINANISALSNFFLGMLSKMISTVITQPLIVSKASLQSANSKFSNFQDVLTYLYT
                     SEGLLSLWKGLGPQLAKGVIVQGLLFMYKGEITKCIRHLSNVQKKN"
     gene            complement(<887827..>889143)
                     /gene="TPHA0D04140"
                     /locus_tag="TPHA_0D04140"
                     /db_xref="GeneID:11534276"
     mRNA            complement(<887827..>889143)
                     /gene="TPHA0D04140"
                     /locus_tag="TPHA_0D04140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685433.1"
                     /db_xref="GeneID:11534276"
     CDS             complement(887827..889143)
                     /gene="TPHA0D04140"
                     /locus_tag="TPHA_0D04140"
                     /inference="similar to DNA sequence:INSDC:YGR119C"
                     /note="similar to Saccharomyces cerevisiae NUP57
                     (YGR119C); ancestral locus Anc_3.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685481.1"
                     /db_xref="GeneID:11534276"
                     /db_xref="GOA:G8BT76"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:G8BT76"
                     /translation="MFSFGKTANNTATTGNTGTTAGFSFGQNSNTANTSAAAPGGLFS
                     KPAAPQQTGSLFGGTPSQQAQPATSGLFGNTNPTTTTGGLFGNATTAPASGGLFGKST
                     GTQSAGNGLFGNTIAQPAQQQQQQPSLFGSNTLKSTQPSFAWTEQSQNNQQLSQPQQT
                     QQQIQQQQILQQQQQMFQNSNYPHQIQEQLIKCKELWDPSNNKSKLKSFVYNKVDETE
                     AILYSKPNTIPQEEWDAAIEKKPSKDMIPIEILGYDGLNQRNQLQRENVAQARVIFNQ
                     LLEKSTQLQQKHELSTSSRILKAQARNSEIEKRILKLGSQLAILKSRGLPLNAHEEKM
                     WDQFETLLKRSENPAGLGKTNELWARLAVLKEKAKTISEQLDNTLVVIDENGAKQNNR
                     DHVSEEHVENKIDKIAEILSNQQRGITYLNNVLVKDHATLDKLISK"
     gene            complement(<889694..>890488)
                     /gene="TPHA0D04150"
                     /locus_tag="TPHA_0D04150"
                     /db_xref="GeneID:11534589"
     mRNA            complement(<889694..>890488)
                     /gene="TPHA0D04150"
                     /locus_tag="TPHA_0D04150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685434.1"
                     /db_xref="GeneID:11534589"
     CDS             complement(889694..890488)
                     /gene="TPHA0D04150"
                     /locus_tag="TPHA_0D04150"
                     /inference="similar to DNA sequence:INSDC:YGR120C"
                     /note="similar to Saccharomyces cerevisiae COG2 (YGR120C);
                     ancestral locus Anc_3.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685482.1"
                     /db_xref="GeneID:11534589"
                     /db_xref="UniProtKB/TrEMBL:G8BT77"
                     /translation="MEDFELPIAAEINRDLFSDEIEVYKNDIESFDVDKFLMKNNLQY
                     IQLDSLIRSVDDLSRDVIQNLSAELINKYTDYTKFCLTYAIDGDKLNNNESLAELEKT
                     KTNLYEFISQLELLIAKDIPRTKEVISDTTSYLSKVNEIEQILVNHIRLNKTLARSKE
                     LSDALHHLCGSDVLDEPVILELMKQLNKLVLQTFAMLRELDDLDSPYIRHLRNDYQSL
                     IQTFQISMKILVEKCISDPDNYTNLATELVLIMKQTQQLTDAPSQE"
     gene            <890978..>893731
                     /gene="TPHA0D04160"
                     /locus_tag="TPHA_0D04160"
                     /db_xref="GeneID:11531007"
     mRNA            <890978..>893731
                     /gene="TPHA0D04160"
                     /locus_tag="TPHA_0D04160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685435.1"
                     /db_xref="GeneID:11531007"
     CDS             890978..893731
                     /gene="TPHA0D04160"
                     /locus_tag="TPHA_0D04160"
                     /inference="similar to DNA sequence:INSDC:YPR135W"
                     /note="similar to Saccharomyces cerevisiae CTF4 (YPR135W);
                     ancestral locus Anc_3.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685483.1"
                     /db_xref="GeneID:11531007"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022100"
                     /db_xref="UniProtKB/TrEMBL:G8BT78"
                     /translation="MTPKIVVKDIFDYGGKTLISLVSDNDTVIVANKKGMVKVLKADK
                     PEQEPEVIEIAQGLTSVHGDTNGTLILTNIEGNAFRYTIQTGKEQLLTRSSLPLHDSA
                     IVHSGRITVIGGDDLELSLINLENAGDSFQKETFKVDEQVSQLSCNSKTNILAVSFVN
                     GKVQFFSLNTAIPNKVHELSDYIPAVTYDLTFKDPLLENILGNDKDEDTDGSDDEDEK
                     ISDSEFCDDNRICTRTAWSPSGLLFALPCKDKTIKMFSIKNYELVKTLTTPDNVSVYF
                     IDLQFDCQYGNYIAAADLNNKIFVWKCDTGELIYSNAFKKQLTNISWRLQEDGTKLQL
                     IAGTWSGSIITIKDLAKTSEEAQTEGAKNSNLFVNSDISESENETEENQKDGANIDDL
                     DDKENLFTQEVDEEENTKRKVPYDDEEDFIEDDDGAGYVIPNKRHHFSSTHGGNATPV
                     AYSSGRPKPFQYTTISPGSTPFGSLDRRYLTMNTVGYVVTVRNNEQNSITISFFDLSR
                     FTETHFEDLFGYDICSLNENATLFAQSKSGQIHYRPHSAMHSNWTKVLPLQRDEKITS
                     VAATNKRVYIGTSFGYLRTFNIFGVPLAVEKVTPIVSLVANEFRIFIVHYSPFNGVSY
                     SLYEQGPQSSKYFQRESPLPIFVPQSGLGSSGRSNDLFTSFNPLGIKSMFFNIYGDPC
                     IFGSDNLLMVLSKWRSTMEARWVPLLDANIEIWKMSGGKETSDVSVWPLGLTYDVLNC
                     ILVKGKNFWPGFPLPLPSELGVRVPILVKSKVLQETKNKKKLQSEAEVAMSDDETKET
                     NEELEIPVNMAAEEEYIRSKVLSSLLSDTLENDGELYGNENEVLTSLVGTQDKSLLRL
                     FADACSEQNSDKAMSIVFELKQDRALNAAVKISERAEMLGLVRRINAIREAKFEEQMN
                     SIE"
     gene            <894124..>895845
                     /gene="TPHA0D04170"
                     /locus_tag="TPHA_0D04170"
                     /db_xref="GeneID:11530985"
     mRNA            <894124..>895845
                     /gene="TPHA0D04170"
                     /locus_tag="TPHA_0D04170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685436.1"
                     /db_xref="GeneID:11530985"
     CDS             894124..895845
                     /gene="TPHA0D04170"
                     /locus_tag="TPHA_0D04170"
                     /inference="similar to DNA sequence:INSDC:YPR137W"
                     /note="similar to Saccharomyces cerevisiae RRP9 (YPR137W);
                     ancestral locus Anc_3.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685484.1"
                     /db_xref="GeneID:11530985"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BRX5"
                     /translation="MERAESANKRKRSREERTPPNKNDEDITDPSSDEGSSMGEDEAV
                     DGSNDEELRSDEEFEEENPADKRRRLAKQYLENLKTEANDIVTKSVQDDTSDKYTQID
                     DYNNFNAEDLDREIIATRLKQDVAEQQGRVYRFIADKLLISEAKTSFTRVGENGLTSL
                     SCHQPIANRFELNDRIVNNKNANKIFAYTVSKDLQLTKYDISDFTQRPKKLNNVRGGK
                     KFVPESNLGFENTTEGHYDEILTVAASSDGRYVVTGGKDKKLIVWSTESLAPVKVIPT
                     KSNKGEVMSIIFRKGTDQLYAACADFKVRTYSINQFSQLETLYGHHDLVIDISALSLE
                     RCVTVGARDRTAMLWKIPDETRLTFRGGEDTNKLFKKWMNQNATEKQDGTIEYPDESE
                     APVFYGEGSIDVVSMIDDSHFVTGSDNGNLCLWSLAKKKPLFIERAAHGILPIPDDKQ
                     VSGEASEEIRKAQMQNNKITKPYWITSVHAIPYSNIFISGSWNGSLKVWKLNENLREF
                     SLLGELNNCKGVVTKIQAVESGKHGRETFRILATVAKEHKLGRWIDHVPGARNGIYSA
                     TVEQTSF"
     gene            896679..896752
                     /gene="TPHA0Dtrna4N"
                     /locus_tag="TPHA_0Dtrna4N"
                     /db_xref="GeneID:11531049"
     tRNA            896679..896752
                     /gene="TPHA0Dtrna4N"
                     /locus_tag="TPHA_0Dtrna4N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11531049"
     gene            complement(<897107..>898642)
                     /gene="TPHA0D04180"
                     /locus_tag="TPHA_0D04180"
                     /db_xref="GeneID:11534585"
     mRNA            complement(<897107..>898642)
                     /gene="TPHA0D04180"
                     /locus_tag="TPHA_0D04180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685437.1"
                     /db_xref="GeneID:11534585"
     CDS             complement(897107..898642)
                     /gene="TPHA0D04180"
                     /locus_tag="TPHA_0D04180"
                     /inference="similar to DNA sequence:INSDC:YGR121C,YPR138C"
                     /note="similar to Saccharomyces cerevisiae MEP1 (YGR121C)
                     and MEP3 (YPR138C); ancestral locus Anc_3.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685485.1"
                     /db_xref="GeneID:11534585"
                     /db_xref="GOA:G8BRX6"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:G8BRX6"
                     /translation="MTRGDGYLWKETYDGATVAFIILGASLVFFMVPGLGFLYSGLAR
                     RKSALSLIWAVLTATLVGMLQWYFWGYSLAFSSSAKDNKFIGNLDSFGFRNVYGGDPE
                     TYTTYPEIAFASFQMMFLCVTLSIIAGATAERGRLLPHMVFLFIFATVVYCPIAYWVW
                     APGGWCYQWGVLDWAGGGPVEILSAVAGFVYSYFLGRRRENLLINFRPHNVSMVTLGT
                     SILWFGWLLFNAATSLEPNLRSVYAFMNTNISAVLGGMTWCLIDFRLEQKWSTVGLCS
                     GIICGLVAATPSSGCITLYGSVIQGIVAGVVCNFATKIKYYLKVDDALDLLAEHGIAG
                     VVGLIFNALFAADWVIGMDGVTRHRGGWLTHNYKQMYIQIAYIAAVSGYCAVVTAIIC
                     FVIDKIPGLQLRVDEQAERNGMDEDQIGEFAYDYVEIRRDYYQWGVDTDNNYTTANGI
                     STDDDDTEEDAEATANKTKPTYNTQNNHTEANQESSNEDYSDLSSNIDHNVTTEKVTA
                     LNQ"
     gene            complement(<899419..>901437)
                     /gene="TPHA0D04190"
                     /locus_tag="TPHA_0D04190"
                     /db_xref="GeneID:11530945"
     mRNA            complement(<899419..>901437)
                     /gene="TPHA0D04190"
                     /locus_tag="TPHA_0D04190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685438.1"
                     /db_xref="GeneID:11530945"
     CDS             complement(899419..901437)
                     /gene="TPHA0D04190"
                     /locus_tag="TPHA_0D04190"
                     /inference="similar to DNA sequence:INSDC:YPR141C"
                     /note="similar to Saccharomyces cerevisiae KAR3 (YPR141C);
                     ancestral locus Anc_3.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685486.1"
                     /db_xref="GeneID:11530945"
                     /db_xref="GOA:G8BRX7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8BRX7"
                     /translation="MEILRTPERNHVSKSKIPSPILTSTSPKFFKQRDDDVSDKLSNH
                     ITLSYKEKITELNNLQQELYDKKLGFDLLKDELFEEAQKLNFLKLQFDKLQTEKLMKN
                     RRYRNQFIEYTNYSQEQDNKLKVLREGFEINKEQMRIENDSKVNKIMKEYSLKIATLN
                     ENQMFSMKKSRENLLDEVEKVNNEIKLLNYDEQFEEAYNAYEVVKRSEWLEEYHASWK
                     SALEETENLNGEKSKLLKRLSLLKKAHKAMKEQTKSLENRLSTLQHESNKIESTISQI
                     RYSIQEKESLIEEFSGVKPQLLQEITNWKKRTLLLDEEFKREESLRRINHNKIQELRG
                     NIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRIIVNDLKQLHAFTFDKIFGM
                     QDDNYEVFDDIKNLVQSSLDGYNVCIFTYGQTGSGKTYTMLNEKDGIIMQTIEYIVHF
                     AGNLHKLGWEYELEVEFIEIYNETIRDLLNPEAKHQHVIRHDDKKGTTEVTNTHKITI
                     KLTHNEDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE
                     HSTGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPF
                     RNSKLTYLLKNSLINKSKTLMYVNISPNINSIRETINSLRLARKVNTG"
     gene            902814..902887
                     /gene="TPHA0Dtrna8I"
                     /locus_tag="TPHA_0Dtrna8I"
                     /db_xref="GeneID:11534246"
     tRNA            902814..902887
                     /gene="TPHA0Dtrna8I"
                     /locus_tag="TPHA_0Dtrna8I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11534246"
     gene            <904705..>906429
                     /gene="TPHA0D04200"
                     /locus_tag="TPHA_0D04200"
                     /db_xref="GeneID:11534417"
     mRNA            <904705..>906429
                     /gene="TPHA0D04200"
                     /locus_tag="TPHA_0D04200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685439.1"
                     /db_xref="GeneID:11534417"
     CDS             904705..906429
                     /gene="TPHA0D04200"
                     /locus_tag="TPHA_0D04200"
                     /inference="similar to DNA sequence:INSDC:YGR124W,YPR145W"
                     /note="similar to Saccharomyces cerevisiae ASN2 (YGR124W)
                     and ASN1 (YPR145W); ancestral locus Anc_3.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685487.1"
                     /db_xref="GeneID:11534417"
                     /db_xref="GOA:G8BRX8"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR006426"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BRX8"
                     /translation="MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTI
                     MAHERLAIVGLDSGAQPITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPII
                     PLYMKYGAEAPKHLDGMFAWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFAS
                     ELKCLTDDCDSIVAFPPGHVYDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEK
                     AVRKRLMAEVPYGVLLSGGLDSSLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDN
                     GNLRSSGWSRLHSFAIGLPGAPDLIAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYH
                     LETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTE
                     SVKRVKNLHLSDCLRANKSTMAWGLEARVPFLDREFLDLCMNIDPSEKMINQKEGRIE
                     KYILRKAFDTTDEPNEKPYLPDEILWRQKEQFSDGVGYSWIDGLKDTAERVISDELFE
                     NPREHWGSDIPTTKEAYWYRLKFDALFPQPTAASTVMRWIPKADWGCAEDPSGRYAKI
                     HEQHIGAK"
     gene            complement(<906686..>906997)
                     /gene="TPHA0D04205"
                     /locus_tag="TPHA_0D04205"
                     /db_xref="GeneID:11530989"
     mRNA            complement(<906686..>906997)
                     /gene="TPHA0D04205"
                     /locus_tag="TPHA_0D04205"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685440.1"
                     /db_xref="GeneID:11530989"
     CDS             complement(906686..906997)
                     /gene="TPHA0D04205"
                     /locus_tag="TPHA_0D04205"
                     /inference="similar to DNA sequence:INSDC:YPR145C-A"
                     /note="similar to Saccharomyces cerevisiae YPR145C-A;
                     ancestral locus Anc_3.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685488.1"
                     /db_xref="GeneID:11530989"
                     /db_xref="UniProtKB/TrEMBL:G8BRX9"
                     /translation="MFSKMKALFHKPREINNQQGKPTSYVIDEDPLPKRSKKEILKRA
                     VSLKSIHHDKSKKSKNNKPITRYDIFNSHYGEQFHSKVSVIINREETANFFYYTDASS
                     K"
     gene            <908861..>912010
                     /gene="TPHA0D04210"
                     /locus_tag="TPHA_0D04210"
                     /db_xref="GeneID:11530933"
     mRNA            <908861..>912010
                     /gene="TPHA0D04210"
                     /locus_tag="TPHA_0D04210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685441.1"
                     /db_xref="GeneID:11530933"
     CDS             908861..912010
                     /gene="TPHA0D04210"
                     /locus_tag="TPHA_0D04210"
                     /inference="similar to DNA sequence:INSDC:YGR125W"
                     /note="similar to Saccharomyces cerevisiae YGR125W;
                     ancestral locus Anc_3.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685489.1"
                     /db_xref="GeneID:11530933"
                     /db_xref="GOA:G8BRY0"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="UniProtKB/TrEMBL:G8BRY0"
                     /translation="MPSRKKERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIF
                     DEFPLESTNSLTLPDSMSMKNNTVNINDKLVPDNSKNRTFYNDSIYPPENKTSMKSIT
                     VADILHRQTAELSKTFYDSNFTDKDVKDYIDIIDNDVATSNESDSNSTPEPYLGDEYD
                     QHRLAIRTQKSPNIADDEQSRLLTPSSSIIGAELDLEAHYDEFEPVRMDASSINRQNE
                     SKLIDFSQILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMGTAGISMFYISSI
                     ICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSLDVQEEIISTTIFCYVISSL
                     VTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFL
                     SYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIVALVPMLS
                     LNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGILHVPIN
                     VPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSPIAG
                     YLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTII
                     IIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKF
                     LDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNINDD
                     NIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGL
                     EWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQSSQRLMSL
                     PLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDVFSESK
                     DIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETM
                     LSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLLI
                     MSISDYRFKALLGYTLVNA"
     gene            complement(<912211..>913161)
                     /gene="TPHA0D04220"
                     /locus_tag="TPHA_0D04220"
                     /db_xref="GeneID:11530994"
     mRNA            complement(<912211..>913161)
                     /gene="TPHA0D04220"
                     /locus_tag="TPHA_0D04220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685442.1"
                     /db_xref="GeneID:11530994"
     CDS             complement(912211..913161)
                     /gene="TPHA0D04220"
                     /locus_tag="TPHA_0D04220"
                     /inference="similar to DNA sequence:INSDC:YPR147C"
                     /note="similar to Saccharomyces cerevisiae YPR147C;
                     ancestral locus Anc_3.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685490.1"
                     /db_xref="GeneID:11530994"
                     /db_xref="InterPro:IPR019363"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BRY1"
                     /translation="MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWI
                     PGNPGLLEYYEEFLKLLHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHK
                     IEIINKFAAYGRELIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKG
                     TQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFL
                     KDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRS
                     ELIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHVVDNYF"
     gene            complement(<913504..>915462)
                     /gene="TPHA0D04230"
                     /locus_tag="TPHA_0D04230"
                     /db_xref="GeneID:11530931"
     mRNA            complement(<913504..>915462)
                     /gene="TPHA0D04230"
                     /locus_tag="TPHA_0D04230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685443.1"
                     /db_xref="GeneID:11530931"
     CDS             complement(913504..915462)
                     /gene="TPHA0D04230"
                     /locus_tag="TPHA_0D04230"
                     /inference="similar to DNA sequence:INSDC:YGR128C"
                     /note="similar to Saccharomyces cerevisiae UTP8 (YGR128C);
                     ancestral locus Anc_3.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685491.1"
                     /db_xref="GeneID:11530931"
                     /db_xref="InterPro:IPR018843"
                     /db_xref="UniProtKB/TrEMBL:G8BRY2"
                     /translation="MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITI
                     GVSGCAVSQYVINPTPNVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNK
                     KNTLHVAIKTVDPDKFSTTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQI
                     FDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSI
                     KELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQ
                     AISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNN
                     HKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDD
                     ANLVKRHDFKYEAILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSD
                     VIDLIFKNFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPID
                     ELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEE
                     KKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGK
                     RNNHYQTSGATVPEIKALTAYSVEYLEL"
     gene            <916281..>916910
                     /gene="TPHA0D04240"
                     /locus_tag="TPHA_0D04240"
                     /db_xref="GeneID:11534254"
     mRNA            <916281..>916910
                     /gene="TPHA0D04240"
                     /locus_tag="TPHA_0D04240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685444.1"
                     /db_xref="GeneID:11534254"
     CDS             916281..916910
                     /gene="TPHA0D04240"
                     /locus_tag="TPHA_0D04240"
                     /inference="similar to DNA sequence:INSDC:YGR129W"
                     /note="similar to Saccharomyces cerevisiae SYF2 (YGR129W);
                     ancestral locus Anc_3.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685492.1"
                     /db_xref="GeneID:11534254"
                     /db_xref="InterPro:IPR013260"
                     /db_xref="UniProtKB/TrEMBL:G8BRY3"
                     /translation="MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVY
                     SINMDDDGDGDAGDDLLTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQ
                     QTAKFTYDKEIHRMKKRQGKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDI
                     NKVSNDRYIKRMKLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLEG"
     gene            complement(<917249..>919138)
                     /gene="TPHA0D04250"
                     /locus_tag="TPHA_0D04250"
                     /db_xref="GeneID:11534546"
     mRNA            complement(<917249..>919138)
                     /gene="TPHA0D04250"
                     /locus_tag="TPHA_0D04250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685445.1"
                     /db_xref="GeneID:11534546"
     CDS             complement(917249..919138)
                     /gene="TPHA0D04250"
                     /locus_tag="TPHA_0D04250"
                     /inference="similar to DNA sequence:INSDC:YGR130C"
                     /note="similar to Saccharomyces cerevisiae YGR130C;
                     ancestral locus Anc_3.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685493.1"
                     /db_xref="GeneID:11534546"
                     /db_xref="UniProtKB/TrEMBL:G8BRY4"
                     /translation="MSKRKDTFTVLEDHPGQEPQQTFLTRHISRKSENTEYISPFRNP
                     QDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDN
                     EKRQAQLLMELQIKEHKLHELQKSSRVLVLDEDKNELVLEESSSSDEEEESEEDDDDG
                     DEGEDEDGDESVEEEKYVEEEEDNNAEENISEKIESIIGELDSQNENVSKNAEILEEQ
                     SNVVDTEASQHESKGESLDEEEEEEDTEQDAVGPIDPSIVPMVRIPPICTDLLSAPKT
                     NATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPETHAVASPENPEYLVRTNEYNIVS
                     KAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKLVELQKQLDDIEEKKKISN
                     MKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQKINAKEDLLAKQLDVK
                     NEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINENNMRIQKDIEVLQVK
                     KLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKFDKLAIIKNETIS
                     ENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLTELQEKHNEEMAEIQK
                     KYQEK"
     gene            <920720..>921196
                     /gene="TPHA0D04260"
                     /locus_tag="TPHA_0D04260"
                     /db_xref="GeneID:11531023"
     mRNA            <920720..>921196
                     /gene="TPHA0D04260"
                     /locus_tag="TPHA_0D04260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685446.1"
                     /db_xref="GeneID:11531023"
     CDS             920720..921196
                     /gene="TPHA0D04260"
                     /locus_tag="TPHA_0D04260"
                     /inference="similar to DNA sequence:INSDC:YGR133W"
                     /note="similar to Saccharomyces cerevisiae PEX4 (YGR133W);
                     ancestral locus Anc_3.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685494.1"
                     /db_xref="GeneID:11531023"
                     /db_xref="GOA:G8BRY5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8BRY5"
                     /translation="MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKG
                     PVNTPYHKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWS
                     PVWNLMYVMVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQEDTATH"
     gene            <921933..>923642
                     /gene="TPHA0D04270"
                     /locus_tag="TPHA_0D04270"
                     /db_xref="GeneID:11534602"
     mRNA            <921933..>923642
                     /gene="TPHA0D04270"
                     /locus_tag="TPHA_0D04270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685447.1"
                     /db_xref="GeneID:11534602"
     CDS             921933..923642
                     /gene="TPHA0D04270"
                     /locus_tag="TPHA_0D04270"
                     /inference="similar to DNA sequence:INSDC:YDR062W"
                     /note="similar to Saccharomyces cerevisiae LCB2 (YDR062W);
                     ancestral locus Anc_8.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685495.1"
                     /db_xref="GeneID:11534602"
                     /db_xref="GOA:G8BRY6"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8BRY6"
                     /translation="MSQPANDTRVPLIEPGEVSVDIKRENEFGALTSKDYLYKVKSTH
                     GKQLKPSVFEAPPYYISLITYLNYLILIILGHLHDFFSMTFMKDKNIGLLEHDGYAPW
                     YSKFESFYTRRMKKRIDDCFSRPTTGVPGRFIRCIDRISHDLNEYFTYPGTTTMCLNL
                     SSYNYLGFAQSEGQCTDAAIEAANTYGSNSGGPRNLIGTTDLHIEAEKCIAAFVGKEA
                     AMLNSMGYSTNANFFNSFLDAKCLVISDELNHTSIRTGVRLSGAAVRTFKHNDMDYLE
                     KLIREQIVAGQPKTSRPWKKIIIIVEGLFSMEGSTCNLPALVALKKKYKCYLFVDEAH
                     SIGAMGPTGRGVCDVYGVDPNDVDILMGTLTKSFGAAGGYIACDQWIIDKFKLDVSTV
                     AYGESIPSPVLAQIISSLKTIIGEIHPGEGEERLQRIAFNSRYLRLGLRRLGFIVYGA
                     PDSPVIPMLLYCPSKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCMSASITKDDI
                     DYLLRHVNEVGDKLYLKVSNGKSSVPEDGRPPRWTIEEVLEKTPEDCKHDEFFIEEQG
                     LIS"
     gene            <924255..>925946
                     /gene="TPHA0D04280"
                     /locus_tag="TPHA_0D04280"
                     /db_xref="GeneID:11531005"
     mRNA            <924255..>925946
                     /gene="TPHA0D04280"
                     /locus_tag="TPHA_0D04280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685448.1"
                     /db_xref="GeneID:11531005"
     CDS             924255..925946
                     /gene="TPHA0D04280"
                     /locus_tag="TPHA_0D04280"
                     /inference="similar to DNA sequence:INSDC:YER140W"
                     /note="similar to Saccharomyces cerevisiae YER140W;
                     ancestral locus Anc_8.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685496.1"
                     /db_xref="GeneID:11531005"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:G8BRY7"
                     /translation="MNAGVTGKRLPFDNKRNRRLKKRAQSNTLHDKNHIYSNELKGII
                     DAGGNGARDQHDTANNKPTKDFIKVVFDELNHSLNINEVEEDEEDLLQDEYELEQLIN
                     MFKIPLFLEKFVLFTLLASLDCFLYYFTILPIRILHGLITRNKLKNNRASRISKERLI
                     VFIIVVASLILTKLDTSKVYHLIKRQSSVKLYMLYNVLEMSDKMLSSFGQSLLNVVLS
                     KKYNAYKGTPIQHIFFIIISIVYLVIHGYILVYQTVALNVAINSYSNSLLTLLLSIQF
                     AELKSAIFKKFDKEGLFQITIADVVERFQIIVILTIISVRNLVARYGSSGTILPTSWT
                     LHSTTSTTASIIIGALCGPMVSVIGSELIVDWAKHAYINKFNRIRPTIYEKFFVITYR
                     SYISGIQKYQDRLGLPLHAYTVLSLVMVPRTIIQGLRASNYHGTQIFIVATLIFIFVM
                     GILIVMKLCVYSILTKWGTEIKKSMRKRHNSVTEKSYVPGILSSGMSKLDSPTLDVLQ
                     SKMTKIHPSPKISKNTYIHDNKLKSLNDERKRKDEENPKSLEQVTRFKMVSKQIW"
     gene            <926466..>927956
                     /gene="TPHA0D04290"
                     /locus_tag="TPHA_0D04290"
                     /db_xref="GeneID:11534590"
     mRNA            <926466..>927956
                     /gene="TPHA0D04290"
                     /locus_tag="TPHA_0D04290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685449.1"
                     /db_xref="GeneID:11534590"
     CDS             926466..927956
                     /gene="TPHA0D04290"
                     /locus_tag="TPHA_0D04290"
                     /inference="similar to DNA sequence:INSDC:YER141W"
                     /note="similar to Saccharomyces cerevisiae COX15
                     (YER141W); ancestral locus Anc_8.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685497.1"
                     /db_xref="GeneID:11534590"
                     /db_xref="GOA:G8BRY8"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:G8BRY8"
                     /translation="MILLRNFLVRGSSRQFFNGAANKLARNPMLKSASFSSIARTNVA
                     NGTNVSNLLLSLNKSRNVHTSRILKQSSTILADSIGNSSRTNAKQLLSSKIVGYWLIG
                     TSGLVFGIVILGGLTRLTESGLSIVEWKPVTGAIPPLNQEEWEKEFEKYQTSPEFKEL
                     NSHIDIDDFKFIFFMEWFHRLWGRGIGVVFILPAIYFAATKKTTSHVNVRLFGLTCLL
                     GLQGVIGWWMVYSGIDKKQLDERKSKPTVSQYRLTTHLGAAFCLYMGMIWTGYNILRE
                     IKLVGNPRKALETIKLLDSSKILKLRKASIHMLLFTFLTAMSGGMVAGLDAGLIYNSF
                     PKMGATWFPSSRELMDPNYARAADKSDLWWRNLFENPTTVQLIHRILGVSTFCAVFGL
                     HMVCVKKKHLIPKSANNTVRAMMGLVTLQVALGISVLIYIVPVSLAAIHQAGALALFT
                     SSVVFAAQMRKPRLPVRNVITVLNKQLDSKTAQKGSKILSEAAKFK"
     gene            <928596..>929870
                     /gene="TPHA0D04300"
                     /locus_tag="TPHA_0D04300"
                     /db_xref="GeneID:11531055"
     mRNA            <928596..>929870
                     /gene="TPHA0D04300"
                     /locus_tag="TPHA_0D04300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685450.1"
                     /db_xref="GeneID:11531055"
     CDS             928596..929870
                     /gene="TPHA0D04300"
                     /locus_tag="TPHA_0D04300"
                     /inference="similar to DNA sequence:INSDC:YER143W"
                     /note="similar to Saccharomyces cerevisiae DDI1 (YER143W);
                     ancestral locus Anc_8.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685498.1"
                     /db_xref="GeneID:11531055"
                     /db_xref="GOA:G8BRY9"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001995"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G8BRY9"
                     /translation="MDLTVSNEITGNITGPLDVSDDMALGDFLALLEIDCGFDLKKHD
                     LYHNMDILDKNKLATSLKELGLSRGDLLLIRNKIGNEPVTDVTELSDDEFIEQFRNEL
                     LHNEMLRNSIGARIPMFLEMINNPQLFKERLGPIILQRRYSSGMGGGNIAAQNTFGIP
                     QEEYNRLMSNPEDPDNKKRITELTNQQDIDEQMRNALEYTPEVFTTVSMLYIDLEING
                     TAVKAFVDTGAQMTILSTKLAKKTGLDRLIDKRFTGEAHGVGVGKIHGRIHQAQIKIE
                     TQFIPCSFTVLDTPMDLLIGLDMLKRHQANVDLEKNVLRIAGVETKFLGEADIPKDFA
                     PENSITMKEKPKEKKILKPSKKIITTINPQSSSNIGSVSTSAQPVTSAPKKYSDETIR
                     QLTNLGFSRAEALKALDQTNGNVEFAASLLFQ"
     gene            complement(<930085..>930708)
                     /gene="TPHA0D04310"
                     /locus_tag="TPHA_0D04310"
                     /db_xref="GeneID:11530998"
     mRNA            complement(<930085..>930708)
                     /gene="TPHA0D04310"
                     /locus_tag="TPHA_0D04310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685451.1"
                     /db_xref="GeneID:11530998"
     CDS             complement(930085..930708)
                     /gene="TPHA0D04310"
                     /locus_tag="TPHA_0D04310"
                     /inference="similar to DNA sequence:INSDC:YDR067C"
                     /note="similar to Saccharomyces cerevisiae YDR067C;
                     ancestral locus Anc_8.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685499.1"
                     /db_xref="GeneID:11530998"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ0"
                     /translation="MELVSPLQFSVVQPTLYRGSYPREINLPFLKSLQLKKIISFVPE
                     EITKEVDAVLVNFCEEHYIELIHIQSGKVKQKKEKKKKEDKSKVKRKQKQVPIEYSTV
                     IECVKILINKNNYPCYMHGVSDNDIVISLVVACLRKFSFWSNIAIMNEFLVYNSSINI
                     HERTFIESFNSEIIIENMDKKDIVNWIHSQSTSSSSTSMLPKIKFES"
     gene            complement(<931213..>931545)
                     /gene="TPHA0D04320"
                     /locus_tag="TPHA_0D04320"
                     /db_xref="GeneID:11530959"
     mRNA            complement(<931213..>931545)
                     /gene="TPHA0D04320"
                     /locus_tag="TPHA_0D04320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685452.1"
                     /db_xref="GeneID:11530959"
     CDS             complement(931213..931545)
                     /gene="TPHA0D04320"
                     /locus_tag="TPHA_0D04320"
                     /inference="similar to DNA sequence:INSDC:YDR070C"
                     /note="similar to Saccharomyces cerevisiae YDR070C;
                     ancestral locus Anc_8.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685500.1"
                     /db_xref="GeneID:11530959"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ1"
                     /translation="MRRALVRLPIGCLQVSKWQVLYGARRVPVQMFSTSKESSFDDRD
                     LHQKMHQSKDEKKEMKVFHKNQKTLEKMESKKKRCHVGEKKPDMETLKKFGEDARVAQ
                     NRPDDGVY"
     gene            <932233..>932493
                     /gene="TPHA0D04330"
                     /locus_tag="TPHA_0D04330"
                     /db_xref="GeneID:11534554"
     mRNA            <932233..>932493
                     /gene="TPHA0D04330"
                     /locus_tag="TPHA_0D04330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685453.1"
                     /db_xref="GeneID:11534554"
     CDS             932233..932493
                     /gene="TPHA0D04330"
                     /locus_tag="TPHA_0D04330"
                     /inference="similar to DNA sequence:INSDC:YER146W"
                     /note="similar to Saccharomyces cerevisiae LSM5 (YER146W);
                     ancestral locus Anc_8.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685501.1"
                     /db_xref="GeneID:11534554"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ2"
                     /translation="MSGVEVLLPLEIIDKTINQNVWIILQSNREFTGTLIGFDDFVNV
                     IIEDAVEYITRNNDDDDIVMKHHGRMLLSGNNIAMLVPGGKR"
     gene            complement(<932744..>934045)
                     /gene="TPHA0D04340"
                     /locus_tag="TPHA_0D04340"
                     /db_xref="GeneID:11534295"
     mRNA            complement(<932744..>934045)
                     /gene="TPHA0D04340"
                     /locus_tag="TPHA_0D04340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685454.1"
                     /db_xref="GeneID:11534295"
     CDS             complement(932744..934045)
                     /gene="TPHA0D04340"
                     /locus_tag="TPHA_0D04340"
                     /inference="similar to DNA sequence:INSDC:YER149C"
                     /note="similar to Saccharomyces cerevisiae PEA2 (YER149C);
                     ancestral locus Anc_8.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685502.1"
                     /db_xref="GeneID:11534295"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ3"
                     /translation="MIQQADIDSGKIDMKLMEKANPLLFSVGRLEEYPLEYAELKQYM
                     TATDGNRAITPFYHQDGVAVTDRDYLDFLLYRSNDNDTEIDLDKKLTSEYALYQVQKQ
                     KKNGGLPKDLHLPMEQVLELKPKSDEWYQHMLSIMENINGIELDMALLKSMNPSTNSS
                     SMGGVLSANHSSVALLNNMDTTISSDVNSKKVMKNRNNSVLDVMNPNESIMTIEDIQD
                     KKQSEMLVQELTAYLISTSIKKGIDVKPPMVDDPVDFLKGAIDFITNEISQHQKVIKE
                     ARQNTIKRSKSYKSTKELETAFKDLQLAHSFLTRKFQNDREEYTKDIERLSATNRELQ
                     QKILNYHSSIIASENKVTALEKELKELRLDMINKPVNSSREDISPSSPVSASSNSITI
                     MRNEFKKMLTETQKKHELELMAEKDSRLQLEAELARLRNDQ"
     gene            complement(<934597..>937161)
                     /gene="TPHA0D04350"
                     /locus_tag="TPHA_0D04350"
                     /db_xref="GeneID:11534303"
     mRNA            complement(<934597..>937161)
                     /gene="TPHA0D04350"
                     /locus_tag="TPHA_0D04350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685455.1"
                     /db_xref="GeneID:11534303"
     CDS             complement(934597..937161)
                     /gene="TPHA0D04350"
                     /locus_tag="TPHA_0D04350"
                     /inference="similar to DNA sequence:INSDC:YER151C"
                     /note="similar to Saccharomyces cerevisiae UBP3 (YER151C);
                     ancestral locus Anc_8.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685503.1"
                     /db_xref="GeneID:11534303"
                     /db_xref="GOA:G8BRZ4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ4"
                     /translation="MSEMDSQDNSEESYSMYPKTSSPPPPPPGPHQSGMHFSVYQPAV
                     PMYSYPQTPYMYTGQMPSYGFNMMGQNQMMYQHNAIPQSGTSDGKKKWNHGNANGTMA
                     NGKVHHYQASQHTTSYHPHSAAGGSAKFIPSNKSNSSSSSSVNFSNPSASASFNPQLK
                     YKFDISKSNAEEVISSTSSFPLFFNTNEKEFAEARKIRQQLRMKTLDRQESSSVVAPS
                     EEQNDTPEEKKSIIDGSTKTEDIKESEKLKQEVNNVPEPVNDKVEKSAGSENISQETT
                     IETDKKVEKVSQSNATATSVSASTSISTSSTSSKTISKSWSAIASNAINKSRTQATLS
                     ATSNILSSPSIASSSSSVLAATVETTAQSQVQVPQKKDKKYVPPSNVGIEPLGATALR
                     ICYDPDFIIYVLKQSEKSLPIKNIVPRGIINSANICFMSSVLQVLLSCAPFINILNVV
                     SINSNIMKPGVNQTKLLDACIKLYSRFDKESFEAEKEKEKDNESSSKKQSSQYNAKAT
                     AISPEEFYKVLSTISKFKDLKWGHQEDAEEFLTHLLDQLHEEFISVIESLTNNEVMNL
                     INSISDEELKIFVIKNIAQYTKAGFNKTPSPQLKALLNKYSSSIESEGDGWHEVSGSS
                     KKGKKTKTAAKRTVEVEPSPISNLFGGQFRSVLDIPNNKESQSITLDPFQTIQLDISD
                     KETDTIESAFKKFSEYELLPFKASSGNDVEAKKQTFIDRLPQVLLVQLKRFSFVNNED
                     KDNNMMNYNSINGRIEKIRKKISYGHELVIPEESLSPHSWSQTNRKYQLTGVIYHHGL
                     SSDGGHYTADVFNKTADKWYRIDDINITELKKDDVLKGGEDGTDTRTAYILMYQKL"
     gene            complement(<937770..>938567)
                     /gene="TPHA0D04360"
                     /locus_tag="TPHA_0D04360"
                     /db_xref="GeneID:11531017"
     mRNA            complement(<937770..>938567)
                     /gene="TPHA0D04360"
                     /locus_tag="TPHA_0D04360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685456.1"
                     /db_xref="GeneID:11531017"
     CDS             complement(937770..938567)
                     /gene="TPHA0D04360"
                     /locus_tag="TPHA_0D04360"
                     /inference="similar to DNA sequence:INSDC:YDR078C"
                     /note="similar to Saccharomyces cerevisiae SHU2 (YDR078C);
                     ancestral locus Anc_8.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685504.1"
                     /db_xref="GeneID:11531017"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ5"
                     /translation="MSKPSKNMIYSKLFGNLINSRWKLDDTMISFLYYLFPRDLFVRA
                     LSLLDSGDMFIYLLESGPEEQVCEEAAVVHTGEDGTTHEQERSDDNGLENQQTRETLD
                     SSNYQTFLEEFSRKLYDPGQSIPKRLIVKSNEDTDVPIYVDLGTWICSCGEYTERFQE
                     AMTAGPSDASSQETNSKLSSILLTIKDDSSKFSDDKFAQIDAHSLSSQYYIDHSKLIC
                     PHLLAYSILLSSSQRTFRYFAIRNPTVLLIKITNLDEWLRLHINIVS"
     gene            complement(<938942..>939754)
                     /gene="TPHA0D04370"
                     /locus_tag="TPHA_0D04370"
                     /db_xref="GeneID:11534133"
     mRNA            complement(<938942..>939754)
                     /gene="TPHA0D04370"
                     /locus_tag="TPHA_0D04370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685457.1"
                     /db_xref="GeneID:11534133"
     CDS             complement(938942..939754)
                     /gene="TPHA0D04370"
                     /locus_tag="TPHA_0D04370"
                     /inference="similar to DNA sequence:INSDC:YER153C"
                     /note="similar to Saccharomyces cerevisiae PET122
                     (YER153C); ancestral locus Anc_8.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685505.1"
                     /db_xref="GeneID:11534133"
                     /db_xref="GOA:G8BRZ6"
                     /db_xref="InterPro:IPR008732"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ6"
                     /translation="MSEDLRSQLYVQCLNREFDAALENFKSIPVNEMDYSLLKLYMNN
                     SCQWGHFPSIQYIWYKYVMRNQALLIEPSLLCDMANMCVAENQSFMPNQIYMYYKKYY
                     YKDQLSQSLPNNSQIEYELLKAKVESFAKTSKVGTLFQEKWYLFVKEMDNYLSPQVIF
                     KVRDFPLLTESLRDLNIADLKQLLFTNGNIDIKNNSTPALLLNMSLLQPNEIFDDQIK
                     FQLFKRFKEEFPALSLTDSVKILHHKFKDNMYLIQQLKMHAPSDDWVKIINE"
     gene            <940134..>941369
                     /gene="TPHA0D04380"
                     /locus_tag="TPHA_0D04380"
                     /db_xref="GeneID:11530949"
     mRNA            <940134..>941369
                     /gene="TPHA0D04380"
                     /locus_tag="TPHA_0D04380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685458.1"
                     /db_xref="GeneID:11530949"
     CDS             940134..941369
                     /gene="TPHA0D04380"
                     /locus_tag="TPHA_0D04380"
                     /inference="similar to DNA sequence:INSDC:YER154W"
                     /note="similar to Saccharomyces cerevisiae OXA1 (YER154W);
                     ancestral locus Anc_8.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685506.1"
                     /db_xref="GeneID:11530949"
                     /db_xref="GOA:G8BRZ7"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ7"
                     /translation="MFKRSIFGATNKLIRGPIRGRVTPASLLTNFRPQQSLIGAGIRF
                     KSTAVDSTTQSGSEIQTTLPSFDELNDIVSSAGVTDQMANTVSDACNEIGYLNSIGMA
                     QTWWWPADLVQHMLEYVHVYTGLPWWGTICTVTILVRLLMFPLYVKSSDTMARNSQIK
                     PELDKINQELMSTTELADGQRVALKRKQLLAKHGIKNRWLVAPMLQMPLALGFFGGIR
                     HMANYPVSGFTDQGILWFTDLSQADPYIGLQVITSMILISFTRMGGETGAQQFSPNMK
                     KFFTILPLLSIPATMNLSSGVVLYFAVNSAFSILQTSVLRNKTLRKKLNIADIVVHDP
                     STTGPKKGIMETFRDNMAKSKAQAERRQKMQLAEKEKQELAKQNKANSKIKIVHRSQF
                     KKNNTFFYLNDINQFLVYK"
     gene            complement(<941586..>948047)
                     /gene="TPHA0D04390"
                     /locus_tag="TPHA_0D04390"
                     /db_xref="GeneID:11530966"
     mRNA            complement(<941586..>948047)
                     /gene="TPHA0D04390"
                     /locus_tag="TPHA_0D04390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685459.1"
                     /db_xref="GeneID:11530966"
     CDS             complement(941586..948047)
                     /gene="TPHA0D04390"
                     /locus_tag="TPHA_0D04390"
                     /inference="similar to DNA sequence:INSDC:YER155C"
                     /note="similar to Saccharomyces cerevisiae BEM2 (YER155C);
                     ancestral locus Anc_8.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685507.1"
                     /db_xref="GeneID:11530966"
                     /db_xref="GOA:G8BRZ8"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ8"
                     /translation="MVVVIVCCLVHTGMPRFRYPGAVVICFSLFYFDLTQGDGTVTSL
                     AHTFYNYLFVIGIYVYADIYLVYSLHSIKKTNFTYTPVVFHRIRSKNIDKITDMRGFK
                     WSSRRRASKMADDDSDSHEGNGNGTVHPRSRSMSHAGNATGNAAEPTASKRKSSFLLS
                     SRFSRSNENIISEQQLSRSSTVGIPSIAETAQQARMPRSQPQQPQPQQQPQQHADRNT
                     VVTLDQNNYDNTILKVGWVNRSNGQYLQSAASPIDSRMPNDHISRPDSTHGSTSQNNL
                     GEKLGGSLSKESIVPPKKDLYMYKSNSSGSSLNLNTIGSGNNDTLLVPDYKLYRAQLK
                     GPLLHLYKSGLPNSVKYFDPLVTQPPSNNNNAQTNTIGSATSQTPRQTLSYVNDIFPH
                     PQLKLEKNKDGRERIVSGSLESLCHTVLFWNTTSRNAINLILLLPMLDDFTKSFNYFI
                     LYTNHFIAHYHNDNATDEKKLNLLEERISLLIKSIVDLMPSFLLSQQCLNSIFTLIKM
                     LKLENLKTIINNKTKSLNKLVSFKNLELLQSDELRALKYEYFIKSVDPIAFADTFHTI
                     SLTFDKVWSPRYDYSLLYNSTYINNVTISPSTPQNNSSNNNSTESLIIRSLNPSVFNN
                     DDNLHILGRIMTSQLFSSSASPKLRAELLMIWIKVGCRLEEIGDLSSWLSIATIICSQ
                     PILRLSKTWNFVDDTTIKIVLRDWIPTMVQLGRRQFASKSTNSVFILAPPNLEDKFIR
                     ENVISYFGDLTIYADKLKDDIKFKYLEKKINRTKNAFYKWEQRLQDTSNKDANAINVQ
                     SKINKDLKIDENVKNDINSYWRYYLSSPKVDINKLMQLSLDIEPPSVDQSIYSKIGLN
                     TNSSILTGSYLPVVFNELSTNFSFFPKKSIIELSAVKNTKNDLPTGEQTHSSSKVPPP
                     RSSARMSKSISISEPFSLMRSSYAQINDDYSNNTIDEISSKQITGFDLIDSAILKNIS
                     SIEPSNSKLMRSACDIYNINSHIFRLNNGLIFKTFQDHSDENSNIGINTSFASEISDS
                     TTRFSHLSVSTNNNTSFRDIIKDLSTISNSKDSRLSSIPKSNSIEDLDFLKDITKFSD
                     GFDESTVINTVLKSSSLDKMIDLLVLTITIFSKLVNTSDLKKYYEDVSKVTSVENDSL
                     LKQAAPSTTFGLLDFAFVKLSMDSTLFTEIFFDSYKSFTTTTSLIEQLAKRFIKAKAC
                     AYAITAMSLRESELSDTVDSSKFPNWDMTVEKESEINMSFVLMIHLGIMEAVHHLVKH
                     QYSDFADDITCNSTFLDFFKILEESVTEDWPKQIRVIKEERALPPDQIEEIDSVYSKL
                     SLHFNNIKSLYQKQFYRPVNMHRASRRASMLLNSFVNYSYDNFSNSLKNIENVDEFTT
                     SFLALKYNDYEAILNWLVPLNIFISQQFQLVTKSEWITLSQQLEILYNQSPTSLFNYP
                     SHIEYLKLLSVGDLEIEELEIANIFVWLSSVVGNQRQLFFKTIPVSIQLLFKFHLSLT
                     NFFVSIISDPNINFQDRVNRFSVIIQTLNYVRWKNSSIDAFEVSHKTDHDSELSPHIP
                     SFIETAIANALLAPQSRRYETSLRFAHSKLKVQKSQKRLRSICEILEDIDAIHIKLFL
                     EAEVSATGVTNNYCPCPGWLVSSLMDLTLLISNSSSLNTNSFNFDKKRCINNIISNVT
                     EMIPNTNNNHGRSSNFFKILFTNYRLPLESYQGKVKDVSKEEAKLADLKETGLYNEIL
                     ILEVEKLRREKQKKEMLLMKEHESKRISVSQNISWKNKRNSIIIPSSYQVTANNQVTT
                     SVTNGTDITKRNSVSSSSTRNSIITSNNHSGVSRRLGDFFKSPFSMGTFSSSVSNQSL
                     HSYLVQVLKNDGSLSPAVLPEIELSNLLETKPMLIIKTFEIKAIVPLVNHKMSSSYAY
                     SFKIIMGNGSEHTIQATSMKDMNEWVQMIKTSKRYSFYSQKYKGKTHNKVFGVPLEDI
                     CEREKGPVPAIVVKLLQTIEERGLDEIGLYRVPGSTGSITALKNAFDEEGAINNTFTL
                     DDDRWYEINTIAGCFKMYLRELPDSLFTNEKIDDFAGVTLQFKAKKLSEEEYTNSIIK
                     LLNGLPNIYYETMKAIVLHLNTVHKHVSNNRMDASNLAIVFSMSFIDQDNFASSMGTT
                     LGAIQTILQHFITFPEKFFKE"
     gene            complement(<948659..>948877)
                     /gene="TPHA0D04400"
                     /locus_tag="TPHA_0D04400"
                     /db_xref="GeneID:11534578"
     mRNA            complement(<948659..>948877)
                     /gene="TPHA0D04400"
                     /locus_tag="TPHA_0D04400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685460.1"
                     /db_xref="GeneID:11534578"
     CDS             complement(948659..948877)
                     /gene="TPHA0D04400"
                     /locus_tag="TPHA_0D04400"
                     /inference="similar to DNA sequence:INSDC:YDR079C-A"
                     /note="similar to Saccharomyces cerevisiae TFB5
                     (YDR079C-A); ancestral locus Anc_8.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685508.1"
                     /db_xref="GeneID:11534578"
                     /db_xref="GOA:G8BRZ9"
                     /db_xref="InterPro:IPR009400"
                     /db_xref="UniProtKB/TrEMBL:G8BRZ9"
                     /translation="MARARKGALIQCDPSIKALIIQIDSEYNDIILEELDETHILVDP
                     RKVEYIKQELNRLLSKNIYNPLEEEEEE"
     gene            <949150..>951882
                     /gene="TPHA0D04410"
                     /locus_tag="TPHA_0D04410"
                     /db_xref="GeneID:11534391"
     mRNA            <949150..>951882
                     /gene="TPHA0D04410"
                     /locus_tag="TPHA_0D04410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685461.1"
                     /db_xref="GeneID:11534391"
     CDS             949150..951882
                     /gene="TPHA0D04410"
                     /locus_tag="TPHA_0D04410"
                     /inference="similar to DNA sequence:INSDC:YDR080W"
                     /note="similar to Saccharomyces cerevisiae VPS41
                     (YDR080W); ancestral locus Anc_8.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685509.1"
                     /db_xref="GeneID:11534391"
                     /db_xref="GOA:G8BS00"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BS00"
                     /translation="MVGVEDAKETLEDPVEDSVAVTQEESSQPSSEEDSGDELEDGPP
                     LLKYTRFDKKLPPNFFQRDSISAMLLTDNFFAFGTEAGILHLTDKYFNTLKTFKCHRS
                     SIRKISTDFVQNKYFGTASLDGTVVIGEYANPSNTTVAYDFKRPVNSLVLDKDYERNK
                     NFISGGTAGDVVLSQRNWLGNRLDVVLNSEEHRLHQHSKNLSADKILELNYINDVLIW
                     FNNNGITFYDIYSKTTLLNIPFPMEGEGEQTRSDLYKPYLHVSDTDRIIIGWYKYIWI
                     LKISVLKLSYNNSKDKSSPNGTSRSSVASSSTGFVPSKIFNEPKNISTFLSNAASSLK
                     ATPDKKIELEVNFNIDFLISGISSFKDDQLLVLGFENYSTQDYRKRIITPPEIKILSM
                     VDGREEMSNEIIVKDYKSLSINDFYLAKYIDDLTTCYYLICPTDAICIQELTLKDHYD
                     WYVKNKMYLKAWEIGEYVTDDYERFKVGLLYLQDILDSDNNEHLAKMINSILNYRKLD
                     NIQDGELLQNIKDEWKKHILHFAKNGELSLIINYIPTYYNIGVDTYDIVLDSLLKEKD
                     FTGLLALLENWPPDLYNRKLLTDNVEQLIQLQDTDNVEYRKLVIYLYSKEEKYSKAIP
                     HMLIINDLNALDILISHDIVSQFMNDIVRIVLLPFNNDIKKFDELALGEVELLLTKPI
                     QILVKSKDTLDLKKLIDAFSEPKSLQIVNFLFLKEISNFDPNLTIAYEDYMIQLYFNY
                     SKSEVLYVFKRKSDYNIENAIDICMKNGDAVEELIYLWGEAGETKKALSLIIDELNDP
                     TTAIEYVNSWGDVELWEFLIGYSLDKPSFVKALLNSNDKFGETYAEVIKGMPDTMEIE
                     GFSVIINNILKDNTLSESALKNIFKIIDDETISCSMDYMRINTMGKLFDGEADK"
     gene            complement(<951966..>954350)
                     /gene="TPHA0D04420"
                     /locus_tag="TPHA_0D04420"
                     /db_xref="GeneID:11534226"
     mRNA            complement(<951966..>954350)
                     /gene="TPHA0D04420"
                     /locus_tag="TPHA_0D04420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685462.1"
                     /db_xref="GeneID:11534226"
     CDS             complement(951966..954350)
                     /gene="TPHA0D04420"
                     /locus_tag="TPHA_0D04420"
                     /inference="similar to DNA sequence:INSDC:YDR081C"
                     /note="similar to Saccharomyces cerevisiae PDC2 (YDR081C);
                     ancestral locus Anc_8.213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685510.1"
                     /db_xref="GeneID:11534226"
                     /db_xref="GOA:G8BS01"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8BS01"
                     /translation="MLSIEQKYNICLMAEKHPKWTQLDLAKWAFDIFQLDKKPSQGTV
                     SRLLANKDTYMNAKKHEKHANRLRRQNNFLVRRILQEWLYQSIWNDMPVSIHILQVTS
                     QSIWLNIPSQYREGNGIFSYRYIVNFLSKLNLNSQVLDASHKLKPKKIWRFEERSELK
                     QLLDTFNSDDIFTVDETFLAYNLPLDYNQYESSKIQSRLEVLTMMLCSNTSGSEKLKP
                     LVIGKYNNYSSFKNYFPDSSTANQNNTGEESSVGSNQNLGRKMSKMFNISYRSNSRLI
                     LTSNIFHDWLVRWDKRLISNDRKVCLILDDSCSHRIVNSQLSNITLVYTCAATKFLPF
                     NWGVLDEFKIRYRIKQYDALIDLQQRMIQKTSKRQLINFEQSELTMSNAFKFIEQVWK
                     EIPAETISSSWRCSGIISSNKLPKANSAGIAFKRNTQLDEELAKKCELFDCVKKWDYE
                     LLLDLNIENKYRNLLNSKEIIESAIVEEFEPEFHSYKVNANKIRANKYSPSHYHSRTD
                     IPNNKICCSPRIDTNSNNLMGTNELQLADLDRESLNFDTKKIMSEFSSNKKDINLEPS
                     FEIEKFLEETTDNLDNNLFNVSTLIDNPDLFIMPTMDFQFQPSSSMTNIDQQFPQNTL
                     PVVTNNTIVDPILVKNPPEMLTTLGTSETPEEHDCTSLSNNLSNNMFTSRNINKVSMN
                     VDQNQNIVTNTTDPNMNETLFILEETKNNSENINIIKALEYILNRAENKHNIILSDQS
                     ITEIRSNISYLKNKINKPPKNNLASRYDNYIQDILDDQLNLKYLHDTNSGTYKS"
     gene            complement(<954910..>955509)
                     /gene="TPHA0D04430"
                     /locus_tag="TPHA_0D04430"
                     /db_xref="GeneID:11534135"
     mRNA            complement(<954910..>955509)
                     /gene="TPHA0D04430"
                     /locus_tag="TPHA_0D04430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685463.1"
                     /db_xref="GeneID:11534135"
     CDS             complement(954910..955509)
                     /gene="TPHA0D04430"
                     /locus_tag="TPHA_0D04430"
                     /inference="similar to DNA sequence:INSDC:YDR084C"
                     /note="similar to Saccharomyces cerevisiae TVP23
                     (YDR084C); ancestral locus Anc_8.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685511.1"
                     /db_xref="GeneID:11534135"
                     /db_xref="GOA:G8BS02"
                     /db_xref="InterPro:IPR008564"
                     /db_xref="UniProtKB/TrEMBL:G8BS02"
                     /translation="MEHIRNFYSTILKSSHPLTLSVHLAGKAVPIVFYILGSIFFSFT
                     AQFITIVLLLACDFYITKNISGRKLVQLRWWYDSTGVSGKTLTFESHKQYPPSTIPIN
                     AIDSKLFWWSIYLTPIVWIVFAIMCILRLKLFYLVLVLVGICLTGINAYGFRQCNSWE
                     PTTDSNTAENDSWFQLPSIPGLDNLGAIAQVSSFFQRST"
     gene            956982..957077
                     /gene="TPHA0Dtrna12K"
                     /locus_tag="TPHA_0Dtrna12K"
                     /db_xref="GeneID:11531084"
     tRNA            join(956982..957019,957041..957077)
                     /gene="TPHA0Dtrna12K"
                     /locus_tag="TPHA_0Dtrna12K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11531084"
     gene            <957641..>959617
                     /gene="TPHA0D04440"
                     /locus_tag="TPHA_0D04440"
                     /db_xref="GeneID:11531086"
     mRNA            <957641..>959617
                     /gene="TPHA0D04440"
                     /locus_tag="TPHA_0D04440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685464.1"
                     /db_xref="GeneID:11531086"
     CDS             957641..959617
                     /gene="TPHA0D04440"
                     /locus_tag="TPHA_0D04440"
                     /inference="similar to DNA sequence:INSDC:YJL201W"
                     /note="similar to Saccharomyces cerevisiae ECM25
                     (YJL201W); ancestral locus Anc_1.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685512.1"
                     /db_xref="GeneID:11531086"
                     /db_xref="GOA:G8BS03"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8BS03"
                     /translation="MIDVNVNNIFFKSYSVDPNTGHSIYVFDSTYLPSPEEIGDKQVF
                     DLLIDELMDTLIAKLPAAPYSIVVFSSGFSKKKISWVYGIKMYSKLPNESRKYLQKTY
                     IVHESFYIRTVYQVLSNAMNFKFLGSSSSSNSNNSDNNLLNNDDKNSIPAESVDTSAY
                     LVHVPNLTALSHLIDITRLRISLNVYLHDYDISEYIDVPDEYFGRMTTIGTKQYKQLI
                     FDKIFKRLRVESVANELVFQKPGSYKKVNILLDIIERSNYIDLSQWDIYSLASVFFNF
                     LKNKSKPLIPIDLMTLPISDDFDYTYSTFMKIIEFNNYYDLLVAIIPLFLSVLDAHET
                     TKHDSRSLSKALAPTLCKERISMNSSSRMAIGIRFIKNLLEHFDDIRHKIDSSRVGRT
                     SRTKSDTYSTAPITSPMAKQNGKVTQQNAGKAIPTNISNGQTNPPPLLPKPRKMSPSK
                     YDNNVYANRTPSRDHSPTRSSSIIQPPSIVSKTRGSSTDSLSLSLGVNNNIPNLPPRV
                     ASVSVRINSDSLASESQSSINTISSNNTNNSMKKQESEELVASPLPPESIKEMVQESP
                     SNEDNEEINKILKGASKLTLENNAKILTFDREMKKKKQKEQKSNASTAAKFSSGGYSG
                     IKTGNKVSKLAALYEERLQGIQVMNELQKQMNNA"
     gene            <960383..>964735
                     /gene="TPHA0D04450"
                     /locus_tag="TPHA_0D04450"
                     /db_xref="GeneID:11534405"
     mRNA            <960383..>964735
                     /gene="TPHA0D04450"
                     /locus_tag="TPHA_0D04450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685465.1"
                     /db_xref="GeneID:11534405"
     CDS             960383..964735
                     /gene="TPHA0D04450"
                     /locus_tag="TPHA_0D04450"
                     /inference="similar to DNA sequence:INSDC:YCR038C"
                     /note="similar to Saccharomyces cerevisiae BUD5 (YCR038C);
                     ancestral locus Anc_1.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685513.1"
                     /db_xref="GeneID:11534405"
                     /db_xref="GOA:G8BS04"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:G8BS04"
                     /translation="MNPDNRESHISTTTPLFGDKKNSVFLVSPTKSLSYVRKSGIQTQ
                     NNNVDNETDTFMRSGSLDTLSSKGDSFITAYSAEHNSSNITLDNYQDHFNEFQQLQET
                     NSDNNLYFDEKIITENSLLENESNLQDNFNFDIDATPLVKGITNKQDISDITTPILPR
                     AQNNNRHSFENEHSIVERQYINTNGKKISGLGLSTASLDMLNNSISIKDRDSILKDTK
                     GASPTRAVRTSMLVNEYTQIIPDSVTPEFPLPDDRHRFVSNANTENSKAINQRSSYIT
                     NDSANTSDEYIKNNKRSTFLSDKGEYDNRKPSAALFDETKKTQAAPSNDNIVSAAVEN
                     ENLAFLFIVATHSFDSTSLNNTDDESICLSFRKDDVAFVHTVDESGWGEVTLVKNQAR
                     GWVPFNYFSDLVKSENYTKKGTKEDTSSIVESRKPLEDLLNTCARFLLYPQDEPLEGT
                     NEFTFNIEYVNSIRNGVRTLLELTECVSRSNELIQSSYDLRRARKKLLADWYNLMIKS
                     DHYKHTTSNAKIGNLITLVYEVLKRAFTFYVVWTKVKATQDTESASRRTSMQLNKLPE
                     SEIRRSKSIHRRMEYLDTPPNATIRLHEIYDILFRYIGLLLGRLDIIEHNPNSCETLE
                     YIVLQMIILLRELLYISKSCATIIQQKYHHTYENHLDESLDPLLSFVSILVSCIKQLV
                     TQILNEDYEKTATNVQIRKGTYFYTDEGKHLMMILSSMAPLISSAVACCGNYIRIIGD
                     FQLGSDRKYPNFKKIRITPEEFIKKCSNGIVSTLNKATFLGDESTKDKRQKSIKEMPR
                     KRISRYSTIRVGDNSNFCISPEGTQFLQELMPEKPFSRDSIFAKFKIEDNETFDDSQD
                     QSQKDQINNREVMMDQIMIGPDENIIGASFKSLVFKLTDEVWKVDDFFIATVLLNFRT
                     FGTTVDLIDLLICRFDVNNTSSFNEHSKSFSTGSAKLKLRRKLVCKIFQTWMESYWDY
                     ESDFDILATIINFFNEGISVYLPIEAKNLIEVAAKLFVAAGNSNSHYFRTQIKSIVIP
                     YNAEKTNTSSVISSTSTDSTKYKSSLFSVDDRLIEEYELTHVIEPPNQNSFSLPIPIL
                     NIGRSALLSKYNIQDMESAVRKYRSFRDNALSNTETRQFEEQSDLEMLIKEWNEMVKN
                     DHHLSKYIHLPLNLVDLNPLEVAKQLTIIESKLYLSIEPFELVNDNFLEKKRKEGLAP
                     NVNLIIDFTNQLSHYVIEGILSPNLSNQSRAVRLKGWLKIALSVLYFRNFNSVASIMT
                     ALQNHVITRLTDIWELLDEKDMDLFDYLSRIIHPNNNFKVYRKKLNSILEGDTAKTIK
                     ASKCSLPVVPFFNLFLQDLTFISEGNPNYRNANSFRPDKTINIDKYFKISKSICMVQF
                     FQVPYETRNLSTPTKRESFFSLTEHMDVDTNCIAPIPLLQEFILDEFWRVNTLYSQKD
                     DRAYELSLQLKPKN"
     gene            complement(<964925..>967363)
                     /gene="TPHA0D04460"
                     /locus_tag="TPHA_0D04460"
                     /db_xref="GeneID:11530954"
     mRNA            complement(<964925..>967363)
                     /gene="TPHA0D04460"
                     /locus_tag="TPHA_0D04460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685466.1"
                     /db_xref="GeneID:11530954"
     CDS             complement(964925..967363)
                     /gene="TPHA0D04460"
                     /locus_tag="TPHA_0D04460"
                     /inference="similar to DNA sequence:INSDC:YJL200C"
                     /note="similar to Saccharomyces cerevisiae ACO2 (YJL200C);
                     ancestral locus Anc_1.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685514.1"
                     /db_xref="GeneID:11530954"
                     /db_xref="GOA:G8BS05"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:G8BS05"
                     /translation="MLVRRRFPLLQRVIKSSEVRRSLATSQNLDQLFPTTYDNINDKD
                     ANKYNNQIPPYAKLIRNLFALKKFANDKPLTLTEKILYTHLTDIKETIGTISSYNSIY
                     DIRGDEYLKLSPDRVAMQDASAQMALLQFINTGLQQIAVPASIHCDHLIVGKNGEEKD
                     LARSIATNKEIFDFLHNCATKYGIQFWGPGSGIIHQIILENFSAPGLLMLGTDSHTPN
                     AGGLGAIAIGVGGADAVDALTATPWELKTPKVMGVKLTGQLNGWSSPKDVITKLAGLL
                     TVRGGTGFIIEYFGEGINHLSCTGMATICNMGAEVGATTSLFPYMDAHKRYLNATGRH
                     FVTKYADVALNQFNLLRADEGCHYDKVIEIDLSALEPSVNGPFTPDLSTPISEYGKIS
                     KKNNWPQDISAGLIGSCTNSSYEDMSRAVNLVKQASKAGLKPKIPFFVTPGSEQIRAT
                     LDRDDIIKTFAENGATVLSNACGQCIGQWDREDVPKQTQKENSIFTSFNRNFRARNDG
                     NKNTMNFLTSPEVVTAMIYSGDAQFNPITDSIPLPNGGSFKFSPPNAEELPANGFKHG
                     RNELYPTEGVPTANPDVEINVSQESNRLQLLTPFDRWDGKELKTTILLKVEGKCTTDH
                     ISAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLDGTGYDIPALMMKWKDENR
                     PWNVVAEHNYGEGSAREHAALSPRYLGGKMLLVKSFARIHETNLKKQGILPLTFMHED
                     DYDKLSSGDILETIGLADMINKGGDNGGTLDVKVTKKNGNSFIIKTKHTMSKDQVGFF
                     KAGSAINFIGTVFN"
     gene            complement(967909..967991)
                     /gene="TPHA0Dtrna9L"
                     /locus_tag="TPHA_0Dtrna9L"
                     /db_xref="GeneID:11534298"
     tRNA            complement(967909..967991)
                     /gene="TPHA0Dtrna9L"
                     /locus_tag="TPHA_0Dtrna9L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11534298"
     gene            complement(<969254..>970465)
                     /gene="TPHA0D04470"
                     /locus_tag="TPHA_0D04470"
                     /db_xref="GeneID:11531067"
     mRNA            complement(<969254..>970465)
                     /gene="TPHA0D04470"
                     /locus_tag="TPHA_0D04470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685467.1"
                     /db_xref="GeneID:11531067"
     CDS             complement(969254..970465)
                     /gene="TPHA0D04470"
                     /locus_tag="TPHA_0D04470"
                     /inference="similar to DNA sequence:INSDC:YJL203W"
                     /note="similar to Saccharomyces cerevisiae PRP21
                     (YJL203W); ancestral locus Anc_1.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685515.1"
                     /db_xref="GeneID:11531067"
                     /db_xref="GOA:G8BS06"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR022030"
                     /db_xref="UniProtKB/TrEMBL:G8BS06"
                     /translation="MEEVPIIDNNEIKNHILKTVNYIKEHGKSFEDELRLDEKFSFVN
                     PDNEYHKYYQCMLDKNLNDHKLEQNAKEGKQTIEEEDNISVDELNDNKVEVPNEPHPF
                     FFSNYDTNLKPKSFEILKLTAQFVVCNEDINYLEKLKTKYIDNPQFAFLNENHDLNKT
                     FNVFVNQYKEILNNKIVKPLMFGNNLKGIDFKRTVLERSFKRAEYLEYQAELGQKFQK
                     EKNLLDIEYAAINWTKFKVLTAFSLDDPNTLDKDNVDEYNKPINLQGLKLKEISKNEN
                     TTLIYFQSIEPINKKEELEVSKQGKHTKRKMKVKAAGETRNKKLKSKQNTEVNDSDIK
                     DNRNKSGHYIECPITKKMVPVAQFDRYLQTLLGDPKYKEERTKFEQKHKMTNLTDAEA
                     YENIKKMARKD"
     gene            complement(<970967..>974989)
                     /gene="TPHA0D04480"
                     /locus_tag="TPHA_0D04480"
                     /db_xref="GeneID:11534608"
     mRNA            complement(<970967..>974989)
                     /gene="TPHA0D04480"
                     /locus_tag="TPHA_0D04480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685468.1"
                     /db_xref="GeneID:11534608"
     CDS             complement(970967..974989)
                     /gene="TPHA0D04480"
                     /locus_tag="TPHA_0D04480"
                     /inference="similar to DNA sequence:INSDC:YDL195W"
                     /note="similar to Saccharomyces cerevisiae SEC31
                     (YDL195W); ancestral locus Anc_7.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685516.1"
                     /db_xref="GeneID:11534608"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021614"
                     /db_xref="UniProtKB/TrEMBL:G8BS07"
                     /translation="MVKVAEYDNGSIFGWSSDVTPYLATGAGSSDYDTFNTSSQVNEN
                     QPTLKLWSLISSKSDIPVLSIDVDSTFNDLSWSIDNEMIAGAMQNGTIQLFKTDKKES
                     LEKIGSFEDEAQDITIIKFNNKQNNVLLSGSSTGKILVWDTNYLNNLSYKPITPGSGT
                     LAAKHSSDSKKLGITSIAWNHSLSHVFASAASTSYASVWDLKANREVLKLSYTPTTIR
                     EPVQMTVVEWNPKNSTKVATAGYSSDENSSAIYIWDLRKANTPTSVLSNDKSDGHRHP
                     ITSLDWCRTDPRFLISSCKDDFSINLWNPQSGEILSGYSVSGLNSENDVVSKPMAVRM
                     APKFPELVAYSTKESKVLVRTFQDYTTTLDHEKEESLENKSEDVFWNEVSNIQIKHPI
                     NKPHIYKILAPEWKTNKKPLVKWGFGNKLVTLTGNGKGIKIMRAQIKGCFQENTLLAD
                     AIDSKDFNAIINKRLAKSSNDDNEEDWNLIDRLALDGKEEILIESIAYDDDTSENESQ
                     NEDTDFFATLENSYQPSGAFILSDGVEKEIAKYVSKNNYHAAIKTALANNLHMEAMCI
                     AMNSQNSNLINLVNKTFFSSYGEEKSLVRFMYSKVNNSLDDLVESLDVSQWKIAANTI
                     VENSNDNIEIRNSYLAKLAAKLSLAGYRQDSIALYLSVNIVNEVSSLWSQEFDALERN
                     MLNKSTNNSLTHTEFLDELIEKLVAISSSLGNDKIKITDDKVISKFLEYIDIACSNGS
                     YAFAQKILSILPEDNEAIRNEKERVAMFLHNTLDNDFLETENEELPELFSKAGIHNSF
                     AKLQSVSSSVDASFQNYSSNSSVTSNSFSAIVSNNANYMQNNQSYHNPAVATPISLNS
                     SNNQSFSHNPYAPSSALQSMSPLTSVKNISGIKRMDSSQSLLSSHTYQSADLSFVSTP
                     VLPLQGLVKPTATILSNNDTFHPNSDSAAPQKPAMTSGQAPRNNLQSNKGWNDLPMNI
                     AEKVTRAKAVQVMPIQPIQSVGSFPLKRAQSNSLYLKSRTSSIASMNGINPPPPKNLS
                     RKPSIINQPKIVTAVSSNPYAPATSAHARTQSNLTGIPINSNNSNNPYAPTSGIEPPQ
                     FSNLVPAAPQVLRDNFNGSLVGENIITPASMSMNPYAPSQPDGALQNSFHMNSKNGIP
                     GDNQTQPVAAKQGQEVTAGPPPPSFNRKFSKQSAKDISNTPNSSNVSLMSQYDKSSSE
                     ITRGSAVDAVNEFKPVSMDDSKQLAYNGIQPEQEQEIIKYFREELQRVSPLLPQEYSK
                     QLKDCKKRLQILFQHIEKHTLITPLVMSKIYHIVELMKAHNFDEALEIQKDILQNHSE
                     EAGNWLTGVKRIVAISKATT"
     gene            <977003..>978121
                     /gene="TPHA0D04490"
                     /locus_tag="TPHA_0D04490"
                     /db_xref="GeneID:11531042"
     mRNA            <977003..>978121
                     /gene="TPHA0D04490"
                     /locus_tag="TPHA_0D04490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685469.1"
                     /db_xref="GeneID:11531042"
     CDS             977003..978121
                     /gene="TPHA0D04490"
                     /locus_tag="TPHA_0D04490"
                     /inference="similar to DNA sequence:INSDC:YLR216C"
                     /note="similar to Saccharomyces cerevisiae CPR6 (YLR216C);
                     ancestral locus Anc_7.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685517.1"
                     /db_xref="GeneID:11531042"
                     /db_xref="GOA:G8BS08"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BS08"
                     /translation="MTRQKTYFNISINNKPKGKIVFELYNDIAPKTVENFVTLSNEGN
                     GLKCKSNPDVPLCYKGSIFHRVIKDFMLQFGDFTNFDGTGGESIYGEKFEDENFTVKH
                     DKPFLLSMANAGPNTNGSQCFITTVPTPHLDGKHVVFGEVIEGKRIVRLIENLQCDQE
                     NNKPLYDVKIDECGILPNDYEVPENAEETPMDQYGDNYEDSLKNDQKVDINDYDSVYK
                     AIEFVKNIGTEQFKLKELEVALEKYEKCNKFLKEYYPDDLEEDQLKAIQQLKISIPLN
                     IALCALKLKNYRRVLVAASEILYAEGADDKSKAKALYRRGMAYYYMNDTDMALADLEM
                     ATTFQQNDPAILKAIQDTKNKRKAENNKQKKSLSKMFS"
     gene            <978756..>982382
                     /gene="TPHA0D04500"
                     /locus_tag="TPHA_0D04500"
                     /db_xref="GeneID:11531099"
     mRNA            <978756..>982382
                     /gene="TPHA0D04500"
                     /locus_tag="TPHA_0D04500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685470.1"
                     /db_xref="GeneID:11531099"
     CDS             978756..982382
                     /gene="TPHA0D04500"
                     /locus_tag="TPHA_0D04500"
                     /inference="similar to DNA sequence:INSDC:YDL145C"
                     /note="similar to Saccharomyces cerevisiae COP1 (YDL145C);
                     ancestral locus Anc_7.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685518.1"
                     /db_xref="GeneID:11531099"
                     /db_xref="GOA:G8BS09"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BS09"
                     /translation="MKLLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT
                     LLHRFEDHDGPVRGIDFHPTQPLFVSAGDDYTIKVWSLETNKCLYTLEGHLDYVRTVF
                     FHRELPWIISASDDQTIRIWNWQNRKEIACITGHNHFVMCAQFHPTEDLIVSASLDET
                     VRVWDISKLREKHSAPGGANIPSTFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNW
                     ASFHPTLPLIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQNLIISVG
                     EDKTLRIWDLDKRVPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERPAF
                     NIYQNNLFYVNNEKQLQTFDYNNKVSSLPYVSLKKLGETWVAFRSISYNPSQHSVLVN
                     QGDDHYSLVVLPKQPTGPVDPTSVVDGDGLFAQFVARNRFATYNKKNNVIEIRSLDNK
                     VTKSINIDSSVRDMAYGGPGMLLVLQAKAVTLLDVQQGKPVASIPLKNVKYISWSPDG
                     QYLALISKHTISITNKKLQMVYTRHETIRVKSIAWDETNVLIYSTLNHIKYLLLNGDL
                     GIIKTLEKTLYITRVQGKLLYTLNRDGEVQILSIDPTEYRFKKALTNGNYPEVMRIIK
                     NSNLVGQNIISYLQKSGHPDVALQFVQDPQTRFDLSVEYGNLDVALTEAKKLDNSSTW
                     TRLRTEAMTQGNIKIVELVDQTLRSFDQLSFLYLIGGERTKLSKMESVAQSRNDISSS
                     ILNSVYNNSITHRSNIFANAGSLPLAYAVAKANGDEDAAAAYLEQAGIDEQDVTLPDV
                     MNPSNFVKEPVIQPMESWPLNEAELSYFEKAVLGQIEDLSLDEPVEDESVSRSHVQGE
                     DAFFDDEDAAEGEDAWDMGDDDLDIDETSVIAPTAVEDQAAVVSTPGLDQETSIWVKN
                     SKLPAVLAASGAFDAAGHALNKQVGIVNFEPLRKYFVEIYEGSRTYMISEPSELPSIQ
                     GHIRAFADEPQEAEILPYIPGVDVVTAKMNEGFKHFKANKLTEAIESFRSAIYHIVLL
                     VVYNEEDEKFARSTLEKAREYILGLSIELARRALPEDDIKRNLELAAYFTKAKLAPAH
                     HSNALQVAMSQNFKNKNFVQASYFAGKFLQIMDSGPRAEQAKKIKDKSDSLANDAVEI
                     DFDPYAEFDICASSYTPIYKGEPSVQDPLTGAKYHSSEKDNIDKIALISKVGTPASGL
                     RILI"
     gene            <982939..>984378
                     /gene="TPHA0D04510"
                     /locus_tag="TPHA_0D04510"
                     /db_xref="GeneID:11531114"
     mRNA            <982939..>984378
                     /gene="TPHA0D04510"
                     /locus_tag="TPHA_0D04510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685471.1"
                     /db_xref="GeneID:11531114"
     CDS             982939..984378
                     /gene="TPHA0D04510"
                     /locus_tag="TPHA_0D04510"
                     /inference="similar to DNA sequence:INSDC:YLR212C"
                     /note="similar to Saccharomyces cerevisiae TUB4 (YLR212C);
                     ancestral locus Anc_7.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685519.1"
                     /db_xref="GeneID:11531114"
                     /db_xref="GOA:G8BS10"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G8BS10"
                     /translation="MAGEIITIQIGQCGNQVGKHFWNQLSKEHGIDRDGSCKFDDDPQ
                     KNIRDDDTNPFFKKNDSHRYTPRALLFDMEPGAVQDVTNTFPNFFDPRNVSVSRDELG
                     AGNSWSKGYDYGVSNQDELLNIIDKEIDNTENFEGFQLIHSVAGGTGSGLGSNLLELI
                     SDRYHKKFISTYSVFPSDESEVVVQPYNTLLTLRRLAENSDASIVFDNNALLNLSSQV
                     FKDPNTSYIHTNQLISSTMSSITNTIRFPSYMYNSMSSIFSTLVPTPDLHFLLPGFTP
                     FTSDYVNNGKDYKRNTAYDVILDLFDKSNSLVSSRVDNPTYFNIYTSLIGSTEQNDIS
                     RAILKLQSRINFAPWSSTSIHVNVGRRSSFLPQPEQAVNGFGNRNYVNGMMLANSTSI
                     LSVFERTVRTFDKIFAKGAFLNTFRNGKMFQNDWDEFSECREVAQNLINSYSTAEQEN
                     YLDDILIEEENIIGNAEAENDIGLDSNII"
     gene            <985683..>987191
                     /gene="TPHA0D04520"
                     /locus_tag="TPHA_0D04520"
                     /db_xref="GeneID:11534270"
     mRNA            <985683..>987191
                     /gene="TPHA0D04520"
                     /locus_tag="TPHA_0D04520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685472.1"
                     /db_xref="GeneID:11534270"
     CDS             985683..987191
                     /gene="TPHA0D04520"
                     /locus_tag="TPHA_0D04520"
                     /inference="similar to DNA sequence:INSDC:YDL160C"
                     /note="similar to Saccharomyces cerevisiae DHH1 (YDL160C);
                     ancestral locus Anc_7.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685520.1"
                     /db_xref="GeneID:11534270"
                     /db_xref="GOA:G8BS11"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BS11"
                     /translation="MSNSEQDWKSQLNIPKKDTRPQTEDVLNTKGNTFEDFYLKRELL
                     MGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIPTLEKVKSKINKIQ
                     ALIMVPTRELALQTSQVVRTLGKRCEISCMVTTGGTNLRDDIIRLNETVHILVGTPGR
                     VLDLASRGIADLSGCGLFIMDEADKMLSRDFKSIIEQILTFLPEQHQSLLFSATFPLT
                     VKEFMVKHLHKPYEINLMDELTLKGITQYYAFVEEKQKLHCLNTLFSKLQINQAIIFC
                     NSTNRVELLAKKITDLGFSCYYSHARMKQQERNRVFHEFRHGKVRTLVCSDLLTRGID
                     IQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI
                     AAIPTTIDKSLYVANDNSAVPVPFPIEQQLIPQNLPPQQQLPLPPQMNAHFNTMNQQQ
                     FQMQQQPSPLQQQQQQPQQPQQPQQQFQQPPQQFQQYPQQGMPIQAPQHPQF"
     gene            complement(<988612..>989496)
                     /gene="TPHA0D04530"
                     /locus_tag="TPHA_0D04530"
                     /db_xref="GeneID:11531120"
     mRNA            complement(<988612..>989496)
                     /gene="TPHA0D04530"
                     /locus_tag="TPHA_0D04530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685473.1"
                     /db_xref="GeneID:11531120"
     CDS             complement(988612..989496)
                     /gene="TPHA0D04530"
                     /locus_tag="TPHA_0D04530"
                     /inference="similar to DNA sequence:INSDC:YLR208W"
                     /note="similar to Saccharomyces cerevisiae SEC13
                     (YLR208W); ancestral locus Anc_7.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685521.1"
                     /db_xref="GeneID:11531120"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BS12"
                     /translation="MVTIENAHSDIIHDTSFDYYATRLASCSSDKTIKIFAVNGEQYA
                     LLDTLVGHEGPVWRVSWAHPKFGNLLASASYDGKIIIWKEANKKWSKLASLSVHSASV
                     NVVEWAPSEFGAILLAGSSDGNISVVELKDEKLGKPMIMKAHKVGVSTVSWAPFVASE
                     SSEEDHTHSLRFVSGGLDNAVKIWKYDTEKETYVIETELEGHTNCVNDVAWSPTVLVN
                     TYIATASNDNTSIVWTQEGSKGEWKKQLLTEPFEAAPSRVNWSLSGNILAVSTNDDKV
                     TLWKENLDGKWETAGDLE"
     gene            complement(<990102..>992630)
                     /gene="TPHA0D04540"
                     /locus_tag="TPHA_0D04540"
                     /db_xref="GeneID:11530982"
     mRNA            complement(<990102..>992630)
                     /gene="TPHA0D04540"
                     /locus_tag="TPHA_0D04540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685474.1"
                     /db_xref="GeneID:11530982"
     CDS             complement(990102..992630)
                     /gene="TPHA0D04540"
                     /locus_tag="TPHA_0D04540"
                     /inference="similar to DNA sequence:INSDC:YLR207W"
                     /note="similar to Saccharomyces cerevisiae HRD3 (YLR207W);
                     ancestral locus Anc_7.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685522.1"
                     /db_xref="GeneID:11530982"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BS13"
                     /translation="MLHSWVLFLYIGFIEVVCGEVESQVSFNVNNVDYDPYEKAVNIL
                     SDKIRYDDEIDYYSKKNISGIDITIPVDYSEDEQEFRYKKFWKSEATTWQKEAIGYLT
                     ISSDKFNNTAATLLLAQIHLWGEYGYPNNKTLAYSYLNKYNEMIGFTDGEALFDLAVM
                     LSTGLFGAIPIDIGKSLLYYQQAASLGNMKAKQALAYRYANGLNVPRDCNMALLLYRE
                     LSDEVRSKYSDYEWNVALPYMETYNIRIPDFQGGLLGEGLSSTHSSTTRKDSVRPDIT
                     SSLLTQMNGGQIVLQFGIGAKDYAADGESDDSNDKLVDLYYTAWDLYKGTYERNRDVE
                     SARTILELAIEVYSSSEPYMDNLQIYFFGKCYYLLGHIYFTGEGISKPDIERAQLLLQ
                     KSIDIVENVSAVKSKANIDMGLINQFIKNDTSKAIKYYRNVLEENVNDGTADYQLSKL
                     SSEKPELNLGDPFVLMQTAYRRSHIAGTYEYAKMIEESVNNYYSCEDTSFLFKRFLEM
                     NEVIVAPQLRIAFSELLKGNTEVALWAYAQAAEQGFEAAQISAAYLLYQDAYLMEEVP
                     ETTDERKSMAISYYNRAFKQNNIDAAIIAGNIFYNMKDYSKAIAMYQSASLRFAPQAI
                     WNLGYMYEHGLGVGVDYKMAHDYYNQVLDHNPELFFAVKLTVMKLTLKSWISWLSGEP
                     VSFWNQDKEEIDGVSIISQEEQMLSQMSIFRRFKYSVEQALLENSGHHAYPTPLTEKQ
                     INDKQQEKKKKDEKNDPTDTGWVEKFIMKIDELGLSLEDVLSIMFMAMILLVTMIIRP
                     LIIRAGWNVRINGIVIRGNAEANGEQEQPQEVQPANIDIQFFAI"
     gene            <993082..>994395
                     /gene="TPHA0D04550"
                     /locus_tag="TPHA_0D04550"
                     /db_xref="GeneID:11531016"
     mRNA            <993082..>994395
                     /gene="TPHA0D04550"
                     /locus_tag="TPHA_0D04550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685475.1"
                     /db_xref="GeneID:11531016"
     CDS             993082..994395
                     /gene="TPHA0D04550"
                     /locus_tag="TPHA_0D04550"
                     /note="ancestral locus Anc_7.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685523.1"
                     /db_xref="GeneID:11531016"
                     /db_xref="UniProtKB/TrEMBL:G8BS14"
                     /translation="MKIKWTCNCCKERNHYNGNDAQQYGIDFSRLNLCRKCHKISCDS
                     CQLFQDYEKFCPYCCRNNKVPDCADGSRLSFEERYCQEICYDEYCTNGCFQCPKCNNS
                     LALSLCKNERLKDPNGKTISFQCYCCSWSWSTELPGNVKLLSKHIFSLHLNLDPKFQR
                     FKQLSNIYLNDSSDCSNNDPSYSVKDIYLKQGDLQSARGLLDIINNKKETSFNTSSTV
                     LLNDQFPHQNLYDDTNTSLPELSKLVMKFEYKCPHCEETILKPSSELYSSDNTYESFA
                     FTQLPTIEVSAIKDLKQDLVLIMKNIEDNLNDFVQAEIITSDNIQLSQNKFIFMKSTG
                     DKLQDKSKYYAELMSYLEGLPSFDLNLCDNVNNKFVRIEKQRRLAKNNNIAVMNNANS
                     PMNYKEESDRYIVSPIKILTETALNKLLVKYKFKTYEVSLECILK"
     gene            complement(<994552..>996015)
                     /gene="TPHA0D04560"
                     /locus_tag="TPHA_0D04560"
                     /db_xref="GeneID:11534395"
     mRNA            complement(<994552..>996015)
                     /gene="TPHA0D04560"
                     /locus_tag="TPHA_0D04560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685476.1"
                     /db_xref="GeneID:11534395"
     CDS             complement(994552..996015)
                     /gene="TPHA0D04560"
                     /locus_tag="TPHA_0D04560"
                     /inference="similar to DNA sequence:INSDC:YDL161W,YLR206W"
                     /note="similar to Saccharomyces cerevisiae ENT1 (YDL161W)
                     and ENT2 (YLR206W); ancestral locus Anc_7.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685524.1"
                     /db_xref="GeneID:11534395"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8BS15"
                     /translation="MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAE
                     KTYDSADFFEIMDMLDKRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLI
                     KTLTEFRYEDENSGGVDQGQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPP
                     ARNGSDEDLQRALEESRRTAEEDERKRRLNQDDSDLQAALQLSKEEEELKRLQELQSS
                     MHMQQQQPVYYDVFGNPISYEEYLQYQMQQDQLQKQQQNEWLLQQKQQDLLAQQQQQE
                     MLLQQQQFLLAQQQQQASYLAQQQAMMQQQQQMPMQTGSNNPFALNNQQTNNNNVQAA
                     SELPDFTKPQAQSYQPAKLPEQIEIQQPVQQPVQQPLQQNRTGNKEMTNKYNELNQLL
                     ASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGESKVNPFLSNQYTGLPSS
                     NIIPTQTGYGFGNQPQQQQYQQQQQQNNNQGVSLIDL"
     gene            <996539..>998749
                     /gene="TPHA0D04570"
                     /locus_tag="TPHA_0D04570"
                     /db_xref="GeneID:11534581"
     mRNA            <996539..>998749
                     /gene="TPHA0D04570"
                     /locus_tag="TPHA_0D04570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685477.1"
                     /db_xref="GeneID:11534581"
     CDS             996539..998749
                     /gene="TPHA0D04570"
                     /locus_tag="TPHA_0D04570"
                     /inference="similar to DNA sequence:INSDC:YDL164C"
                     /note="similar to Saccharomyces cerevisiae CDC9 (YDL164C);
                     ancestral locus Anc_7.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685525.1"
                     /db_xref="GeneID:11534581"
                     /db_xref="GOA:G8BS16"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:G8BS16"
                     /translation="MAIGRLQTTIFRQLSYCRPFVSSLRFGTASLLYTRTMSNSLEPS
                     KKQATLARFFTSMGKKTPPAVEVATKQESPENHVDKKRKVEVHPSQSVGASEKAESPP
                     DQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRL
                     GPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFK
                     PKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIG
                     LAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEI
                     VINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGER
                     AQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIIL
                     DCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLR
                     ERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHY
                     EPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE
                     TCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADL
                     SLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN"
     gene            complement(<998966..>999304)
                     /gene="TPHA0D04575"
                     /locus_tag="TPHA_0D04575"
                     /db_xref="GeneID:11534239"
     mRNA            complement(<998966..>999304)
                     /gene="TPHA0D04575"
                     /locus_tag="TPHA_0D04575"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685478.1"
                     /db_xref="GeneID:11534239"
     CDS             complement(998966..999304)
                     /gene="TPHA0D04575"
                     /locus_tag="TPHA_0D04575"
                     /inference="similar to DNA sequence:INSDC:YLR204W"
                     /note="similar to Saccharomyces cerevisiae QRI5 (YLR204W);
                     ancestral locus Anc_7.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685526.1"
                     /db_xref="GeneID:11534239"
                     /db_xref="InterPro:IPR013177"
                     /db_xref="UniProtKB/TrEMBL:G8BS17"
                     /translation="MFGIVRNCAWKAPRALHGVFNLKLRKNYLHTFVDSRASSILGNP
                     VINSKVLVQLNLRPLAPLAPVRDVPHQNIVEMELDSVMRKRKKKMKKHKLRKRRKREK
                     AEKRKLSQGR"
     gene            <1000005..>1001417
                     /gene="TPHA0D04580"
                     /locus_tag="TPHA_0D04580"
                     /db_xref="GeneID:11534442"
     mRNA            <1000005..>1001417
                     /gene="TPHA0D04580"
                     /locus_tag="TPHA_0D04580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685479.1"
                     /db_xref="GeneID:11534442"
     CDS             1000005..1001417
                     /gene="TPHA0D04580"
                     /locus_tag="TPHA_0D04580"
                     /inference="similar to DNA sequence:INSDC:YIL146C"
                     /note="similar to Saccharomyces cerevisiae ECM37
                     (YIL146C); ancestral locus Anc_5.699"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685527.1"
                     /db_xref="GeneID:11534442"
                     /db_xref="UniProtKB/TrEMBL:G8BS18"
                     /translation="MRNTIMDIRSYTERRSVIEPHYSVLDLLEANMGGPPPSANVISN
                     STNTQNDWNAIIDLSDSWQILSSSSENSEEEDIEVRNGTLGRSRNANMSIHASTTSAY
                     SHSYFDQSASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEYC
                     FMLDVSTDNSVSLLVVQNHLELLDILRHSRDITVVAIVLSLDHRRGDNLEIIKNCNKV
                     LSSMKERKWPMLYYPNLIIIHERANNNHGSKTKVIANLLQFLREHEPSKLNGSIRSDT
                     VSQERSERMIKELFKPNSAPVNNKKNLSRSSIRAIRNVKSMRKSKYKPRIPLTERDKS
                     GIGKKDDKNQNDKDWFYKWSVSISIGIGIGVGYCLSTIIPSTTFSYLLRDFDSNETND
                     LIAYMDVVTDTDSDFIKDTIDNGQTINLPQTWDFLTSTVRHICVIMKYIILKPISFLG
                     SNWQNLDDSNRIIAMSYVLL"
     gene            <1001887..>1005270
                     /gene="TPHA0D04590"
                     /locus_tag="TPHA_0D04590"
                     /db_xref="GeneID:11534551"
     mRNA            <1001887..>1005270
                     /gene="TPHA0D04590"
                     /locus_tag="TPHA_0D04590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685480.1"
                     /db_xref="GeneID:11534551"
     CDS             1001887..1005270
                     /gene="TPHA0D04590"
                     /locus_tag="TPHA_0D04590"
                     /inference="similar to DNA sequence:INSDC:YIL147C"
                     /note="similar to Saccharomyces cerevisiae SLN1 (YIL147C);
                     ancestral locus Anc_5.700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685528.1"
                     /db_xref="GeneID:11534551"
                     /db_xref="GOA:G8BS19"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:G8BS19"
                     /translation="MQLIPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYF
                     TANYKNLKTGRLYIAAQLKASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISST
                     NWYESSLVLEKFLTSSDLFSVARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLN
                     ISLPSSLETIGICTDPVLNGSNFLMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLK
                     SVFNDTTALENSEVFVISADYSITTNLEYFNFLFASAYDNADKDYDLHYRIDNDTFVY
                     NGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSLVNWLAIVAQPEAAFSESATKLERII
                     SGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATERIAEGRGLRPPQPTVGSSVSRNSS
                     IKWRNSLENHVRSSLGFNANKLSDSGSITANNFKNNTSSSNSITSSHIYGNNNSSHSS
                     MGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCL
                     LEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVD
                     KIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLA
                     KDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGE
                     YDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSETELNNDENETHTISKD
                     DTADSSIKIGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIKSTDLDDDENKLG
                     VELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQL
                     STMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDELFNDEFNAVSKKNRKVKFKF
                     SGSSSAKSIKTRNSIGSSLNNRHSTTSIDSSSSDSDEEDNVRPSSVRLNRPFLQSTGT
                     ATSTQNVPTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDL
                     ARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAF
                     PKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIEDFQ"
     gene            complement(<1005511..>1006083)
                     /gene="TPHA0D04600"
                     /locus_tag="TPHA_0D04600"
                     /db_xref="GeneID:11531111"
     mRNA            complement(join(<1005511..1005889,1006076..>1006083))
                     /gene="TPHA0D04600"
                     /locus_tag="TPHA_0D04600"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="XM_003685481.1"
                     /db_xref="GeneID:11531111"
     CDS             complement(join(1005511..1005889,1006076..1006083))
                     /gene="TPHA0D04600"
                     /locus_tag="TPHA_0D04600"
                     /inference="similar to DNA sequence:INSDC:YIL148W,YKR094C"
                     /note="similar to Saccharomyces cerevisiae RPL40A
                     (YIL148W) and RPL40B (YKR094C); ancestral locus Anc_5.701"
                     /codon_start=1
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /protein_id="XP_003685529.1"
                     /db_xref="GeneID:11531111"
                     /db_xref="GOA:G8BS20"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BS20"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            <1006833..>1010384
                     /gene="TPHA0D04610"
                     /locus_tag="TPHA_0D04610"
                     /db_xref="GeneID:11531037"
     mRNA            <1006833..>1010384
                     /gene="TPHA0D04610"
                     /locus_tag="TPHA_0D04610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685482.1"
                     /db_xref="GeneID:11531037"
     CDS             1006833..1010384
                     /gene="TPHA0D04610"
                     /locus_tag="TPHA_0D04610"
                     /inference="similar to DNA sequence:INSDC:YIL149C,YKR095W"
                     /note="similar to Saccharomyces cerevisiae MLP2 (YIL149C)
                     and MLP1 (YKR095W); ancestral locus Anc_5.702"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685530.1"
                     /db_xref="GeneID:11531037"
                     /db_xref="UniProtKB/TrEMBL:G8BS21"
                     /translation="MNKQETTSSIVVNSEEWDALHNKLKDLKELNNGLKNEFLVLSNS
                     LNLSNNNSNNSINKKQLDFSELEKRFEVINSINEQLKNELYTKNKEYFQIKQECDVKI
                     EDYKSNLNELKHRLSKEILQNKNNKQKIINVYEHSINESLENDKKYVKDFEKLETLES
                     KFLETYDQMNIMKNKIYFNTQPATPIAENEPSEESYDVEVDNNYNSWRTSIEYNEKLN
                     IKKVVYKLQERLETVSTMNKELLKIIKLSENEEMNISLQNLNSNNNNLYNDTHSNNDF
                     EFDINNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIE
                     EQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNN
                     KILTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELT
                     NKMESIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDK
                     IHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLSIEISNASNENKILKE
                     KFDLLIKSYTELKELKSEISTYTKSSVISKDGNETAKISELVDLKAKCKNLEKSFKDR
                     ESKFQELEIENNNVKDELKKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKE
                     ELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKISNLASS
                     AESAAMLKNKNEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLRED
                     YCDLEKSKNELEQRLLLLESSEKSLQEEIVKMKDELMTSNNELDNNQRSQEELRNEYE
                     KQNKLYKIKEEELESALNQLMLKENQNSALDLESLPDDVMLKLKEMVKKDIEIENDII
                     LKAKLKEIEKNSAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAENQAMART
                     RKELEKEYEERLSKESEKLSDQYNNKLKDDLSEELLKIDKKYAMELETKLKNETDESK
                     KEFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIPSTTNLSTN
                     FAFGQNPFVSNASQNAYMSNVFLSGSPFSRNAPEKAFKHSTPDNTNSSITVQPTLTFN
                     TDFSNESKDLKRSAESAAEDDEVEEGDNKIAKIQRDD"
     gene            complement(<1010489..>1011709)
                     /gene="TPHA0D04620"
                     /locus_tag="TPHA_0D04620"
                     /db_xref="GeneID:11534614"
     mRNA            complement(<1010489..>1011709)
                     /gene="TPHA0D04620"
                     /locus_tag="TPHA_0D04620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685483.1"
                     /db_xref="GeneID:11534614"
     CDS             complement(1010489..1011709)
                     /gene="TPHA0D04620"
                     /locus_tag="TPHA_0D04620"
                     /note="ancestral locus Anc_5.704"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685531.1"
                     /db_xref="GeneID:11534614"
                     /db_xref="GOA:G8BS22"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:G8BS22"
                     /translation="MTTEIDSLERLKLVQIGDMVYDVVAEKKGSKYSSFKLESYKCTE
                     ESAALEVHSLLASSELVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGE
                     DSIKDLATKFEASKDYTIIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIP
                     LGTGNALASSIHLSSPHQVFQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHA
                     NLLHACDSDEYQKMGTERFAKASENIFKNYDLNIGLTTKNGSESISRNYAYFAIINTP
                     NLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYY
                     YPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLLLNLDDINNQHGVAESNKNKITIS
                     KFPNDLNFQLNLFA"
     gene            <1012556..>1015444
                     /gene="TPHA0D04640"
                     /locus_tag="TPHA_0D04640"
                     /db_xref="GeneID:11534272"
     mRNA            <1012556..>1015444
                     /gene="TPHA0D04640"
                     /locus_tag="TPHA_0D04640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685484.1"
                     /db_xref="GeneID:11534272"
     CDS             1012556..1015444
                     /gene="TPHA0D04640"
                     /locus_tag="TPHA_0D04640"
                     /inference="similar to DNA sequence:INSDC:YIL151C,YKR096W"
                     /note="similar to Saccharomyces cerevisiae YIL151C and
                     YKR096W; ancestral locus Anc_5.706"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685532.1"
                     /db_xref="GeneID:11534272"
                     /db_xref="UniProtKB/TrEMBL:G8BS23"
                     /translation="MSAYTGNMNKDNKRILQSIDEPWFSLKFRKVSPSVKEYGSQSKG
                     DLDSKKCSETEPVTPESETVSPIAPIKPVNSSQHSKPVADIEKSIEIDHMLNADEKLD
                     PLAGLLPLFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTE
                     FIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVS
                     VINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLN
                     SLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIE
                     NTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYFTLLSLFFGSTSSSQLS
                     GMERSSLHYFWNEFANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPLFSLISIVE
                     TIIMNKKLNPFFCVYKSSDDFEIKSVSLSNWKILIEQMDDTLLHSNKLLFKKFLMLNV
                     AISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLNESIDMVN
                     KHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASI
                     TTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPELIDVSIR
                     GQSLTNSSCIKNSDSLTNDYLFDWGFELNNNNAVIIDDTLHGRNRIFKFSYIPDFQDF
                     DKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPK
                     LENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSAS
                     RVMIVINYLYAMNQINILKEFESPISKALKNIDGSQILNFNGKFKNDLLTKENGPGQQ
                     LNMIELRMDNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVASLQDWLL"
     gene            complement(<1015658..>1016923)
                     /gene="TPHA0D04650"
                     /locus_tag="TPHA_0D04650"
                     /db_xref="GeneID:11534134"
     mRNA            complement(<1015658..>1016923)
                     /gene="TPHA0D04650"
                     /locus_tag="TPHA_0D04650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685485.1"
                     /db_xref="GeneID:11534134"
     CDS             complement(1015658..1016923)
                     /gene="TPHA0D04650"
                     /locus_tag="TPHA_0D04650"
                     /inference="similar to DNA sequence:INSDC:YIL153W"
                     /note="similar to Saccharomyces cerevisiae RRD1 (YIL153W);
                     ancestral locus Anc_5.709"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685533.1"
                     /db_xref="GeneID:11534134"
                     /db_xref="GOA:G8BS24"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:G8BS24"
                     /translation="MEDLSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLH
                     KYINMVHNVEIPDLTYVSEITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWH
                     SLIDSKVPLLLEKVLGCSNHATEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHE
                     LSFLAVIAAMDMLGLWTENFKGVDLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDD
                     HFHLSYILGSSQLSENPNPPFSPSDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSE
                     HSPILYDISTTVNSWLKVNSGLVKMYMVEVLNKFPVVQHFWFGEGFYPWKNVKTHKLL
                     DVYMNDTNQENNVFNSSDSSSIPNNAMNKDRSVNQNPSQLNRIPQNRYTAIPVNNRDL
                     RRPPMGPPSSHGVENILQFKPIDRFRRRR"
     gene            complement(<1017401..>1020538)
                     /gene="TPHA0D04660"
                     /locus_tag="TPHA_0D04660"
                     /db_xref="GeneID:11534279"
     mRNA            complement(<1017401..>1020538)
                     /gene="TPHA0D04660"
                     /locus_tag="TPHA_0D04660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685486.1"
                     /db_xref="GeneID:11534279"
     CDS             complement(1017401..1020538)
                     /gene="TPHA0D04660"
                     /locus_tag="TPHA_0D04660"
                     /inference="similar to DNA sequence:INSDC:YIL156W,YKR098C"
                     /note="similar to Saccharomyces cerevisiae UBP7 (YIL156W)
                     and UBP11 (YKR098C); ancestral locus Anc_5.712"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685534.1"
                     /db_xref="GeneID:11534279"
                     /db_xref="GOA:G8BS25"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8BS25"
                     /translation="MKVESTFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLE
                     HTAYLLESYLDLLHEQKYDECLSAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKIL
                     YQNQANMTNVLAIVKNEVDSILDESILELEGIEKVIKRDRAYSSPAPKVNNISKFSKL
                     SINDNHHNGETISTDNKLQSHFPQTPNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIW
                     HIPSLEPNDQLKLALEQPVEFSDEEIDASSISEPLGRRYSPLSPYQKKRNSSISSAFL
                     VPFPHNENDKVHDNSMLIEDLPVDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLSNSY
                     IQSMDRLQKQNVITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPN
                     LLWNEETQTPIYSFEELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYL
                     LLSTKSLNLKQVPTNLLGGFEKWKKVLKTYNKEYGIDITPFIKKLHATELNKNTVPTG
                     EMKTLEATSWKQPEVPLRIRKRPPPPPPSSIPEIPSTYQNNELTTLIEDKRLENIDVQ
                     GKHRRIEYISPPIPPRTPSPNHQPSYNQKKHQYKALKSYATPVPTIEQNPNTYVSLSI
                     TGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTDKINLSRSFSILFRK
                     MYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLHDELSKEDTVLND
                     YSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSINCQRCGYSSFN
                     YSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCSRCGSQSDNF
                     VKTSHNDHHKEHTSETTDDSKQNRKSRLFLLPKKYNPTSRSLSPFGRHSSHKSSEKWK
                     SKKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRL
                     YAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNK
                     VSSSHVYVLFYEKID"
     gene            <1021296..>1023581
                     /gene="TPHA0D04680"
                     /locus_tag="TPHA_0D04680"
                     /db_xref="GeneID:11534440"
     mRNA            <1021296..>1023581
                     /gene="TPHA0D04680"
                     /locus_tag="TPHA_0D04680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685487.1"
                     /db_xref="GeneID:11534440"
     CDS             1021296..1023581
                     /gene="TPHA0D04680"
                     /locus_tag="TPHA_0D04680"
                     /inference="similar to DNA sequence:INSDC:YKR099W"
                     /note="similar to Saccharomyces cerevisiae BAS1 (YKR099W);
                     ancestral locus Anc_5.713"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685535.1"
                     /db_xref="GeneID:11534440"
                     /db_xref="GOA:G8BS26"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G8BS26"
                     /translation="MAMNKKSLINKKLKKKKPVDHLDVTESLGYQTYRKKARNIWKKE
                     EDEKLLFYIDESLKKLGYSDGLDVLKSIKFKDDDFAAQNEKKMNIIKNIPWDDIATHF
                     DSQIRKGKDLRKHWTGSLDPTLRKGKWVPSEDNKLLKAFNKHGRHWLNIAAEIPGRTE
                     DQCAKRYLEVLRPDNARRLRDWALEEDLKLIQKVGIYGTKWRKISSEMDCRPSLTCRN
                     RWRKIITMVVRSNAPQQIMKAVKENKNIDISKSDSNISLNKNKHNAKDNKKITNGTKT
                     QADNKSLNHKYASDNDGNEHGNAENDDENEIIDKYDESESEDLLVESYEEQTSPNLNI
                     TSPNDTNILNEKDEISDKPTDSMSLSTQHNQGNNITSPMSHQKESLLLNHIASTFESL
                     QSITDIKSPESAERGGTPYQDVTPISSLNSTNHESSKNIPKHVPNSSSMEWKFTLKDG
                     KGLSISNGYINNSDLIRELIEQARKYSLQISIHQHIHNHYTSNSQESGQNSGIFNDKS
                     FPIDNVHTIDREFDVFGKDFLSNSPDFDSLGLGTSNEENQDNNILEYNINKNSIGGSI
                     HRSSSYVSKDDSVSSKGSRSVQSSDIRELGANRINHFNYLPPTIKPKLASSDSPQNPT
                     LNKTPTSSESNFPNYPNKITKEGLAKRGESRRRRMTDGSLYSSAESSNSMSSIVKQSS
                     RNTPGSFKQLSKTESYQNEEEGLDFWENLRTLAGNPSLDDSERVEDMDEAEDYGMFFD
                     IIDNQQKSYDSPDIFHSNYTK"
     gene            complement(<1023974..>1025083)
                     /gene="TPHA0D04690"
                     /locus_tag="TPHA_0D04690"
                     /db_xref="GeneID:11531057"
     mRNA            complement(<1023974..>1025083)
                     /gene="TPHA0D04690"
                     /locus_tag="TPHA_0D04690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685488.1"
                     /db_xref="GeneID:11531057"
     CDS             complement(1023974..1025083)
                     /gene="TPHA0D04690"
                     /locus_tag="TPHA_0D04690"
                     /inference="similar to DNA sequence:INSDC:YIL158W,YKR100C"
                     /note="similar to Saccharomyces cerevisiae YIL158W and
                     SKG1 (YKR100C); ancestral locus Anc_5.716"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685536.1"
                     /db_xref="GeneID:11531057"
                     /db_xref="UniProtKB/TrEMBL:G8BS27"
                     /translation="MLDNGSAVAVGCAVGIPVGVGCAIGLFFWLRFQKRLKREESEDL
                     DLQKAIYDDEGFISFNNLSSMQYKNDDKFNSNDEITQSYNNSTTSLNTDTKEKRKSKH
                     FVPAYRRKINSISRRSRLDDPSILYENNGSKTSIVQQPSLYEQMIPVIQDDNLFFNNN
                     DNNNNDNSNNNNANNNTNINTDQTRSLDLNSNHHRANGILANEKVNTPYASNLLNFFK
                     TDSSISVIESIDGSNTNNDTKHSTQLELVNKLQNGGSDLATFYPRRLSSPSTTNNGAF
                     GTSYIQTNNSQNSIHTRSSSMNSFIKPAPIDNIFSTPTKSVKSVTNQDNYQLKNNYDI
                     ENANEIEEEDQYENDYTNYSKNRSDFIDSLRPKNT"
     gene            <1026978..>1031510
                     /gene="TPHA0D04700"
                     /locus_tag="TPHA_0D04700"
                     /db_xref="GeneID:11534560"
     mRNA            <1026978..>1031510
                     /gene="TPHA0D04700"
                     /locus_tag="TPHA_0D04700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685489.1"
                     /db_xref="GeneID:11534560"
     CDS             1026978..1031510
                     /gene="TPHA0D04700"
                     /locus_tag="TPHA_0D04700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685537.1"
                     /db_xref="GeneID:11534560"
                     /db_xref="GOA:G8BS28"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G8BS28"
                     /translation="MSELDKDSSSNVSSASDHISYNGFDEKADKRIRQLAQQLTRTST
                     NLDTQDVNGNNNNDVQSTVSRSIFSDSLLKEGVNPVFTDINDPNYNEKLDPNSDNFSS
                     YDWVKNISNLANADPDYYKPYKLGCSWKNLTAEGNSSDVSYQSTVLNLPLKLATLGYY
                     LLSSGANKKVQILKSVDGLIKPGELLVVLGRPGSGCTTLLKSITSNTHGFQLTDESEI
                     SYDGLTPKEIKKHYRGDVVYNAEADIHLPHLTVFQTLVTVAKLKTPQNRFKGVTREQF
                     ADHVTDVTMATYGLLHTRNTKVGNDLVRGVSGGERKRVSIAEVTICGSKFQCWDNATR
                     GLDSATALEFIRALKTQAVLQNTAATVAIYQCSQDAYDLFDKVCVLDEGYQLFYGSSS
                     KAKEFFIKMGYICPPRQTTADFLTSVTSPVERILNEEYLAKGIKIPQTPRDMSEYWRN
                     SQEYRDLIREIDEYNAQNNDESKQIMHDAHVATQSRRARPSSPYTVSYGLQIKYILTR
                     NIWRMKNSFEITGFQVFGNSAMALILGSMFYKVMLHPTTDTFYYRGAAMFFAVLFNAF
                     SSLIEIFTLYEARPITEKHKSYSLYHPSADAFASIISEIPPKLITSVCFNIIFYFLCN
                     FRRNGGVFFFYYLISIVAVFAMSHLFRCVGSLTKTLQEAMVPASMLLLALSMYTGFAI
                     PRTKILGWSIWVWYINPLAYLFESLMINEFHGRHFPCTAYIPAGGSYDSQTGTTRICS
                     VNGAIAGQDYVLGDDYIKSSYAYEHKHKWRGFGVGMAYVVFFFVVYLVICEYNEGAKQ
                     KGEILVFPRSVVKKMKKAKTLNDSSSNVSDVEKATSESISDKKLLEESSGSFDDSSER
                     EHFNISKSSAVFHWRNLCYDVQIKSETRRILNNVDGWVKPGTLTALMGSSGAGKTTLL
                     DCLAERVTMGVITGDIFVDGLPRDTSFPRSIGYCQQQDLHLTTATVRESLRFSAELRQ
                     PADVSVSEKHAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLL
                     VFLDEPTSGLDSQTAWSICQLMKKLAKFGQAILCTIHQPSAILMQEFDRLLFLQKGGK
                     TVYFGELGDNCTTMIDYFERNGAHKCPPDANPAEWMLEVVGAAPGSHASQDYNEVWRN
                     SDEYRAVQEELDWMESELPKQATETSAHELLEFASSLWIQYVAVCIRLFQQYWRTPSY
                     IWSKFLVTIFNALFIGFTFFKADRTLQGLQNQMLAIFMFTVITNPILQQYLPSFVTQR
                     DLYEARERPSRTFSWKAFIAAQISVEIPWSILAGTLYFLIYYYAIGFYNNASAADQLH
                     ERGALFWLFSCAFFVYIVSLGTLVIAFNQVAETAAHLASLMFTMCLSFNGVLVTSAKM
                     PRFWIFMYRVSPFTYFVDALLSTGVANVEVHCADYELRKFTPPSGLTCGEYMDPYISA
                     AGTGYLTDPNNTETCSFCQISDTNTFLASVGSSYHRRWRNFGIFICFIAINYIGGIFF
                     YWLSRVPKGSKKMKSK"
     gene            <1033100..>1034263
                     /gene="TPHA0D04710"
                     /locus_tag="TPHA_0D04710"
                     /db_xref="GeneID:11530968"
     mRNA            <1033100..>1034263
                     /gene="TPHA0D04710"
                     /locus_tag="TPHA_0D04710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685490.1"
                     /db_xref="GeneID:11530968"
     CDS             1033100..1034263
                     /gene="TPHA0D04710"
                     /locus_tag="TPHA_0D04710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685538.1"
                     /db_xref="GeneID:11530968"
                     /db_xref="UniProtKB/TrEMBL:G8BS29"
                     /translation="MPEQQEIASLYTIQTTGSPSTDEVPEDYLRTIEEKIYNKRHIDD
                     RIQNIVINKDYAVLFLHKYHKVKKIELSLLEGENVRDTHSKNFEQTYFLFHDTILSKT
                     SKEEPAKSGTEIQLTQLQNLTIIFCENNSYVLPIIFPNFMRLHILKDQFPYTILQSLV
                     NDNIISFDKFFQKVKKKVKKIEVQSDTSYRLNLNHFKKLSFLKSNFETCLDSQKIANK
                     PILKFVNEQKRAFAKNAAIVNCCCSISHSIEEAKLEADELSKYITEVDKQLNRLYQTR
                     LTSFRGIFVTLIVFTSIFISGLFKDIYNDSASTGIIIAFILLVIFCGICFLILILLYW
                     HISLLWFLPLNRNTDEKNNKDASNTRDLEIVYSEFEQGHNSNSSSVRTNPENV"
     gene            complement(<1034385..>1035263)
                     /gene="TPHA0D04720"
                     /locus_tag="TPHA_0D04720"
                     /db_xref="GeneID:11531069"
     mRNA            complement(<1034385..>1035263)
                     /gene="TPHA0D04720"
                     /locus_tag="TPHA_0D04720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685491.1"
                     /db_xref="GeneID:11531069"
     CDS             complement(1034385..1035263)
                     /gene="TPHA0D04720"
                     /locus_tag="TPHA_0D04720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685539.1"
                     /db_xref="GeneID:11531069"
                     /db_xref="UniProtKB/TrEMBL:G8BS30"
                     /translation="MFIWKSGKSRTEAQDPRKFDVSFTVIKCEAINELYDSIVIAGDG
                     DSWDSPLYEQLEELADYTRPNAPALLAIGNDEVNTLYISSPFGMSKCKNKVYERNYKT
                     KKIDFEKLNQQIQARYLVEPLRRKTNTPKRMLDRRFADGTDHLNPIKSVEYLPLYRDD
                     YIPIIFLKCSYENAKRTAKLVAIERKQWDDDISLKFFPDIFYSYLEYPVEFVIWRIKG
                     SVYAQLKVCGGSDPNISITMFDYMRDQYLEFMGYKLVNHQGDSDVILIEPVERRKDED
                     LSDSIEEAPPSYDTLF"
     gene            complement(<1036442..>1037584)
                     /gene="TPHA0D04730"
                     /locus_tag="TPHA_0D04730"
                     /db_xref="GeneID:11534609"
     mRNA            complement(<1036442..>1037584)
                     /gene="TPHA0D04730"
                     /locus_tag="TPHA_0D04730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685492.1"
                     /db_xref="GeneID:11534609"
     CDS             complement(1036442..1037584)
                     /gene="TPHA0D04730"
                     /locus_tag="TPHA_0D04730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685540.1"
                     /db_xref="GeneID:11534609"
                     /db_xref="UniProtKB/TrEMBL:G8BS31"
                     /translation="MTKNIQYGLKGKKGTLSIEKEKTENEKLTFNNFRKVPKIVIIYF
                     LLFIIVFVLSTLYFRNHDLYGDKKVQSVAFTAGIAPTIAKRSHWYWAAAAALGGFLVT
                     AAALSGGYAVTACSKDLGSPNCWISVAIALVSGSLGGVATAAAGVAGAAASAAANAKR
                     DGGFISSIGPLDFYHTSLTNLTQLNSTFVDAGLTLLGAFEYTNTSDSSIQTQKRGLSD
                     GNRQHVLYFKSAKGNHVASHLNNDIDRLVSSITNQVEPGSLSDTIGNYKSLQRRYNYF
                     DAEWISWNWDNVNVDLTRDVEQDRGLEEEEYDQGFYNFFSGAPAWKYCWAVTVNPHPG
                     QNEGYDQIGDGNAVHGELYFNTYGGVDGYCNDNKDGAQCPNPACES"
     gap             1040452..1041487
                     /estimated_length=1036
CONTIG      join(HE612859.1:1..1042069)
//
DBGET integrated database retrieval system