GenomeNet

Database: RefSeq
Entry: NC_016524
LinkDB: NC_016524
Original site: NC_016524 
LOCUS       NC_016524             854350 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 5, complete genome.
ACCESSION   NC_016524
VERSION     NC_016524.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 854350)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 854350)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612860.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..854350
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="5"
     gene            <1153..>1908
                     /gene="TPHA0E00100"
                     /locus_tag="TPHA_0E00100"
                     /db_xref="GeneID:11531392"
     mRNA            <1153..>1908
                     /gene="TPHA0E00100"
                     /locus_tag="TPHA_0E00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685493.1"
                     /db_xref="GeneID:11531392"
     CDS             1153..1908
                     /gene="TPHA0E00100"
                     /locus_tag="TPHA_0E00100"
                     /inference="similar to DNA sequence:INSDC:YIL161W"
                     /note="similar to Saccharomyces cerevisiae YIL161W;
                     ancestral locus Anc_5.719"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685541.1"
                     /db_xref="GeneID:11531392"
                     /db_xref="UniProtKB/TrEMBL:G8BT79"
                     /translation="MSESGTNLPKRKRYYRKNNNNIRHDTTNNDKIREPTPEVLSDQL
                     NGNISRGEKIIHNKASEKLSRISINENNKQQKSTSSRTNSSKKTNYKRYTSDFNLSII
                     DDSAELKSSEDQNIRKEEIECCLRQLSHYSFKLFNKGKYVESFGFNHKLLDISGNKNQ
                     IRLLISIPNDYPKSPVKVNIANKKNPDYPKVQEEIFQLVKNFNMKSKDLLLKKYPIIA
                     QINYLVQKKDILMNPSFKNIDDKEQQFYKDIYV"
     gene            complement(<2049..>3290)
                     /gene="TPHA0E00110"
                     /locus_tag="TPHA_0E00110"
                     /db_xref="GeneID:11531245"
     mRNA            complement(<2049..>3290)
                     /gene="TPHA0E00110"
                     /locus_tag="TPHA_0E00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685494.1"
                     /db_xref="GeneID:11531245"
     CDS             complement(2049..3290)
                     /gene="TPHA0E00110"
                     /locus_tag="TPHA_0E00110"
                     /inference="similar to DNA sequence:INSDC:YIL160C"
                     /note="similar to Saccharomyces cerevisiae POT1 (YIL160C);
                     ancestral locus Anc_5.718"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685542.1"
                     /db_xref="GeneID:11531245"
                     /db_xref="GOA:G8BT80"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:G8BT80"
                     /translation="MSERLQSVSNHLQASISNSVGFVCPTKKNPDDVVIIQAKRSAIA
                     KGFKGSFKDLNTDYLLQQFLIEFLKTLPDNLKSNPRLIEEIVCGNVLNYGAGATEHRS
                     ACLAAGIPYTTAFMALNRQCSSGLTAVNDIANKIKTGQIEIGLALGVESMTKNYASVN
                     PLGRISEEMKINKEARKCLIPMGITNENIAQQFGISRKEQDEFAANSYKKASNAIKNG
                     LFKNEILPIKTPDGKIVTIDEGPREGVTADSLGNLKPAFIKDKGSTTAGNASQVSDGV
                     AGVLLTRRSVAEKFGFPVIGRYLAFQAVGVPPEVMGVGPAYAIPRVLKDVGLTIDNID
                     VFEINEAFAAQALYCINKLGIKREKVNPKGGAIALGHPLGCTGARQVATIMNELKTNQ
                     IGVVSMCIGTGMGAAAVFIKE"
     gene            <4818..>9746
                     /gene="TPHA0E00120"
                     /locus_tag="TPHA_0E00120"
                     /db_xref="GeneID:11531246"
     mRNA            <4818..>9746
                     /gene="TPHA0E00120"
                     /locus_tag="TPHA_0E00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685495.1"
                     /db_xref="GeneID:11531246"
     CDS             4818..9746
                     /gene="TPHA0E00120"
                     /locus_tag="TPHA_0E00120"
                     /inference="similar to DNA sequence:INSDC:YIL159W"
                     /note="similar to Saccharomyces cerevisiae BNR1 (YIL159W);
                     ancestral locus Anc_5.717"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685543.1"
                     /db_xref="GeneID:11531246"
                     /db_xref="InterPro:IPR014767"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BT81"
                     /translation="MNNQYDHITINDSDSSSNIDSEFEIDNAMDNEFSGMTIIEHNKQ
                     DNMIDYKDNTNELIEKGLSLVGSALSELPPNEYLEANNGEDSFIHVENNNNDNNNCNK
                     KIPIELDNLEFNPHVVPENDDIVNELFTSLLKDRSNFWRSSLVSNDISKRRKWALICK
                     IKNEEKEDNLQQKADKLQLTSALTDFADISVTSTEGDTSRELVKPNLLNGKQQNVHNI
                     MLQLRNLINNNSEISKTIYILEKKLRQTNFLLTFINEVNINILAEIDYKITSNLQNAY
                     LNCFKSILNHENGRYYILKSKKIVQYFVQLLSDKQSTIRIKLLATELLLLLTYVDTQL
                     GYETVLESLEPNFSSWLDNMKSYLLDKDTIVNEQKINHAYIYFLNATTLLGEYSTVSL
                     FLLNSIMEVLPNIERKYKIINGLKEFGIHQIFYLMKILCTDEEQEIEIISNSNTFSKT
                     VLSEQINLYSKIEQDVIMSISHHKPMFVDISFGNELQLLVSQVQKTPLEKPIGDLLTT
                     LIKLITSRTQSESLKVMKTFESMLAYLINSLFSNSNIHMLDRDDDFDISPELVVQSSI
                     NDLMDRLHSDEIAKRAMDEMTGLEHNLIKLKSELESLKEERHADTGELIKELQETNLQ
                     NEKLHLELKGMQKMLQLSEEKRKEDKNTIEKYATHDRYRSLNNSNGSLNYSSTKFKMI
                     RNISNSKLKTSNIGNGDFVRKSVNNSLYKSKRISSLSSYLKQDKGNDLAFLGSNNDAR
                     HDQSLSKSNNGNFKQDMEFSQTSQESHLNRVSLDKNIFNNLKMRSTDSFFISSNHNNI
                     NEISQLDQKEYLDVSDLHSQAVYNPSQGALLKNSFKLTNDSVNSFISIESSDISENEG
                     FHPMRDSKNSLLQVNHKHKNLNNYIPIDGRPNDASFRTTTNHSQSHQIYLPKFPVGYE
                     VNEENVNAFTQIPSADHVFKNSVAITTATTTGHGFHYMADTNMEDSVVQRYVSLQQSN
                     PSVSQTQPLMVQQPPSPPPLPSSLEILKNNVQNLQENSSDKIEISKYNSIASLTSSPP
                     PPPPLPPSLTIITEPTSTLKSESLEAKTSPLPPPPPPLPPSLKFDSEEPKILPLAPPP
                     PPPPPPLLKNLSQDMNMEKGESKNTAENIKPEDDNIPAVPPFLTHLNIQKEDKKLKQI
                     HWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKNTDEAKTKDK
                     QQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFFNKEEFTH
                     ISGSVARNYAPYGVDYQTNNEATKDASELERADRIFLELFYNLRAYWAERSQCLLLLH
                     TYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMNKKPAEGILISSLTK
                     LVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHITMECKEFC
                     THVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILTNHSIVK
                     VLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLDNKLQ
                     KNNSSGDDSDLEKNTENDDAVDKLLLKLRGVENKPEPLRRRRSTKLLSNVIEENLEDT
                     IEISLENNKEEKLLKRTHALINDTQKFNQGSL"
     gene            complement(<10049..>10606)
                     /gene="TPHA0E00130"
                     /locus_tag="TPHA_0E00130"
                     /db_xref="GeneID:11531251"
     mRNA            complement(<10049..>10606)
                     /gene="TPHA0E00130"
                     /locus_tag="TPHA_0E00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685496.1"
                     /db_xref="GeneID:11531251"
     CDS             complement(10049..10606)
                     /gene="TPHA0E00130"
                     /locus_tag="TPHA_0E00130"
                     /inference="similar to DNA sequence:INSDC:YIL157C"
                     /note="similar to Saccharomyces cerevisiae YIL157C;
                     ancestral locus Anc_5.715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685544.1"
                     /db_xref="GeneID:11531251"
                     /db_xref="InterPro:IPR014807"
                     /db_xref="UniProtKB/TrEMBL:G8BT82"
                     /translation="MLKITNKAITRNLLCLSSKRSIVFQATKLRSTISTVETEKIRKP
                     ITINDELPDPTEHQFRQRLGFVAFVLSVSSALGLLFNYEKTESPIVVNTIYYLRRSAK
                     TREILGDNIEFDGLIPWVSGKLNQVQGKVNIKFHIKGSNNVVGTVRLVADRNNRDEEF
                     LIHEWTLTVNGQKLDILSEIEGASI"
     gene            <11050..>11373
                     /gene="TPHA0E00140"
                     /locus_tag="TPHA_0E00140"
                     /db_xref="GeneID:11531236"
     mRNA            join(<11050..11058,11161..>11373)
                     /gene="TPHA0E00140"
                     /locus_tag="TPHA_0E00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685497.1"
                     /db_xref="GeneID:11531236"
     CDS             join(11050..11058,11161..11373)
                     /gene="TPHA0E00140"
                     /locus_tag="TPHA_0E00140"
                     /inference="similar to DNA sequence:INSDC:YIL156W-B"
                     /note="similar to Saccharomyces cerevisiae YIL156W-B;
                     ancestral locus Anc_5.714"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685545.1"
                     /db_xref="GeneID:11531236"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:G8BT83"
                     /translation="MTFIGKAIHVSIDLTLLSVCLAGIKRNTGLQFRVDKVEDTNVQR
                     YINKYLNFGESIYDYSVATCGSSSYFSRK"
     gene            complement(<11922..>13862)
                     /gene="TPHA0E00150"
                     /locus_tag="TPHA_0E00150"
                     /db_xref="GeneID:11531237"
     mRNA            complement(<11922..>13862)
                     /gene="TPHA0E00150"
                     /locus_tag="TPHA_0E00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685498.1"
                     /db_xref="GeneID:11531237"
     CDS             complement(11922..13862)
                     /gene="TPHA0E00150"
                     /locus_tag="TPHA_0E00150"
                     /inference="similar to DNA sequence:INSDC:YIL155C"
                     /note="similar to Saccharomyces cerevisiae GUT2 (YIL155C);
                     ancestral locus Anc_5.711"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685546.1"
                     /db_xref="GeneID:11531237"
                     /db_xref="GOA:G8BT84"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:G8BT84"
                     /translation="MFRHAVKQVASRKLVAGTAAAVVGASFYYNQLQSTNNWDNASII
                     QNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNV
                     ALVEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPH
                     LCKILPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESK
                     LKAGLVYHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDI
                     ETGEKIQINAKVIVNATGPYSDKILQMDNNKNGKPDEFTQSAETSIATKVAVQNPHMV
                     VPSAGVHIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPT
                     ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKEGATQELVRSHFI
                     FTSDHGLVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLA
                     ALLAQKYHLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDF
                     DSFRYPYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELN
                     WDEERRKQETDYSIEYIKTFGV"
     gene            complement(<14950..>16272)
                     /gene="TPHA0E00160"
                     /locus_tag="TPHA_0E00160"
                     /db_xref="GeneID:11531253"
     mRNA            complement(<14950..>16272)
                     /gene="TPHA0E00160"
                     /locus_tag="TPHA_0E00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685499.1"
                     /db_xref="GeneID:11531253"
     CDS             complement(14950..16272)
                     /gene="TPHA0E00160"
                     /locus_tag="TPHA_0E00160"
                     /inference="similar to DNA sequence:INSDC:YIL154C"
                     /note="similar to Saccharomyces cerevisiae IMP2'
                     (YIL154C); ancestral locus Anc_5.710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685547.1"
                     /db_xref="GeneID:11531253"
                     /db_xref="UniProtKB/TrEMBL:G8BT85"
                     /translation="MSNRKSILLTGPEGGTVDILNENETHSKDAANTKNSPIMELSNS
                     AGDYFSAGANNESSGVKFDSEQIENDRGRTRSRNNREDSSGTGNSFSYSSNNNSKSRS
                     RSRASSMVRDEEFLKWTVLRKDPSMRLKFRRANDGAHRDHSNEDLEDDDDEYFDEDDD
                     EISDEEQVSDLENELEIDDFTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNK
                     IDPNANVLINELEGGFVKAMELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTS
                     ATIASSNTNNTTSSSGSSDSGDSFILYTDLSSESTYALTYVMGTLVKNNDTLYIVHWE
                     GSTTSNNDAMKKKMTSNLQKIRENVMYLNDCNNSIIDRLDVVVISMTHPYPKHFLNEM
                     IYGLKPKSLICSLNIMLSPSGLQNYVCSIPVLVIRKKLKRTRRRGIDE"
     gene            complement(<16873..>18609)
                     /gene="TPHA0E00170"
                     /locus_tag="TPHA_0E00170"
                     /db_xref="GeneID:11531254"
     mRNA            complement(<16873..>18609)
                     /gene="TPHA0E00170"
                     /locus_tag="TPHA_0E00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685500.1"
                     /db_xref="GeneID:11531254"
     CDS             complement(16873..18609)
                     /gene="TPHA0E00170"
                     /locus_tag="TPHA_0E00170"
                     /inference="similar to DNA sequence:INSDC:YKR097W"
                     /note="similar to Saccharomyces cerevisiae PCK1 (YKR097W);
                     ancestral locus Anc_5.708"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685548.1"
                     /db_xref="GeneID:11531254"
                     /db_xref="GOA:G8BT86"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /db_xref="UniProtKB/TrEMBL:G8BT86"
                     /translation="MSAIFATETSREDIINNIKSLNDSSSLNTESQNNTKIKNKNDTI
                     KLLEEFISDNLSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSP
                     KDKRIVEEELSKDNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPR
                     YRIKIRVVCARAYHALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSK
                     TSVEINFKEMEMTILGTEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVT
                     LFFGLSGTGKTTLSADPHRQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFN
                     AIKFGSVLENCIYDEETHEVDYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLIL
                     LTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALH
                     PMKYASMLAEKMDKHKANAWLLNTGWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNE
                     EYETLPIFNLQIPKNANGVPSELLNPAGSWTDSSEDYMTAVQRLGKLFNENFKTYEDK
                     ATNEVIKAGPVL"
     gene            <19852..>20349
                     /gene="TPHA0E00180"
                     /locus_tag="TPHA_0E00180"
                     /db_xref="GeneID:11531255"
     mRNA            <19852..>20349
                     /gene="TPHA0E00180"
                     /locus_tag="TPHA_0E00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685501.1"
                     /db_xref="GeneID:11531255"
     CDS             19852..20349
                     /gene="TPHA0E00180"
                     /locus_tag="TPHA_0E00180"
                     /inference="similar to DNA sequence:INSDC:YIL152W"
                     /note="similar to Saccharomyces cerevisiae YIL152W;
                     ancestral locus Anc_5.707"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685549.1"
                     /db_xref="GeneID:11531255"
                     /db_xref="UniProtKB/TrEMBL:G8BT87"
                     /translation="MKSRLIIDHKRLVSHLDSRKKNKKAISELLATKKKYNKTYSKLK
                     LNNNFHNFKCSSASVSDLRLSINKFNMLLKASSNKYDEIHDINSIEKLSQNEFIVTTI
                     DSKTLILHSNEKNVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYDKIKTLLK
                     AYIHT"
     gene            complement(<20436..>24521)
                     /gene="TPHA0E00190"
                     /locus_tag="TPHA_0E00190"
                     /db_xref="GeneID:11531256"
     mRNA            complement(<20436..>24521)
                     /gene="TPHA0E00190"
                     /locus_tag="TPHA_0E00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685502.1"
                     /db_xref="GeneID:11531256"
     CDS             complement(20436..24521)
                     /gene="TPHA0E00190"
                     /locus_tag="TPHA_0E00190"
                     /inference="similar to DNA sequence:INSDC:YIL151C,YKR096W"
                     /note="similar to Saccharomyces cerevisiae YIL151C and
                     YKR096W; ancestral locus Anc_5.706"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685550.1"
                     /db_xref="GeneID:11531256"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="UniProtKB/TrEMBL:G8BT88"
                     /translation="MTLHLHNTIDLNFQTGHSTHLLVAKNYNTDKAMMQNNTSVEHDN
                     VGQKRHGSNSYKYLQPGIVKRRLAGNNNGDIHIQESSSNFDPKYSSFAYSRKDPINLT
                     TVDAPFIDLRPYVTENTPIASPKRNAIKKHQNNIAVTPQQSLVGNDIATLLSMDQKVL
                     SNPEILKATEPIIDDSMINNISLKNSLSRERSLNPGVNNIEDIFKIAASNFPSPENET
                     MIMNNININSTTKNGMAQNKIYSNESINKLNRKYNEELLPYSIIDNSSENQKSLNINN
                     NDYRGNGSDSGQINNFDYNTDNNETIDNDNGNNNHSNDSNMRNNVNNSSTGTHNDGNG
                     SGNNNNNNINNNSSSDENNNNNPEENNNSNGNNNEIPSVSVPLRKSSQVLVQKLQDIY
                     KTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFITTAIHPTQPESD
                     QQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVFISISNMLAD
                     IPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGKLYYHMST
                     VQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRNDQLLVD
                     YIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQFKC
                     FYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKITQ
                     PRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVS
                     IKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFP
                     WNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRG
                     SLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEI
                     GERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSF
                     KLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSF
                     DKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPMNEL
                     LVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIATS
                     KILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATH
                     IEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTD
                     DITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEGHNKLAIN"
     gene            complement(<25648..>26127)
                     /gene="TPHA0E00200"
                     /locus_tag="TPHA_0E00200"
                     /db_xref="GeneID:11531257"
     mRNA            complement(join(<25648..25882,26105..>26127))
                     /gene="TPHA0E00200"
                     /locus_tag="TPHA_0E00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685503.1"
                     /db_xref="GeneID:11531257"
     CDS             complement(join(25648..25882,26105..26127))
                     /gene="TPHA0E00200"
                     /locus_tag="TPHA_0E00200"
                     /inference="similar to DNA sequence:INSDC:YKR095W-A"
                     /note="similar to Saccharomyces cerevisiae PCC1
                     (YKR095W-A); ancestral locus Anc_5.705"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685551.1"
                     /db_xref="GeneID:11531257"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="UniProtKB/TrEMBL:G8BT89"
                     /translation="MFKKQSLEKLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSS
                     QGSDLVVNFQSVDDRVLRVGVSNVIDSIKTIIETIDELQDF"
     gene            complement(<26313..>27947)
                     /gene="TPHA0E00210"
                     /locus_tag="TPHA_0E00210"
                     /db_xref="GeneID:11531471"
     mRNA            complement(<26313..>27947)
                     /gene="TPHA0E00210"
                     /locus_tag="TPHA_0E00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685504.1"
                     /db_xref="GeneID:11531471"
     CDS             complement(26313..27947)
                     /gene="TPHA0E00210"
                     /locus_tag="TPHA_0E00210"
                     /inference="similar to DNA sequence:INSDC:YIL150C"
                     /note="similar to Saccharomyces cerevisiae MCM10
                     (YIL150C); ancestral locus Anc_5.703"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685552.1"
                     /db_xref="GeneID:11531471"
                     /db_xref="GOA:G8BT90"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015408"
                     /db_xref="UniProtKB/TrEMBL:G8BT90"
                     /translation="MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLK
                     RLVEDVNPNEAKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAG
                     ANLSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFS
                     EPDYANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNL
                     RVGDIIFILNPEVLPWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKT
                     GAKCNTPINKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNT
                     SNLKPGNNFNIVADRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLEN
                     KRRKIKDDKRDVMLQRALRESVGNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGF
                     DPTGGQIKVVLEKSADKSTQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHR
                     EQSFAQYKKSIIAAENRDRKSASTKNDTDSDDLEII"
     gene            complement(<28358..>32212)
                     /gene="TPHA0E00230"
                     /locus_tag="TPHA_0E00230"
                     /db_xref="GeneID:11531258"
     mRNA            complement(<28358..>32212)
                     /gene="TPHA0E00230"
                     /locus_tag="TPHA_0E00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685505.1"
                     /db_xref="GeneID:11531258"
     CDS             complement(28358..32212)
                     /gene="TPHA0E00230"
                     /locus_tag="TPHA_0E00230"
                     /inference="similar to DNA sequence:INSDC:YIL149C,YKR095W"
                     /note="similar to Saccharomyces cerevisiae MLP2 (YIL149C)
                     and MLP1 (YKR095W); ancestral locus Anc_5.702"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685553.1"
                     /db_xref="GeneID:11531258"
                     /db_xref="UniProtKB/TrEMBL:G8BT91"
                     /translation="MATGYDLFKLSSYYNIPTSELLSLNENILEQLKSKVDGDKIVLR
                     HDENADNDSTDLQTLHEQLNNITLKYNRVTNEKTQLADKISELEVKLEQEKCNNLHTK
                     LELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCLNREVINLKNDILI
                     LETKYDKLLKGYNDTKDNLKEKISELLALDTSFKSETKLKDEIIEEKDYLIANLTNEI
                     ESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTA
                     TVNEFQSKTGINFVSTDDFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELN
                     NQYDKINELELLLSKEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDL
                     TNQIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRF
                     ESVISLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESD
                     KLKEKISELQQQLNANRPVSHEKNGHESVLAENKLYTEGDRLILDELKNNIPEFTKQA
                     SNIISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKE
                     HMEVIKDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRIT
                     NELKMEREQLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQ
                     ELQDFISTKNRELDWYQKKFDIFSTMLKRVAEGNDNNDDIPVKTENINSSDSFVLDNF
                     SEQVEGDDTSSKERSPSCNNISVFRVKDPMKPLSNNNTDNVTSSNINFKTSSDLNNDF
                     ELLFNEYKVIEKELEKAKNEIMRTSGDAQELEKLSELLLSRDQEHSSLMKSNRQLQEK
                     LNDSEKHIEQMDMEIKKLNDSILEYQKNTLNITSEITLLRNRCKELENKLKEASLQSD
                     FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKL
                     EVQSKTVQELETQIKSTEADSRSRSTSIPKSQNQSLDKQDTKLITDEDSNVIPQSTQE
                     EDIKIKDVKTLDSEVSGSGVNLKNNAPEEKIIPVISNEHICTMESHTINNNPVKESVD
                     MLSNEESPSKMESDTTTTKPSFLPNQNLTQPSVTSSFTFSPLAMENPFTSPNNAKTPT
                     SSFGMKPAFSFGSNPFTSNTNSLGTKMSTPDSNSTGGLFSQKNDESKDTASQESSAID
                     TNAGKRNSESEDNSSETKKTKF"
     gene            <33468..>34482
                     /gene="TPHA0E00240"
                     /locus_tag="TPHA_0E00240"
                     /db_xref="GeneID:11531259"
     mRNA            join(<33468..33475,34104..>34482)
                     /gene="TPHA0E00240"
                     /locus_tag="TPHA_0E00240"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="XM_003685506.1"
                     /db_xref="GeneID:11531259"
     CDS             join(33468..33475,34104..34482)
                     /gene="TPHA0E00240"
                     /locus_tag="TPHA_0E00240"
                     /inference="similar to DNA sequence:INSDC:YIL148W,YKR094C"
                     /note="similar to Saccharomyces cerevisiae RPL40A
                     (YIL148W) and RPL40B (YKR094C); ancestral locus Anc_5.701"
                     /codon_start=1
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /protein_id="XP_003685554.1"
                     /db_xref="GeneID:11531259"
                     /db_xref="GOA:G8BS20"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BS20"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            complement(<34875..>38081)
                     /gene="TPHA0E00250"
                     /locus_tag="TPHA_0E00250"
                     /db_xref="GeneID:11531261"
     mRNA            complement(<34875..>38081)
                     /gene="TPHA0E00250"
                     /locus_tag="TPHA_0E00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685507.1"
                     /db_xref="GeneID:11531261"
     CDS             complement(34875..38081)
                     /gene="TPHA0E00250"
                     /locus_tag="TPHA_0E00250"
                     /inference="similar to DNA sequence:INSDC:YIL147C"
                     /note="similar to Saccharomyces cerevisiae SLN1 (YIL147C);
                     ancestral locus Anc_5.700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685555.1"
                     /db_xref="GeneID:11531261"
                     /db_xref="GOA:G8BT93"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:G8BT93"
                     /translation="MNLKNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVY
                     FTNNYKSLRAEQLFIAAQLKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTT
                     ENWVESISSVSAFLTSSSIFSRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSS
                     DERLPASIGTIGFLTDPVLNTSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSI
                     VAVFNDTTALENSNVAIISAKYRNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFL
                     FDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKI
                     ISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELISRGRGLRPYYENLSDRTSQDN
                     TSTRTTIDLSDLDGYTNEKEKSLPTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSG
                     MLSPTSTNFIVNNDTKTVRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKA
                     RTKELEAAKIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLK
                     LIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNF
                     SILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSS
                     LNNYDKVYIKEGTSFTGDNDAIPTEPISDKISFAGGSSSIHDYCSKTDENDNIKTEIK
                     SDDSTISDYSEENIMGSYYENKNPGQELLGVPIPKPKKWVISVDVEDTGPGISPTLQK
                     SVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQ
                     ERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAAEKNDDANTNGQTTL
                     NAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVD
                     GQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADD
                     SNKKECENSGMNAFLAKPIKRFELKEIIKEFQNPPNDL"
     gene            complement(<38725..>39654)
                     /gene="TPHA0E00260"
                     /locus_tag="TPHA_0E00260"
                     /db_xref="GeneID:11531262"
     mRNA            complement(<38725..>39654)
                     /gene="TPHA0E00260"
                     /locus_tag="TPHA_0E00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685508.1"
                     /db_xref="GeneID:11531262"
     CDS             complement(38725..39654)
                     /gene="TPHA0E00260"
                     /locus_tag="TPHA_0E00260"
                     /inference="similar to DNA sequence:INSDC:YIL145C"
                     /note="similar to Saccharomyces cerevisiae PAN6 (YIL145C);
                     ancestral locus Anc_5.697"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685556.1"
                     /db_xref="GeneID:11531262"
                     /db_xref="GOA:G8BT94"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BT94"
                     /translation="MKTFNKVADVIQWRKNEIGCREKVTIGFVPTMGCLHQGHATLIR
                     NSKKENDFTVVSIFVNPSQFAPDEDLDQYPRTMENDVKLLESLGVDALFAPTAKELYP
                     QGIPLDVEKQHGPFVTVLGISEMLEGTTRPNFFRGVATVVMKLLNIVSPDFAYFGQKD
                     IQQFKVLDVMVNELFMNTKLILVPIVRNADGLALSSRNKYLCDETLELSTNIFKGLND
                     ASEKLKLIDLGESLSHSKITSTVLDIWKPLIESGDFNVDYLSFAKWDTLQELENITSE
                     DVKAKIVISCAVYVTDRHDKSTVVRLIDNIICQ"
     gene            complement(<40503..>43073)
                     /gene="TPHA0E00270"
                     /locus_tag="TPHA_0E00270"
                     /db_xref="GeneID:11531263"
     mRNA            complement(<40503..>43073)
                     /gene="TPHA0E00270"
                     /locus_tag="TPHA_0E00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685509.1"
                     /db_xref="GeneID:11531263"
     CDS             complement(40503..43073)
                     /gene="TPHA0E00270"
                     /locus_tag="TPHA_0E00270"
                     /inference="similar to DNA sequence:INSDC:YIL143C"
                     /note="similar to Saccharomyces cerevisiae SSL2 (YIL143C);
                     ancestral locus Anc_5.695"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685557.1"
                     /db_xref="GeneID:11531263"
                     /db_xref="GOA:G8BT95"
                     /db_xref="InterPro:IPR001161"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BT95"
                     /translation="MTSVEDDKVKAEEKAVNFPAMSQSFFSDSESDATDDNVFSGNEN
                     NDVGHDDVIQQDDTNDLDYDKDSVTHPPTSRMRQKKNVTKRGRSKKNTNSGTIGRLAA
                     KDQNFLYSNSNTDLPADFQPDAVSSMFRSHDFSYLKLRPDHASRPIWISPSDGRVILE
                     SFSPLAEQAQDFLVTIAEPVSRPSHIHEYRITAYSLYAAVSVGLETEDIVSVLDRLSK
                     VPVAPSIINFIKSATVSYGKVKLVIKHNRYFVETSQAEILQMLLKDSVIGPLRIDADQ
                     NQQNQGIIRKDGEVSAIERNVNPDDVESVFSAVVGGDNELEEEDDDLDAVHAFEIANQ
                     SVELVKKRCQEIDYPVLEEYDFRNDNRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRA
                     RSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLQWCTLQPENCAV
                     FTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILDEVHVVPA
                     AMFRRVVTAIAAHAKLGLTATLVREDDKISDLNFLIGPKLYEANWMELSQKGHIANVQ
                     CAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDKIIVFSDN
                     VYALQEYALKLGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSIDLPEATC
                     LIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLV
                     DQGYAFKVITHLHGMELLPNLAYALARERRELLQEVLLKNEEAAGLEVGDDADNTIGR
                     GGHSHKKGKSRIHRGEGSLAGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKNLKK
                     "
     gene            complement(<43667..>44827)
                     /gene="TPHA0E00280"
                     /locus_tag="TPHA_0E00280"
                     /db_xref="GeneID:11531267"
     mRNA            complement(<43667..>44827)
                     /gene="TPHA0E00280"
                     /locus_tag="TPHA_0E00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685510.1"
                     /db_xref="GeneID:11531267"
     CDS             complement(43667..44827)
                     /gene="TPHA0E00280"
                     /locus_tag="TPHA_0E00280"
                     /inference="similar to DNA sequence:INSDC:YOR084W"
                     /note="similar to Saccharomyces cerevisiae YOR084W;
                     ancestral locus Anc_5.693"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685558.1"
                     /db_xref="GeneID:11531267"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BT96"
                     /translation="MVNVYKDKFIHQTKVMDAVHPRMQNDATISPEIDRLKIVYDLFT
                     LKPAYQNKNSLYKVNMIFLHGSGMNRHIWEYYLPNLLVDKNDHITLNKVINMDQVTHG
                     DSAVINDGKLGVGYVWTDGARDACKIAEHEFLETNINEKAIYVNIVVGHSMGGHQALF
                     CGILNPYLFDLIFCIEPVVLQPTISNDKGYTKVNPSFFRALNSRIKDTFENEQEYEQF
                     IRTKSFFNNTKPEILDMFIETEKMLLPDGTVKKKMRREQEMLCYLTLHPGATWLIENL
                     HNIKVPVIAINGEIAKWAPKENFEILKQKIPNFEEIIVEKGDHLLNIELPDTVIKHLN
                     EMTKKHILTKTHQENRVLKNLSKEERNKIFEKNFQTLLNERVGKGKVTLAKF"
     gene            complement(<45537..>46796)
                     /gene="TPHA0E00290"
                     /locus_tag="TPHA_0E00290"
                     /db_xref="GeneID:11531270"
     mRNA            complement(<45537..>46796)
                     /gene="TPHA0E00290"
                     /locus_tag="TPHA_0E00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685511.1"
                     /db_xref="GeneID:11531270"
     CDS             complement(45537..46796)
                     /gene="TPHA0E00290"
                     /locus_tag="TPHA_0E00290"
                     /inference="similar to DNA sequence:INSDC:YKR091W,YOR083W"
                     /note="similar to Saccharomyces cerevisiae SRL3 (YKR091W)
                     and WHI5 (YOR083W); ancestral locus Anc_5.692"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685559.1"
                     /db_xref="GeneID:11531270"
                     /db_xref="InterPro:IPR013734"
                     /db_xref="UniProtKB/TrEMBL:G8BT97"
                     /translation="MEESLLYDKERTSSPSEKTLLDATKMEITTPPKVRFPKITTTSS
                     PEDNIKDNTGNSPKLQVDSRRAGLDNNTLSSLGISVRRSSRSSNFDSSPIGTQNREVS
                     DEFEMNSGHLDVGSNNTDSSKTNAFSIPQSPSSKTKLLPPTTPKSRHNEMFLSPSSPK
                     LKSPGVYKEHDKPIREISNTLKTRLNYALVKLQNGWTEKTFSQLEKEVDREKNPLHSD
                     DTIKLEAQRRLSVYNNIYANDNSDSDGNSEEDSNIARFSIENHKNAKLENKDYIKGLS
                     SNSAHTAFLKAISSPKKSNHANDKYPVSPLKWNQREGSPTKETSPVPEDEAIETLMSL
                     SSPKKSHSKAFEMINNNKKPVLSNRESSDKKDHSAFKPLNVINNSNNISRDSKSQTEV
                     GNDSTDIEMEFDDVQTDIEDPETSVDT"
     gene            complement(<47535..>49676)
                     /gene="TPHA0E00300"
                     /locus_tag="TPHA_0E00300"
                     /db_xref="GeneID:11531271"
     mRNA            complement(<47535..>49676)
                     /gene="TPHA0E00300"
                     /locus_tag="TPHA_0E00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685512.1"
                     /db_xref="GeneID:11531271"
     CDS             complement(47535..49676)
                     /gene="TPHA0E00300"
                     /locus_tag="TPHA_0E00300"
                     /inference="similar to DNA sequence:INSDC:YKR090W"
                     /note="similar to Saccharomyces cerevisiae PXL1 (YKR090W);
                     ancestral locus Anc_5.691"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685560.1"
                     /db_xref="GeneID:11531271"
                     /db_xref="GOA:G8BT98"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="UniProtKB/TrEMBL:G8BT98"
                     /translation="MSNIYGSPFPKINPNIRYRTTLERAGFDVNFQAGKNGHKSGTSI
                     TLKSEHSNVTPASANSNASVRSPPYMNHNKSNNNVQEQLFNFENPNNKSNVSIGSQRH
                     NQNNNASFRLQKNNHSNLSVNSQRHNQSDLSLGSHGKNNAASQELNPVEKSFMMLTEN
                     DTTTSFHTAVEQDFYTPQPQLNPYTQKTTAYNQNNNHDSLNLNANPELERNLTNHSED
                     LKPVISRTTKSLKSHFDEESYSSKNSSAASNFNPILNEHNGNVPSGNNPRRSVAESFI
                     SEDLNLGLNEKVKIPNNASVYSQRTHQSSNSNMRSNKSADTLNFSNSPVSERQWKGNT
                     LDDEDSSTPVLATNQEVEKLLEQLNNSSLSRENNLDLDLQNKSLSYDALQNVDYPRKD
                     TIDPFLNLNNSDTRFKKSSAYLSGYQPKLHEFQTFEYETEELPKLNSNTLPETVNEEP
                     VENTLPATTSIEKGFQDYDKQNSVEDLNKVATDPLHFNAGSTINFADTIATTTVTDTL
                     AAAAAAATSTTSTTNDKQNIDTPTIDNFEINSQAQKIYPPGEGPCRKCGLEIIGKRIY
                     SKHNNELSGQWHRDCFQCALCDITFNKTTPCYIIDDRPYCQQHYHETNNSICQICNKF
                     IEGECLENDKQERFHTDCLTCFICRSSMKEVYYIFNGEVPICGNHDIDTLLRDGLGGN
                     ADQSSSNNGNGHHPNRNNTLMKRRTKLINFA"
     gene            <51113..>53305
                     /gene="TPHA0E00310"
                     /locus_tag="TPHA_0E00310"
                     /db_xref="GeneID:11531272"
     mRNA            <51113..>53305
                     /gene="TPHA0E00310"
                     /locus_tag="TPHA_0E00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685513.1"
                     /db_xref="GeneID:11531272"
     CDS             51113..53305
                     /gene="TPHA0E00310"
                     /locus_tag="TPHA_0E00310"
                     /inference="similar to DNA sequence:INSDC:YJR119C"
                     /note="similar to Saccharomyces cerevisiae JHD2 (YJR119C);
                     ancestral locus Anc_7.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685561.1"
                     /db_xref="GeneID:11531272"
                     /db_xref="GOA:G8BT99"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BT99"
                     /translation="MEFVPTLYPTTEEFNNPIEYLSQLRVQKIGKRYGMVKLVPPSDF
                     KPPLSINTDTFKFITRLQNLSQLSLVNRNRLFFMKQLNNYNKAMKSMAPILTKPYVLG
                     SQSTDKIYLHDLFVCIYKYFNKTIVSPKEHIMGNKRLWSSVNRSQDNKGAYLLEKIFK
                     KYIFSYYNYLYKMVKEAPKTGLQSLLYNDETPRSLLEEEDAFEEDDFELAETDENLDH
                     DVCSVCSKLVDDISVICTECSNAFHLSCIENTGKDINGTDWFCNNCIVGNGYYGFKEE
                     KEFYSLPSFRKLAGYKAGTTNTELSNKEVEELEDEFWSIVNDSDRNISVKYGADIHNS
                     KPGEITGFPTEEYKRFDVLSNERIDFEEYSKYFNHPMNLVNLPNAKGSLLPLLEQNIS
                     GMTIPWIYIGSKFSTFCWHLEDQYTLSANYQQEGFPKVWYSIPEDSNTNLQSYLKDLA
                     PDMFDKQPDLMHQLVTLVSPYSKEFKKANIKCYKVIQRPNEYVITFPKCYHAGFNTGY
                     NFNEAVNFTLDLWLKYGVEAAEDYKETNKMCVFDMNELMFNILLTFINHKKETTKKEQ
                     HISVVLARQSYKLALRAFNEASRASDLIYPKVIKTVIELNKPLVTENYKGKRVRESSQ
                     QYYIFCSKCKTICFFTFVLHKSQSKGASRKRKKLDLESIVDWNAAAKNNNWELFCLTD
                     YKLHVEKKGDKILNDADFSNGDLLVHIRNSEEISDLLKAADLKLDKIL"
     gene            <53580..>54149
                     /gene="TPHA0E00320"
                     /locus_tag="TPHA_0E00320"
                     /db_xref="GeneID:11531273"
     mRNA            <53580..>54149
                     /gene="TPHA0E00320"
                     /locus_tag="TPHA_0E00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685514.1"
                     /db_xref="GeneID:11531273"
     CDS             53580..54149
                     /gene="TPHA0E00320"
                     /locus_tag="TPHA_0E00320"
                     /inference="similar to DNA sequence:INSDC:YJR118C"
                     /note="similar to Saccharomyces cerevisiae ILM1 (YJR118C);
                     ancestral locus Anc_7.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685562.1"
                     /db_xref="GeneID:11531273"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:G8BTA0"
                     /translation="MALLSSTNVLYLRIAFLSTISFFCFKNVTSILENSYFLVLTQAM
                     NLPALNLAPKSAQLGVVGLLFALLAIDDLIPLLERNTKHFSSIVPFRLMIFFIVTASS
                     YLAETNYYVHNNAVFIYSFIEVWLNFLIFSAIREERNDEYSRTHQFMDDEIVNDDDEE
                     NEGDSQSEAYDNLTSAQEIALEAMEVEQD"
     gene            complement(<54489..>55988)
                     /gene="TPHA0E00330"
                     /locus_tag="TPHA_0E00330"
                     /db_xref="GeneID:11531274"
     mRNA            complement(<54489..>55988)
                     /gene="TPHA0E00330"
                     /locus_tag="TPHA_0E00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685515.1"
                     /db_xref="GeneID:11531274"
     CDS             complement(54489..55988)
                     /gene="TPHA0E00330"
                     /locus_tag="TPHA_0E00330"
                     /inference="similar to DNA sequence:INSDC:YER021W"
                     /note="similar to Saccharomyces cerevisiae RPN3 (YER021W);
                     ancestral locus Anc_7.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685563.1"
                     /db_xref="GeneID:11531274"
                     /db_xref="GOA:G8BTA1"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:G8BTA1"
                     /translation="MQDDSVMDVDSEVLYAGEESVNILIQVLSNVVKTTTSLDLRYIW
                     SSLRELSSIRKDTLDQQTLAALVGILYPESSMFKNSLLKYINDNQKIDVTDAEKIRNS
                     YPSVFYEVTNKKTIEVAAEVNAFVHLLVQLYLLDSGKLQELDAFNKKIVIPNVLYHYN
                     KRTLNLINAKLWFYVVICNEKLGRKTDLIIRSEMIKFLRIASLKHDHETKAMLINLIL
                     RDCLSAGDIEAAADFVAKVDFPITDVSSSLEARYYFYLSKIYAIQLNYSTANEYIISA
                     IRKAPNTNNSLGFLQQAYKLQCVIELLMGDIPELSFFTQSNIKKSLEPYYYISNAVKH
                     GNLQKFTSAIKTYKQQLIKDGNYQICVRLRSNVIKTGIRIISLTYKKISLKDICLRLH
                     LDSEQTVEYMVSRAIRDGVIEAKINNEEGTIETSELLNTYGTTQPQQMFDERINFVNQ
                     LHDECVKAMRYPDKKKDMIGKKENQDGFLDKDIFDDSSDFSDIEDFGFL"
     gene            complement(<56728..>58101)
                     /gene="TPHA0E00340"
                     /locus_tag="TPHA_0E00340"
                     /db_xref="GeneID:11531275"
     mRNA            complement(<56728..>58101)
                     /gene="TPHA0E00340"
                     /locus_tag="TPHA_0E00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685516.1"
                     /db_xref="GeneID:11531275"
     CDS             complement(56728..58101)
                     /gene="TPHA0E00340"
                     /locus_tag="TPHA_0E00340"
                     /inference="similar to DNA sequence:INSDC:YJR117W"
                     /note="similar to Saccharomyces cerevisiae STE24
                     (YJR117W); ancestral locus Anc_7.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685564.1"
                     /db_xref="GeneID:11531275"
                     /db_xref="GOA:G8BTA2"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:G8BTA2"
                     /translation="MSFFENLEFALDRKDIPWKSIILSISIAQFVFETYLTVRQYKVL
                     SGKKLPPVLENEIDQETFEKTEKYSKAKAKFSIIVSIYSLLQNAAVLHYDLMPLIWNR
                     AAFNLDGIMGANHSLSTIAYSLAYLWLTSYMSAILDLPVSFYSHFVLEEKFGFNKLTI
                     RLWITDMLKGHLLGVAIGGPVLYLFLWIFDRFQSNFLMYICIFIFVVQILAMTLIPVY
                     IMPLFNKFTPLEDGELKSSIETLAKRVNFPLDKIFVVDGSKRSSHSNAYFTGLPFTSK
                     RIVLFDTLVKDSTVEEITAVLAHEIGHWQKNHILRMLTFSETHLFVIFSLFTCVFHNL
                     SFYNAFGFYIGEAVSSGENAPHVFTPTFPILIGFMLFNDLLTPLECGMQFVMNLISRF
                     HEYQADEYAKDLGYSKHLCKALISLQVKNLSTMNVDPLYSSYHYSHPTLAERLNALDY
                     VSEKKEK"
     gene            complement(<58653..>59522)
                     /gene="TPHA0E00350"
                     /locus_tag="TPHA_0E00350"
                     /db_xref="GeneID:11531281"
     mRNA            complement(<58653..>59522)
                     /gene="TPHA0E00350"
                     /locus_tag="TPHA_0E00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685517.1"
                     /db_xref="GeneID:11531281"
     CDS             complement(58653..59522)
                     /gene="TPHA0E00350"
                     /locus_tag="TPHA_0E00350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685565.1"
                     /db_xref="GeneID:11531281"
                     /db_xref="GOA:G8BTA3"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:G8BTA3"
                     /translation="MSLSNDLLDVKHGLETRIDPFIGYSWFPESDNLYLSHLHEIFYS
                     FLFYTICYNVFAPKINKIVFGKYYTDLPEKKDKRDYDIHTVSMIQSAVSYAMLPFSLF
                     VSKDLNVAIYYDHLCTMVSSLALGYFIWDITACVGHYDISGSAFIIHAIVSSYIAGVT
                     LIPLFQPWIGAFLAFEASTPFVNVHWYVSQISAFAKRHGQKSPIPSWIGTANGLFLML
                     VFFAVRIVWGISATTKLYSQIYLARDLVPKIPTAIFLCVHITLNFLNIYWFSKMLAVA
                     KGVLFGNKKDKQA"
     gene            complement(<60312..>61163)
                     /gene="TPHA0E00360"
                     /locus_tag="TPHA_0E00360"
                     /db_xref="GeneID:11531282"
     mRNA            complement(<60312..>61163)
                     /gene="TPHA0E00360"
                     /locus_tag="TPHA_0E00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685518.1"
                     /db_xref="GeneID:11531282"
     CDS             complement(60312..61163)
                     /gene="TPHA0E00360"
                     /locus_tag="TPHA_0E00360"
                     /inference="similar to DNA sequence:INSDC:YJR116W"
                     /note="similar to Saccharomyces cerevisiae YJR116W;
                     ancestral locus Anc_7.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685566.1"
                     /db_xref="GeneID:11531282"
                     /db_xref="GOA:G8BTA4"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:G8BTA4"
                     /translation="MISDPLLAYSWFPESENLYLSHLHEVVLSFLFYQILSSYVAPKV
                     NELIFKKPYENITDEKAKIDFDIHTVSMVQCILSIILALPSLQLPFNLNVVTYQDDFS
                     SLVAALTVGYFIWDCVICVRYYKLYGLQFLIHALVSLYVFGTTLLPFCQPWIGKFLLF
                     EASTPFVNINWYIIQLTKMSEKLQKGSKTIEKNSKPIVPVWFNVFNGVILMFVFFTVR
                     ILWGFSAVAIVVYEMYKIRDQLPMFLSVSVILLNSIMNYLNVIWFSKMVSIARKQASS
                     FKKTHSD"
     gene            <61989..>63287
                     /gene="TPHA0E00370"
                     /locus_tag="TPHA_0E00370"
                     /db_xref="GeneID:11531283"
     mRNA            <61989..>63287
                     /gene="TPHA0E00370"
                     /locus_tag="TPHA_0E00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685519.1"
                     /db_xref="GeneID:11531283"
     CDS             61989..63287
                     /gene="TPHA0E00370"
                     /locus_tag="TPHA_0E00370"
                     /inference="similar to DNA sequence:INSDC:YJR107W"
                     /note="similar to Saccharomyces cerevisiae YJR107W;
                     ancestral locus Anc_7.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685567.1"
                     /db_xref="GeneID:11531283"
                     /db_xref="GOA:G8BTA5"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BTA5"
                     /translation="MLFVKISVITIWLLRKSQAFQLQGTLKYYDSAEKFRLNYNGNAK
                     EEYDGVDVNTETDHGNYLDNNSGYDDDGETGLENVYDGLEESLSEQKEVYNENFETST
                     SRNEDYKNVKISQDFYDRLVYFSKVCAMTSCISDNLIKENKTFAEGGCPGHLKFCKDP
                     IDNPTYTRTRIEMVLSADKGELGTGYVIVDHKRKVVIIAFRGSSTRQDWFSDFQIYPV
                     DYEPASLVAYNKLVNKRIIPECHNCKIHRGFYRFKETLGPLFLDKIEAIFNKYPDYRA
                     VVSGHSLGAAMASITGIELKLRGYNPIVLTYATPRMFNTEMREWIDTIFSTDQIHYTS
                     VSKGVVDYNHCDKGGYFRVVHNQDYIPMVPPFYEAAGLELFINKIELPHTIDDVEYRG
                     HKKTYFEDITKLNTVNHVEDWLHTYEHRAYFILIEGCHNI"
     gene            <63717..>64325
                     /gene="TPHA0E00380"
                     /locus_tag="TPHA_0E00380"
                     /db_xref="GeneID:11531284"
     mRNA            <63717..>64325
                     /gene="TPHA0E00380"
                     /locus_tag="TPHA_0E00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685520.1"
                     /db_xref="GeneID:11531284"
     CDS             63717..64325
                     /gene="TPHA0E00380"
                     /locus_tag="TPHA_0E00380"
                     /inference="similar to DNA sequence:INSDC:YJR112W"
                     /note="similar to Saccharomyces cerevisiae NNF1 (YJR112W);
                     ancestral locus Anc_7.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685568.1"
                     /db_xref="GeneID:11531284"
                     /db_xref="InterPro:IPR007128"
                     /db_xref="InterPro:IPR016851"
                     /db_xref="UniProtKB/TrEMBL:G8BTA6"
                     /translation="MNEHNRIRYIRFNQVFEKAFSQSVSKLQSWDKLSSCFPEYSMED
                     EGASNLENCQKQVIQFWTELCKREFNEILKEKNVKEKLDSLDDLIAEAKVRVAAEKGN
                     PTKSDANIILDELDAKQLLELNLHTQRVKTIKDLDIRLDRLNNINTSISDNILSLEKQ
                     IETEREELDQIYKKYLGDSINKEKDEVLVQGLHDMVLELQEL"
     gene            complement(<64714..>67113)
                     /gene="TPHA0E00390"
                     /locus_tag="TPHA_0E00390"
                     /db_xref="GeneID:11531285"
     mRNA            complement(<64714..>67113)
                     /gene="TPHA0E00390"
                     /locus_tag="TPHA_0E00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685521.1"
                     /db_xref="GeneID:11531285"
     CDS             complement(64714..67113)
                     /gene="TPHA0E00390"
                     /locus_tag="TPHA_0E00390"
                     /inference="similar to DNA sequence:INSDC:YBL047C"
                     /note="similar to Saccharomyces cerevisiae EDE1 (YBL047C);
                     ancestral locus Anc_7.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685569.1"
                     /db_xref="GeneID:11531285"
                     /db_xref="GOA:G8BTA7"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8BTA7"
                     /translation="MSAQQGSIPALSKNDIAKFTQLYQRSKSPDQNFISGEQARGIFM
                     KANIGTDILGSIWALTDVNAAGVLTEPQFVMAMHLIQLFLNKSITIDHLPSVLPQYLW
                     DSISMPGTPSTAASPALSKASLSSTVTGNWTLSQSKKQEFDRIFESLDVDKQGRLSSS
                     KLVPFFLSSKLSQDVLAYVWDLADFNNSSDFSKKEFAIAMFLIQKKKAGVELPEALPQ
                     SLLDSVNFQPSAAVPDVKTVNRNVAPSAVSAIPSDSFPAATNAASMTTSAAAAAAAAA
                     PIAAVAAATTTAAASAPVDKEKRINNELNRINATKKQIETKLEDLHVTHDKNVKETEQ
                     LELNLIQRQNELKALQKHLDQLELDNTSELTKINQLNENLKIAIKKKNDFTKNITTLK
                     SSSETLTKKIEEDQIKYKQQSSLLDVNRKQLETTETKNNNFQSELSLLSASLPTFISK
                     FTSFLENQKIVEQQHAKLQEKYKGLDNRNNELKAYETKIAEETKEIEDNEQKCDQKID
                     RLQQLFDEFTARQKEYEAENDKLKSRHVDYAQELQELTERQMKLNLGDIPDNVDDILI
                     KLDMYNKKTVDVDSKIESPSGAASTEGDAREGSDVFDKDIPVIGSQTEGEPDDEQTLE
                     NAAEILDDRFEGDLNEYGIPRSQSLTSSVTNNPPLSLREDTIDLQYNAENLAAKEHDL
                     TDQKTSNLETEKDSATPSNDDKEELDLSDNINELQGQSTKPTENYNDIDEEFPPIQEP
                     QLEESDSSDEDEDEDEIPKKDEVAAALNDEFGNLDITPDEGTKPNNEVVDTAETLTTA
                     E"
     gene            <68460..>68801
                     /gene="TPHA0E00400"
                     /locus_tag="TPHA_0E00400"
                     /db_xref="GeneID:11531287"
     mRNA            <68460..>68801
                     /gene="TPHA0E00400"
                     /locus_tag="TPHA_0E00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685522.1"
                     /db_xref="GeneID:11531287"
     CDS             68460..68801
                     /gene="TPHA0E00400"
                     /locus_tag="TPHA_0E00400"
                     /inference="similar to DNA sequence:INSDC:YBL043W,YJR115W"
                     /note="similar to Saccharomyces cerevisiae ECM13 (YBL043W)
                     and YJR115W; ancestral locus Anc_7.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685570.1"
                     /db_xref="GeneID:11531287"
                     /db_xref="UniProtKB/TrEMBL:G8BTA8"
                     /translation="MPQASYYTDLSLINTVRSKLLTCTRKRKQERKDFNLRVLIGHAS
                     LLDRLLDEYEERVNASHNGNDEVEGYGDNYILSTPKQPHSTILYQPKPRHPDQIHQKQ
                     SQRRAPQAVSV"
     gene            <69626..>71329
                     /gene="TPHA0E00410"
                     /locus_tag="TPHA_0E00410"
                     /db_xref="GeneID:11531288"
     mRNA            <69626..>71329
                     /gene="TPHA0E00410"
                     /locus_tag="TPHA_0E00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685523.1"
                     /db_xref="GeneID:11531288"
     CDS             69626..71329
                     /gene="TPHA0E00410"
                     /locus_tag="TPHA_0E00410"
                     /note="ancestral locus Anc_7.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685571.1"
                     /db_xref="GeneID:11531288"
                     /db_xref="GOA:G8BTA9"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:G8BTA9"
                     /translation="MLTKVFYLVLSLAVGAHLFNYFLGDQFEDYLKGGTYENEMLGAA
                     AGNKCNRYDKLLGNTEEYIFNKIVQNESYRNATAYKLARAVQVDTTIEDDYPNPEFQP
                     DFPGWVKFKKLHAQLEKDFPLVWSNLKVETVNGYSLLLTWEGSDASLKPNLFMAHEDT
                     VPIDNATVDQWEHAPFSGDFDGTYIWGRGSIDDKNMLIAMLESVEFILQNEPDFKPKR
                     GLLLALGADEEISGYFGNAYIKDILLERYGEDGVYSIVDEGGIGISKLGDIWVASPAT
                     GEKGQLNLHFKVNGAGGHASVPPDHTTVGIASAIIAEIESQKFPQLYTEHNPIAKLMQ
                     CAADNSHMLPPSLKKDIRHATRDEAAKQRVLGFINRMGGKLVSYLFRTSQAATIVDGG
                     VKANAIPETTDFNINSRISVESSVQETIDKLVSQAMVVVKKFDLGLTVLGKEILPKTA
                     NGDVIVSVLNKLEPAPVSPTNEVWSEFAGSIKGFFEDIIFPNKLQQQVDLIVAPSVMP
                     ANTDTWHYWQLTKNIYRFQPALVNLELVSHIHSSNEHIDLDTLMYAVGFFYNYIHVIN
                     K"
     gene            <71900..>72625
                     /gene="TPHA0E00420"
                     /locus_tag="TPHA_0E00420"
                     /db_xref="GeneID:11531527"
     mRNA            <71900..>72625
                     /gene="TPHA0E00420"
                     /locus_tag="TPHA_0E00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685524.1"
                     /db_xref="GeneID:11531527"
     CDS             71900..72625
                     /gene="TPHA0E00420"
                     /locus_tag="TPHA_0E00420"
                     /inference="similar to DNA sequence:INSDC:YBL041W"
                     /note="similar to Saccharomyces cerevisiae PRE7 (YBL041W);
                     ancestral locus Anc_7.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685572.1"
                     /db_xref="GeneID:11531527"
                     /db_xref="GOA:G8BTB0"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BTB0"
                     /translation="MSTIASEYANEVSNTPIEHQFNPYSDNGGTILGIAGEDFAVLAG
                     DTRHTTDYSINSRYEPKVFDCGDDIIISANGFAADGEALVKRFKNSIKWYHFDNNDKK
                     LALSSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREFCRAGGA
                     AASLIMPFLDNQVNFKNQYTPDSNGKVKRPFKHLSIDEVIKLVRDAFTSATERHIHVG
                     DGLEILIVTKEGVRKEFYELKRD"
     gene            complement(<72975..>73634)
                     /gene="TPHA0E00430"
                     /locus_tag="TPHA_0E00430"
                     /db_xref="GeneID:11531528"
     mRNA            complement(<72975..>73634)
                     /gene="TPHA0E00430"
                     /locus_tag="TPHA_0E00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685525.1"
                     /db_xref="GeneID:11531528"
     CDS             complement(72975..73634)
                     /gene="TPHA0E00430"
                     /locus_tag="TPHA_0E00430"
                     /inference="similar to DNA sequence:INSDC:YBL040C"
                     /note="similar to Saccharomyces cerevisiae ERD2 (YBL040C);
                     ancestral locus Anc_7.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685573.1"
                     /db_xref="GeneID:11531528"
                     /db_xref="GOA:G8BTB1"
                     /db_xref="InterPro:IPR000133"
                     /db_xref="UniProtKB/TrEMBL:G8BTB1"
                     /translation="MMNPFRILGDLSHLASILVLIFNIKSTNTIEGISIKTQVLYVLV
                     FLTRYLDLFSFRLVSFYNTIMKLFFISSSIYVVVLLQRSKTTQAVAYKTMLLTDTFKV
                     QYILLGTLIAAFVINHKFTFVEIAWSFSVWLESVAILPQLFMLSKSGKSKSLTVHYIF
                     ALGLYRTLYIPNWIWRYHTEGVIDKIALAAGIIQTLVYSDFFYLYYKKVIKRSALNLP
                     N"
     gene            <74295..>74465
                     /gene="TPHA0E00440"
                     /locus_tag="TPHA_0E00440"
                     /db_xref="GeneID:11531289"
     mRNA            <74295..>74465
                     /gene="TPHA0E00440"
                     /locus_tag="TPHA_0E00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685526.1"
                     /db_xref="GeneID:11531289"
     CDS             74295..74465
                     /gene="TPHA0E00440"
                     /locus_tag="TPHA_0E00440"
                     /inference="similar to DNA sequence:INSDC:YBL039W-B"
                     /note="similar to Saccharomyces cerevisiae YBL039W-B;
                     ancestral locus Anc_7.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685574.1"
                     /db_xref="GeneID:11531289"
                     /db_xref="UniProtKB/TrEMBL:G8BTB2"
                     /translation="MGFFSNNPLIEFCHKIMKRPSTLLMWCFTGIIISSSIYLLLPSF
                     HYDGKRDRDKCK"
     gene            <74833..>75294
                     /gene="TPHA0E00450"
                     /locus_tag="TPHA_0E00450"
                     /db_xref="GeneID:11531291"
     mRNA            <74833..>75294
                     /gene="TPHA0E00450"
                     /locus_tag="TPHA_0E00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685527.1"
                     /db_xref="GeneID:11531291"
     CDS             74833..75294
                     /gene="TPHA0E00450"
                     /locus_tag="TPHA_0E00450"
                     /inference="similar to DNA sequence:INSDC:YJR104C"
                     /note="similar to Saccharomyces cerevisiae SOD1 (YJR104C);
                     ancestral locus Anc_7.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685575.1"
                     /db_xref="GeneID:11531291"
                     /db_xref="GOA:G8BTB3"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /db_xref="UniProtKB/TrEMBL:G8BTB3"
                     /translation="MVSAVAYLNGTYNVSGIVHLTQYTEDSPTNITWYLEGNTPNALR
                     GFHIHEFGNTSNHCMAAGGHYNPFKMNHGAPNATVRHVGDLGNVQTDSYGIAEGFILD
                     DEIKLFGANSVLGRTLVIHSGTDDLGLGNNPESLINGNSGPRAACGIINIL"
     gene            complement(<75495..>77225)
                     /gene="TPHA0E00460"
                     /locus_tag="TPHA_0E00460"
                     /db_xref="GeneID:11531292"
     mRNA            complement(<75495..>77225)
                     /gene="TPHA0E00460"
                     /locus_tag="TPHA_0E00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685528.1"
                     /db_xref="GeneID:11531292"
     CDS             complement(75495..77225)
                     /gene="TPHA0E00460"
                     /locus_tag="TPHA_0E00460"
                     /inference="similar to DNA sequence:INSDC:YBL039C,YJR103W"
                     /note="similar to Saccharomyces cerevisiae URA7 (YBL039C)
                     and URA8 (YJR103W); ancestral locus Anc_7.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685576.1"
                     /db_xref="GeneID:11531292"
                     /db_xref="GOA:G8BTB4"
                     /db_xref="InterPro:IPR004468"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8BTB4"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLFKTLGYKVTSIKIDPYMN
                     IDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLNVTLTKDHNITTGKIYSHVIQKER
                     KGDYLGKTVQIVPHLTNAIQDWIERVSRIPVDDTGLEPDICIIELGGTVGDIESAPFV
                     EALRQFQFKVGRENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLIPDMIAVRCSE
                     ILDLPTIEKIAMFCHVGCDQVVNVHDVNSTYHVPLLLLEQKMMDYLTKRLHLNEISIT
                     DEDIQKGNQLLIKWKSMTGNYDESLQTVKIALVGKYTHLKDSYLSVIKALEHSSMKCR
                     NKLEIQWVEASDLEPETQETEKDKFHAAWNKVSTADGILVPGGFGYRGTEGMILAAKW
                     ARENKVPYLGVCLGLQIATIEFMRNVIGMKDGKSAEFFPDTDPESHVVVYMPEIDKEN
                     MGGTMRLGLRPTYFQDNTDWSQIKKVYGNKDSVAERHRHRYEINPKLITQLEENGLMF
                     VGRDETGDRCEIFELKNHPYYVATQYHPEYTSKVLDPSKPFLGFVAASAGVMPKLLDG
                     SLEYEGSADF"
     gene            complement(<77741..>78331)
                     /gene="TPHA0E00470"
                     /locus_tag="TPHA_0E00470"
                     /db_xref="GeneID:11531293"
     mRNA            complement(<77741..>78331)
                     /gene="TPHA0E00470"
                     /locus_tag="TPHA_0E00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685529.1"
                     /db_xref="GeneID:11531293"
     CDS             complement(77741..78331)
                     /gene="TPHA0E00470"
                     /locus_tag="TPHA_0E00470"
                     /inference="similar to DNA sequence:INSDC:YPR046W"
                     /note="similar to Saccharomyces cerevisiae MCM16
                     (YPR046W); ancestral locus Anc_7.475"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685577.1"
                     /db_xref="GeneID:11531293"
                     /db_xref="UniProtKB/TrEMBL:G8BTB5"
                     /translation="MERIARLEEEHVKTHSELLKALDTLYLLKKSGGKDIELNPDRKQ
                     QLETRTKVQLSLQKSIPLLRSINSVSNMQNGNDNSGKSTTENPDIPSAEKMLANRLGS
                     FMEEDYEKTQALFEAMNLETEEREELQREQQRYEALIAQYKDLASKLDDKLAKQKEMN
                     EHATAVSDEEYLRQNETMEQLLLALKIHGGYLNATE"
     gene            <78703..>79299
                     /gene="TPHA0E00480"
                     /locus_tag="TPHA_0E00480"
                     /db_xref="GeneID:11531398"
     mRNA            <78703..>79299
                     /gene="TPHA0E00480"
                     /locus_tag="TPHA_0E00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685530.1"
                     /db_xref="GeneID:11531398"
     CDS             78703..79299
                     /gene="TPHA0E00480"
                     /locus_tag="TPHA_0E00480"
                     /inference="similar to DNA sequence:INSDC:YJR102C"
                     /note="similar to Saccharomyces cerevisiae VPS25
                     (YJR102C); ancestral locus Anc_7.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685578.1"
                     /db_xref="GeneID:11531398"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:G8BTB6"
                     /translation="MSAFDELPKVYYFPPLYTRQVNSLIRRQQIDTWIDLILQYAKSM
                     NCWMMTSEGNLIQTKIDELTGSDSNAIEKKSLFVNETIQRSIPHTFVEEIWTHMVENG
                     KAIRTEHDIESNSVYYIMWKGVDLWSSVILQWFETAVKLNQVVTLYELSQGDETIGWD
                     FHGMPEPLLAKCIKSLCDRQRATIMKDEYGKPVGVKVI"
     gene            complement(<79528..>80328)
                     /gene="TPHA0E00490"
                     /locus_tag="TPHA_0E00490"
                     /db_xref="GeneID:11531399"
     mRNA            complement(<79528..>80328)
                     /gene="TPHA0E00490"
                     /locus_tag="TPHA_0E00490"
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /transcript_id="XM_003685531.1"
                     /db_xref="GeneID:11531399"
     CDS             complement(79528..80328)
                     /gene="TPHA0E00490"
                     /locus_tag="TPHA_0E00490"
                     /inference="similar to DNA sequence:INSDC:YJR101W"
                     /note="similar to Saccharomyces cerevisiae RSM26
                     (YJR101W); ancestral locus Anc_7.473"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /protein_id="XP_003685579.1"
                     /db_xref="GeneID:11531399"
                     /db_xref="GOA:G8BTB7"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:G8BTB7"
                     /translation="MFHSGLRLSIAKRGMHRVPTLPNYARLVRDGIPKVLSAKAFDIA
                     WKQQQKLNCEKLSLLTSGTSLESYLPFHIILNTSKKQFQTNIFNAASATHNNHLFIEN
                     ILPTETSVPSEPSRHFLYVVEKSFGCSWVELKKEIIKRAKNDVLGQGWLFLVENNYKE
                     FHILTIQNNGSPYYFPRNQSIDLNNAISLDEYSQLNEIKKIVNEQTSKNGKEKVEDWT
                     MPIICINLCDHAYLHDYGVKGRSEYVKNVLDNLNWNVINARLYSDSNK"
     gene            complement(80765..80883)
                     /gene="TPHA0Etrna4L"
                     /locus_tag="TPHA_0Etrna4L"
                     /db_xref="GeneID:11531423"
     tRNA            complement(join(80765..80809,80845..80883))
                     /gene="TPHA0Etrna4L"
                     /locus_tag="TPHA_0Etrna4L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:11531423"
     gene            complement(<82796..>83503)
                     /gene="TPHA0E00500"
                     /locus_tag="TPHA_0E00500"
                     /db_xref="GeneID:11531421"
     mRNA            complement(<82796..>83503)
                     /gene="TPHA0E00500"
                     /locus_tag="TPHA_0E00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685532.1"
                     /db_xref="GeneID:11531421"
     CDS             complement(82796..83503)
                     /gene="TPHA0E00500"
                     /locus_tag="TPHA_0E00500"
                     /inference="similar to DNA sequence:INSDC:YJR099W"
                     /note="similar to Saccharomyces cerevisiae YUH1 (YJR099W);
                     ancestral locus Anc_7.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685580.1"
                     /db_xref="GeneID:11531421"
                     /db_xref="GOA:G8BTB8"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="UniProtKB/TrEMBL:G8BTB8"
                     /translation="MSNEYSVIPLESNPEVFTNFARKLGLNQQYVFTDIYSLTDPDLI
                     GFIPTPVKAIILLFPITAATELDKNTNNADVSKKPPIWFKQTVRNACGLYAILHSLSN
                     NKDLLKEDCELEKYLETHIKEYNKYEDKITSDFVVNISNKNTEYFAEGQTSAPSAEGN
                     VDLHYITFIEKDNDIYELDGRRLDGSKYLGKKSDLNSSNLLGESIVANRVQWYMDSAD
                     VDKKLHFSLLGLVPSWD"
     gene            complement(<86720..>87562)
                     /gene="TPHA0E00520"
                     /locus_tag="TPHA_0E00520"
                     /db_xref="GeneID:11531242"
     mRNA            complement(join(<86720..86996,87561..>87562))
                     /gene="TPHA0E00520"
                     /locus_tag="TPHA_0E00520"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_003685533.1"
                     /db_xref="GeneID:11531242"
     CDS             complement(join(86720..86996,87561..87562))
                     /gene="TPHA0E00520"
                     /locus_tag="TPHA_0E00520"
                     /inference="similar to DNA
                     sequence:INSDC:YJR094W-A,YPR043W"
                     /note="similar to Saccharomyces cerevisiae RPL43B
                     (YJR094W-A) and RPL43A (YPR043W); ancestral locus
                     Anc_7.466"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_003685581.1"
                     /db_xref="GeneID:11531242"
                     /db_xref="GOA:G8BTB9"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:G8BTB9"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGK
                     KSVKRGAAGIWTCGACKKTVAGGAYTVSTAAAATVRSTIRRLRDMVEA"
     gene            <88642..>89613
                     /gene="TPHA0E00530"
                     /locus_tag="TPHA_0E00530"
                     /db_xref="GeneID:11531374"
     mRNA            <88642..>89613
                     /gene="TPHA0E00530"
                     /locus_tag="TPHA_0E00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685534.1"
                     /db_xref="GeneID:11531374"
     CDS             88642..89613
                     /gene="TPHA0E00530"
                     /locus_tag="TPHA_0E00530"
                     /inference="similar to DNA sequence:INSDC:YJR093C"
                     /note="similar to Saccharomyces cerevisiae FIP1 (YJR093C);
                     ancestral locus Anc_7.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685582.1"
                     /db_xref="GeneID:11531374"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:G8BTC0"
                     /translation="MSSGDEDDKFLYGSDEETTIANKKRTKTKADGDVERRTKGNAIK
                     KSKTDSVSKSDESESASDSEYSDEESDSDVEFIISTGTNDASLLDSNQTSGTITVASE
                     TDVSKVNEAGEKKTGELGAADEQGSSEAAARKTETSLLDINGEGLFEGEPISSISPEV
                     LKEKPWRQPGANLSDYFNYGFNEYTWMEYLQKQEKLKQEYNPHKILMGLMALQQQGKL
                     AVPQQKPIDQSSSTISNKLQNNNSNNMNMNMGMNMNMNMNMNMDMNKMQNNPGHPPVP
                     PSGFPMFGGFAPFPMPHMLQQMPNGKFPPIPGAQPSQQQNTGSPQQK"
     gene            complement(<89734..>90720)
                     /gene="TPHA0E00540"
                     /locus_tag="TPHA_0E00540"
                     /db_xref="GeneID:11531300"
     mRNA            complement(<89734..>90720)
                     /gene="TPHA0E00540"
                     /locus_tag="TPHA_0E00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685535.1"
                     /db_xref="GeneID:11531300"
     CDS             complement(89734..90720)
                     /gene="TPHA0E00540"
                     /locus_tag="TPHA_0E00540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685583.1"
                     /db_xref="GeneID:11531300"
                     /db_xref="UniProtKB/TrEMBL:G8BTC1"
                     /translation="MDRDYVVFDDCNGSQVGTYEEFFGAIESLVLNASDAKSKKISKT
                     VPVNLLSDEMILSPISDCNGERGDNSQFSDDLGFEDSFEKQSLESTDAFLEKLRHNNS
                     LQKKTVGLGIHVEKSNYKNSEGEDYIVVPKIDSTSRRIQPKRLFFYLSLDGISQKLQK
                     RLSYCNAQLSIKMQRKCVVLQTVKIPITSINISIVFQDILVFPSDWIQSHDQVNVLLQ
                     VHGQDQNRNLKSDEDRVSSNPFAMKFSGKAKYLRKKKVVEKLSVSHTFEFLKGMNTLG
                     CNKVDLKKLMKIKNEEKRIPLFSSPSELIKQELKNPSQNVIATLVLHTCGSS"
     gene            <92509..>96027
                     /gene="TPHA0E00550"
                     /locus_tag="TPHA_0E00550"
                     /db_xref="GeneID:11531301"
     mRNA            <92509..>96027
                     /gene="TPHA0E00550"
                     /locus_tag="TPHA_0E00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685536.1"
                     /db_xref="GeneID:11531301"
     CDS             92509..96027
                     /gene="TPHA0E00550"
                     /locus_tag="TPHA_0E00550"
                     /inference="similar to DNA sequence:INSDC:YJR091C,YPR042C"
                     /note="similar to Saccharomyces cerevisiae JSN1 (YJR091C)
                     and PUF2 (YPR042C); ancestral locus Anc_7.462"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685584.1"
                     /db_xref="GeneID:11531301"
                     /db_xref="GOA:G8BTC2"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BTC2"
                     /translation="MSSTSLENTDGDNVAADSNVNRNQDIQTIDFNVLSTPKRKTSMP
                     MNSASSTPLIILPSIEGENEVNVIHGNDPDSLHPQKIGSYRIRAGNKISNTLSNLLPS
                     SLSAKLHHSKKLPNDTTTPDGTGNNNGNKKFTKPITPQSIKKDERSPVTEKIEEHNEL
                     NVFSNIHDSTSLLLSATTSNTNNNVHNARRRTDTMNSQITNLSMSAGPASSTIWAPNN
                     AKENMQTNNENLTQQHLSHPYLHNNLYSSSLQTFTSDVTNSLQNNNRDNLMIPQPFPT
                     TNSSVQDNNNNNTWSSNNNITTSQMNNSQNTDFFGNRQRSKSTATNIYPDNVLYEQKN
                     SRNRTFTISGSTGTPAFPVQNMYMNGDNAINNTNNVMNSGMYNEIVDIPLVDDDVDPT
                     SLNWVTTDTTAPYINQVSNLLPSDTISISNIFSMQQQNSQLYNVINLTSTALVTLCSR
                     FGKVNSARTLQNLNIALVKFDSVNSAVLATEMLQNKAISMVGVPCHVAFAKIFPTPVP
                     DPNRMTNMQFNNENGRSLLQEQLFNGNFSLQQQGNITVPVFNQQFIQLQHQMQQIQKQ
                     QTQSNSQHHNQQNSSLSNNQQHASHQSTTHITNADKEQCPFHLPPETISSQQDSLKDI
                     INSFDTKVNKLIINHVVNNALKDEGKTDISNFGPLPKSNPSKEFDAPTLRELRKIIDG
                     NQMSDLEIEQLALVMLDELPELSSDYLGNTIVQKLFDHSSDIIKDIMLRKTAKYLTTM
                     GVHKNGTWACQKMIKKATTSRQKMLIAEGVKKYCTPLFNDQFGNYVIQCVLKFGFPWN
                     NFIFESIIANFWTIAQNRYGSRAVRACLEAHNIITEEQTIVLSAIIVLYVQYLITNGN
                     GTLLVTWFLDTCNLPNRHEIFAKRLVPNIVELSCHKLSSLTILKILTFRGDDTTRNII
                     LSTIFGPIPSDKEGEREQRVDKDKDESSGPPEALIKILNDKSNGPTFIYKVLSMPLLE
                     DDIRAHVVKQVRKVLLDSSSSAQNHRRLMEEVGLASLSPQSPNSQNNQQRNSNGNNYA
                     NAVQGNDITRHVSHVSVSSVRSNGAQNINQGAALNKPALTKNMQLNQPIMNNSYPTSG
                     YPGLSPTPLLTMNNNNTNNNPNLNGNTNHGYYNYPSLYSMNSNTSSNFPYNDDLTSQI
                     ESLMINNNENQNSILLNGGNVQKYGI"
     gene            <96958..>100278
                     /gene="TPHA0E00560"
                     /locus_tag="TPHA_0E00560"
                     /db_xref="GeneID:11531302"
     mRNA            <96958..>100278
                     /gene="TPHA0E00560"
                     /locus_tag="TPHA_0E00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685537.1"
                     /db_xref="GeneID:11531302"
     CDS             96958..100278
                     /gene="TPHA0E00560"
                     /locus_tag="TPHA_0E00560"
                     /inference="similar to DNA sequence:INSDC:YJR090C"
                     /note="similar to Saccharomyces cerevisiae GRR1 (YJR090C);
                     ancestral locus Anc_7.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685585.1"
                     /db_xref="GeneID:11531302"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:G8BTC3"
                     /translation="MDIDLPIENNITNNDINYNRTNEEYTNTDGSTLSGSNLRRSQVR
                     SVNNTENLNNHTLTNSDILTNHPDTFNVVNLDLMQVDDDLDINKQTNENSQYKRLSDL
                     NNKMIDELLRTSSYVNFSGITLSPESSKDLYNFKNSLEKKVSEYIRIIEHRREQVSQE
                     LRKDNQRIRQSNSQSNSEIASYINKLERIKLRAAETETVELQRVRTNFIQLIELFKLK
                     FETYITNLQEGNNAQNPTKSFIEWLDSLNPYVSSQFLQQTQLQNSLPKGNNIENDVNT
                     NLKLYSSPNSFSNIAFSKLKNPIRMVNSNIFPLNSLPPEILGLVLEKVNSTYNIVKLF
                     SVCKLWAELIVKIIYYRPHINKKYQLDIFMRTMLLPKSRTVFDYRAMIKRLNFSFVGD
                     YLHDEELYHFVGCKNLERLTLVFCKNITSNSISAVLEGCRYLQSIDITGIKEISDNIF
                     GTLANNCPRLQGFYVPQARNISFNSLHNFISRVSILKRVKITANNEINDELVELLANK
                     CPLLVEVDITQCPNVHDSSLLTLFTKLTQLREFRNTHNTNITDKAFLEITKKIQNLPS
                     LRLLDLSGCENITDKTIERVVSLAPKLRNVFLGKCSRITDISLFQLAKLGKNLQTIHF
                     GHCFNITDQGVRVLVQTCPRIQYVDFACCTNLTNRTLYELADLSKLKRIGLVKCTQIT
                     DEGLLNMISLRGRNDTLERVHLSYCSNLTIYPIYELLMACPRLSHLSLTAVPSFLRPD
                     ITTFCRAVPTDFSENQRIIFCVFSGKGVHKLRHYLMGLTTPTDGPETDINEVLTQYIT
                     AKNLLRPDEAMEEGIRRITLDVNADSAAILAATGISQMNGINNDLLFQGIDFDRLDDI
                     FNWYNVSYGNVTLDSSEINELLTAVDRKFCGDPFDEEYDERDGIVAPGASNNVNSELA
                     HVIRRYNEMDDRIDDFEVNVASLARVQFQFTGFLVHEMLQIYTQMIELNRQLVDTQRI
                     ILESNITADIKGLSIFKLIFTERFRNILKKFELSSVVLRLYLRDSISVLTRQREIVLA
                     HLTNDGEMNEDGMIRGPDDENALPIPNTNLGMLQFNNLRAQVQNENGLGGPMNILNQN
                     RTEDISDTPEADTALEEA"
     gene            complement(<100530..>100817)
                     /gene="TPHA0E00570"
                     /locus_tag="TPHA_0E00570"
                     /db_xref="GeneID:11531303"
     mRNA            complement(<100530..>100817)
                     /gene="TPHA0E00570"
                     /locus_tag="TPHA_0E00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685538.1"
                     /db_xref="GeneID:11531303"
     CDS             complement(100530..100817)
                     /gene="TPHA0E00570"
                     /locus_tag="TPHA_0E00570"
                     /inference="similar to DNA sequence:INSDC:YJR086W"
                     /note="similar to Saccharomyces cerevisiae STE18
                     (YJR086W); ancestral locus Anc_7.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685586.1"
                     /db_xref="GeneID:11531303"
                     /db_xref="GOA:G8BTC4"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="UniProtKB/TrEMBL:G8BTC4"
                     /translation="MPYENQIALKIQYLKLKRINELNNTLKTELARERITASNASLNL
                     INYTTTKEDFVISEIWGYPKPGSNHFRNSLSAGLSRKRVNVNSNDACCTIV"
     gene            complement(<101962..>103254)
                     /gene="TPHA0E00580"
                     /locus_tag="TPHA_0E00580"
                     /db_xref="GeneID:11531304"
     mRNA            complement(<101962..>103254)
                     /gene="TPHA0E00580"
                     /locus_tag="TPHA_0E00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685539.1"
                     /db_xref="GeneID:11531304"
     CDS             complement(101962..103254)
                     /gene="TPHA0E00580"
                     /locus_tag="TPHA_0E00580"
                     /inference="similar to DNA sequence:INSDC:YJR084W"
                     /note="similar to Saccharomyces cerevisiae CSN12
                     (YJR084W); ancestral locus Anc_7.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685587.1"
                     /db_xref="GeneID:11531304"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:G8BTC5"
                     /translation="MIKIDSELGPTDAVDIDLYFKKKYSDSGFYLFLSATKKEHQCTF
                     LLQSSDDKLAKLYNICIKLHAGAYNILSLCQEQVRIMNRISETETDWITEPLWFVCHQ
                     MIQYCSTDTAQLENCGRLIHRSFNLCLNDRNPVLSSNRKSGSYSLANLEFIIYHKLKN
                     RDMMKNLVKVLQSRNMDIIMDQPSNKEKNSIKVGHMVRYYYYLGEYYGCFESDFNKAS
                     TFLSIALLHCNFNYKTHIAKILVLLVPFVIVSRKMYPNEKVLTQLLSATGQYGEKLFK
                     FIIQLVYCLKSGDIHGYDKFVSSNEVFLLKNGIYVAMCHIRELVFLKFFKTCTKMIGN
                     NKTIVPLSSIAEVYGNYSQRKKKIRRLINMKSKKDTKIPIDITSLENKEMNENMDELE
                     CLLANLINKGFIKGYLSHSNRCIVLSKNDAFPHLSSSL"
     gene            <103667..>104551
                     /gene="TPHA0E00590"
                     /locus_tag="TPHA_0E00590"
                     /db_xref="GeneID:11531305"
     mRNA            <103667..>104551
                     /gene="TPHA0E00590"
                     /locus_tag="TPHA_0E00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685540.1"
                     /db_xref="GeneID:11531305"
     CDS             103667..104551
                     /gene="TPHA0E00590"
                     /locus_tag="TPHA_0E00590"
                     /inference="similar to DNA sequence:INSDC:YJR083C"
                     /note="similar to Saccharomyces cerevisiae ACF4 (YJR083C);
                     ancestral locus Anc_7.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685588.1"
                     /db_xref="GeneID:11531305"
                     /db_xref="UniProtKB/TrEMBL:G8BTC6"
                     /translation="MSQNQRKVSQPLDLHSFSIVNKQSEPKDTTEGQVDKDEQNSNNA
                     LEKRATDNSEHSHSRNSSDIKLKPISPRKAGIQLPLPLQSTPVKNQKHERMDSNKEEN
                     IITDETYQELLYKLATKKRTVTELIDHLKKEEKELRILEDEISRYAEKKGIHNQNNIL
                     ASPRGKGNNEMIQSWAKQIHSAIDEVNNSPNVVNGKKSISDFFYKQQDNEVKSRNYKV
                     EKPFFKQLVDKFSEFTFNEDDEEEFDKSRNLDEYSVNNNFNYEYDESNIDDEEEPEGI
                     LNIGLRKPRVSKPLTIKK"
     gene            complement(<104754..>106178)
                     /gene="TPHA0E00600"
                     /locus_tag="TPHA_0E00600"
                     /db_xref="GeneID:11531309"
     mRNA            complement(<104754..>106178)
                     /gene="TPHA0E00600"
                     /locus_tag="TPHA_0E00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685541.1"
                     /db_xref="GeneID:11531309"
     CDS             complement(104754..106178)
                     /gene="TPHA0E00600"
                     /locus_tag="TPHA_0E00600"
                     /inference="similar to DNA sequence:INSDC:YPR036W"
                     /note="similar to Saccharomyces cerevisiae VMA13
                     (YPR036W); ancestral locus Anc_7.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685589.1"
                     /db_xref="GeneID:11531309"
                     /db_xref="GOA:G8BTC7"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BTC7"
                     /translation="MSTSILLDSTHFNEIRKAIGSRSVAWDAVARSSEVDGNDVAVAK
                     QLESILINKKPTSGESELNVNKSMIVSLIHFLQTSTNNESKKYVTNLIAELFSSEEYS
                     ADALAVFKETPSLINQLYEVSFQSTDPQTCLITAFNVVSILIQKDTHDIDLIKKLLSN
                     KSYLDILHNKEQMDTSYVCMRLLQELAGVKEYRKTIWSLRANYIGTIFGIIKSATQPD
                     SNTRLVATNSNNLGIQLQYYSLLLIWLLTFDNTIAYELTTEYLADFLTLLRLVKVTIK
                     EKISRISIAIILQCCSKDVKGNRQLIKKLLLLGNTLQVLQSLSERKYSDEELKQDIST
                     LKEILEAEYNELTSFDEYIAEVDSKLLCWSPPHISNGFWSDNIDKFKADNWKLFKKLV
                     TLLINVASNENVKNISEKQKKIILEVALNDITHVVELLPESVIVLGEMNGKSVIMQLL
                     SHSDSRVKYEALKATQTIIGYNYR"
     gene            complement(<106811..>109999)
                     /gene="TPHA0E00610"
                     /locus_tag="TPHA_0E00610"
                     /db_xref="GeneID:11531310"
     mRNA            complement(<106811..>109999)
                     /gene="TPHA0E00610"
                     /locus_tag="TPHA_0E00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685542.1"
                     /db_xref="GeneID:11531310"
     CDS             complement(106811..109999)
                     /gene="TPHA0E00610"
                     /locus_tag="TPHA_0E00610"
                     /inference="similar to DNA sequence:INSDC:YBL106C,YPR032W"
                     /note="similar to Saccharomyces cerevisiae SRO77 (YBL106C)
                     and SRO7 (YPR032W); ancestral locus Anc_7.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685590.1"
                     /db_xref="GeneID:11531310"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BTC8"
                     /translation="MFKNKFKSVLKHSSNNDANAKEAVNQKKGNDNNEQSENPSSGSK
                     FKSMRHAFKSSTITEVPTINSGMSRIFHTQQVSLSGIRGTITTMAFEQTQGLLAVATT
                     SKDVHIFGNKEVEVVMSFEGKDTIKELRFVKGIYLLVISSKDIITIISLYSKQILTSV
                     FAPGKLISVETDPSLDWILMGLQSGTLLAYDVDRDQMCEFRVDNIQKLNFFKQSAISP
                     IVSIQWNPRDIGTVLISYEQSTIIFSLIENTVKQHFIYELPPDAPGGDYSFNTKETRY
                     PKVIQSLFHPNSLHILTIHEDNSLCFWDANTGKLILARTILETQINKPQIGLQKAAPV
                     GIPKVLKAKWVCANNPEYTSLAIAYQSSSSTMGSDNNQNLIIFDFGGTPSYTVTTYDG
                     MKKYYSKPRGQKIVPLIQQGNIIDMLPIPRASPFFAGCHDPAIILLLFDNGELGTMIF
                     PKGLFTTKASLLPQNLCWLRPPVTMITGISVPKKLWLGMMTSQRNEQGLLKGGLASKK
                     EMRLQTIRSAIATGHVNGTVRIWDASQKELEDNSVFEVNLGSIINTSQGLAVTNISFS
                     PDTLELAVSVESGNVILFKYEMNQYFIPDGNTDKALEIKLRRFSLNDSDEVLVDVRDR
                     ASTSIKKGFLPSTAVHACRGKVTALKNSGIGFVGIAYQDGSVIVIDRRGPATMYFGNV
                     NSSKINGKTITAIEFCIMEYGTDGYSSILMLAGSDSGELFTYKILPAGGSRFSVELIE
                     VTKTNEPAPVLYIGAVDKSNGQNCSATIAKMDQLSSGIPIPGTVFVVTSMDARTVKLG
                     KSKDSGKTFKYPVLSSSLSFIPYIGSKGDNKLATVLVSMLANGDVKVLSTPDLKDVKT
                     MHIGSATQAKYIPECSVLTNGDIIIRNGTHSAGLYSTVDQKAAGLESPKTGRDSNSKP
                     QPDTLYNPTLHIPYRPQVNSMQWARGTVYVTDDQLSEVLSGKKRPPSKYKESEIAKGT
                     ITLAPPKKSNQKAIEEGGKYRPEDMTYKSPVRHTQRSGGYDVIKAVTRTVETQYDYVE
                     SQFNEYTTALGNSLNEAVEDTSKDLMKSAIGI"
     gene            complement(<110394..>111848)
                     /gene="TPHA0E00620"
                     /locus_tag="TPHA_0E00620"
                     /db_xref="GeneID:11531311"
     mRNA            complement(<110394..>111848)
                     /gene="TPHA0E00620"
                     /locus_tag="TPHA_0E00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685543.1"
                     /db_xref="GeneID:11531311"
     CDS             complement(110394..111848)
                     /gene="TPHA0E00620"
                     /locus_tag="TPHA_0E00620"
                     /inference="similar to DNA sequence:INSDC:YBL103C"
                     /note="similar to Saccharomyces cerevisiae RTG3 (YBL103C);
                     ancestral locus Anc_7.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685591.1"
                     /db_xref="GeneID:11531311"
                     /db_xref="GOA:G8BTC9"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024099"
                     /db_xref="UniProtKB/TrEMBL:G8BTC9"
                     /translation="MDQNLINQYLNNKQHHDKQLGAENNSSYNENTPSDDIENASYNL
                     ISDMNYMARDKTDNVHNRGLEANNANSFNLENMGGETRFLDDIFANSNGNDVSEIFNS
                     MNHQNSISNNDRIMRSNLDQYNDNIDNIPGIETTDFLFAKEAMQPGIDLASSLGSSIH
                     SDINSGSYQPQAFSYNGSGINTSNNSFNVNNTSNLNSMRSLSTSLRTGNYLSSSLRQP
                     SLINPDYNNAMTPSSVNSISKFEATISPGVSGSSSAAPSSSVPNKMVSHMSAEEKRKR
                     KREFHNAVERRRRELIKEKIKELGKLVPPSLFMYDAATGKKIKANKGTILYKTVEYLE
                     FLKNVVEAQHYRKKKLLLKLQELNHVNETDKSLFDNSNEVKLEVDDNSMTFSTEKIID
                     ARVTSNANPHLEKFILEADHNLYPGEASLQQPANTAQYQQYQQSQSDDFANDNLNQYL
                     SGALIEAEDNAQLTYNVGQDGTTPADYLLEFDAI"
     gene            <112629..>113285
                     /gene="TPHA0E00630"
                     /locus_tag="TPHA_0E00630"
                     /db_xref="GeneID:11531312"
     mRNA            <112629..>113285
                     /gene="TPHA0E00630"
                     /locus_tag="TPHA_0E00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685544.1"
                     /db_xref="GeneID:11531312"
     CDS             112629..113285
                     /gene="TPHA0E00630"
                     /locus_tag="TPHA_0E00630"
                     /inference="similar to DNA sequence:INSDC:YBL102W"
                     /note="similar to Saccharomyces cerevisiae SFT2 (YBL102W);
                     ancestral locus Anc_7.437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685592.1"
                     /db_xref="GeneID:11531312"
                     /db_xref="GOA:G8BTD0"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:G8BTD0"
                     /translation="MADLNPNDSGLRDSLNKWYSSRTDAAAAAAEGSVSGNVRGFFST
                     FSDSVNSTAQDVYSRLPLTNQDLSQTEEPSWFALSRTERLLLFIACLLGSIACFTLCI
                     FLFPVLAIKPRKFGLLWTMGSLLFILAFGFFMGPIAYIKHLTSRERLPFTVFFFSTCF
                     LTIYFAAFVKSSLLTMPCAVLELIAVVYYAISYFPFGRAGLSMLSSFGLSRARGALNI
                     "
     gene            complement(<113447..>116662)
                     /gene="TPHA0E00640"
                     /locus_tag="TPHA_0E00640"
                     /db_xref="GeneID:11531315"
     mRNA            complement(<113447..>116662)
                     /gene="TPHA0E00640"
                     /locus_tag="TPHA_0E00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685545.1"
                     /db_xref="GeneID:11531315"
     CDS             complement(113447..116662)
                     /gene="TPHA0E00640"
                     /locus_tag="TPHA_0E00640"
                     /inference="similar to DNA sequence:INSDC:YBL101C,YPR030W"
                     /note="similar to Saccharomyces cerevisiae ECM21 (YBL101C)
                     and CSR2 (YPR030W); ancestral locus Anc_7.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685593.1"
                     /db_xref="GeneID:11531315"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G8BTD1"
                     /translation="MSLNATDKSETRSGHHIKSDKRSPSMKVALSAFMGSSANSSTTS
                     LHSHAHSSKNSGIASTYSNASLPVARRNSAHHFPVRKTSNSSSHSHNNNKTSQAPLNH
                     PQLNNDSSADLGNTRRHSIAVFSPSPNGKSTNPFRQSSSSDSHSITLTPVHSPASTRP
                     VSANTDSALLSKLGKTYLRDYLKARGLLEKKLIFTGDNIKISVADSGSTMFLASNPRR
                     SDAYYARMNGYADSDAADDPYLSRNDTTLRNPASSASSGDRLNRSRASSSASGRQSIN
                     SRSNSSTDSDETVHPYNVAIIVTVKQSTQLKDIEANLFSRIRVFWKEGVPPTKSFKEE
                     VYNYGSIKWTLNCKNYDLYIPCKVSSKDKIVNNNIKERKLEIFRNIPDKDRIYADASH
                     SKEAIFDRLSKTETKKFHSGTYVFMLPVAFSDNVPESLYYPSARIGYRVSIATKIEKT
                     KKDHLSSKDSHRLYSGTSTGSKDSLKEIGDIQPGVKHSSSTSLFKKVKSSLSIANDTV
                     EHSKENHSANKIYVEYPLTIIRTPPPSSTTTANRSIYVNRTWSDALGYEISFGQKYIP
                     LGSKVPIKLKISPLTKDIKLHRVRVNLLEKVSFVSKNYEYEFDQIDVISKDPYSPYYK
                     NFQAMRRKCRSLSLLEIRTKEKGGHALREEIVENCFAGNLLAYDSIKDYSKKTDKERP
                     EIGINEPIVIETNIEFPKFVDLDKKGTRNIPPYGVDSYVSVNSTDSDDVKQPLNKRHS
                     SIRGFFTTAHSSTELKPEVNHTTDPRLLETKILTNSGKDIKLNTSVHMAKRGLYVDSY
                     NCANISCKHKLEIMFRVSKKDDVNPTKIRNYEVVLDIPVIIVSDKCVVESMELPTYSM
                     AIMDNPHSDLASTTKNAVDDVFPPSFEEVFSVPASPLGSPFASPTNSPRMRAMFSNDD
                     LSDHLSLSKDVSSLNLNRTGEFVSTNPFHLNYSSNTDIASMVKSSQQFTTFDNLDDLL
                     GSPKKDGIDENLVKSGDSDSLVAIDVPYCLYSPDKKKKLTINESQPEGLFKSDYSFKP
                     KGSNHSLSGSDEIYHEVLGPDLKKSFTKSDPPTYDDIVSNR"
     gene            118145..118234
                     /gene="TPHA0Etrna5F"
                     /locus_tag="TPHA_0Etrna5F"
                     /db_xref="GeneID:11531299"
     tRNA            join(118145..118182,118198..118234)
                     /gene="TPHA0Etrna5F"
                     /locus_tag="TPHA_0Etrna5F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11531299"
     gene            complement(<118357..>121965)
                     /gene="TPHA0E00650"
                     /locus_tag="TPHA_0E00650"
                     /db_xref="GeneID:11531430"
     mRNA            complement(<118357..>121965)
                     /gene="TPHA0E00650"
                     /locus_tag="TPHA_0E00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685546.1"
                     /db_xref="GeneID:11531430"
     CDS             complement(118357..121965)
                     /gene="TPHA0E00650"
                     /locus_tag="TPHA_0E00650"
                     /inference="similar to DNA sequence:INSDC:YPR026W"
                     /note="similar to Saccharomyces cerevisiae ATH1 (YPR026W);
                     ancestral locus Anc_7.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685594.1"
                     /db_xref="GeneID:11531430"
                     /db_xref="GOA:G8BTD2"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:G8BTD2"
                     /translation="MFFDNVYSQRKEKDLVLLIWFQRIFIIMLLIIFLIFNCFITVQS
                     IHINSFFNNKFLRHFSTRNNKLIYASPIAQSNLSILSVGEEISQVATARKTSKKLYDL
                     LINYEDSYYDDENMVLGTDVITKNTYTRQPYVANGYIGSRIPNIGFGYALDEYSIWNP
                     DVTDNPELFNNGWPLRNRRYAGSFVSDFYSLQKKLNSTNFPEIDDIGYSNVISSIPEW
                     TNIKLTVIDENDRSFNFNPQDISVNDITNYHQNLSMQNGMVTTDLNWLNNTLHINSTM
                     FTHRKLYPLGLLEIDITLNREYLPTDFATYNISVFDILDFNTSHRTFLRDMGPSYDSS
                     KMQGIFMVVEPENVPYTNCVIFSTTEIEQLDITGSVHRNITLDDYVIDGMNSSISQVA
                     KDITLSTEFPKLKIYKYSSIISSNYDGCKNNTYQDNLNEAKHLALNSRGNFQNLADSN
                     TQAWVDLYDNAFIEIPSDSVLELAARSSLFHLMSNARLHNISEDRGLPLPVSGLSSDS
                     YGGLVFWDADVWMQPAILPFFPDVAKNINNYRNATHKQAQLNAKQYGYNGAWYPWTSG
                     GFSNCTSTGPCIDYEYHINVDIALATFSIYMNGADGIDDTYLKYTVWPIVRDAAIAFT
                     EYVQYDKQLDVYETFNLTDPDEFANHVNNGAFTNAGIKILMKWAVDIGNHLEEKVDPI
                     WKAINEKIVIPKTSSNITLEYSGMNSTAEIKQADVPLLVYPLGYITDESILNNAIRDL
                     YYYSEHQAHTGPAMTYPVFVAAAAGLLNHGSSSQSYLYKSILPYLRGPFAQFSEQSDD
                     NFLENGGLHPAYPFLTANGGFLQSILFGLTGIRYSYKVDSDTNKIARLLKFNPIKLKL
                     LPGGLKIRNFKYMGQVLDIIIDDYNGTIIHKSGNKTITIQIPDRSSIRDQDINPYRGK
                     NKTKEDNRILSKRKSNIYELKPNENFTIPLFVTELNAPGNIVESKQITNLTEGVAGDV
                     AMSAVDGNNYTHWQPVNKAETARLLIDLGPGNEQTITGGMFLWGQRPAKNVSISVLPH
                     SQATEQLFQNITYFAEHFEFPNRERTILQLIQEVDNITEPEVCQIFSSDGVCDAGFTQ
                     LLNWKSKDIDELIQQFPNTPGIRENFITIVDNLSVLPSEPYYPEYYEQALIEILPSNK
                     TKFSVDYSKVEYYKKSEVFEQSQWPKTRFIIVSIQDTYDKDLDPKGSTIKEIILYS"
     gene            complement(<125411..>127759)
                     /gene="TPHA0E00660"
                     /locus_tag="TPHA_0E00660"
                     /db_xref="GeneID:11531318"
     mRNA            complement(<125411..>127759)
                     /gene="TPHA0E00660"
                     /locus_tag="TPHA_0E00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685547.1"
                     /db_xref="GeneID:11531318"
     CDS             complement(125411..127759)
                     /gene="TPHA0E00660"
                     /locus_tag="TPHA_0E00660"
                     /inference="similar to DNA sequence:INSDC:YPR024W"
                     /note="similar to Saccharomyces cerevisiae YME1 (YPR024W);
                     ancestral locus Anc_7.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685595.1"
                     /db_xref="GeneID:11531318"
                     /db_xref="GOA:G8BTD3"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTD3"
                     /translation="MLRATTIASMSRLLASRNMLRSTQIISLASRKSLKYYSTDKPPS
                     GNDSKTTANEGAATQGGSSKKPITNQSTGNKDTSASNEKVANDPVKKNSVKTFASAAA
                     AAISSTVEGIKSSTKKSEAKNSQGPVSHALLAKQEQEANNAVTNPDSQAVFYKLLLQS
                     NYPQYVVSRFETPGIASNHECMELYMEALQRIGRHAEADAVRQSLLTASSAGAVNPSL
                     ASSASLGNNSTNNNYHTNFPTMYNPMFGSNKAPIHVVVTESTFTVISRWVRWLLVFGI
                     LTYGVSEGFRYITENTSLLKNNDVADKSVDVAKTNVTFDDVRGCDEARAELEEIVDFL
                     KDPAKYESLGGKLPSGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVGVG
                     AKRIRDLFSQARAKAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQTSG
                     IIIIGATNFPESLDKALTRPGRFDKVVNVDLPDVRGRADILAHHLKKITLAPNVDATV
                     IARGTPGLSGAELANLVNQAAVYACQQNAISVDMSHLEWAKDKILLGAERKTMVLTEA
                     SRRATAYHEAGHAIMAMYTPSATPLYKATILPRGRALGITFQLPEMDKVDITKKECLS
                     RLDVCMGGKIAEELIYGKENTTSGCGSDLQSATQTARAMVTQYGMSEDVGPVNLADKW
                     ETWSGKIRDIADNEVVEMLKLSEDRTRKLLNSKKVELERLAKGLIEYETLDAKEIEKV
                     CNGEPINKLRTATNTIIEGPDSDVRKERGETDKKPLTALIKA"
     gene            <128252..>128968
                     /gene="TPHA0E00670"
                     /locus_tag="TPHA_0E00670"
                     /db_xref="GeneID:11531319"
     mRNA            <128252..>128968
                     /gene="TPHA0E00670"
                     /locus_tag="TPHA_0E00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685548.1"
                     /db_xref="GeneID:11531319"
     CDS             128252..128968
                     /gene="TPHA0E00670"
                     /locus_tag="TPHA_0E00670"
                     /inference="similar to DNA sequence:INSDC:YBL095W"
                     /note="similar to Saccharomyces cerevisiae YBL095W;
                     ancestral locus Anc_7.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685596.1"
                     /db_xref="GeneID:11531319"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8BTD4"
                     /translation="MFKIINRGVLLPALGFGLGVATSMDVWPRTQLPLHDETLLPHLR
                     SVKEGQNNDVLEKISRLHEYQELTGASSHFTKQFVQSQKIPSAHHSNHVGQGLLFGRR
                     KLEIDPLVFHNEAEREIVGFYHIGADLSGDNDKVHYGILSLILDESLCYCGFSCLPSK
                     RGVTARLSVHFNTELPANSTIMLKAKVSEVKGRKCIINGTLSLVDTDTAVVSGVPFAN
                     AECILVEPKWFKYLNWVDMF"
     gene            <129553..>131043
                     /gene="TPHA0E00680"
                     /locus_tag="TPHA_0E00680"
                     /db_xref="GeneID:11531320"
     mRNA            <129553..>131043
                     /gene="TPHA0E00680"
                     /locus_tag="TPHA_0E00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685549.1"
                     /db_xref="GeneID:11531320"
     CDS             129553..131043
                     /gene="TPHA0E00680"
                     /locus_tag="TPHA_0E00680"
                     /inference="similar to DNA sequence:INSDC:YER122C"
                     /note="similar to Saccharomyces cerevisiae GLO3 (YER122C);
                     ancestral locus Anc_7.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685597.1"
                     /db_xref="GeneID:11531320"
                     /db_xref="GOA:G8BTD5"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:G8BTD5"
                     /translation="MSSDNGEVFASKELTTQVFQKLSTKLENRVCFDCGNKNPTWTSV
                     PFGVMLCIQCSAVHRNLGVHITFVKSSTLDKWTINNLRRFKHGGNLKAREYFLKNNGK
                     QYLNTSNVDARVKYTSSIAKKYKEHLEKAVKKDMELYPSELVLTDGQEADFDNLSSAN
                     ASADSLNKNSTDDFFATFQKPTDPESSSTKILTPTSTGAVGSSASPTPRSSMLAGNAN
                     RRRITTASAGGSRAGSGAAKHSILSSNRKPTRITTSKIDKSKADDLFDQFEKDAEAEK
                     EETQANSFANRRAASSTSSLNNATYKPVVIKPENSFGEEKDDFYDFLNGDSSDSYSTP
                     APGVAEIQPKLAKLGFGMTMNDANELAEQQKETLRAASGPKYTGAVATKYGGQKAISS
                     DQMFGRGSYDDTAAQEAKQKLRSFDNATSISSSSYFGEEQEGEEDEFGANPSYNNGHS
                     YNNNSNTNNGFVDFNLSTDDDLQMLKDAVGQGAQKLGNYLRDYLRN"
     gene            <132656..>133051
                     /gene="TPHA0E00690"
                     /locus_tag="TPHA_0E00690"
                     /db_xref="GeneID:11531235"
     mRNA            <132656..>133051
                     /gene="TPHA0E00690"
                     /locus_tag="TPHA_0E00690"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_003685550.1"
                     /db_xref="GeneID:11531235"
     CDS             132656..133051
                     /gene="TPHA0E00690"
                     /locus_tag="TPHA_0E00690"
                     /inference="similar to DNA sequence:INSDC:YBL092W"
                     /note="similar to Saccharomyces cerevisiae RPL32
                     (YBL092W); ancestral locus Anc_7.424"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_003685598.1"
                     /db_xref="GeneID:11531235"
                     /db_xref="GOA:G8BTD6"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="UniProtKB/TrEMBL:G8BTD6"
                     /translation="MASSLPHPKIVKKHTKKFKRHHSDRYHRVGESWRKQKVLTLLLE
                     EDSEGNISEPKIGYGSNNKTKFLTPSGHKTLLIANVKDLELLTMHTKSYAAEIAHNVS
                     SKNRVTILSRAKALGVKITNPKGRLALEA"
     gene            complement(<133715..>134404)
                     /gene="TPHA0E00700"
                     /locus_tag="TPHA_0E00700"
                     /db_xref="GeneID:11531464"
     mRNA            complement(<133715..>134404)
                     /gene="TPHA0E00700"
                     /locus_tag="TPHA_0E00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685551.1"
                     /db_xref="GeneID:11531464"
     CDS             complement(133715..134404)
                     /gene="TPHA0E00700"
                     /locus_tag="TPHA_0E00700"
                     /inference="similar to DNA
                     sequence:INSDC:YBL091C-A,YER120W"
                     /note="similar to Saccharomyces cerevisiae SCS22
                     (YBL091C-A) and SCS2 (YER120W); ancestral locus Anc_7.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685599.1"
                     /db_xref="GeneID:11531464"
                     /db_xref="GOA:G8BTD7"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016763"
                     /db_xref="UniProtKB/TrEMBL:G8BTD7"
                     /translation="MSAVTIQPDVLEFKSPFTVQSTEYASITNNSNETIAFKVKTTAP
                     KFYCVRPNAAVVAPGETVQVQIILLGLSEEPAADFKCRDKFLVITLPAPYDLDGKPVA
                     DVWPSLEAEFKQQAVSKKMKVKYVISSEQPTQQQEQEQQQQVQEDEVNQEQIVSEPKE
                     IVAEKKEPVQTKPIEKEIIREAKAEESPMVKVETSEKKATAFSESEDLLNTNTLIIIA
                     LIALLLGWFYY"
     gene            complement(<135250..>136147)
                     /gene="TPHA0E00710"
                     /locus_tag="TPHA_0E00710"
                     /db_xref="GeneID:11531504"
     mRNA            complement(join(<135250..135621,136106..>136147))
                     /gene="TPHA0E00710"
                     /locus_tag="TPHA_0E00710"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_003685552.1"
                     /db_xref="GeneID:11531504"
     CDS             complement(join(135250..135621,136106..136147))
                     /gene="TPHA0E00710"
                     /locus_tag="TPHA_0E00710"
                     /inference="similar to DNA sequence:INSDC:YBL087C,YER117W"
                     /note="similar to Saccharomyces cerevisiae RPL23A
                     (YBL087C) and RPL23B (YER117W); ancestral locus Anc_7.417"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_003685600.1"
                     /db_xref="GeneID:11531504"
                     /db_xref="GOA:G8BTD8"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:G8BTD8"
                     /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGS
                     RLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKAWRRKDGVYLYFEDNAGVI
                     ANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV"
     gene            complement(<136859..>137929)
                     /gene="TPHA0E00720"
                     /locus_tag="TPHA_0E00720"
                     /db_xref="GeneID:11531181"
     mRNA            complement(<136859..>137929)
                     /gene="TPHA0E00720"
                     /locus_tag="TPHA_0E00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685553.1"
                     /db_xref="GeneID:11531181"
     CDS             complement(136859..137929)
                     /gene="TPHA0E00720"
                     /locus_tag="TPHA_0E00720"
                     /inference="similar to DNA sequence:INSDC:YBL086C"
                     /note="similar to Saccharomyces cerevisiae YBL086C;
                     ancestral locus Anc_7.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685601.1"
                     /db_xref="GeneID:11531181"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="UniProtKB/TrEMBL:G8BTD9"
                     /translation="MKLRGSSKQNRPRFLLSILFKDLINVSSESGSCFIKWALKDGTG
                     TSIHALSSDHKGNHLQLYGINQNTGLTPIQQINNHRVVWGYDLEVPLHIKLYVDNNGV
                     LIGKLLILEVYLDKNTNKTDHTLKQTTSAPNEKKNKLEKVLEPTATELKKTVTAAHAG
                     VTNGPNISQINKSKYELLGTVKIDITDYIRPDEQFSSNRYLLQNSKVNTILQLSMKLK
                     LIRGKYTDFTIKKPSNKPGAKSIAQSGIGDIFQQEDSTIYSSLGGSTKVNGSSESDNL
                     YAASTAGSKVHTSVSSVRPSYLVEDAYMKSLNLSWDRRPGEFNVQECIEDIINGGDGW
                     ARNEKGVKLIDLKTYGDREEFQ"
     gene            <139190..>142126
                     /gene="TPHA0E00730"
                     /locus_tag="TPHA_0E00730"
                     /db_xref="GeneID:11531187"
     mRNA            <139190..>142126
                     /gene="TPHA0E00730"
                     /locus_tag="TPHA_0E00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685554.1"
                     /db_xref="GeneID:11531187"
     CDS             139190..142126
                     /gene="TPHA0E00730"
                     /locus_tag="TPHA_0E00730"
                     /inference="similar to DNA sequence:INSDC:YBL085W,YER114C"
                     /note="similar to Saccharomyces cerevisiae BOI1 (YBL085W)
                     and BOI2 (YER114C); ancestral locus Anc_7.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685602.1"
                     /db_xref="GeneID:11531187"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:G8BTE0"
                     /translation="MNSNSIPNLAHYYDVDSNLESPTSIVNGSSKTFPLYIAINQYEK
                     RMEDELNMQLGDKIQVITDDSEYNDGWYYGKNLRTQEEGLYPVVFTQTFVPDRVQLTQ
                     EKSARRISTIMTNLPVNSTSELPTPQKAETATLINGSNKMKDRSLSLKKTMSDIDKAL
                     EELQSGNSGPAPNVTRKISDISTNMEELTIEKSWTPDLQDRNIGDYSHDLDNNQSRSA
                     SNNTIIVNKLSDVNNKVNTSGNVDRIPERPELNPKNVLNWTPEDVTDHFTLSGFDPEV
                     SSKFKIQKISGKILLELELSHLKEIDIDSFGTRFEVFKEIEALKKIVQNTPNSNEFHN
                     DSSINVNNRSSTLMPAAHLNEQETVSNQKNIANMINNENLSPLRDSKYLAPHSQTLNE
                     NTNPTNLSLKTDHQNRKSTKSNTPSLILTPDTNKVETNNVIMDENMFTSPRKAPKPPT
                     YPSPVQPLSASASKRMSLSPMLNSPSTHYRSTSIEKSSSVVATPKPSSKSNKFKFPQS
                     SGTIPNSNNQLTNNTSSASRKSNIYSNHRKSISGGSFVDLYHRVSSISSPYNESRKGS
                     DNASTKNNEHQRQPSNISNSHSKNASQSNIDVRSHRRNSSLLSFFSGKNEDRPSSPLK
                     SSNPKTSGKSTHSRTSSYVKSPFTSENADENIRATPKDLFASPSIAVSSDITMQSPIQ
                     DSKRRVNSTFDNRSPTFDDSARTLIEEDEKKRSISEMAKGKAMHKMAGKPNSKRNTTA
                     FVEGIRTIKANDAIKDADCSGWMKKKGSGTMGVWKTRFFTLHGTRLSYFSSTTDTREK
                     GLIDITGHRVVPAKDDDKIVSLYAASTGKGRYCFKLLPPQPGAKKGLTFTQPRVHYFA
                     VDTKDEMRSWMSALIKSTIDINTETSVVSSYSSSTISLAKAKEMLSQARQENIQRQQG
                     TLLNEEDEDQMLWEQELSGKPKNKEKIRRNRYTMDFSVSRSKMEQIHLIHLHHLSMLS
                     VTNQQP"
     gene            complement(<142456..>144696)
                     /gene="TPHA0E00740"
                     /locus_tag="TPHA_0E00740"
                     /db_xref="GeneID:11531377"
     mRNA            complement(<142456..>144696)
                     /gene="TPHA0E00740"
                     /locus_tag="TPHA_0E00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685555.1"
                     /db_xref="GeneID:11531377"
     CDS             complement(142456..144696)
                     /gene="TPHA0E00740"
                     /locus_tag="TPHA_0E00740"
                     /inference="similar to DNA sequence:INSDC:YBL084C"
                     /note="similar to Saccharomyces cerevisiae CDC27
                     (YBL084C); ancestral locus Anc_7.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685603.1"
                     /db_xref="GeneID:11531377"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BTE1"
                     /translation="MLFGTGPSLHKYNNLLNGNNDDIINENTLNNIINLNEYIQQSIL
                     QLNYDSAEFLSELLFAECKKLNDRTIYKIEAIYLYSLSLYLNENIHTAFDISKNYKHL
                     NIGIAYVYALCSNKLNNKNINDSIRILLDFKEKINSNNSTTTTLPASNLIHFPNTATI
                     DCLLGKLFKKNDNLKESAVYFTEALNKNPYLWEAYVELSNSRATLDLQKLYSVLIKHS
                     QANQQQQQYNSSNILHHTHHPNRNRFNSVVKPYSTPFKSNRNNNYIINSSLKINDHPK
                     QSLLGSNKKTITSGSILNKTNVMASTTSSNSNNNNSNNNTTSERQSSHFKVLNKNKFF
                     SSSPSKKVLNDTSTLKTPKGKTTSTQHSNISNSNSKNNAGILNKDQASTTNSFASSDS
                     PNSSLLLSSTKNNRSGQNSQQQQPLSISLVEIMYSFAKIMKTSSLYDSYKAIRLLNND
                     IPQHIRENMPWCQAQLGKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLN
                     DKSKLSILSSELITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYT
                     LQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARS
                     INPINVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTL
                     ALKFFEELKHVAPDEATVHFLLGQIYSILGRKKDAIKEYTIALNLDPKGRQLIMEALE
                     KCHTLD"
     gene            <146045..>149278
                     /gene="TPHA0E00750"
                     /locus_tag="TPHA_0E00750"
                     /db_xref="GeneID:11531378"
     mRNA            <146045..>149278
                     /gene="TPHA0E00750"
                     /locus_tag="TPHA_0E00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685556.1"
                     /db_xref="GeneID:11531378"
     CDS             146045..149278
                     /gene="TPHA0E00750"
                     /locus_tag="TPHA_0E00750"
                     /inference="similar to DNA sequence:INSDC:YER111C"
                     /note="similar to Saccharomyces cerevisiae SWI4 (YER111C);
                     ancestral locus Anc_7.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685604.1"
                     /db_xref="GeneID:11531378"
                     /db_xref="GOA:G8BTE2"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BTE2"
                     /translation="MVYNQIVMFANNSNDDGVKSNELVAKKEYLAAENDGSGSNIQTQ
                     QPYSANTLNITGGVNLTSNTPIIEIATYSEIDVYECYVRGFESRIVMRRKNNDWVNIT
                     QVLKLASFSKTKRTKIIEKESMNMEHEKVQGGYGRFQGTWIPLSSTKELIEKYNIDDP
                     VISALVNFVLDPDNPPPRRSKNSILKKTSPGMKINSPSSYNKTPKKNNVISGSSTSTS
                     TNGNKKNRKKFGSGSGQLLRINPSPLSNVFQTPQLPNGTSHSNGNMSANTIIDTTVES
                     VSTLSNTEVPNVEGQKETNNTSRNPSFAANGYSATQKPLQFFPVPTISGYNSVNNNNN
                     LNSNSNVNVVRKPINSNKDQLKFEKNGTKNPKESSFLTFIPDSRNKTFTSSEHMSVNP
                     VHYNNSHMNNKDSKDNTKNTKRRKKKMDDDENNDFNDENSMIRNGNATVQDKTQQNFK
                     VIKQQMIGSNFHNLSLPNSSRSIQSNSAVSSSSTHVPSESTPYSQFKITANDIPVVSE
                     QEYKEIILQTLSSEDIIDASSLPLVLYHPPASLDINFEVDNQGHTALHWATAMSNVPL
                     IKLLISMNIDIFKSNKRGFNCITKMIFYNNCYKAGTFAEIISILKMCLITSDDNNRIP
                     LHYLVELSVNKSKDPQVINYYIETIFKILANENYSLLRLCLYHQDNMGNTLLHLAALN
                     LNIDLYNKLIELGASKDIPNFDSKTPAAILSKFNLLPNEDIENIEYMQGIELQEGFQS
                     PQSNKPKYEHLNNEHKKHTNLDINVINSPYRVKLHNNNEHNLLGHEISNNDTFTMEDI
                     SELDNLVTSSVVKDTDELHHNLLKNSPMLYKSKSNSELGRNVLQQPITLNEPKARNPS
                     NSVFDNDMTTEESISNIHDIEDDLSIGSNSVKQTYKLAILTSNLNKSIKSDVRNMQEE
                     ISKNKRKVDVINYQLEGVDNQRKTLIDQMSKNFKINKIDELHDKLKSLHEEKDALKKQ
                     FLEKFERTQHKIYLQNVKDIESSELKNTYNGQSIEMLAKEDIKKLIEEVKNSKEQKRT
                     TIKNIADAVATMTSSDKIEKYRKLIGLTIENVDAKLDEIEYELSMNM"
     gene            <150033..>153383
                     /gene="TPHA0E00760"
                     /locus_tag="TPHA_0E00760"
                     /db_xref="GeneID:11531495"
     mRNA            <150033..>153383
                     /gene="TPHA0E00760"
                     /locus_tag="TPHA_0E00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685557.1"
                     /db_xref="GeneID:11531495"
     CDS             150033..153383
                     /gene="TPHA0E00760"
                     /locus_tag="TPHA_0E00760"
                     /inference="similar to DNA sequence:INSDC:YER110C"
                     /note="similar to Saccharomyces cerevisiae KAP123
                     (YER110C); ancestral locus Anc_7.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685605.1"
                     /db_xref="GeneID:11531495"
                     /db_xref="GOA:G8BTE3"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BTE3"
                     /translation="MDQQFLAQLEQTLNAIIKPSSSASLKETTKTLQSQYYTQATTVP
                     ALIHILQNSSDDALKQLAGVEARKLVPKHWSTLDDAIKNEMKNSLLQTAFSEDKEIIR
                     HSNARVIASIGTEELEGNKWPELVPSLIQAASGEDAGVRQIAVFILLSLLEDYSPSLS
                     VFIDDFLNLFAQTINDTTSLETRSLSAQALNHISALIEEQETINPQFATKFASLIPSI
                     VNTLDAVIKAEDIKNSKAIFNCLNDILLLDSQLTGNTIVDLIKLTLQIASNTEVEEDV
                     RVFAIQFIISALSYRKSKIIQSKLGREITLTALRIAAEEIDVEEELNNEDEAGENEEN
                     TPSLIAIRLLAFASAELPPSQVSTVIIEHLPIMLQSSNPFERRAILLAISVAVTGSPD
                     YFLSQFEKVIPATISGLKDAEPVVILAALKCVHQLTTDLQDEVAKFHEQYLPLIIDII
                     DSAKFVVIYNYATMALDGLLEFIAYEAIAKYLEPLMNKLFYMLESNNSSKLRCAVVSA
                     IGSAAFAAGSAFIPYFKTSVQYLEQFIQNCSQIEGMSEDDIELRAITFENISTMARAV
                     RSEAFSEYAEPLVNSAYEAIKTDSARLRESGYAFIANLAKVYGENFAPFLKTILPEIF
                     KTLELDEYQFNFDGDAEDLSAFAEGATEEDLQSKFTVNTGISYEKEVAAAALSELALG
                     TKEHFLPYVEQSLKTLSEQVDESYGLRETALATLWNIVKAVLLSSRIEPESYPKGLPA
                     TSYIDATSLAVVQTARAISIANLNDEFETSMVITVMEDLANMIKQFGPIIIMDSGDSS
                     SLETLCMQVLSVLNGTHACQTVDIEEDAPKDEELDASETEATLLDIALEVLVSLSHAL
                     GSDFASIFENFKPVLFELYESKSKNKRSSAIGATSEIVLGMKEGSPYIQEMLEAMIVR
                     LTSDKSLEVRGNAAYGVGLLCEYASFDISSIYGAVLKAMYELLSTADQKSLAADDDEA
                     TREIIDRAFANASGCVARMILKHENLVPLEQTIPALFAHLPLKTGFEEYTPIFQVIMK
                     LYQDNNAVITNMTPKVIEFFAAVFTKDAERIKLEQESTLGREENLERLKQFQTDDIKQ
                     KIVELLKYINNTYSGVVVKDPVLAPVIA"
     gene            <154048..>155115
                     /gene="TPHA0E00770"
                     /locus_tag="TPHA_0E00770"
                     /db_xref="GeneID:11531478"
     mRNA            <154048..>155115
                     /gene="TPHA0E00770"
                     /locus_tag="TPHA_0E00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685558.1"
                     /db_xref="GeneID:11531478"
     CDS             154048..155115
                     /gene="TPHA0E00770"
                     /locus_tag="TPHA_0E00770"
                     /inference="similar to DNA sequence:INSDC:YER107C"
                     /note="similar to Saccharomyces cerevisiae GLE2 (YER107C);
                     ancestral locus Anc_7.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685606.1"
                     /db_xref="GeneID:11531478"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BTE4"
                     /translation="MSFFRSNTSSNQTMAADKDLMNDIVINNPAEDSISDIAFSPQQD
                     FLFSVSSWDNKVRIWDAQGGNPQGRAQYEHAAPVLCTRWSSDGTKVASGGCDNAIKIY
                     DVASGQNQQLGTHNAAVKSLRFVNCGPSNQECLVTGSWDKTLKYWDLRQPQPISTVML
                     PERVYSMDSKDKLLVVGTADRNICIIDLNSPGNIFKTFLSPLKWQTRAIACFNRGDSY
                     AIGSIEGRCAIRYVDDMQQKNLGFSFKCHRQNQNNNSMHANIYPVNSIAVHPVYGSFA
                     TAGSDGTFHFWDKDHRHRLKAFPSQNATIPVVNFNRNGSVLAYALSYDWFQGYGGNKQ
                     GYPNVIKLHPTTDAEVQERKK"
     gene            <155978..>157279
                     /gene="TPHA0E00780"
                     /locus_tag="TPHA_0E00780"
                     /db_xref="GeneID:11531418"
     mRNA            <155978..>157279
                     /gene="TPHA0E00780"
                     /locus_tag="TPHA_0E00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685559.1"
                     /db_xref="GeneID:11531418"
     CDS             155978..157279
                     /gene="TPHA0E00780"
                     /locus_tag="TPHA_0E00780"
                     /inference="similar to DNA sequence:INSDC:YBL081W"
                     /note="similar to Saccharomyces cerevisiae YBL081W;
                     ancestral locus Anc_7.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685607.1"
                     /db_xref="GeneID:11531418"
                     /db_xref="UniProtKB/TrEMBL:G8BTE5"
                     /translation="MPGEIVNVAFLSQMEDMDIYLKDYRSRKSTSKTSYGSTYVQSSG
                     NQGRFNNDGIIRHNGYRNNHSYKYDSHNEHGMSGSQYDNMMHNNSNSNSDNSDNNNNN
                     KSNNSNNSNKNKGNLGSGEIYNNWVGNDGYNIKKGNYGEQGYANYSNLNFKVTSDSNN
                     SNNDNTSRNKDISKNDNDSLKNGGKNASNNPYIQNTNLATHFKKTYSPMYYNNTRNDS
                     TGSLTKMNPMFFGSSENSDFQSTSKLVGNTTTLMNSSINNSLAGGSSFSSNNFDYMFQ
                     NHSDLKNNLSSANVAAPTPYSNYLGNSILPNSSVSASMGNNPLALSTNLDLMSGLSTP
                     NMINEFQKTLSFTSISPLKVSQNDALPTQHGTENKETSNTGEKGKTNPEVEPPSSISN
                     SNMMLMDDSSFLWGSSNADLSSSTSVNGTFGIWNNDMSVWS"
     gene            complement(<158016..>158948)
                     /gene="TPHA0E00790"
                     /locus_tag="TPHA_0E00790"
                     /db_xref="GeneID:11531441"
     mRNA            complement(<158016..>158948)
                     /gene="TPHA0E00790"
                     /locus_tag="TPHA_0E00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685560.1"
                     /db_xref="GeneID:11531441"
     CDS             complement(158016..158948)
                     /gene="TPHA0E00790"
                     /locus_tag="TPHA_0E00790"
                     /inference="similar to DNA sequence:INSDC:YER106W"
                     /note="similar to Saccharomyces cerevisiae MAM1 (YER106W);
                     ancestral locus Anc_7.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685608.1"
                     /db_xref="GeneID:11531441"
                     /db_xref="InterPro:IPR018847"
                     /db_xref="UniProtKB/TrEMBL:G8BTE6"
                     /translation="MVKKNGPNGRLSHQKPLGSKNVNVVRNLKGAGKQDNQIKSSRVK
                     VQKATHLHNGSLLEETLLHPLTGKQSATKNIDTQSKRTDNEMNKPLETEYKMSDDGTK
                     TSIVNKLASNHPNSVQKIEDDRWLSTLSEENLLSLQREISQLEGMQFNCDHEFCHNLD
                     STLKKSDLNIGNFRVWFLFDLEMTADGLINLRNACYQKFIYNKVDIAWTKSNILKNTN
                     SSKQLPCIQSDSLEFFPLEQISLRNIEIDLKNNSEDNRKNSNRLTDFSVNIVSMLESD
                     EEEEVKHNHMIRNKKIAPTILSSRNKKRYLMLKL"
     gene            complement(<159926..>160282)
                     /gene="TPHA0E00800"
                     /locus_tag="TPHA_0E00800"
                     /db_xref="GeneID:11531442"
     mRNA            complement(<159926..>160282)
                     /gene="TPHA0E00800"
                     /locus_tag="TPHA_0E00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685561.1"
                     /db_xref="GeneID:11531442"
     CDS             complement(159926..160282)
                     /gene="TPHA0E00800"
                     /locus_tag="TPHA_0E00800"
                     /inference="similar to DNA sequence:INSDC:YBL078C"
                     /note="similar to Saccharomyces cerevisiae ATG8 (YBL078C);
                     ancestral locus Anc_7.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685609.1"
                     /db_xref="GeneID:11531442"
                     /db_xref="GOA:G8BTE7"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BTE7"
                     /translation="MKSSFKSEYPFEKRKAESSRITEKFQNRIPVICEKAEKSDIPEI
                     DKRKYLVPSDLTVGQFVYVIRKRIMLPAEKAIFIFVNDTLPPTAALMSAVYQEHKDKD
                     GFLYVTYSGENTFGGN"
     gene            complement(<160885..>161310)
                     /gene="TPHA0E00810"
                     /locus_tag="TPHA_0E00810"
                     /db_xref="GeneID:11531140"
     mRNA            complement(<160885..>161310)
                     /gene="TPHA0E00810"
                     /locus_tag="TPHA_0E00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685562.1"
                     /db_xref="GeneID:11531140"
     CDS             complement(160885..161310)
                     /gene="TPHA0E00810"
                     /locus_tag="TPHA_0E00810"
                     /inference="similar to DNA sequence:INSDC:YER104W"
                     /note="similar to Saccharomyces cerevisiae RTT105
                     (YER104W); ancestral locus Anc_7.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685610.1"
                     /db_xref="GeneID:11531140"
                     /db_xref="UniProtKB/TrEMBL:G8BTE8"
                     /translation="MKGEEADSAKRVESNSVVDSVINNRKTKKNVESRLRTSVDDLKL
                     ARKRIKEGKLMKNRGGSAGMEVFVMRSEYEHQTREIKKEAQKNEPSEQLINEIEQENE
                     IETKETLSDDELLEILDQFEIKKNLQRELEVELANLSIQ"
     gene            complement(<161843..>165058)
                     /gene="TPHA0E00820"
                     /locus_tag="TPHA_0E00820"
                     /db_xref="GeneID:11531142"
     mRNA            complement(<161843..>165058)
                     /gene="TPHA0E00820"
                     /locus_tag="TPHA_0E00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685563.1"
                     /db_xref="GeneID:11531142"
     CDS             complement(161843..165058)
                     /gene="TPHA0E00820"
                     /locus_tag="TPHA_0E00820"
                     /inference="similar to DNA sequence:INSDC:YBL076C"
                     /note="similar to Saccharomyces cerevisiae ILS1 (YBL076C);
                     ancestral locus Anc_7.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685611.1"
                     /db_xref="GeneID:11531142"
                     /db_xref="GOA:G8BTE9"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:G8BTE9"
                     /translation="MSESTYFSFPREEEKVLAFWEEIDAFHRSMELTKDKPEFSFFDG
                     PPFATGTPHYGHILASTVKDIVPRYATMTGHHVERRFGWDTHGLPIEHIIDKKLGINS
                     KEDVFKYGIENYNNDCRDIVMTYADEWRKTIGRVGRWIDFDNDYKTMYPTFMESVWWA
                     FKELHKKDQVYRGFRVMPYSTGLTTPLSNFEAQQNYKDVNDPAVTIGFSVVGQEKTQL
                     VAWTTTPWTLPSNLALCVNPEFEYVKIYDENKDQYFILLESLVKSLYKKPAAEKFKVV
                     EKIKGSDLVGLKYEPLFPYYKEDFADSAFRVVGDSYVTSDSGTGIVHNAPAFGEEDYN
                     VCLKNAIIKEDGEIPNPVDDNGKFTDNITDFKGMYVKDADKEIIKYLTASGNLLLASQ
                     IRHSYPFCWRSDTPLLYRTVPAWFVRVKEIVPQMLDSVMKSNWVPNNIKEKRFANWIA
                     NARDWNVSRNRYWGTPIPLWVSEDYEEIVCIGSIQELEELSGVTGIKDLHRDIIDKIT
                     IPSKQGKGDLKRVEEVFDCWFESGSMPYASQHYPFENAEKFNQRVPANFISEGLDQTR
                     GWFYTLSVLGTHLFGTVPYQNVIVSGIILAADGRKMSKSLKNYPDPNIILEQYGADAL
                     RLYLINSPVLKAESLKFKEEGVKEVVSKVLLPWWNSYKFLEGQIALLSKTSDLKFKWD
                     PTVKSNNVMDRWLLASIQSLVQYIDGEMADYRLYTVVPRLLHFIDELTNWYIRFNRRR
                     LKGENGVDDCLKALNSLFEALFTFIRAMAPFTPFLADTIYMKMKEFIPKDILSEFGSD
                     DRSVHFLSYPIVKKELFDEKIEVAVSRMQTVIELGRNIREKKTISLKTPLKSLVILHN
                     DDEYLKDVEDLKEYIIEELNVRDVIITKDEDKYGVEYRVVADWPILGKKLKKDAKKVK
                     DALPNVTSVQVREYLGTGELDVAGIKLVKGDLNAIRGLPESKVQDGQETRTDHEVLII
                     LDTKIYPELKTEGLARELVNRIQKLRKKSGLEATDDVLVEYELTKDTIDFEDIVKEHK
                     EMLTKTCRSEIKKSDNSRADPIADEEQTINDTVFKLKIFRI"
     gene            complement(<165746..>167668)
                     /gene="TPHA0E00830"
                     /locus_tag="TPHA_0E00830"
                     /db_xref="GeneID:11531166"
     mRNA            complement(<165746..>167668)
                     /gene="TPHA0E00830"
                     /locus_tag="TPHA_0E00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685564.1"
                     /db_xref="GeneID:11531166"
     CDS             complement(165746..167668)
                     /gene="TPHA0E00830"
                     /locus_tag="TPHA_0E00830"
                     /inference="similar to DNA sequence:INSDC:YBL075C,YER103W"
                     /note="similar to Saccharomyces cerevisiae SSA3 (YBL075C)
                     and SSA4 (YER103W); ancestral locus Anc_7.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685612.1"
                     /db_xref="GeneID:11531166"
                     /db_xref="GOA:G8BTF0"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8BTF0"
                     /translation="MSKAVGIDLGTTYSCVAHFTNDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAMNPSNTVFDAKRLIGRKFSDPEVINDAKHFPFKIVNKEGKPVIE
                     VEYKAETKSFTPEEISSMILTKMKETAEGYLGGEVKDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGTKEHNVLIFDLGGGTFDVSLLSIDEGIFEVK
                     ATAGDTHLGGEDFDNRVVNHLAQEFQRKYKKDLTKNQRALRRLRTAAERAKRTLSSSA
                     QTSIEIDSLFEGEDFYTSLTRARFEELCADLFRSTLEPVEKVLADAKIDKSKVDEIVL
                     VGGSTRIPKVQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILTGDTSAKTQDLLLL
                     DVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTKD
                     NNILGKFELAGIPPAPRGVPQIEVTFDIDANGILNVSALEKGTGKSNKITITNDKGRL
                     SKEDIDRMVSDAEKYKAEDDAEAERILAKNQLESYAFSLKSTIGEANFKEKVGEEDVK
                     TIETAVQETVDWLDASQSASIDEYKDRQKELEGKVNPIMTKFYGAGGAPPGGAAPGGA
                     APEAAGSEGPTVEEVD"
     gene            complement(<168629..>169774)
                     /gene="TPHA0E00840"
                     /locus_tag="TPHA_0E00840"
                     /db_xref="GeneID:11531167"
     mRNA            complement(<168629..>169774)
                     /gene="TPHA0E00840"
                     /locus_tag="TPHA_0E00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685565.1"
                     /db_xref="GeneID:11531167"
     CDS             complement(168629..169774)
                     /gene="TPHA0E00840"
                     /locus_tag="TPHA_0E00840"
                     /inference="similar to DNA sequence:INSDC:YBL074C"
                     /note="similar to Saccharomyces cerevisiae AAR2 (YBL074C);
                     ancestral locus Anc_7.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685613.1"
                     /db_xref="GeneID:11531167"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="UniProtKB/TrEMBL:G8BTF1"
                     /translation="MAFLTLPILISSSDDVTIGIDNYSFEVKKNQEFFGIQNIPCDSV
                     HLIHFQEHNKKESIRYGYWFNCNVGVNGDVGYYLKYNGEKEIFDVFKETNLNVYYENI
                     NKYRNLMVNYPQVEDIESSDNWTLQTKYISWDQVVSVHESGDNDQQSFVYVDTSMTSR
                     EEIFFLQKKLNIDENNAMNEKHFKYTILNFKSKDALRAEYRMTDFLDKSNYLNAKLLP
                     NFFNNDIKRLLGELQISFLNCITFGNYGSSLQWHNIIELLTQSSVVPGEENTVKDLDE
                     ILSKQLRMMPNEYYDILLNMKLWRKTIDKSIQKHVLVKTRKQLEIISQDLKGDHDDSD
                     DAVYNHTTAYTDELDSGEYYYPSIGSDEESDNEGPTVVAGIYHNRNN"
     gene            complement(<170079..>170681)
                     /gene="TPHA0E00850"
                     /locus_tag="TPHA_0E00850"
                     /db_xref="GeneID:11531174"
     mRNA            complement(<170079..>170681)
                     /gene="TPHA0E00850"
                     /locus_tag="TPHA_0E00850"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_003685566.1"
                     /db_xref="GeneID:11531174"
     CDS             complement(170079..170681)
                     /gene="TPHA0E00850"
                     /locus_tag="TPHA_0E00850"
                     /inference="similar to DNA sequence:INSDC:YBL072C,YER102W"
                     /note="similar to Saccharomyces cerevisiae RPS8A (YBL072C)
                     and RPS8B (YER102W); ancestral locus Anc_7.395"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_003685614.1"
                     /db_xref="GeneID:11531174"
                     /db_xref="GOA:G8BTF2"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:G8BTF2"
                     /translation="MGISRDSRHKRSATGAKRAQFRKKRKFELGRQATNTKIGTKRIH
                     SVRTRGGNKKYRALRIETGNFSWASEGVAKKTRIVGVAYHPSNNELVRTNTLTKAAIV
                     QIDATPFKQWYESHYGASLGKKRNAKDEEIVAPSKSAEKKWASRAGSAKVEQAVESQF
                     GAGRLYAAISSRPGQSGRCDGYILEGEELAFYLRRMTAKK"
     gene            <172803..>174080
                     /gene="TPHA0E00860"
                     /locus_tag="TPHA_0E00860"
                     /db_xref="GeneID:11531175"
     mRNA            <172803..>174080
                     /gene="TPHA0E00860"
                     /locus_tag="TPHA_0E00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685567.1"
                     /db_xref="GeneID:11531175"
     CDS             172803..174080
                     /gene="TPHA0E00860"
                     /locus_tag="TPHA_0E00860"
                     /inference="similar to DNA sequence:INSDC:YBL069W,YER101C"
                     /note="similar to Saccharomyces cerevisiae AST1 (YBL069W)
                     and AST2 (YER101C); ancestral locus Anc_7.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685615.1"
                     /db_xref="GeneID:11531175"
                     /db_xref="GOA:G8BTF3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BTF3"
                     /translation="MSISFEKQEHKLDDATIQGSEIPKEIPTGETVLHRVARPVRHVK
                     NIPVKALVFSSKEGPMLFTYDRKIRTPIPKNKLVVQVAYAGLNPIDMKIKNGYKSGSF
                     YGDAGVGREYFGTIISVGEDIASKNTWREGDEVMGIYYHPHSGNGALQSSILIDPKVD
                     PIMLKPATITMPEAGGTLYCLGAAYQILKSLDKAKVLKPDSNILINGGTTSVGMFVLQ
                     LLKNHYHLVSKVSIVTTGTGSKVLKNHFPSFASDLIFIDYLTCRGKASKPLRKMLEEK
                     VYTDFNEDTQEETTQQYTQGKYDIVFDFVGGYDILAHSSALIHSGGQYVTTVGDYVSD
                     YKNDVFETWDNPSANARKIFGAVLWSYTYTHFNFNPNYDVKWIKEVAEILEKREVKCI
                     VDKVYEWKDFKEAFSYLSTQRSQGKLILKVEKF"
     STS             173230..174401
                     /standard_name="D1S3695"
                     /db_xref="UniSTS:474273"
     STS             174043..174402
                     /standard_name="D1S3698"
                     /db_xref="UniSTS:474276"
     gene            complement(<174245..>176392)
                     /gene="TPHA0E00870"
                     /locus_tag="TPHA_0E00870"
                     /db_xref="GeneID:11531180"
     mRNA            complement(<174245..>176392)
                     /gene="TPHA0E00870"
                     /locus_tag="TPHA_0E00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685568.1"
                     /db_xref="GeneID:11531180"
     CDS             complement(174245..176392)
                     /gene="TPHA0E00870"
                     /locus_tag="TPHA_0E00870"
                     /inference="similar to DNA sequence:INSDC:YBL067C,YER098W"
                     /note="similar to Saccharomyces cerevisiae UBP13 (YBL067C)
                     and UBP9 (YER098W); ancestral locus Anc_7.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685616.1"
                     /db_xref="GeneID:11531180"
                     /db_xref="GOA:G8BTF4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8BTF4"
                     /translation="MAIKLKRWLSKSNKGNDKSNETSRPEEYNKCLEPKLATRQIIDN
                     FEFNETTEHYEVPGINKTAQLLNSNSRALSESPTPVPLKDPRELVKNDSDHQKLLEIT
                     KLSDSSNKVFGYENFGNTCYCNSVLQCLYNIPELRDNVIKYPMVPNEQKFNFKNTKTK
                     VYDENSFDNNTRLLTVNNNNSHNQNGTLKNLYKNNTQSSSQELLSKIPLQRRNSFKIL
                     ASRDQSMLYSTSNSTNASFVSSDQRADTEPTRGHVMASTPITEKIHEISVTTIVGRKK
                     NIRQINILETGKYENNMAKPMGNDNDNDMELTDDAFENDETLENIKKIESSEGKKQTA
                     LISGPVLNIDTALNTNGKSNMYSALKDIFDAITENNHLTGIVSPKELIETLKRENMMF
                     NSMMHQDAHEFLNFLLNQISDNIESNMNNPNNDNGEFGGLKFERNFINDLFQGVIKYT
                     TRCLTCDNITSREELFLDFAIEVSNNEETNIQEILGDYSQREMLNGSNKFFCDCCSGL
                     QEAERIVGLKKLPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKS
                     YDLTGIVLHLGGGPQHGHYVSICKNEKYGWLLFDDEVVVSITEESVLKFVGDPTTLTT
                     AYLLVYKLKDEKYEENVSDIDYENNIKILLENDDFVRKYVSQSSSLNEKATKQSVLED
                     VQEDDLYNEDRVDKTVPSSKSSKRRSKMFSFGL"
     gene            complement(<177030..>180164)
                     /gene="TPHA0E00880"
                     /locus_tag="TPHA_0E00880"
                     /db_xref="GeneID:11531191"
     mRNA            complement(<177030..>180164)
                     /gene="TPHA0E00880"
                     /locus_tag="TPHA_0E00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685569.1"
                     /db_xref="GeneID:11531191"
     CDS             complement(177030..180164)
                     /gene="TPHA0E00880"
                     /locus_tag="TPHA_0E00880"
                     /inference="similar to DNA sequence:INSDC:YBL066C"
                     /note="similar to Saccharomyces cerevisiae SEF1 (YBL066C);
                     ancestral locus Anc_7.389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685617.1"
                     /db_xref="GeneID:11531191"
                     /db_xref="GOA:G8BTF5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BTF5"
                     /translation="MVNKDEKKHQNRKSKPTNIKNEISTIVADDSTKQSANTNKSSAV
                     DFPSTGHRPVTSCSHCRQHKIKCNATFKYPDPCDRCLRVGLDCEIDPQFRPKKGSQLQ
                     NLRNDVNELMSKIDSLIKNDQLILSSLNTKSPGILLKDNGNAKYSATDNPDDNNSGNI
                     NINETFNDDANHKQKTKDLKIAVQTYLVKEPPLMSTIDSPNSINNDNHSSITSPINGK
                     GSTTSNNSRYTMEHEFNDGLHRKGNAKFDNIKHVTSTTNPVQPLSSPYESINEFVLGD
                     VKLSLEKANYLHDIFTERYLPFFPIMISDSATKLCNQSQLLFWTVMLTASLSEPTPTL
                     YMKLAGLIKQLAIETCWLRTPRSTHISQALLILCIWPLPNQKILDDCSYRFVGLAKSL
                     SLQLGLHRGEFYTEFTRTQTLMANAEKWRTRTWLGIYFAEICWASIIGLPPNSQTDYL
                     IEHARVGGDLDGVETNENNQSTNNDIFIFPKLFRRLICLAHFQNKLYNVLGSSIVSSD
                     GLMEPKDRAGALTMMNRELQRLNEREGFEDLNAVNIYYQYVKLTICCFAFLPKTPTED
                     QTSYVTEAYLSATKIVTLFSKLLETRQVIELPIYVRQSVTYAAFILFKLYLTPYLLTK
                     YVDSSRQSVVTVYRLYRNQLAEWSAKVENDLTRTTTVLDKLNLVLLTHPEVFTEKEGI
                     ITRMRSHLTGSLFYDLVYCVHEARRRETDPEYNEKAQKAFEAHKLEKGIVSLDRKLVP
                     LPFYNQISKEDFQTITNTTPGGTTITKLVPTKNAIAKSNKSDDGSVNQINGIPFSMLS
                     ETGSVNIENILGREASTAIDNKPTLQRGFDNSSLFSGNLNSSSFLNQKIGELYNTTGV
                     NGIELKSSRNTVLKNESAKEKMSNSSMQRANSIPADYNYSQSVQSSLSKQFSKEKDPS
                     IYDWKEPLPNHMGSSTTISGQTKRQRSRSIFGNQSRASNRNQNDISPVPLIGTALNNV
                     HNTNTSSTANTNNKLASTLDTQGINITNSGTNINMLSEIDNFLLQQSNGWMENSSLND
                     DFLGWFDMNMEPGF"
     gene            <181328..>185026
                     /gene="TPHA0E00890"
                     /locus_tag="TPHA_0E00890"
                     /db_xref="GeneID:11531196"
     mRNA            <181328..>185026
                     /gene="TPHA0E00890"
                     /locus_tag="TPHA_0E00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685570.1"
                     /db_xref="GeneID:11531196"
     CDS             181328..185026
                     /gene="TPHA0E00890"
                     /locus_tag="TPHA_0E00890"
                     /inference="similar to DNA sequence:INSDC:YBL063W"
                     /note="similar to Saccharomyces cerevisiae KIP1 (YBL063W);
                     ancestral locus Anc_7.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685618.1"
                     /db_xref="GeneID:11531196"
                     /db_xref="GOA:G8BTF6"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8BTF6"
                     /translation="MVDNNAQDADESILVSETDDASIAEQSTKASDGGVYVNDSSKSL
                     SHTKDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGS
                     TRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQ
                     GYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSK
                     NDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTD
                     ALNSNDKLINQTSGNSTPYSITNGLNVNDKFKIKNNNLHDFDGKNVRIMSNQNKSASN
                     CNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVT
                     KVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV
                     DRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKN
                     TPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQLDLYESNSILITEQK
                     AKIDNMEDQIKRFKAKYVEETESNRILLNKLEQSEDANQKLSEKTKVIISLFKRYQEN
                     FKIFNSNINQIHSSNLEVFDSLQNHKDKLDLCSKKNIKTLKEIYIAEEKYTEQLNTLK
                     ASLSSYSDRFMLVFSSVFDEMENNSIEFERNVKSKLSSLDLTMVVEEIKNMKETVEMI
                     CNNILIASDTWDSSYKEVYNSHLMTLKNCFNMVEHKCANINQLMDENFSKFQNDIKSG
                     VHNYKNVSSDHTNDMKHTIYEQSLEIEKLKEKIIIEQQNSKSVESRLNKVIDYFEDEI
                     LKSRRKITTDLIDTLKQSEKDHLELDKQILNRTLSGLRNFENEKQSDLQKSINALTSK
                     FSDVFKNVSLVAEQLPLTIDLTSENLLTTIDEFLKTSPISTELIELVDLVRSYTEQSK
                     SKPILDLLEQLNETRKLMLGDVSMHLKDQISSLTNFTREKKEKFTESNVMASNFIDQF
                     IKYILTDYKDNMTQIPKSQNNVIVDNTNTIETIINSMNELKKESNINEYSDKSKDLVS
                     TFKRNLPVLELPQDFKVFKDIAEEVQGTAHEDQFSPSRSHKLNSLKIIPSTPVPIPDY
                     PLPKVLIPKSVNTSAQRSKTIQSPFKEANILRNITDISNPNNLKRRFTSDSLIHPTEP
                     TDDKIKNCILPHNFIKNSHNVQNIAYII"
     gene            complement(<185111..>186205)
                     /gene="TPHA0E00910"
                     /locus_tag="TPHA_0E00910"
                     /db_xref="GeneID:11531197"
     mRNA            complement(<185111..>186205)
                     /gene="TPHA0E00910"
                     /locus_tag="TPHA_0E00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685571.1"
                     /db_xref="GeneID:11531197"
     CDS             complement(185111..186205)
                     /gene="TPHA0E00910"
                     /locus_tag="TPHA_0E00910"
                     /inference="similar to DNA sequence:INSDC:YBL061C,YER096W"
                     /note="similar to Saccharomyces cerevisiae SKT5 (YBL061C)
                     and SHC1 (YER096W); ancestral locus Anc_7.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685619.1"
                     /db_xref="GeneID:11531197"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BTF7"
                     /translation="MEIDCLYKPLFTTISRTQSLSTDVRGRNDQDNKTSGSEVNSVHS
                     CSVEFFDVNTFFDECIQKDTGINIGNRDFTDNTGIPAIALTSNCDSATNSNSSGKETS
                     ILSSAPSESTESDISLNITFTLKSPLNEMPSVESIQSLIKFAKNSMDPKTLFQCIQKM
                     LVVVCWINMNPSNYNKNSLNKSLIRTLKRNLKFLIARKYKDAGYILADAYSSGLFGSV
                     DNKKAFILFRNASQLGHIEATFRTAYCYERGLGVEASSWKALKYLEYAAKQKHQIAMF
                     KLGMAYYYEKLGAPKNDVTKLSGVTWLTRAVDCSDNVICDAPYELGKIYATGYKDLIL
                     KDTLYSELLFRKAEMLGYSSSKGSAADFIG"
     gene            complement(<186837..>187967)
                     /gene="TPHA0E00920"
                     /locus_tag="TPHA_0E00920"
                     /db_xref="GeneID:11531206"
     mRNA            complement(<186837..>187967)
                     /gene="TPHA0E00920"
                     /locus_tag="TPHA_0E00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685572.1"
                     /db_xref="GeneID:11531206"
     CDS             complement(186837..187967)
                     /gene="TPHA0E00920"
                     /locus_tag="TPHA_0E00920"
                     /inference="similar to DNA sequence:INSDC:YER095W"
                     /note="similar to Saccharomyces cerevisiae RAD51
                     (YER095W); ancestral locus Anc_7.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685620.1"
                     /db_xref="GeneID:11531206"
                     /db_xref="GOA:G8BTF8"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTF8"
                     /translation="MTEIEGNAMDVNNLVANDSAQQVGDTSMSDAQQEDQVAENDENH
                     DMANGDGGLVAFVPLEKLQVNGITSTDLKRLRESGLHTAEAVAYAPRKDLLLIKGISE
                     AKADKLLNEAARLVPMGFVTAADFHVRRSEMICLTTGSKNLDTMLGGGVETGSITELF
                     GEFRTGKSQLCHTLAVTCQLPLDIGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDD
                     ALNNVAYARAYNADHQIRLLDAAAQMMSESRFSLIIVDSVMALYRTDFSGRGELSARQ
                     MHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMMFNPDPKKPIGGNIMAHSSTTRL
                     GFKKGKGCQRYCKVVDSPCLPEAECIFAIYEDGIGDPREEDE"
     gene            <188886..>191117
                     /gene="TPHA0E00930"
                     /locus_tag="TPHA_0E00930"
                     /db_xref="GeneID:11531207"
     mRNA            <188886..>191117
                     /gene="TPHA0E00930"
                     /locus_tag="TPHA_0E00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685573.1"
                     /db_xref="GeneID:11531207"
     CDS             188886..191117
                     /gene="TPHA0E00930"
                     /locus_tag="TPHA_0E00930"
                     /inference="similar to DNA sequence:INSDC:YBL060W"
                     /note="similar to Saccharomyces cerevisiae YBL060W;
                     ancestral locus Anc_7.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685621.1"
                     /db_xref="GeneID:11531207"
                     /db_xref="GOA:G8BTF9"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G8BTF9"
                     /translation="MSRFDRGRNLVEVEQRNASLTSIPNSLINSKRLKNRSESFFFTT
                     SRESIPPNRSVTTSAIEPTKTGITDDKDYQIALEIFNFRYKKIDYKEYANFLGTSKNN
                     KILKYYINLLEPFPHSLLALLEKLSERIYFIAEAQNIDRILEEVSIQYINFFTNVDSQ
                     PNVIGLWHFNYKIVHITLFSLLLMNSDLHNEENVKHQQKNKVSQYSVDTFLDNTIYAI
                     KKEYFPDAPNREIDSLNLPNQDELVSELTSYFELNKNKPLSLFSKDGNKGEGGGGKNK
                     NSKKKLEKEYTSISGGNNSLTVKGSSTNNRGTRSRRSSIYSLSHTRSPSLHSVNSAFS
                     SKTTATSNSYGNQTSDFDIANTSADWKFHNNIPLSNLFHPEPFDSEFMHENFTYWFMD
                     GIIMIASNSNHNKKLNRIYNNNSNNSNSNTDEASMRRLTSSSSLNSLATSTDKKNRDK
                     SKFKSPQKLLFKFLRKSKKPTIFDEAITPSAFLNEKSTWSRAKVQISEGRIFIFKLHH
                     MLNISTTNLLKIGDIEEFKKLSSSYVVHNLFNVLAELVQENVVIGQSPNSSNIVEARG
                     NFMISIPNPLGKCKLLVLEFQTDTVEEAQLYVETINFWAARLTPVPSAQFELVSNEEY
                     GWSSLLLSNPQKINKVPSISTWAPLLTSDLLCTEDDSIIDESPLQERIDQLTKFTTEL
                     EQLLDEHNNNKPKIIQIWSNTPSFDKIMDNWNHRYLFLNKQFEKQSIYLKALNKAKEI
                     IPN"
     gene            <191669..>192286
                     /gene="TPHA0E00940"
                     /locus_tag="TPHA_0E00940"
                     /db_xref="GeneID:11531222"
     mRNA            <191669..>192286
                     /gene="TPHA0E00940"
                     /locus_tag="TPHA_0E00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685574.1"
                     /db_xref="GeneID:11531222"
     CDS             191669..192286
                     /gene="TPHA0E00940"
                     /locus_tag="TPHA_0E00940"
                     /inference="similar to DNA sequence:INSDC:YER094C"
                     /note="similar to Saccharomyces cerevisiae PUP3 (YER094C);
                     ancestral locus Anc_7.383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685622.1"
                     /db_xref="GeneID:11531222"
                     /db_xref="GOA:G8BTG0"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BTG0"
                     /translation="MSDPSSINGGIVVAMAGKDCVAIACDLRLGSQSLGVSNNFEKIF
                     NYGHVFFGITGLATDVTTLNEVFRYKTNLYKLKEERPIEPETFTQLVSSTLYEKRFGP
                     YFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEA
                     EDLFETISQALLSAADRDALSGWGAVVYIIKKDKVIKRHLRTRQD"
     gene            <192697..>193205
                     /gene="TPHA0E00950"
                     /locus_tag="TPHA_0E00950"
                     /db_xref="GeneID:11531225"
     mRNA            join(<192697..192841,192925..>193205)
                     /gene="TPHA0E00950"
                     /locus_tag="TPHA_0E00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685575.1"
                     /db_xref="GeneID:11531225"
     CDS             join(192697..192841,192925..193205)
                     /gene="TPHA0E00950"
                     /locus_tag="TPHA_0E00950"
                     /inference="similar to DNA
                     sequence:INSDC:YBL059W,YER093C-A"
                     /note="similar to Saccharomyces cerevisiae YBL059W and
                     YER093C-A; ancestral locus Anc_7.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685623.1"
                     /db_xref="GeneID:11531225"
                     /db_xref="UniProtKB/TrEMBL:G8BTG1"
                     /translation="MTFKTRELSVLSEEYTSRRRTQMLRFLGATTFTLISFRYFKKAL
                     ISRQYRPNMFQLNNRPPPVAAQNEAMAALTIATSITISLFSMAITGSCWIYDISSVQE
                     LRYALRNTLVPSSEEASNDNMDQETSDAIEQLKLAFSKK"
     gene            <193658..>197911
                     /gene="TPHA0E00960"
                     /locus_tag="TPHA_0E00960"
                     /db_xref="GeneID:11531229"
     mRNA            <193658..>197911
                     /gene="TPHA0E00960"
                     /locus_tag="TPHA_0E00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685576.1"
                     /db_xref="GeneID:11531229"
     CDS             193658..197911
                     /gene="TPHA0E00960"
                     /locus_tag="TPHA_0E00960"
                     /inference="similar to DNA sequence:INSDC:YER093C"
                     /note="similar to Saccharomyces cerevisiae TSC11
                     (YER093C); ancestral locus Anc_7.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685624.1"
                     /db_xref="GeneID:11531229"
                     /db_xref="GOA:G8BTG2"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:G8BTG2"
                     /translation="MNNLDSSPRLEVNRSRSDTINTQESIGTSSVSIHSNAKNKNKKN
                     LILSTSFVSSKRSEYNTALPSSPLNSKYNKSTANKTLFTLKNEIIQFQNELIEVKRKK
                     RDAERLKKTTSSNIYSGTYSTNHLEKHSIRIKTNTQIREFDNLIKKLEKQITEAKLKY
                     ENIAKMSGIAFSLHNNSIDNLTASYSEEDADGDISYLSNKLTSEISLGDAFNRQISAD
                     NSSIHSIQTNYDIEKHISNTPLLNYQPLGENTTINKETAIWLISDSMQGLRNIHSPVE
                     DLIKRANDFILLIEMHPEIRNELALPTFMPSIQALLLHEDKLVVAASFKICRYLINGA
                     EFIDELLSLRLAEFIVISLGKENSYQIEREQALKLVRKFNEYKKLPKSIMQAIISSIE
                     KTDDNMRYICLETLLETCFIDPELVNNCRGMRVLEDLLHDFNSIKIVSIILDTILQLM
                     SHHDTRKSFINDFDISVLNIKFSDLNNKPTTNIDNLQNSAYLISRALKNPDGYRLYSV
                     NNFEPLKQLMSFLQVPVCASYLFDIFLDVLRIKSLNFKVKAKYFNTPRTTSHYVYKEC
                     MPINQQVALLITIFHHCDLVKKITNLIDEFENDESKSPLLNKARYFLYEYLNLSMNLI
                     EVDPFIINKYLPTGDKNSLGETFLFEKISYNLNKKRNTIGLEEIDYNRNVKNLSLALR
                     SNALINKVDDLKFRRMVFDSKVLQIKDFSLWNWNIIQELLVGPLMNPKQLEELSKTKF
                     IRKLLVFYRPLRQRFSNVSKKSRLANKYIQVGCQFFKTMIATSEGMKILIDDTKIIPQ
                     LTSLLFRAMEGKTDGNLFKESSLSTKLVFGYFKFIGTLTTNSNGIYLLNKWNFFTIIY
                     KMFQNSSKISTKFLMLTLPEIDIMYSSHCRAILGKALVTSDEHVRKLATKIMGTKLRQ
                     VTDILLSNNDATEASSPMHTKSEDPLIHKYILEKLTRQLYDLNPEVVAIADEALYEYV
                     VKTENSSQELASWLRTSLNQMVFISSPILFELMSNSYGFQILNEINYIEEERLSWISQ
                     KDKDYVYIVEEFLSNYESLAKPDYKENEISIPADKVDSNIKKRLPLHFYGSLAKTDDG
                     INMITSCRDLVIFMDVIKKYIADLKAGKASEKGDDILELKAKMWSCGFIGSTPLGIGL
                     ADNYSLTEDFITIAYDSTVTSLRTTAFYVLGLLSKTKEGCEILDELGWTCCLTVFSEP
                     VGIALPKAVDKFLSYKEMEWKLKQEYSDGMITFDSDSGNLIENGKVEEIALNLDKMLA
                     DIDNMENVITEPIKNYYNYNSTSIETTPEKDNKKSYSNCITLNFSPTKNDFTNVDDEL
                     KKLINEAVTSVCELSNHIIANKAIKNLTEMKQKYANIKLFENEVLFSKVFDIMNHYRF
                     KPNVRKFLMGLFINKKSMRNLIRSDRQKIRRLRTNSLTN"
     gene            complement(<198028..>198624)
                     /gene="TPHA0E00970"
                     /locus_tag="TPHA_0E00970"
                     /db_xref="GeneID:11531234"
     mRNA            complement(<198028..>198624)
                     /gene="TPHA0E00970"
                     /locus_tag="TPHA_0E00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685577.1"
                     /db_xref="GeneID:11531234"
     CDS             complement(198028..198624)
                     /gene="TPHA0E00970"
                     /locus_tag="TPHA_0E00970"
                     /inference="similar to DNA sequence:INSDC:YER092W"
                     /note="similar to Saccharomyces cerevisiae IES5 (YER092W);
                     ancestral locus Anc_7.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685625.1"
                     /db_xref="GeneID:11531234"
                     /db_xref="GOA:G8BTG3"
                     /db_xref="InterPro:IPR020366"
                     /db_xref="UniProtKB/TrEMBL:G8BTG3"
                     /translation="MNSEKQYQKLVSRHDELIKQDLTLRKEYTTLLRKCQSLFYYLNN
                     DKLYNTRIIDKVNRSIGFTMPSSRYRKNRSQQKKTSDKLSKDENDENDSMAITKDEIS
                     SKVSELNPLEYLNAITNKGVVDRNKMITNKILKRKITDGSIKKLPDLKWYNDQLELVF
                     EQLDDNTEEFELPEEIQNSYELYKTTPLLYNDIKDDIK"
     gene            <199864..>202170
                     /gene="TPHA0E00980"
                     /locus_tag="TPHA_0E00980"
                     /db_xref="GeneID:11531250"
     mRNA            <199864..>202170
                     /gene="TPHA0E00980"
                     /locus_tag="TPHA_0E00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685578.1"
                     /db_xref="GeneID:11531250"
     CDS             199864..202170
                     /gene="TPHA0E00980"
                     /locus_tag="TPHA_0E00980"
                     /inference="similar to DNA sequence:INSDC:YER091C"
                     /note="similar to Saccharomyces cerevisiae MET6 (YER091C);
                     ancestral locus Anc_7.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685626.1"
                     /db_xref="GeneID:11531250"
                     /db_xref="GOA:G8BTG4"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:G8BTG4"
                     /translation="MVKSAVLGFPRIGPNRELKKVTEAYWKGNATHDDLIATSKEIKK
                     NNWLLQQQQGIDIIPSNDFSFYDQVLDLSYLFNVIPKRYSEYDLAPIDTVFAMGRGLQ
                     QNDDQGNKVVDVTALEMVKWFDSNYHYVRPTFSKNTNLKLNGSKPVDDYLEAKALGIQ
                     TRPVLLGPVSFLYLGKADKDSLDLDPLSLLSEILPLYNEIFNQLYKAGATEIQVDEPI
                     LVLDLTEKERNAIVEAYNYFHKNSQVNITLATYFGTVVPNLSALKDLPVAGFHFDFVR
                     APDQLDDVLSIISDKQTLSVGVVDGRNIWKNDLAKSTAIVEKAVSKLGSDRVIVATSS
                     SLLHTPVDLANETKLSDEVRDFFSFATQKVNEVSLIANKLNGKNVTKEFEANAASIKA
                     RKSSSITNDAKVQERVKSINEKLAQRTSPFVEREKIQKDVFKLPLFPTTTIGSFPQTK
                     DIRINRNKFVKGTLSSEEYEKFIQSEIEKVIRFQEEIDLDVLVHGEPERNDMVQYFGE
                     QLKGYAFTTNGWVQSYGSRYVRPPIIVGDLSRPKAMSVKESVYAQSITKKHVKGMLTG
                     PITCLRWSFPRDDVDQQTQALQLGLALRDEVLDLEAAGIKIIQVDEPALREGLPLRAG
                     PERSAYMDWAALAFRVATAGVQDKTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKDD
                     PNYIAEFKDYPNHIGLGLYDIHSPRVASKDEFTTKVETILDTYPAKRFWVNPDCGLKT
                     RDWYETKLSLANMVEAAKAFRTKYADQA"
     gene            <202855..>203961
                     /gene="TPHA0E00990"
                     /locus_tag="TPHA_0E00990"
                     /db_xref="GeneID:11531297"
     mRNA            <202855..>203961
                     /gene="TPHA0E00990"
                     /locus_tag="TPHA_0E00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685579.1"
                     /db_xref="GeneID:11531297"
     CDS             202855..203961
                     /gene="TPHA0E00990"
                     /locus_tag="TPHA_0E00990"
                     /inference="similar to DNA sequence:INSDC:YBL058W"
                     /note="similar to Saccharomyces cerevisiae SHP1 (YBL058W);
                     ancestral locus Anc_7.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685627.1"
                     /db_xref="GeneID:11531297"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BTG5"
                     /translation="MSSENVNQFIALTSASQPVAEQYLELYSDDIGDALNAYYADQAE
                     RKSSSSQPSSQNSQQKSSKKAASSGNNKFMSFSQMMKDSDQDDSDENRHTFAGGEKSG
                     LEVTDPNDSNSLIKDLLEKAKRGGQELPEGANNDESEKKNKFTGRGYRLGATVGSASE
                     VYEDNSPAGKAPTRVTRDITFWKEGFQVGDGELFRYDDPANSFYLNELNQGRAPLKLL
                     NVEFGQEVDVNVYKKLDESYKAPKRKLGGFGGKGQRLGSPIPGDAQEASEPTTSHIEE
                     SNKATEEAEKKDSNKTQGDSLVQIRYATGKREIYHCNATDTVQSIYDHVKSNTNDTRP
                     FALNTSFPVTPIENFEATLKDADLINSVVVQRWI"
     gene            complement(<204170..>205708)
                     /gene="TPHA0E01000"
                     /locus_tag="TPHA_0E01000"
                     /db_xref="GeneID:11531298"
     mRNA            complement(<204170..>205708)
                     /gene="TPHA0E01000"
                     /locus_tag="TPHA_0E01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685580.1"
                     /db_xref="GeneID:11531298"
     CDS             complement(204170..205708)
                     /gene="TPHA0E01000"
                     /locus_tag="TPHA_0E01000"
                     /inference="similar to DNA sequence:INSDC:YER090W"
                     /note="similar to Saccharomyces cerevisiae TRP2 (YER090W);
                     ancestral locus Anc_7.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685628.1"
                     /db_xref="GeneID:11531298"
                     /db_xref="GOA:G8BTG6"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:G8BTG6"
                     /translation="MSNQHTPVKVQPELEALKVLEQQNIGDGKNANMYPVYAFLPSLD
                     LTPHVAYLKLAKLNEINRKESFLLESAKTSSELDRYSFIGIAPRKIIKTGPTESIEVD
                     PLNILEQEVSHHVLAENIPGLPPLSGGAVGYISYDCVRYFEPKTARPLKDVLKVPEAY
                     LMLCDTIIAFDHVFQRFQIIHNINISQTTLSEGYSLATNVIENIINILRDDSSPIPYP
                     KQGPIKLNQDFESNVGKEGYENHVTLLKKHIKMGDIIQAVPSQRVARPTSLHPFNIYR
                     HLRTVNPSPYLFYIDCLDFQIIGASPELLCKSDNKNKVITHPIAGTVKRGKTSEEDDI
                     LADQLLGSLKDRAEHVMLVDLARNDINRICDPKTTSVDKLLTVQRFSHVQHLVSQVSG
                     TLRPDKTRFDAFRSIFPAGTVSGAPKVKAMELVAELEGERRGIYAGAVGNWSYDGKTM
                     DTCIALRTMVYKNNVAYLQAGGGIVFDSDEYDEYVETMNKMMANHNTIVQAEEIWAEK
                     VGSL"
     gene            <206253..>207785
                     /gene="TPHA0E01010"
                     /locus_tag="TPHA_0E01010"
                     /db_xref="GeneID:11531214"
     mRNA            <206253..>207785
                     /gene="TPHA0E01010"
                     /locus_tag="TPHA_0E01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685581.1"
                     /db_xref="GeneID:11531214"
     CDS             206253..207785
                     /gene="TPHA0E01010"
                     /locus_tag="TPHA_0E01010"
                     /inference="similar to DNA sequence:INSDC:YBL056W,YER089C"
                     /note="similar to Saccharomyces cerevisiae PTC3 (YBL056W)
                     and PTC2 (YER089C); ancestral locus Anc_7.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685629.1"
                     /db_xref="GeneID:11531214"
                     /db_xref="GOA:G8BTG7"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G8BTG7"
                     /translation="MDMGQILSNPYIEKEHHSGSDDFTSFGFCSMQGWRVSMEDAHAF
                     ELNVNSAASDTDDAVDHVAFYSIFDGHGGFKVAEFCGQNSVNILRNLNNFKNGNYLKA
                     VSDFALEVDDQLIEADINIHNDHSGSTFTGVIISKSKNLILCANSGDSRTGMAINGCA
                     KALSFDHKPSLVSETSRITNASAFVEIDRVNGNLALSRSMGDFEFKAQPELSPYEQAV
                     TCIPDVIQHTINYAFDDFIMLACDGIWDCLSLQDCTDLVYYGIYQETLSLNDIAAKII
                     DVCCAPNTEGSGIGCDNMSIVIVALLQDAETEEHWFTRIRNKKDISHSERELMSFEDR
                     RKKVFGYFNFDESKGHSVFEVTTMKQSKEDRNDSHNDSDLRYPISSEHVDTTSGNIAV
                     FSTENPAAADIHNRTGNINAESNKHPFNLYTLNNILGSSGIQITRGAENGNDNSAFIH
                     SSNLPRILASLGNTSSSELTNLIDNIETDEDIYMDDDDQNEDDQNRSTPEVRNEPDSA
                     FR"
     gene            complement(<208049..>210583)
                     /gene="TPHA0E01020"
                     /locus_tag="TPHA_0E01020"
                     /db_xref="GeneID:11531523"
     mRNA            complement(<208049..>210583)
                     /gene="TPHA0E01020"
                     /locus_tag="TPHA_0E01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685582.1"
                     /db_xref="GeneID:11531523"
     CDS             complement(208049..210583)
                     /gene="TPHA0E01020"
                     /locus_tag="TPHA_0E01020"
                     /inference="similar to DNA sequence:INSDC:YBL052C"
                     /note="similar to Saccharomyces cerevisiae SAS3 (YBL052C);
                     ancestral locus Anc_7.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685630.1"
                     /db_xref="GeneID:11531523"
                     /db_xref="GOA:G8BTG8"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BTG8"
                     /translation="MMVDSKVNDDTRKRKRASAILRSLIIDDNVHSEISKIARENPNK
                     LMKSKRNTTVNVNYVPRKFHNVIVQGDDVGSRNPSRRNSRRKTSSLTRRKQHRRRLDS
                     LSSATQRSRIKGNTTTSIKQSPVNEFTLPYVVEQMWELPGTVEELNSLNNKLHYITDV
                     KNPNLIDNNDYTITGVKIKFNPLNFLNFSNIVNRSKVEAQLNSKLHNDAVNTDFDVYQ
                     AESLISAIDNANELPYRGVIANSKDFLTSRTAPTISDRIQFKEILDQSLSASYCNANI
                     LMCNHSKAEDIDENKRNKRKKISTTQNQNMLSNTLSSAIEYIYLSGYEIKTWYSAPYP
                     EEYNKNKLLYICQHCLKYMNSRFIYFRHITKCRQAHPPGNEVYRDGKLSIWEVDGREN
                     IVYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTELDESDENNPKWNFVGYFSQEKLNS
                     TDYNLSCILTLPIYQRKGYGQLLMEFSYLLSKVAYKWGTPEKPLSNLGLLSYRNLWKI
                     KCAKVLLMLKKRFKDFCRPIGITLEDISDFTGMIPTDVVIGLEQLQVLYMNKHVVVTN
                     SAETIKTNKDKNTLVNYRIQIDSWTRIEKICNQWKEKNYPEIRPEKLIWKPMLFGPSG
                     GINAVGSLIETPPKPNDGDIITNSQTEDHFNKSIKLLSNFMNDDISDPRSMEQIAWDR
                     IKDRSESDIELSNSQQGKWVPSFIEPIIPNNTKLLKKNSFQIQKNNSEASDNGTVDLE
                     VLDNEEIIDEEEVYIEDEVEGNDEDEVEYQVEDEDDEDDGDQDEDDDGYEELKPISKQ
                     RRKRYVSPTANVTLRRSSRKLRQDLSSSVDENLELPPLRRSTRTRR"
     gene            complement(<211573..>213444)
                     /gene="TPHA0E01030"
                     /locus_tag="TPHA_0E01030"
                     /db_xref="GeneID:11531454"
     mRNA            complement(<211573..>213444)
                     /gene="TPHA0E01030"
                     /locus_tag="TPHA_0E01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685583.1"
                     /db_xref="GeneID:11531454"
     CDS             complement(211573..213444)
                     /gene="TPHA0E01030"
                     /locus_tag="TPHA_0E01030"
                     /inference="similar to DNA sequence:INSDC:YBL051C"
                     /note="similar to Saccharomyces cerevisiae PIN4 (YBL051C);
                     ancestral locus Anc_7.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685631.1"
                     /db_xref="GeneID:11531454"
                     /db_xref="GOA:G8BTG9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BTG9"
                     /translation="MVIDEGTPEFAMSYSDNIVDVSLPDIGPKTSPSNNSSKVLYNDN
                     TLPRDQDDKLANEDDDDDDVIPTAIVIKNIPFAIKKEQLLEFIEKKGLPLPYAFNYHF
                     DNGVFRGLAFANFQSTDETTKVIDVLNGEEIGGRKLRVEYKKMLPQMERDRIEREKRE
                     KRGQLEEQHSLLNSNSHLSLQSLSRTGLNNMNSSTSLYNGNLNSQSSIQLFSTFVGSN
                     NGNASGAGNKNNLLNTNSSTNLLNQQNQSSQYLVNQNTNSSLYGNQVNTTERFYPPLP
                     SSTALPLPPQQLDFNDPDTLEIYSQLLLFKEREKVYYELAYPIGLSANYKRIINVLCS
                     FLGLVTAYDVSFIIVRRKILDPGNLQSHLNMQGQADLIGSVHPLQPSSTGGSLHQSLS
                     YTSLLQAHAATAAASNNAPVASINTPTNNKNSFNSSPAINNYAGIFGSNSSQTLSKTG
                     SQSQLSVAQPQNNNATQTQQSSLQNLELSMQQPFIRQQNPSSSSRIPSGYSSNNNAMK
                     QMNALLRNQTLSPANNQAQSPTSNLQRVPSFYSNNSLGNSSTLLSSQLQDPSQQPFQQ
                     LIAQNTSGSVHSNYSSQSFIDEAAQGNHFSNLNQNNNGTVNDNLEEGLSRSLSGLDL"
     gene            <215117..>215389
                     /gene="TPHA0E01040"
                     /locus_tag="TPHA_0E01040"
                     /db_xref="GeneID:11531203"
     mRNA            <215117..>215389
                     /gene="TPHA0E01040"
                     /locus_tag="TPHA_0E01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685584.1"
                     /db_xref="GeneID:11531203"
     CDS             215117..215389
                     /gene="TPHA0E01040"
                     /locus_tag="TPHA_0E01040"
                     /inference="similar to DNA
                     sequence:INSDC:YER019C-A,YER087C-B"
                     /note="similar to Saccharomyces cerevisiae SBH2
                     (YER019C-A) and SBH1 (YER087C-B); ancestral locus
                     Anc_7.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685632.1"
                     /db_xref="GeneID:11531203"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:G8BTH0"
                     /translation="MVATPPPPGGQRILRRRRQVQSSKEKKAKQTPTSARSAGFGGSS
                     GSILKVFTEEANAFRIDSLIVLFLAFGFVLSVFGLHIVNKMSGRLY"
     gene            complement(<215811..>217592)
                     /gene="TPHA0E01050"
                     /locus_tag="TPHA_0E01050"
                     /db_xref="GeneID:11531204"
     mRNA            complement(<215811..>217592)
                     /gene="TPHA0E01050"
                     /locus_tag="TPHA_0E01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685585.1"
                     /db_xref="GeneID:11531204"
     CDS             complement(215811..217592)
                     /gene="TPHA0E01050"
                     /locus_tag="TPHA_0E01050"
                     /inference="similar to DNA sequence:INSDC:YER087W"
                     /note="similar to Saccharomyces cerevisiae YER087W;
                     ancestral locus Anc_7.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685633.1"
                     /db_xref="GeneID:11531204"
                     /db_xref="GOA:G8BTH1"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8BTH1"
                     /translation="MLYGMRSSNVKLWYQLVVNQRSVRNTHIFHSKKKLDKHDVETLP
                     SSELLQELGFVKQVRSGILQWLPLGLKSLRKIENIVHTHMRDIGAVEVSLSSLSPKDV
                     WMKTNRWSNTELFKLRDSRGADYCLSPTCEEDITTLMNNYITSYKDMPITVYQMTRKY
                     RDEKRPRGGSLRSREFLMKDAYSFSSNKTEALKIFEEMNTAYSNIFKEIKIPYTSAWA
                     ESGDIGGDLSKEYHYKHNKGEDLLLTCDQCHESFNIERCESFPTNDNKAVKDVSVKYS
                     LSKDNSTLIAFYYPKSRNLNIYLASKAVEKDIDMTLTKNLNNDEILKKFHEHKPEPMF
                     ARVIRVMDCRLDHTSDFPDFPLKHYSKQNFAHIDNISIVDAMENEECGACEEGILKSA
                     RSIEVGHTFHLGTKYTKALGATFSDANNKNTNFIEMGCYGIGISRLFGAIAEISKDNK
                     GFRWPASISPYKVSFCTPVASKGENIINQKIDILKKELENSAQFNNEVLNSFNEKISL
                     GQKIQLSQLIGIPLIVIAGPNNWPNVEIEVRGRRWSGEESWKQKYAQYKDEYGWSFLV
                     DSNGDIEKHVVDIKNLENVLEFLIKDL"
     gene            <218359..>219696
                     /gene="TPHA0E01060"
                     /locus_tag="TPHA_0E01060"
                     /db_xref="GeneID:11531189"
     mRNA            <218359..>219696
                     /gene="TPHA0E01060"
                     /locus_tag="TPHA_0E01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685586.1"
                     /db_xref="GeneID:11531189"
     CDS             218359..219696
                     /gene="TPHA0E01060"
                     /locus_tag="TPHA_0E01060"
                     /inference="similar to DNA sequence:INSDC:YLR190W"
                     /note="similar to Saccharomyces cerevisiae MMR1 (YLR190W);
                     ancestral locus Anc_7.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685634.1"
                     /db_xref="GeneID:11531189"
                     /db_xref="UniProtKB/TrEMBL:G8BTH2"
                     /translation="MANGYSTNKIGLNGGQPSNNVQSVRKKSNSNINSLKTDHETTRE
                     SKACVEFKTSLSKLSHLTRERNLRQSQLECNMQTFKTSGVDFLKDLFKVKHRTINFNN
                     KFTHVNNKNNNFNNNMKMNNKSKNNTNSATSLISPILTEVLHQKKINNTPISFFDSLW
                     NITDDNINNTEFKSNIFSKKDDTQKLPIYNSAFEGPKQGFSFSPTSPTTTLIHSELDD
                     FYEHDNITFIDKLKLSNQEEEKYSRTTVQKNYETQALLNRIQSLENEIEYIRVEGNGL
                     LDMTHQLEDNIYDTLYQRDNDSSNLYLDNDYRHVDHRQLGRKINELSWKLSVYKDRIT
                     KYANDFNESDKCNLMNDIMNISKHSHQKLEKITNDELKLIEESLSSDSDREVNSYSNS
                     ISMNEVTYNYNTDKLFEFHTKRLTCDANTRFDLHNTQKTGFNIKLKIKKQYSN"
     gene            <220093..>221211
                     /gene="TPHA0E01070"
                     /locus_tag="TPHA_0E01070"
                     /db_xref="GeneID:11531138"
     mRNA            <220093..>221211
                     /gene="TPHA0E01070"
                     /locus_tag="TPHA_0E01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685587.1"
                     /db_xref="GeneID:11531138"
     CDS             220093..221211
                     /gene="TPHA0E01070"
                     /locus_tag="TPHA_0E01070"
                     /inference="similar to DNA sequence:INSDC:YLR191W"
                     /note="similar to Saccharomyces cerevisiae PEX13
                     (YLR191W); ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685635.1"
                     /db_xref="GeneID:11531138"
                     /db_xref="GOA:G8BTH3"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="UniProtKB/TrEMBL:G8BTH3"
                     /translation="MTSVTGESLRRKPWEEGVSGDNVIQHLPENRKDNGYTEYDNTDV
                     GPIIANNSTGPLNPGFVIGSMNSMNPPYNNNVGLSNYNSPFSNNNGYFTNDGYGMDYR
                     SLNGSRYGGMYSHSYSYPYNNTSQQNNITESTQATFRLLENIVGTFTSFAQMLESTYM
                     ATHNSFFSLISVAEQFGMLKETFASAFDIFKIRKLLRKIRSVLLNGKLEHGTITATCI
                     TSDEDNNFELPSKQYELDDISNENNDEKIKYQEYKKDILTSSIPLRPFMYTIVALIAI
                     PILIKRHINLKQLNYIKSLKDSDFKKINGFAILKYDYIPEDLRLGYTLKKNDIVSIVE
                     GYLSDNGISNWLKIKNKEGKVGLIPNKYVDLLKSSNMV"
     gene            <221722..>222876
                     /gene="TPHA0E01080"
                     /locus_tag="TPHA_0E01080"
                     /db_xref="GeneID:11531486"
     mRNA            <221722..>222876
                     /gene="TPHA0E01080"
                     /locus_tag="TPHA_0E01080"
                     /product="carboxylesterase-mitochondrial 37S ribosomal
                     protein YmS2"
                     /transcript_id="XM_003685588.1"
                     /db_xref="GeneID:11531486"
     CDS             221722..222876
                     /gene="TPHA0E01080"
                     /locus_tag="TPHA_0E01080"
                     /inference="similar to DNA sequence:INSDC:YHR075C"
                     /note="similar to Saccharomyces cerevisiae PPE1 (YHR075C);
                     ancestral locus Anc_5.358"
                     /codon_start=1
                     /product="carboxylesterase-mitochondrial 37S ribosomal
                     protein YmS2"
                     /protein_id="XP_003685636.1"
                     /db_xref="GeneID:11531486"
                     /db_xref="GOA:G8BTH4"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BTH4"
                     /translation="MSDDVRRKLLLKYLGNIDDLNDDNQDENDTPNNISPLKSFTKLN
                     ATDENFALEDKSLPNFFPEDLPSWKEYFDFNNIFVNKKRNIKINFYYKLPLKMDSLSI
                     PIFILHHGAGSSALTFATLARDIFIKLEGRCAIMAFDARGHGKTEPLAPKTQLEYNLN
                     DFTDDFTSLIEAFNRNYLQDITEEKKSFILVGHSLGGSICTFAYSKLIPNIQKQIVGI
                     TMLDIVEEAAIFALDNVQDFLHRTPSMFNSFDEAIRWSVKNNMPQSKESAEISVPALF
                     RMTKNGKVARLSNLQDFKKFWNTWFVNLSHEFVSLPTCKLLILAGNDNLDKQLIVGQM
                     QGKYQLVVFQDSGHFIQEDASVKTAITLIEFWKRNDNKTVVIKSNWGVKS"
     gene            complement(<223170..>226172)
                     /gene="TPHA0E01090"
                     /locus_tag="TPHA_0E01090"
                     /db_xref="GeneID:11531192"
     mRNA            complement(<223170..>226172)
                     /gene="TPHA0E01090"
                     /locus_tag="TPHA_0E01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685589.1"
                     /db_xref="GeneID:11531192"
     CDS             complement(223170..226172)
                     /gene="TPHA0E01090"
                     /locus_tag="TPHA_0E01090"
                     /inference="similar to DNA sequence:INSDC:YHR073W"
                     /note="similar to Saccharomyces cerevisiae OSH3 (YHR073W);
                     ancestral locus Anc_5.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685637.1"
                     /db_xref="GeneID:11531192"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BTH5"
                     /translation="MESIDIQNRSFVVRWLKCSVNDVINYQIKPLKKSIDVSIYKKVT
                     NNNEDNEQGNIYNEHISGNMSNPNIHIINDIKDAYNKPITPTTNSSQVKKDDSIHKPS
                     DNNNISSRDHSGSTVSAFSNNDSNSSLNELNQSNASRPRRSLSLNNITHQSKTLSLSE
                     KLTKEGYTLVKNIGHVQGNFLVQDSIKVVTKSTNKDFYFIFVFNNTLSKNIKKKILFN
                     MSLQSVKKEKFVPISSPVIPIDSRTSLTGKQTLNQAGSTLNSEIAITVGQGRYLQGYL
                     LKKRRKRLQGFKKRFFSLDFKYGTLSYYMNDHNQSFRGEILVNLSTVSANKKDKLIII
                     DSGMEIWALKATSLTSWEAWVTAFQSCFENEKKQTDITMRDASKRDSRTEKVSDLHDY
                     ERCEFNTRLRNQNIKHERALNQASIVRDNLLWKQVTEIKDRLGKCKNDSKLYVKIKDN
                     DPKISNKDKTNNLFQDIQKIESLVNKLVEDIRDHDLNFNETIQRRSSIETNKSSVSLD
                     KLSAISAFSDDVFFDAEDIGNRVIMLPDEQIEMDHEIPIKSTDLTKHNSKYGDDEDED
                     DEEDEDEDTDVNKYNQDSLSDEDSIREHSELFSFNAVGSSQKKDSINSEDNLYPLPLK
                     KKINRRNDISISSTSPPSLLSFLRKNVGKDLSSVAMPISANEPHSILQTLAESFEYAD
                     ILSNISTTDSTFQPLSIVSAFAVSALSIYRDKTRVLRKPFNPLLGETFEYISDTKQFR
                     LISEKVSHKPQIFVFHVEHKDWECNYTVSPVQTFWGKSVELNNEGIVKLELKNSGEVL
                     EWAQPTAMLKNLLAGEKYIEPINEFKILSSKGGYAKVLFRGSSMFGGRSEELTATIVP
                     SSKDPNYSKETITGKWTESLVDKRSNEFLWKVEELLSDSKKKYGFTKFAANLNEITTI
                     EEGFLPPTDSRLRPDMRAYENGELDKAETLKLELEKIQRDRRTDRNDVKPKFFKKISE
                     KEWAFIQGEDSYWERRKRGDWSGIDALW"
     gene            <227519..>227752
                     /gene="TPHA0E01100"
                     /locus_tag="TPHA_0E01100"
                     /db_xref="GeneID:11531534"
     mRNA            <227519..>227752
                     /gene="TPHA0E01100"
                     /locus_tag="TPHA_0E01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685590.1"
                     /db_xref="GeneID:11531534"
     CDS             227519..227752
                     /gene="TPHA0E01100"
                     /locus_tag="TPHA_0E01100"
                     /inference="similar to DNA sequence:INSDC:YDR320C-A"
                     /note="similar to Saccharomyces cerevisiae DAD4
                     (YDR320C-A); ancestral locus Anc_5.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685638.1"
                     /db_xref="GeneID:11531534"
                     /db_xref="GOA:G8BTH6"
                     /db_xref="InterPro:IPR013959"
                     /db_xref="UniProtKB/TrEMBL:G8BTH6"
                     /translation="MAGEEMNNPYEQEQINILDRIIKNIERLNQKCHYFEYNFNRYKS
                     KNKNLEIMGKLSENYNNNLQFNLEASGKRNGPL"
     gene            <228116..>230197
                     /gene="TPHA0E01110"
                     /locus_tag="TPHA_0E01110"
                     /db_xref="GeneID:11531535"
     mRNA            <228116..>230197
                     /gene="TPHA0E01110"
                     /locus_tag="TPHA_0E01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685591.1"
                     /db_xref="GeneID:11531535"
     CDS             228116..230197
                     /gene="TPHA0E01110"
                     /locus_tag="TPHA_0E01110"
                     /inference="similar to DNA sequence:INSDC:YDR320C"
                     /note="similar to Saccharomyces cerevisiae SWA2 (YDR320C);
                     ancestral locus Anc_5.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685639.1"
                     /db_xref="GeneID:11531535"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015228"
                     /db_xref="UniProtKB/TrEMBL:G8BTH7"
                     /translation="MADPFADLLTSFKTGPNERENSGTAQSNTTSRNLSMNELLNSSS
                     NVKNSNLDVLQPKAKNVDMLNKSTSVPSNVINNNKNLLDDFDDLFGPSKPSVTTNTFK
                     GTDQGERDDLDDIMDMFDFTPSPSHCNQEVMPSKTNAEAQSSSKNEVIVDEVKDMEIA
                     KLMSLGLSIDEAIKSFEHGILYDTVASRQQAAQRFSSSSNRRGTPIANSGTNNSSGGG
                     LFSSIIGKSKQLIDDWTVNHDEDDRLFRNTDFSSSTHRGYSNSENSTSNSRNSTSNSR
                     NSTSYSRNSMSNSLSNSISISDSIEHGITHKQKSPADLTSNELEGDLLDSFEENIVIG
                     ESFTNIPPRITERQKPNDERIQDNTLLDFGNEDLSSPANVSISSSGQECIPVISINQI
                     ELSGYNEFKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGD
                     YTSMITISTSALDLFPKESKLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQ
                     AYDSYQLLIENNIFNEKIMAGKLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVN
                     TQSTSSGNLKKIQEQNKRTEKYEEEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRI
                     ITWTQWNEVASSDLVMPKKVKITYLKAVAKTHPDKLPSNLDTESRMLAENIFSILSKN
                     WEKFKVDNNIS"
     gene            complement(<230336..>232537)
                     /gene="TPHA0E01120"
                     /locus_tag="TPHA_0E01120"
                     /db_xref="GeneID:11531344"
     mRNA            complement(<230336..>232537)
                     /gene="TPHA0E01120"
                     /locus_tag="TPHA_0E01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685592.1"
                     /db_xref="GeneID:11531344"
     CDS             complement(230336..232537)
                     /gene="TPHA0E01120"
                     /locus_tag="TPHA_0E01120"
                     /inference="similar to DNA sequence:INSDC:YHR072W"
                     /note="similar to Saccharomyces cerevisiae ERG7 (YHR072W);
                     ancestral locus Anc_5.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685640.1"
                     /db_xref="GeneID:11531344"
                     /db_xref="GOA:G8BTH8"
                     /db_xref="InterPro:IPR002365"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR018333"
                     /db_xref="UniProtKB/TrEMBL:G8BTH8"
                     /translation="MAIEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLND
                     EQSTYTKWLLQVPDFPAPNPAINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYK
                     GPMFMAIGYIAVNYIAGIEIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTAL
                     NYVNLRLLGLSKDHPVCVKARDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPE
                     TWLLPYSLPIHPGRWWVHTRGVYIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESID
                     FSKHRNTVCGVDLYYPHSKLLDVANDCLVFYENYLRPEWVYEKSRKSVYELIKKEIEN
                     TDYLCIAPVNQAFCALVTLIEEGKNSKQFERFQYRMKDALFHGPQGMTVMGTNGTQVW
                     DCAFFIQYYFVAGLAEKPEFYDAISAAYKFLCRSQFDTECEPGSFRDKRVGAWGFSTK
                     TQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFSDERLYKGIDILMSLQNLGSFEYGS
                     FATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTDSSVLGLTYFHKHYDYKKEEISK
                     RIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEALETVGENYKNSEVVRKGCDFL
                     VKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIALLLAKYPHKDVIDRGIQLL
                     KSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLYVKNYGNDSI"
     gene            <232942..>233775
                     /gene="TPHA0E01130"
                     /locus_tag="TPHA_0E01130"
                     /db_xref="GeneID:11531153"
     mRNA            <232942..>233775
                     /gene="TPHA0E01130"
                     /locus_tag="TPHA_0E01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685593.1"
                     /db_xref="GeneID:11531153"
     CDS             232942..233775
                     /gene="TPHA0E01130"
                     /locus_tag="TPHA_0E01130"
                     /inference="similar to DNA sequence:INSDC:YDR319C"
                     /note="similar to Saccharomyces cerevisiae YDR319C;
                     ancestral locus Anc_5.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685641.1"
                     /db_xref="GeneID:11531153"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:G8BTH9"
                     /translation="MQHAIEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILGTETL
                     EYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVP
                     VGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFAIDTLFVLSGGSCDDGSGTT
                     FSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESESFEVELNVVFTV
                     MIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPSNEFLNGLLY
                     K"
     gene            complement(<233837..>234472)
                     /gene="TPHA0E01140"
                     /locus_tag="TPHA_0E01140"
                     /db_xref="GeneID:11531365"
     mRNA            complement(<233837..>234472)
                     /gene="TPHA0E01140"
                     /locus_tag="TPHA_0E01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685594.1"
                     /db_xref="GeneID:11531365"
     CDS             complement(233837..234472)
                     /gene="TPHA0E01140"
                     /locus_tag="TPHA_0E01140"
                     /inference="similar to DNA sequence:INSDC:YHR071W"
                     /note="similar to Saccharomyces cerevisiae PCL5 (YHR071W);
                     ancestral locus Anc_5.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685642.1"
                     /db_xref="GeneID:11531365"
                     /db_xref="GOA:G8BTI0"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8BTI0"
                     /translation="MEKVANCTPFYSYGTPAYSDIDDTHAGTEDSLENTLLDLTLENV
                     LYINGVVDTVFAVNAKFNGKHAVSKKKLKLFLKEIVRRTNSKNINVTTINHAIHYLKA
                     FYSQLEEHDCARAAMDRPLFTFCIKRMFIMCLVLANKFLVDENYVLSTWSLITASSLK
                     DLKIMETYVLKTLDYNLFYSASTQPMQSKRSLDSSVSIDFHSMLNTKKIHS"
     gene            complement(<235157..>236413)
                     /gene="TPHA0E01150"
                     /locus_tag="TPHA_0E01150"
                     /db_xref="GeneID:11531515"
     mRNA            complement(<235157..>236413)
                     /gene="TPHA0E01150"
                     /locus_tag="TPHA_0E01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685595.1"
                     /db_xref="GeneID:11531515"
     CDS             complement(235157..236413)
                     /gene="TPHA0E01150"
                     /locus_tag="TPHA_0E01150"
                     /inference="similar to DNA sequence:INSDC:YDR316W"
                     /note="similar to Saccharomyces cerevisiae OMS1 (YDR316W);
                     ancestral locus Anc_5.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685643.1"
                     /db_xref="GeneID:11531515"
                     /db_xref="GOA:G8BTI1"
                     /db_xref="InterPro:IPR027034"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BTI1"
                     /translation="MLRNVPLCMRACSRRTILKTSIVQFAIEPLAVKRGYHSKEYLER
                     QKLLEEMQSPYRIIRWGAIARSREFKKGLTKYLIGLYAIFLAFGVNRMNKLYSKEQEI
                     EALKEKKSNGDLNDFETVKLKSLTEPTKMRTRDITKLQKYHDLIEQNTGREFNGNEFA
                     SDKFDEIAHNPHIQPARDTTAFYDDKAEDYDADVNFEEKMIFMGRRRKWLMRHCRGDV
                     LEVSCGTGRNIKYLNAEKINSITYIDGSQKMIEIARNKFHEYFPNFKKVAFVCGRAED
                     LNALNKDKGREMLYDTIVETFGLCSHTDPVEALNNFSKLLKPGGRIVLLEHGRGSYDF
                     INKILDTKAERRLHTWGCRWNLDIGELLDDSDLDIVLEKRVHLGTTWCVVAKKKNDTP
                     HAEEITFVDKYIRSGLKTKVEGMDKK"
     gene            complement(<236648..>237502)
                     /gene="TPHA0E01160"
                     /locus_tag="TPHA_0E01160"
                     /db_xref="GeneID:11531148"
     mRNA            complement(<236648..>237502)
                     /gene="TPHA0E01160"
                     /locus_tag="TPHA_0E01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685596.1"
                     /db_xref="GeneID:11531148"
     CDS             complement(236648..237502)
                     /gene="TPHA0E01160"
                     /locus_tag="TPHA_0E01160"
                     /inference="similar to DNA sequence:INSDC:YHR067W"
                     /note="similar to Saccharomyces cerevisiae HTD2 (YHR067W);
                     ancestral locus Anc_5.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685644.1"
                     /db_xref="GeneID:11531148"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8BTI2"
                     /translation="MSLTKSSWAITDTINPKVLHDFQSIIGSKLSTSHIQSNNKFLMP
                     GSHLLYFNSSYSKLDKDGYFNSQTPSMLLDKPDLTFRRRLWSKGDITFKQQLKFGSVY
                     TCTEKVKHCKRIKDNYYVGIERLIRPYNCSANTESSDNSDYCIKETRWLTYTNLPPVI
                     YKVNRGVDKNLLKRIGEFQFEDIDILRYGQLTLNPHRIHWDKNYSCSVEKYDNIIAQG
                     PLIVQALIDIFNKHFTNLQFQIKSIKYKNVNNLYPDTRALVSLEKAEDDVFNLYLTDE
                     KWLPYMQQ"
     gene            <237748..>239808
                     /gene="TPHA0E01170"
                     /locus_tag="TPHA_0E01170"
                     /db_xref="GeneID:11531149"
     mRNA            <237748..>239808
                     /gene="TPHA0E01170"
                     /locus_tag="TPHA_0E01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685597.1"
                     /db_xref="GeneID:11531149"
     CDS             237748..239808
                     /gene="TPHA0E01170"
                     /locus_tag="TPHA_0E01170"
                     /inference="similar to DNA sequence:INSDC:YDR314C"
                     /note="similar to Saccharomyces cerevisiae RAD34
                     (YDR314C); ancestral locus Anc_5.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685645.1"
                     /db_xref="GeneID:11531149"
                     /db_xref="GOA:G8BTI3"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:G8BTI3"
                     /translation="MKRPYEEVDSIEEENHSAIDNASNLQVEDVLDDYESDNEDDDLE
                     FDEEVNWEDVPLVSKFDEQSGVSKSQILNISISTDKFIGSRPKRAKKQVTKLKKLKYG
                     LNIIEIPFFLRTLKERSKLCLDERLNRRLKRSIPKIIGKKFDCLAKQDSNAQNDRLRT
                     LLLGAVLWFRSNYKINSNGFRQNHYRLDYLIRNSGCSVNKKFNHVLDNEQLYYGSRPL
                     IDNLSENIREMAKNKMCNRDYLVFFFVIILKNLLKDKYSYSLRICFALPTHDFDTNYS
                     NAVSMIDNDLSIVPNRFDSDLLKPVFWIELLFQHRHIYVIDPIVSIEESSMISRYNID
                     EPIGIFSCDKHFLNKDQCFNYVVGIDIETQIISDISPRYLPNLCYRYFNVSDFNPIFK
                     TLSFRSYQYFKKTIKKLNLEHSKFSFNNDLLMRHLTRQNYELPSTYKGFYKSKNFILP
                     SQLKTLQFLKMGSNPIGSFTYTLNSQTISELIYWRSDVTILKSRQNWSILGYSIKRNE
                     EPRKLKKFTLLKSKRESKYHQYSISELYSIDQVSKTPKLPIHYTYINGIKGVNPDPLC
                     YKGQYNNVEIFDLDIVPDGFKLLNLYMRESNINVRNLIKKYNKETVRSDNLKYIDVVT
                     GFDFKKKPGFAMPKVTHIMLNCHDFNILQKLINEQIEASRLMLWSELISRIKINDRID
                     KGSS"
     gene            <240374..>241345
                     /gene="TPHA0E01180"
                     /locus_tag="TPHA_0E01180"
                     /db_xref="GeneID:11531345"
     mRNA            <240374..>241345
                     /gene="TPHA0E01180"
                     /locus_tag="TPHA_0E01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685598.1"
                     /db_xref="GeneID:11531345"
     CDS             240374..241345
                     /gene="TPHA0E01180"
                     /locus_tag="TPHA_0E01180"
                     /inference="similar to DNA sequence:INSDC:YDR313C"
                     /note="similar to Saccharomyces cerevisiae PIB1 (YDR313C);
                     ancestral locus Anc_5.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685646.1"
                     /db_xref="GeneID:11531345"
                     /db_xref="GOA:G8BTI4"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:G8BTI4"
                     /translation="MTSDSDTEINTRFINNFAHWQPDADIQNCLNCNSRFTFVNRKHH
                     CRCCGCIFCADCSNRFVNYQPNIVKVIKRWPNEKELAPYRTCIHCYRSLLSNKLLLTP
                     NGEIFTTSRLQDDELGEDISTLDTGNNNEVENNEVSEQNIESEYSNNAILTTNDPVTN
                     TEVNSSPTVGSNKNISTIREIETNDEDHCPICYYDLMNYENELDRTTHLDECIQNASK
                     SQQHQNLGNNEDGNPLSFRNKYKNRMLVFRVRDNKTKKSSEDEDECPICFETMEPGEK
                     IARLECLCVFHYTCIKSWMKKKIQKTKESQGKIPPNANFCPLHDAIY"
     gene            complement(<241546..>241859)
                     /gene="TPHA0E01185"
                     /locus_tag="TPHA_0E01185"
                     /db_xref="GeneID:11531165"
     mRNA            complement(<241546..>241859)
                     /gene="TPHA0E01185"
                     /locus_tag="TPHA_0E01185"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685599.2"
                     /db_xref="GeneID:11531165"
     CDS             complement(241546..>241859)
                     /gene="TPHA0E01185"
                     /locus_tag="TPHA_0E01185"
                     /inference="similar to DNA sequence:INSDC:YDR312W,YHR066W"
                     /note="similar to Saccharomyces cerevisiae SSF2 (YDR312W)
                     and SSF1 (YHR066W); ancestral locus Anc_5.338"
                     /codon_start=3
                     /product="hypothetical protein"
                     /protein_id="XP_003685647.2"
                     /db_xref="GeneID:11531165"
                     /db_xref="UniProtKB/TrEMBL:G8BTI5"
                     /translation="EYVRKTSAEIKLLEKRHAEKMRLKEQRRSEQEKNIERKKSVKEA
                     KKQRKLARREQRKLDEQNGETNMHQDSESDNGSDSEDDENNYQDVPEDIDSDLFSEVE
                     E"
     gap             241860..242466
                     /estimated_length=607
     gene            complement(<242467..>243405)
                     /gene="TPHA0E01190"
                     /locus_tag="TPHA_0E01190"
                     /db_xref="GeneID:11531194"
     mRNA            complement(<242467..>243405)
                     /gene="TPHA0E01190"
                     /locus_tag="TPHA_0E01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685600.2"
                     /db_xref="GeneID:11531194"
     CDS             complement(<242467..243405)
                     /gene="TPHA0E01190"
                     /locus_tag="TPHA_0E01190"
                     /inference="similar to DNA sequence:INSDC:YDR311W"
                     /note="similar to Saccharomyces cerevisiae TFB1 (YDR311W);
                     ancestral locus Anc_5.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685648.2"
                     /db_xref="GeneID:11531194"
                     /db_xref="GOA:G8BTI6"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013876"
                     /db_xref="InterPro:IPR027079"
                     /db_xref="UniProtKB/TrEMBL:G8BTI6"
                     /translation="MSHSGAAVFKKVSGIITIDEGHSPAILTWRSTDGDKTSVIELDG
                     IDKLQATPASSEKMMLRLIGIVDESKKIKDNDGNEVLPKPVTYMFMFNNRIVMDNIKV
                     TLQHIISRYKDTQAYEEKSRRETGGESVDSTPVVSTPLINTRKLDDSLSRKKLLSNFK
                     LQQSLLRENKTLMKTFQETVMSSGLPADEFWSTRIALLRAFALSTSQKVGPYNVLSSI
                     KPVASSDNKVNVNISREKIMSIFQTFPIVNKAYMDNVPKNFKEPEFWARFFASKLFRK
                     LRGERISPNDRGDVIIDRYLTLDEDYDRQDDISLQHD"
     gene            <243772..>245388
                     /gene="TPHA0E01200"
                     /locus_tag="TPHA_0E01200"
                     /db_xref="GeneID:11531238"
     mRNA            <243772..>245388
                     /gene="TPHA0E01200"
                     /locus_tag="TPHA_0E01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685601.1"
                     /db_xref="GeneID:11531238"
     CDS             243772..245388
                     /gene="TPHA0E01200"
                     /locus_tag="TPHA_0E01200"
                     /inference="similar to DNA sequence:INSDC:YHR064C"
                     /note="similar to Saccharomyces cerevisiae SSZ1 (YHR064C);
                     ancestral locus Anc_5.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685649.1"
                     /db_xref="GeneID:11531238"
                     /db_xref="GOA:G8BTI7"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:G8BTI7"
                     /translation="MSSPIIGISFGNTSSSIAYINPKNDVDVIANPDGERSIPSVLSY
                     VGEDEYHGGQALQQLVRKTLKTLIVNFRDFIGLPFSECDASRCESGAQLWMSSGKAGF
                     VISRGEGKEETISVDEVVSRHLNRLKLAAEDYIGTTISQAVLTVPTNFTDEQKAALKA
                     SAAAVGLNIVQFINEPSSSLLAHVEQYKFEDDVNVVVADFGGVRSDAAVIAIRGGIFT
                     ILATEHDKKLGGENLDAELVEYFAQDFQKKNQANPRKNARSLAKLKANASITKKTLSN
                     ATSATISIDSLADGFDYHFSINRMRYELVTNKVFSKFSAFIESVIAKAGLDLLDINAV
                     LLTGGVAFTPKLSSNLEFLFPESVEILGPQNANATNYPNELSSSGAALQAGLLSAYDA
                     DELAEALQPIVINTPHLPKAIGLAGANGDFLPVFLPETSFPVQKKVVLKAATGDLLVG
                     VYEGESFIEEKTVEPTPVEQDEDDSEEWSDEEPEVVREKHYKLGNKLIELGVKGVSKG
                     VEIIFNIDKDGKLRVVAKDLKSGSTVKGEL"
     gene            <245821..>246702
                     /gene="TPHA0E01210"
                     /locus_tag="TPHA_0E01210"
                     /db_xref="GeneID:11531211"
     mRNA            <245821..>246702
                     /gene="TPHA0E01210"
                     /locus_tag="TPHA_0E01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685602.1"
                     /db_xref="GeneID:11531211"
     CDS             245821..246702
                     /gene="TPHA0E01210"
                     /locus_tag="TPHA_0E01210"
                     /inference="similar to DNA sequence:INSDC:YHR062C"
                     /note="similar to Saccharomyces cerevisiae RPP1 (YHR062C);
                     ancestral locus Anc_5.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685650.1"
                     /db_xref="GeneID:11531211"
                     /db_xref="GOA:G8BTI8"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:G8BTI8"
                     /translation="MLVDLNVKWPQEDFSKPITNKDLATLKETLQTLHVLGYTHIALN
                     FTVSHSNKFSNNVNELNPIKVKERFGDFMKQTGMKIYSRVTLVIDDPSKGQSLSKISQ
                     AYDIIAAMPISEKGVTLATTGLDVDLLTFDFGSRLPVFLKHKSICSCVKRGVKLEIVY
                     GYALRDTQARRQFISNVRSVIRSSRSRGIVISSGAQNSLECRNIIGVTALIKSMGLES
                     DKCTRAMGDLASLVLLNGRLRNKSYKQTVVVGGEITSDVVNDIEKIDDVKLLKIVKRS
                     RDDSRDDEFKNNKKTKI"
     gene            <247730..>248803
                     /gene="TPHA0E01220"
                     /locus_tag="TPHA_0E01220"
                     /db_xref="GeneID:11531212"
     mRNA            <247730..>248803
                     /gene="TPHA0E01220"
                     /locus_tag="TPHA_0E01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685603.1"
                     /db_xref="GeneID:11531212"
     CDS             247730..248803
                     /gene="TPHA0E01220"
                     /locus_tag="TPHA_0E01220"
                     /inference="similar to DNA sequence:INSDC:YDR309C,YHR061C"
                     /note="similar to Saccharomyces cerevisiae GIC2 (YDR309C)
                     and GIC1 (YHR061C); ancestral locus Anc_5.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685651.1"
                     /db_xref="GeneID:11531212"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="UniProtKB/TrEMBL:G8BTI9"
                     /translation="MYEGSAIPSSLLPQMNSIWLDEDQEAEKIYGIQSEQFMLNDEET
                     PYGVTIVNSDKPLLQNKNNIKLPSMTNIKTTNPKKFGHKKKKSKDFLKMFTGKDSSNK
                     TELKTISSPFGFKHISHAGKNIYEQPELVAHEQEITSIERPVSQQLTSPKPGHMKSLS
                     KAFVTESIPLNTSESFSRYLNTQRHSGNSSNFKRISNSTPDSERIMSISTMGTSVLSD
                     AYSTKTTGLTYIEKHYAVKHMATKSDVSEVSLDFLKNYTFPSVLKEEEGGGIANTYNV
                     ELLNPISSEQEDDLKFKFEKSLNISSPTSNRQRSNSDPNLLATPQLESTWFEKTSSPR
                     KSLDDDILMYYLAPSSMDSPLCR"
     gene            complement(<249304..>251319)
                     /gene="TPHA0E01230"
                     /locus_tag="TPHA_0E01230"
                     /db_xref="GeneID:11531239"
     mRNA            complement(<249304..>251319)
                     /gene="TPHA0E01230"
                     /locus_tag="TPHA_0E01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685604.1"
                     /db_xref="GeneID:11531239"
     CDS             complement(249304..251319)
                     /gene="TPHA0E01230"
                     /locus_tag="TPHA_0E01230"
                     /inference="similar to DNA sequence:INSDC:YDR307W"
                     /note="similar to Saccharomyces cerevisiae YDR307W;
                     ancestral locus Anc_5.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685652.1"
                     /db_xref="GeneID:11531239"
                     /db_xref="GOA:G8BTJ0"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ0"
                     /translation="MSSMVEVADTLEKDKISRNINIEGIGPYRPYKKYNYLSLLHFGH
                     LNTFDILISLIIIGYYYYYMLFNNNIETLNTTASEQEFITLLNKYREQIVYLNSSSSF
                     PIYFYSLFPNEVILLRKVTLVLVSLFLGMSYLLLRRVCVSTLIAVLATVAISSVQIFQ
                     THSLIVTELPLNWFLTTVAVYSWRSLKIYTPLTKAWFINILMVSISLGLSISSKHISF
                     ATYTWIIIVSLNELWNLISDINLSGKLILKVASIQTFFFVVAPIIIFAVNIIASIENF
                     KHDDIAVSQYLPIDFQAHLRGGLNFTDKFYYGSIIKMRHVESLAGYLHSDEINYPSGS
                     QEQLVSLSDQENDPNNEWIVEHQFANFDFVNRSVAVANQDLIRLRHRVTGKLLRGSTA
                     KPPVSEEDYTSEISCTGDQDYTGDTDELWKLQVLGMNEKQSISIPSSIIQLFNVGHHC
                     AVIGHEVRLPSWGLDNQEVLCIDPPNQIKTFFQISYVNYRVKNYKDAIVYKGNEKTNV
                     LVNKISLMIDLIKTDLRYNSYIKNIKIGETAHVAFWPFTFTDLGISDQIWLSSIVAII
                     IFIGILTKNVLSWNPWMITTSNIDIMPDFSFSFKIELLMGWLLHFAPFFKAAHDNLHI
                     IQYFHSFYFGVLLFVVLLNDLYRWNRLTLFFSVIYCVSHIYIYFSNY"
     gene            <251935..>253314
                     /gene="TPHA0E01240"
                     /locus_tag="TPHA_0E01240"
                     /db_xref="GeneID:11531209"
     mRNA            <251935..>253314
                     /gene="TPHA0E01240"
                     /locus_tag="TPHA_0E01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685605.1"
                     /db_xref="GeneID:11531209"
     CDS             251935..253314
                     /gene="TPHA0E01240"
                     /locus_tag="TPHA_0E01240"
                     /inference="similar to DNA sequence:INSDC:YDR306C"
                     /note="similar to Saccharomyces cerevisiae YDR306C;
                     ancestral locus Anc_5.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685653.1"
                     /db_xref="GeneID:11531209"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ1"
                     /translation="MANKSRPKKVKAPYRKYVGGQGFVRVVEFSTANGNSYSQGVAYS
                     EQISSTTLEDEFSDNDYDEEGNIIDLSKKKKGKATSYRKSESQKKLANASKEASTLLK
                     NMELLNIEAEPMALPLEIQKMVIDYCDKITINFLLVCKIWYWMCLPYIYETPLLTSKN
                     FNKFVDTLVLKKKRKFGDYVKSLNLSTIMQSGKNSFVSKMLRRCSSNLEIFTAPQTSF
                     GYAPLISLKSCHKLKYLDLGLVSETVKLKDLFSAISSFKELTHLSFPRSSIDCEGFED
                     FQWPSNLKYVKLSGGVTNEFVRGTQWPRTITTLEFSFCPRVDEHAIYTVLAQIGDNLK
                     HLLFHYPMPALNENSLDYVFRYCSNLISIQLMVDYCSKWAFAEYMLTPLIYQRPLKTI
                     YLECSGSLGMASKIHPDDLTIAIMESRLPCLKNISVSSRLGWNMRSEDVEDLVSVLED
                     QDGGLYLNY"
     gene            complement(<253551..>253925)
                     /gene="TPHA0E01250"
                     /locus_tag="TPHA_0E01250"
                     /db_xref="GeneID:11531156"
     mRNA            complement(<253551..>253925)
                     /gene="TPHA0E01250"
                     /locus_tag="TPHA_0E01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685606.1"
                     /db_xref="GeneID:11531156"
     CDS             complement(253551..253925)
                     /gene="TPHA0E01250"
                     /locus_tag="TPHA_0E01250"
                     /inference="similar to DNA sequence:INSDC:YHR059W"
                     /note="similar to Saccharomyces cerevisiae FYV4 (YHR059W);
                     ancestral locus Anc_5.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685654.1"
                     /db_xref="GeneID:11531156"
                     /db_xref="InterPro:IPR019083"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ2"
                     /translation="MSSRRFFSIGTPILNSIKVAQMVSLKPTQSIPDVKTFLTIIGRG
                     CHELADTYENNWENLVSWDSRMLKEKGVSVQQRKYILVTVRENEEWSRDKRNKKGKKS
                     FFGGERHRKENIAKYQAEQRNK"
     gene            <254302..>255288
                     /gene="TPHA0E01260"
                     /locus_tag="TPHA_0E01260"
                     /db_xref="GeneID:11531424"
     mRNA            <254302..>255288
                     /gene="TPHA0E01260"
                     /locus_tag="TPHA_0E01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685607.1"
                     /db_xref="GeneID:11531424"
     CDS             254302..255288
                     /gene="TPHA0E01260"
                     /locus_tag="TPHA_0E01260"
                     /inference="similar to DNA sequence:INSDC:YHR058C"
                     /note="similar to Saccharomyces cerevisiae MED6 (YHR058C);
                     ancestral locus Anc_5.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685655.1"
                     /db_xref="GeneID:11531424"
                     /db_xref="GOA:G8BTJ3"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ3"
                     /translation="MDTPLDELQWKSPEWIQAFGLHTDNVMDYFSESPFFNKVSNNQV
                     IRMQKQFSQVPSQQPQQQVNKQCGSDNDNNTGELESGDAKDGAGGQSQMQSQLDIFKS
                     SLDDRSTDQEFEHVGPSRREILLKYPSQAMMERELSKMTGLEYVLAYVREPDLWIIKK
                     QNRISAETTQTLQAYYIIGANVYQSPSAFNIIQSRLLSASYHISSMLENLHKVTMFEP
                     SQGVQIRPTYENATGNTNTNSNTNPNGILRTNAPATSAIAGNTAPPTNSINSVASTNI
                     NTSSKTMAINTANTANTAMGTTRYDPNQRELLPKEMMDTLLAISIKSTPEYI"
     gene            <255678..>256301
                     /gene="TPHA0E01270"
                     /locus_tag="TPHA_0E01270"
                     /db_xref="GeneID:11531162"
     mRNA            <255678..>256301
                     /gene="TPHA0E01270"
                     /locus_tag="TPHA_0E01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685608.1"
                     /db_xref="GeneID:11531162"
     CDS             255678..256301
                     /gene="TPHA0E01270"
                     /locus_tag="TPHA_0E01270"
                     /inference="similar to DNA sequence:INSDC:YDR304C,YHR057C"
                     /note="similar to Saccharomyces cerevisiae CPR5 (YDR304C)
                     and CPR2 (YHR057C); ancestral locus Anc_5.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685656.1"
                     /db_xref="GeneID:11531162"
                     /db_xref="GOA:G8BTJ4"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ4"
                     /translation="MQLFNSIISLFVLFTVFVLGSEEPKITHKVYFDVQAGDKPLGRI
                     IMGLYGEVVPKTVENFYELTISEDPKMGYIDSIFHRVIPNFMIQGGDFTSGTGVGGKS
                     IFGNTFEDENFDIKHDKPGRLSMANRGPNTNGSQFFITTVKTPWLDGRHVVFGEVIEG
                     MDIVSQIETVATNRRDSPLEPVKIVGSGEIETIPVAEQEHEVAHDEL"
     gene            <256778..>257362
                     /gene="TPHA0E01280"
                     /locus_tag="TPHA_0E01280"
                     /db_xref="GeneID:11531163"
     mRNA            <256778..>257362
                     /gene="TPHA0E01280"
                     /locus_tag="TPHA_0E01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685609.1"
                     /db_xref="GeneID:11531163"
     CDS             256778..257362
                     /gene="TPHA0E01280"
                     /locus_tag="TPHA_0E01280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685657.1"
                     /db_xref="GeneID:11531163"
                     /db_xref="GOA:G8BTJ5"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ5"
                     /translation="MRVLNFLLVALTSLVAISMAAKSVDPKITHKVFFDIKHADKHVG
                     RIVMGLYGDDVPKTAKNFFQLAISKDPSFGYIDSIFHRVIDDFMIQGGDFETGRGVGG
                     KSIYGKKFKDENFKIKHTAPGKLSMANAGPDTNGSQFFITTIKTPWLDDHHVVFGEVI
                     EGMDIVDYIQKVKKDASDRPVQDVKIAACGEYTS"
     gene            <258004..>260562
                     /gene="TPHA0E01290"
                     /locus_tag="TPHA_0E01290"
                     /db_xref="GeneID:11531193"
     mRNA            <258004..>260562
                     /gene="TPHA0E01290"
                     /locus_tag="TPHA_0E01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685610.1"
                     /db_xref="GeneID:11531193"
     CDS             258004..260562
                     /gene="TPHA0E01290"
                     /locus_tag="TPHA_0E01290"
                     /inference="similar to DNA sequence:INSDC:YDR303C,YHR056C"
                     /note="similar to Saccharomyces cerevisiae RSC3 (YDR303C)
                     and RSC30 (YHR056C); ancestral locus Anc_5.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685658.1"
                     /db_xref="GeneID:11531193"
                     /db_xref="GOA:G8BTJ6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ6"
                     /translation="MDIRGRKMRKPPACVQCRRRKIGCDRVKPVCGNCNKSGKYDCFF
                     PDVPGMYTPSVSNYERKTTPKVSKAQVAMDHHVRESLLHKNDQHMGLKALEQMRDYNT
                     RLQLLNAQSGMFESSANGNEYSGMGGDNESNPYIPAGYEDYQLLMSYYGTPAEFDLMK
                     SRYSQEEILLKEMEFLEEKLVEVSDLYKENEELDKLNEDIKRQRNKKKSTSITTNNDE
                     LIFKKLKEQSKRQAARVPTDDSDMNTSDIGDDAHSNCNETTEFSEDNVDKFKVIDPNF
                     INKQEIFAIGNNVCVKSGVNDVLPLFDNRNKVFDKQFLIYRDRHLARFYNTLHNLNKT
                     HFTKEFKLWEDVRSMKSFLEKNVTTIRLPERALMQEMIIKYTELVQVSGSMIPVLKSK
                     NELLSSIEQLFSTATQFILMEQSIENLLALFNINMCLLLTFESLSSTVLIPLKEEELK
                     NYQELKNWVPTLKANMEYMKTELESRKNYESIEVLKVISLYKFYRMISSNYNNMVDYD
                     EDIYLARKLALNYESKNAEAIILWNFIFKNYCLRHLFGGETPNLVSGPELNSSIVIDP
                     LLANNIPLLSFQMDIVAYLHSKDFLISMEKLKKFKQTYKFKLNDANKRGTDTASTLQN
                     VIDSTIYRNSVLLLDNYMLIQYESLGEVDLFEDILNEFLKLTQESLFYAFSNLATLKF
                     AGFEFLFANFSFNLLDNICHMLLSLHQRTAVACNIINDSTDATKKVLLQTLMNTLKDV
                     LSKLMMLLDDYKKNLKYIDQNISKILSKMKVIIEYLENKDSIKNRDQDQFIDVLSQIA
                     DNKLEQINTKMISISESLIKTDFYSKRDKYEKVDSITLGITPGNYSNVFSAFFP"
     gene            <261036..>261836
                     /gene="TPHA0E01300"
                     /locus_tag="TPHA_0E01300"
                     /db_xref="GeneID:11531417"
     mRNA            <261036..>261836
                     /gene="TPHA0E01300"
                     /locus_tag="TPHA_0E01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685611.1"
                     /db_xref="GeneID:11531417"
     CDS             261036..261836
                     /gene="TPHA0E01300"
                     /locus_tag="TPHA_0E01300"
                     /note="ancestral locus Anc_5.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685659.1"
                     /db_xref="GeneID:11531417"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ7"
                     /translation="MSTSNVSMAYRVFEKIPLVNKGFYRTITNRSQLTSDFLIKKQGT
                     GAGPFIDLPEFRKLNDSLLIKLPAFSSLYGNIDKISIMNTHMDSNLNNIMNREHCEKL
                     SMEKLTTNEMPVNLIMSAPVPSSNIPILNFNDYKKGIIIPDIDNNLLCFAGDLSINKK
                     TNEMTGFGILALNGYGPIEKLTLDEKESLQVLLGTVVAYESGITIGSVIIPSDSQFQV
                     KIKRKFNTFLKSIKLDWILDNKLFFRNEKSLIKMQGPGTVYLQGRYSN"
     gene            complement(<262034..>262690)
                     /gene="TPHA0E01310"
                     /locus_tag="TPHA_0E01310"
                     /db_xref="GeneID:11531190"
     mRNA            complement(<262034..>262690)
                     /gene="TPHA0E01310"
                     /locus_tag="TPHA_0E01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685612.1"
                     /db_xref="GeneID:11531190"
     CDS             complement(262034..262690)
                     /gene="TPHA0E01310"
                     /locus_tag="TPHA_0E01310"
                     /inference="similar to DNA sequence:INSDC:YDR302W"
                     /note="similar to Saccharomyces cerevisiae GPI11
                     (YDR302W); ancestral locus Anc_5.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685660.1"
                     /db_xref="GeneID:11531190"
                     /db_xref="GOA:G8BTJ8"
                     /db_xref="InterPro:IPR009580"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ8"
                     /translation="MPVKKRTNAIKKKSVTFSDDTTVTQNEHNKKDKDSEHPPVSVKK
                     TIFTIPIHLLGLLYCYIFVSESFDTLKLLCGLIPTQILYVILQFNRNTVYGNKRLKVN
                     VLLIFIAVFAALGVSLPIMLGIILFGAPLIDKSKETLLLALHASFLAYPAIYSVFNCN
                     FKVGTWKKYFIFIILGGWISCIVIPLDWDREWQAWPIPVVIGSYIGAFFGYSTGSYFL
                     "
     gene            complement(<263113..>267186)
                     /gene="TPHA0E01320"
                     /locus_tag="TPHA_0E01320"
                     /db_xref="GeneID:11531199"
     mRNA            complement(<263113..>267186)
                     /gene="TPHA0E01320"
                     /locus_tag="TPHA_0E01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685613.1"
                     /db_xref="GeneID:11531199"
     CDS             complement(263113..267186)
                     /gene="TPHA0E01320"
                     /locus_tag="TPHA_0E01320"
                     /inference="similar to DNA sequence:INSDC:YDR301W"
                     /note="similar to Saccharomyces cerevisiae CFT1 (YDR301W);
                     ancestral locus Anc_5.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685661.1"
                     /db_xref="GeneID:11531199"
                     /db_xref="GOA:G8BTJ9"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:G8BTJ9"
                     /translation="MNIYDDVLDATVVSSSLVGHFTSEDYKELITVRTNILSIFQVDK
                     STNKLHLNYEFKLNGRVSDIALIKQVDSKLDYLIILTATAKLSLVNFNVFTNSLETIS
                     LHYYEDKFRQNSILKLAKESKLRIDQAKNCVLLFNNDNIAILPISSTTDEFEDEDLGQ
                     ESSAKTVKRGNMSIKFPSQSQKKNKITNSSIILKSTELNSKIQNIIDIQFLSNFSKPT
                     LSVLYQPKLAWIGNSNLVTLPTQYMILTLNILERENIKSQENGENSLNQDLIETTIIG
                     QVSELPYELHTIIPLNNGSTLVGSNEIIYIDHTGVLQSLIIINQFQDKETLKKGRVID
                     KSKQNIILNKPIKFINAGSRVESNNVDDKNNVLIFDENNNIYLVNITLEGRLLINFDI
                     NKLPIVNDVLRENSNPLCISCLRSDIKKKFTDLYIGYQSGNALLLRLNNLDSAIDSKK
                     EKVETKINTLIYAEDDEDDLYSHEKESTDDVKNTLKKIETIQPFDIELLSSYKNIGQL
                     SSIVVGKTSSVEKTVKGLPNPNSDEYSIVATSGHGTGSHLTVVQPSVKPSIELALKFI
                     SVTQIWNLKFKSHDKYLVTTDSKNNKSAIYQSSRGFELYKEGRFRRDATTVYVSMFGE
                     DKRIVQVTTNHLYLYDTNFRRLTTMNFEFEVVNVSVLDPYILITLSRGDIKLYELEEN
                     RKRKLFRVELPEILPEMVLTSGVILKSNMCNEFLTDSKNSDKEELLFTFVTADNQIIF
                     FPRNHNDRIFQLNGVDQLDETLFISTYQLPLEVIPDPQIKQVMINKLGKANKEEYLTI
                     LTFGGEIYQYQKSIRRHSRFHRNVTRNNLSITGAPDNAYAKGVSSIERIMHYIPNYNG
                     YSSIFITGNDPYILLKEDDSVPRIFKFANIPLVSMCPWGKTSVMCVDDIKNARVYTLE
                     VNNMYYGNKLPLLKVTLSDTIEDYMTLTKITYHEGSNMYIVAYAKDIEYTAIGEDGER
                     LVGSNEELPHSMSTQSGILLINPKTWNVIDRKDYEANTIINDIRTMIIQLNSKTNFKK
                     ELIVVGISNVGTEDLPPTGSFYIYNTNEVVPDPSKPDTNYRFKDVFHEQVKGTINNVC
                     EISGRFMVNQSQKLLVRDIQEDESVVPVAFHDVPVFVADIKSFGNLFIVGDSMQGFQF
                     VGFDAEPYRMIMLGRSVSKFKTMALDFVVRNGEIYFVVSDTDDILHILKYSPDEPNSL
                     SGQRLAHYSSFNIHSTNTSMHLLPANDEFIENKGNGSSIFQTIGANLDGSIFKILPLS
                     EDSFRRLYVIQQQIIDTEVHAAGLNPRMERLSNEYYQLTNVTRPLLDFNLIRRYSNLS
                     IKKRKSIAQKAGRNAHFEAWRDIINVEFSLRSLTTKK"
     gene            <267849..>269147
                     /gene="TPHA0E01330"
                     /locus_tag="TPHA_0E01330"
                     /db_xref="GeneID:11531200"
     mRNA            <267849..>269147
                     /gene="TPHA0E01330"
                     /locus_tag="TPHA_0E01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685614.1"
                     /db_xref="GeneID:11531200"
     CDS             267849..269147
                     /gene="TPHA0E01330"
                     /locus_tag="TPHA_0E01330"
                     /inference="similar to DNA sequence:INSDC:YDR300C,YHR033W"
                     /note="similar to Saccharomyces cerevisiae PRO1 (YDR300C)
                     and YHR033W; ancestral locus Anc_5.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685662.1"
                     /db_xref="GeneID:11531200"
                     /db_xref="GOA:G8BTK0"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:G8BTK0"
                     /translation="MTTNYTIVIKMGSSSLVDEETKEPKLALMSLLVETVVKLRREGH
                     RIVIVSSGSIAVGLRTMKMDKKPKHLAGKQALAAVGQGRLIARWDLLFSHFNQRIAQV
                     LLTRNDISNWPQYKNAQNTLNELLNMDVIPIVNENDTLSTNEIQFGDNDTLSAITAGA
                     VDANYLFLLTDVDCLYTANPKENPDAKPLLIIPNISEGLPGVDTSSGSGSSVGTGGME
                     TKITAANLATNAGVHTIIMKSDRPKNICSIVHYIRSLDLNLDEEDKKERFGDIDLLDL
                     QVKELKKLKEMGVPLHTKFIANDNQHHLKNREFWILHGLMTKGSVIIDQGAHSALTRK
                     NKAGLFPAGVIGVEGTFHEFECVELKMGKRLASGEMDPDFTPIVFGRARCNYSSDELV
                     KIMGLQSSEIEDALGYVDSEYVAQRDNIALPPNDTDRTIE"
     gene            <270186..>270617
                     /gene="TPHA0E01340"
                     /locus_tag="TPHA_0E01340"
                     /db_xref="GeneID:11531308"
     mRNA            <270186..>270617
                     /gene="TPHA0E01340"
                     /locus_tag="TPHA_0E01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685615.1"
                     /db_xref="GeneID:11531308"
     CDS             270186..270617
                     /gene="TPHA0E01340"
                     /locus_tag="TPHA_0E01340"
                     /inference="similar to DNA sequence:INSDC:YDR298C"
                     /note="similar to Saccharomyces cerevisiae ATP5 (YDR298C);
                     ancestral locus Anc_5.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685663.1"
                     /db_xref="GeneID:11531308"
                     /db_xref="GOA:G8BTK1"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/TrEMBL:G8BTK1"
                     /translation="MLSSSRSLLLNRSFVRFPLLRGISTTTSRSYNPTAITTRQFGLD
                     GTYATALYKSAIKKSTTDKVALELTQLAKLIQNDIRLCQKLDDIQNVSDINDRIKLLE
                     NLLNKNNVEMDYPIRKLLKTLATNKSLTLIPKISNKYNLLL"
     gene            complement(<271085..>272050)
                     /gene="TPHA0E01350"
                     /locus_tag="TPHA_0E01350"
                     /db_xref="GeneID:11531260"
     mRNA            complement(<271085..>272050)
                     /gene="TPHA0E01350"
                     /locus_tag="TPHA_0E01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685616.1"
                     /db_xref="GeneID:11531260"
     CDS             complement(271085..272050)
                     /gene="TPHA0E01350"
                     /locus_tag="TPHA_0E01350"
                     /inference="similar to DNA sequence:INSDC:YDR297W"
                     /note="similar to Saccharomyces cerevisiae SUR2 (YDR297W);
                     ancestral locus Anc_5.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685664.1"
                     /db_xref="GeneID:11531260"
                     /db_xref="GOA:G8BTK2"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G8BTK2"
                     /translation="MNSTVSEKLAQLTPYGYLHSKVAPTVTLTSKENWFDFATDGQLA
                     LFLPVIAYWTVSGFYHILDVYNLAEKYRIHPPEEITSRNKVGRFEVLYTVLFQHLIQV
                     IVAYAFLQLEPAQTTGFEMNSMWKWRQALPFWVPDVAIYYGYSYAFPFAKIFTGFVII
                     DTWQYWLHRLMHVNSTLYKRYHSVHHRLYVPYAYGALYNAPTEGFLLDTLGTGIAMMI
                     TQLNHKEQVILFTFATLKTVDDHCGFTLPFDPFPMIFPNNTIYHDIHHQNWGIKYNYG
                     QPFFTFWDTLFSTDYKGIDSYKEKQKQITLEKYKEFLKERKQKKN"
     gene            <274011..>275261
                     /gene="TPHA0E01360"
                     /locus_tag="TPHA_0E01360"
                     /db_xref="GeneID:11531404"
     mRNA            <274011..>275261
                     /gene="TPHA0E01360"
                     /locus_tag="TPHA_0E01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685617.1"
                     /db_xref="GeneID:11531404"
     CDS             274011..275261
                     /gene="TPHA0E01360"
                     /locus_tag="TPHA_0E01360"
                     /inference="similar to DNA sequence:INSDC:YHR036W"
                     /note="similar to Saccharomyces cerevisiae BRL1 (YHR036W);
                     ancestral locus Anc_5.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685665.1"
                     /db_xref="GeneID:11531404"
                     /db_xref="GOA:G8BTK3"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:G8BTK3"
                     /translation="MDLFSQLSLQDQNVGTNDEALLDLSKLSLVEKTEDISAMDIDAM
                     SVNDIESTNTLKSVSSIPVDEILSVKSFNGGENMVVSDEENQNNNDNTNFIKSLLSPT
                     SLGIAAATSMSTGGEYVNNENPEQIYTIEEPVDEKNEATTSTYLQDLQTELRKRSGKE
                     PINIMINYHNYYNDGYTDNTNKNNQRVLSMHDQYYNTVHSNNVKQPQKDLVLRLPSPW
                     SIYSHPVSRVSYNIMTILQLIINFITYMALALLLFLTLHTIGKDIKSIWNIKKIELVK
                     ESFSCRHNFTINRCQDNNKRLPALYEECEKWFHCMNRDNDMLFSTRTTLTMSFLGEAI
                     NAFIEPIGWKAIMIIILSFLTWTFATNFLFGFARAKSYYGLNKQSQQPTGDKQREPLA
                     NNSHSDSQMTKHPNETALSKISYS"
     gene            <275686..>277425
                     /gene="TPHA0E01370"
                     /locus_tag="TPHA_0E01370"
                     /db_xref="GeneID:11531493"
     mRNA            <275686..>277425
                     /gene="TPHA0E01370"
                     /locus_tag="TPHA_0E01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685618.1"
                     /db_xref="GeneID:11531493"
     CDS             275686..277425
                     /gene="TPHA0E01370"
                     /locus_tag="TPHA_0E01370"
                     /inference="similar to DNA sequence:INSDC:YHR037W"
                     /note="similar to Saccharomyces cerevisiae PUT2 (YHR037W);
                     ancestral locus Anc_5.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685666.1"
                     /db_xref="GeneID:11531493"
                     /db_xref="GOA:G8BTK4"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:G8BTK4"
                     /translation="MLRTTLTTKPYLLIRKFGNYSIPKQITNEPIKNFGAADVKDWDL
                     LRSSIMKFKSSSIDIPLVINGERRYYDESKGKKRSYYKQPNPADHGTILANVTQATET
                     DVLDAIAATKNAKVEWENFSFFDRASVFLKAADLITTKYRYDMLAATMLGQGKNVYQA
                     EIDCITELSDFFRFNVKYANDLYSQQPLESTAGVWNKVEYRPLEGFVYAVSPFNFTAI
                     AANLVGAPALMGNTVIWKPSQSATLSNYLLMTVLEEAGLPKGVINFLPGDPVKVTELI
                     VNDRAFNSLHFTGSTDVFKSLYGKIQSNLVNGVYKDYPRIVGETGGKNFHLIHKSANI
                     PHSVLSTIRGAYEFQGQKCSATSRLYIPESKSKEFIKDFVGTMTSEHSKMTPTNTSAG
                     PLSGGDLHSFIGPVINQQSFNKLAAVLEDAKTDPELEIIYGGKYDNSKGWFIQPTLIK
                     TTNPNHEYMSKEFFGPILTYFEYPDAEFNKICEIIDQTSQYGLTGAVFARDRETIKTA
                     TDALRYGAGNFYVNDKCTGAVVAQQWFGGARMSGTNDKSGSGNILNRFTSIRNIKENF
                     LELTNHKYPSNYD"
     gene            <278339..>281998
                     /gene="TPHA0E01380"
                     /locus_tag="TPHA_0E01380"
                     /db_xref="GeneID:11531496"
     mRNA            <278339..>281998
                     /gene="TPHA0E01380"
                     /locus_tag="TPHA_0E01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685619.1"
                     /db_xref="GeneID:11531496"
     CDS             278339..281998
                     /gene="TPHA0E01380"
                     /locus_tag="TPHA_0E01380"
                     /inference="similar to DNA sequence:INSDC:YDR293C"
                     /note="similar to Saccharomyces cerevisiae SSD1 (YDR293C);
                     ancestral locus Anc_5.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685667.1"
                     /db_xref="GeneID:11531496"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BTK5"
                     /translation="MSNAGSNNKSYYISATGNKNGPKQIHVAHRRSQSELTDLMIEQL
                     SLEDVQKHNQSQNNTNNHTNYRGSPIHHNKNNNHYNNNFHSRNYSEHSNNNNPFSPPK
                     INIQDSDDRNSLGYMHKKTGSQSSAYGHNRRQSLVIDEAKKYAAEEQAKRHGNEDTLN
                     IQTSSNLSLDPPPSFKFPQSPEKHLGQQSFKFPPSIKINTKKESPKKDEDNFIKTPTH
                     SHRRSRSRNNFNGYSNKQNNQSLSNQHSPFRSVSGQSKDNNYNSFTALEPPALFQPGH
                     NNNRPSNGSIQSNNSHGSANVNGNGNGNGNGNGSQRKALYTPYLPQSNIPDLVKQGRL
                     VTGVLRVNKKNRSDAWVTTDGVLDADIYICGSKDRNRALEGDLVAVELLAVDDVWESK
                     REKEEKKRRKDASIQHDIIPLDSTDDYHNDASINISNKLHASNEDYPILSPNTPNLKR
                     YDSEKPGAGSDSETISPSRSSVKRRGSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDD
                     FRPLYAGHVVAVIDRIPGQLFSGTLALLRPSQQTQHDNKPPHVPKIVWFKPTDKKVPL
                     IAIPTELAPKKFVENAENYNDTLFVAALKRWPITSLHPFGVIITELGVLSDPNIEIES
                     ILKDKNFLSNEYLDANDKTKERSNFKPLEIKNETYETRKNFFNENIVAISTLESITDF
                     SFHINESIKGKLQFGCHIVDATESIEPNSSLDRRARKRSTGVFLPQKSVNLLPKVFNE
                     FLTFKEDKVSLAISVVFTLDAETFETESIWIGETTIKPSMVISEESLNDIVEQGSSKT
                     VAKLQQIANQFLRERIDYVDADVSVSLPLINSLDDEKVLVDLNIFENRISSNIIEEIK
                     RRVNSIVAKEIYDKLGDKAFLRRQAIPNDTKMEFFKKKVNQLGFEIDTSSASGLLKYI
                     LSIKDPNARRGVEILLFKLMSRGKYYVAGKVDKEQHKNFITNIPLYTHFTSPLRRYAD
                     HIVHRQLKSLLRGNEFEEDIHSLRITSEYCNFKKDCTYDAQVQAIHLLLSSAINDMSK
                     PTGQLLTMATVLQVYESSFDIFIPELGIEKRVHGDQLPLIKARFDPMNKVLELYWQPR
                     IDSATFIPADERQANSYRNSIKNKFKSESEEIATNEFDKYNNNEYLVSPSFQKELESM
                     NLKIPHISFPEYDPKIGALQSFLSTTVSRRENEHYIQEITELQRIPVLLRAEIGMALP
                     CLTVSALNPFIKTED"
     gene            complement(<282750..>283097)
                     /gene="TPHA0E01390"
                     /locus_tag="TPHA_0E01390"
                     /db_xref="GeneID:11531497"
     mRNA            complement(<282750..>283097)
                     /gene="TPHA0E01390"
                     /locus_tag="TPHA_0E01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685620.1"
                     /db_xref="GeneID:11531497"
     CDS             complement(282750..283097)
                     /gene="TPHA0E01390"
                     /locus_tag="TPHA_0E01390"
                     /inference="similar to DNA sequence:INSDC:YHR039C-A"
                     /note="similar to Saccharomyces cerevisiae VMA10
                     (YHR039C-A); ancestral locus Anc_5.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685668.1"
                     /db_xref="GeneID:11531497"
                     /db_xref="GOA:G8BTK6"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:G8BTK6"
                     /translation="MSAQQNGIVTLLKAEKEAQEIVSEARKYRQEKLKQAKIDAANEI
                     NNYKATKDNELKEFEQKNGNNVAALESESAEEIKKELDEVKKLSKEKEGTVVDLLVKA
                     ITQPVSEMHVNAA"
     gene            <283648..>284832
                     /gene="TPHA0E01400"
                     /locus_tag="TPHA_0E01400"
                     /db_xref="GeneID:11531531"
     mRNA            <283648..>284832
                     /gene="TPHA0E01400"
                     /locus_tag="TPHA_0E01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685621.1"
                     /db_xref="GeneID:11531531"
     CDS             283648..284832
                     /gene="TPHA0E01400"
                     /locus_tag="TPHA_0E01400"
                     /inference="similar to DNA sequence:INSDC:YHR040W"
                     /note="similar to Saccharomyces cerevisiae BCD1 (YHR040W);
                     ancestral locus Anc_5.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685669.1"
                     /db_xref="GeneID:11531531"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:G8BTK7"
                     /translation="MSSKCEICGLEDFKYKCPKCFRKTCSLACSKKHKADFACDGERT
                     NSVDYISNDTFKKHDDLENGLNHLVQRDYNFLTNFKRKYEVNKKDSLSKVKGILYGGN
                     TANKRFKNNSRDNRGLSGPYNPTVNGENTELDEMVCKVISRRGVNCLVLPNGMQRSLQ
                     NKSKWDKPLDCFVWTIEVILLYSQPDANGNKKFVHVTHRMKETNTVAESIGKIIYSKC
                     LENFNIEPKPPSLENAKDDISKGDRTEAMANLPLHFLTKWFPRNYNKQYDSKQLIEIP
                     SSGLCIGEIFKNKTVIEFPTIYITDSLKNVESFGYTIVKKEEPQILPQLHEEVDSNTD
                     APDEISSKIQIPAYEKVVSGYDDIPVDTSIVNDVEVTVNANNCSDSDSDDYDPGVTLD
                     FL"
     gene            <285375..>287240
                     /gene="TPHA0E01410"
                     /locus_tag="TPHA_0E01410"
                     /db_xref="GeneID:11531532"
     mRNA            <285375..>287240
                     /gene="TPHA0E01410"
                     /locus_tag="TPHA_0E01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685622.1"
                     /db_xref="GeneID:11531532"
     CDS             285375..287240
                     /gene="TPHA0E01410"
                     /locus_tag="TPHA_0E01410"
                     /inference="similar to DNA sequence:INSDC:YDR292C"
                     /note="similar to Saccharomyces cerevisiae SRP101
                     (YDR292C); ancestral locus Anc_5.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685670.1"
                     /db_xref="GeneID:11531532"
                     /db_xref="GOA:G8BTK8"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR015284"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTK8"
                     /translation="MFDQLAIFTPQGEVLYQYNPSGKKFAETQVNAFINHLMNSPISK
                     KNDVHSKFSLVNISPTVGDSSNSSKLNFSSMFYISKQPELYYLVTFPEQKLDLKNEAE
                     ETLNLALSLWDSLGLNDSILQNLKNRTETKNWHNYIDLLYGTENDFKKFKEYFVTKYE
                     DSIAVNDTKIVESSQVDSATDGKKVTNTKRNNEGNAKKNKNGNNGGRKWGRGGNMEDG
                     SNIDASTLDFSEHGTPDINDEQYENISQNKDDLGKRTEKGDFLVKEIDELLASQKELS
                     NQKNTEGKPKGFMGSAYSYLQKNVIGNKTITKDDLNIILEELKQQLISKNVAPEAADF
                     LAQQVSRDLLGSKTSNWTSVQSAANDSLTKALTQILTPGISVDLLHEVQKKTSTLDAD
                     GKKQPYIFSVVGVNGVGKSTNLSKLAFWLLQNNFKVLIVACDTFRSGAVEQLRVHVEN
                     LAQLTEESHVRGSKNKRGKSGNDSVELFEAGYGGSDLVTKIAKQAIKYAKDNSFDIVL
                     MDTAGRRHNDPTLMSPLKSFAEQANPDKIIMVGEALVGTDSVQQAKNFNDAFGKVRNL
                     DFLLISKCDTVGTMLGSMVNMVYATGIPILFVGVGQTYTDLRTLSVKWAVDTLMS"
     gene            complement(<287481..>290837)
                     /gene="TPHA0E01420"
                     /locus_tag="TPHA_0E01420"
                     /db_xref="GeneID:11531476"
     mRNA            complement(<287481..>290837)
                     /gene="TPHA0E01420"
                     /locus_tag="TPHA_0E01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685623.1"
                     /db_xref="GeneID:11531476"
     CDS             complement(287481..290837)
                     /gene="TPHA0E01420"
                     /locus_tag="TPHA_0E01420"
                     /inference="similar to DNA sequence:INSDC:YDR291W"
                     /note="similar to Saccharomyces cerevisiae YDR291W;
                     ancestral locus Anc_5.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685671.1"
                     /db_xref="GeneID:11531476"
                     /db_xref="GOA:G8BTK9"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTK9"
                     /translation="MLHATLDENDDHPSNKKIKTNTFKGQEYFDNEFFNDFRKFFKSL
                     NTLYTFLICRKQVITTFEKLKIPIEKQLKRKLSELDFSKVQVILPNDTLFKYIDENQI
                     FTEAKEFDFKNGFQQKDNEDIFKLKNSNENSDNYRSTQLLIFEFIDGNMKKNWTTISE
                     NLNDPNNKYSHFNNYAKKVFHYSSEDLKKMINKRELHFNNRLIDFINKCTEKNLNPEN
                     ELTYLATSMLPQMKNYEDPIVAMEKAKLLRNNKLANSNNDEDGAITIPEMIQSLKNTT
                     FYNSQIKEEVTIESKHSQFENLNFNISEQVLNSLPHKKFYTHQADAINAINNGENVII
                     TTSTSSGKSLIYQLSTIDFLLKKPNSTFLYIFPTKALAQDQKRAFENLLTTINENSNN
                     SIPELRNIIIDTYDGDTDQQKRKFIRDNARIIFTNPDMIHTSILPNHPKWRPFLYNLT
                     FIVVDELHIYKSLFGSHVVLVMRRLQRLCREYYENNFLQFISCSATLKNPIKHMQDIF
                     SINDVTLINNDGSSTGAKHLVIWNPQILAQHERKRESFIRDSAKILVELMLKNVRTIA
                     FCYVRRVCELLMKEVRLIFQEMNRMDMITDVMSYRGGYSASDRRKIEREMFHGNLKAV
                     ISTNALELGIDIGNLDAVLMCGFPLSVANFHQQSGRAGRRNKDSLTLVVASDSPVDQH
                     YVAHPESLINSDDLDSYQDLVLNFDNMLILESHIQCAAFELPINIERDSKYFEEKHLL
                     KICHERLQSDSEGYHTHPRFLPWPSSNVSLRGVEEDYYAVIDRTNGKDIVIEEIEASR
                     TSFTLYDGAILIHQGYPYLVKEFNVEEKYASVIRVDVDWLTSQRDFTDVDPQEIELIR
                     SLENSDVPVYFGKFLVTIVVFGYFKVDKYNRIMDSVETYNPPINIRSKGLWIDLPSRA
                     LDLCEAKNLNIAGAIHAAEHAIMGLLPKFIVAGVDEISTECKAPEKEFAERQTKRKRP
                     ARLVFYDSRGGVYGSGLSIKAFEHIDDILEASLTRVQECPCDTGCPDCVAASFCKEKS
                     LVLSKQGCLILLHCILGHDTDAFIGSILDGPESNMPEIKVETVVPVQDHVNFSEDFKI
                     IDVRINKNAKLDEMEVKVEEVGFKEEKKEF"
     gene            <291791..>292198
                     /gene="TPHA0E01430"
                     /locus_tag="TPHA_0E01430"
                     /db_xref="GeneID:11531352"
     mRNA            <291791..>292198
                     /gene="TPHA0E01430"
                     /locus_tag="TPHA_0E01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685624.1"
                     /db_xref="GeneID:11531352"
     CDS             291791..292198
                     /gene="TPHA0E01430"
                     /locus_tag="TPHA_0E01430"
                     /inference="similar to DNA sequence:INSDC:YDR397C"
                     /note="similar to Saccharomyces cerevisiae NCB2 (YDR397C);
                     ancestral locus Anc_5.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685672.1"
                     /db_xref="GeneID:11531352"
                     /db_xref="GOA:G8BTL0"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BTL0"
                     /translation="MIGEGEDVTLPKATVQKIISEILDPDFTFGKEARDMIIKSGIEF
                     LMILSSISSEMAESDSKKTIAPEHVLKALEALEYDEFVPILSKILVEFKGSMKVKERK
                     DSKFKKSGLSEEELLRQQEELFRKSRSKLNNTK"
     gene            <292555..>294132
                     /gene="TPHA0E01440"
                     /locus_tag="TPHA_0E01440"
                     /db_xref="GeneID:11531449"
     mRNA            <292555..>294132
                     /gene="TPHA0E01440"
                     /locus_tag="TPHA_0E01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685625.1"
                     /db_xref="GeneID:11531449"
     CDS             292555..294132
                     /gene="TPHA0E01440"
                     /locus_tag="TPHA_0E01440"
                     /inference="similar to DNA sequence:INSDC:YOR149C"
                     /note="similar to Saccharomyces cerevisiae SMP3 (YOR149C);
                     ancestral locus Anc_5.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685673.1"
                     /db_xref="GeneID:11531449"
                     /db_xref="GOA:G8BTL1"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8BTL1"
                     /translation="MNWVYVSLIFLTIIISIQPSYIHPDEQFQSLQMLSYIFNKEKYL
                     NLNVKKIIPWEFENQNSARSYFPLYVVYAPIYKFIKIFNITDSLEIFQLVRFYNLIIF
                     LISCKITIVTIKKRLDDKTEQIDVHLFWMLILTSYVTTSFQSHTFSNSIETIILQLHL
                     SILQTLIPRNQRDLSNKYKFALSLLHGTLISFGIFNRMTYPAFIFFPLIYMFFKYYTK
                     SANNMLQLISTIFSFLITSAVIISIDSRLYESDSYVITPLNNLLYNLDKKNLLKHGLH
                     ARYTHIIINLPQMLGPMIYVLFKLKKQKINLLSLSILSGLTCLSLFEHQELRFLIPLY
                     SIFCLYIVTNCNLKAIPNYKVVVKIWIIYNVIMTIVLGLLHQSGVLLSIQFLNKYYKQ
                     NITANIWWKTYSPPTWFYNDAHIVNSSTNIENGIEYNSAIDFELRKHHVIDLKGCSIE
                     LFNDTLHKLLTNQGDKNTTIQVVIPNSVKHRVEKISNNYNITQVYHTWFHLDLDHFDI
                     EHPSSFYPGIGVYDFSL"
     gene            <294532..>296802
                     /gene="TPHA0E01450"
                     /locus_tag="TPHA_0E01450"
                     /db_xref="GeneID:11531450"
     mRNA            <294532..>296802
                     /gene="TPHA0E01450"
                     /locus_tag="TPHA_0E01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685626.1"
                     /db_xref="GeneID:11531450"
     CDS             294532..296802
                     /gene="TPHA0E01450"
                     /locus_tag="TPHA_0E01450"
                     /inference="similar to DNA sequence:INSDC:YOR144C"
                     /note="similar to Saccharomyces cerevisiae ELG1 (YOR144C);
                     ancestral locus Anc_5.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685674.1"
                     /db_xref="GeneID:11531450"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTL2"
                     /translation="MKQKSIKDILNGQNSNKSNARSNVIAPVENDEVILDISGVNEGS
                     PSTIEPITVPSSQSSSLPKGGQFISIQNEMDKDKPMISAKNFLIRNSKTLSKGSKKNS
                     RQKKIINPETIVISLDNENGIDDDYLENDAVMKMNKVNNKFEQLTKPNISITPISNFK
                     TTKLKDLFGKVQKNGKASFQNASTLNRKNEISKLKDLVAPWPQKQLYQPNDADQYTSI
                     EEGKYENVLLTKKKTKTPNLEISEEDYKYLNRNTITNNSDCNMLHKKLNLFGTSALDS
                     SFLKNHHSLLIDYFEPKELKHVLLEPTLKSSVNNCILESFEKLKKMTTRNQLLQKKNY
                     TKEIDYDDFNNFIVYDDDLNVSKDYETFSGGNSNENEEFVPLIVLYGNAVGKNTLLKV
                     IMDALQGQIYELNTSTNRSKKNILESLLEFSTTHYVKGKNSKGLILLDDIDVLFKEHD
                     KFFWYAVERLLLSARKPVVLTCRDINYIPSNLLQIAINQDTCFEAKRISPKSVVSFLQ
                     YYMKKINTEINPEALRCIVEINQNDIRKSLLDLQFLLLPPHTYTFKTPKELNEHHVSD
                     LKELSDYLEILSYADVIDNCIKFKSLINDDKYHTLNTPSAILKCRDSTDEIKLQNDYL
                     IDYKLYLDDELHRKQLPFELNISKYLENKTNEVSGIERNKNLSKIALVKEKNHKRITN
                     SNVVFLSSRISKRNTQNVTARKTRNSSKKFFELIENFSTTDETDEMIDFDFSLNNQSN
                     LDTYVNPYVFKIAEFE"
     gene            298100..298171
                     /gene="TPHA0Etrna3G"
                     /locus_tag="TPHA_0Etrna3G"
                     /db_xref="GeneID:11531513"
     tRNA            298100..298171
                     /gene="TPHA0Etrna3G"
                     /locus_tag="TPHA_0Etrna3G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGG"
                     /db_xref="GeneID:11531513"
     gene            complement(<298520..>299503)
                     /gene="TPHA0E01470"
                     /locus_tag="TPHA_0E01470"
                     /db_xref="GeneID:11531395"
     mRNA            complement(<298520..>299503)
                     /gene="TPHA0E01470"
                     /locus_tag="TPHA_0E01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685627.1"
                     /db_xref="GeneID:11531395"
     CDS             complement(298520..299503)
                     /gene="TPHA0E01470"
                     /locus_tag="TPHA_0E01470"
                     /inference="similar to DNA sequence:INSDC:YOR142W"
                     /note="similar to Saccharomyces cerevisiae LSC1 (YOR142W);
                     ancestral locus Anc_5.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685675.1"
                     /db_xref="GeneID:11531395"
                     /db_xref="GOA:G8BTL3"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:G8BTL3"
                     /translation="MLRSAFRNNINRRLFSRESIPYDKTIKNLLLPADTKVIIQGFTG
                     KQATFHANISMEYGTDIVGGTNPKKAGQLHLGKPVYATVKEAVKETGATATGIFIPPA
                     FAANAIKEAVEAEIPLAVAITEGIPQHDMLYIAEMLKSQDKTRLVGPNCPGIVNPISK
                     VRIGIQPPSIFKPGKIGIISKSGTLTYEAVQQTTLTGLGQTLVIGMGGDAFPGTDFID
                     TLKLFLEDKQTEGIIMLGEIGGTAELEAAQFLKEYNFSKSNPKPVASFIAGTVAGQMK
                     GVRMGHSGAIVEGSGTDAESKKKALRDVGVSVVESPGRLGKALLDDFAKYK"
     gene            complement(<300222..>301355)
                     /gene="TPHA0E01480"
                     /locus_tag="TPHA_0E01480"
                     /db_xref="GeneID:11531363"
     mRNA            complement(<300222..>301355)
                     /gene="TPHA0E01480"
                     /locus_tag="TPHA_0E01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685628.1"
                     /db_xref="GeneID:11531363"
     CDS             complement(300222..301355)
                     /gene="TPHA0E01480"
                     /locus_tag="TPHA_0E01480"
                     /inference="similar to DNA sequence:INSDC:YOR136W"
                     /note="similar to Saccharomyces cerevisiae IDH2 (YOR136W);
                     ancestral locus Anc_5.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685676.1"
                     /db_xref="GeneID:11531363"
                     /db_xref="GOA:G8BTL4"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:G8BTL4"
                     /translation="MLKVGVPLSSKYIGTISKLRYFMTAADKISIGNFKGKPNPETGN
                     YTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNCDIGPLLINGETTIPQTAVDQINN
                     SLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVIREN
                     TEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYTRSIGRSNLIVVHKATIQRR
                     GDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYADSVSVCPNLYGDILSDL
                     NSGLSTGSLGLTPSANIGETVLYEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLQ
                     KYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENLN"
     gene            complement(<301879..>303540)
                     /gene="TPHA0E01490"
                     /locus_tag="TPHA_0E01490"
                     /db_xref="GeneID:11531503"
     mRNA            complement(<301879..>303540)
                     /gene="TPHA0E01490"
                     /locus_tag="TPHA_0E01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685629.1"
                     /db_xref="GeneID:11531503"
     CDS             complement(301879..303540)
                     /gene="TPHA0E01490"
                     /locus_tag="TPHA_0E01490"
                     /inference="similar to DNA sequence:INSDC:YDR389W,YOR134W"
                     /note="similar to Saccharomyces cerevisiae SAC7 (YDR389W)
                     and BAG7 (YOR134W); ancestral locus Anc_5.471"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685677.1"
                     /db_xref="GeneID:11531503"
                     /db_xref="GOA:G8BTL5"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8BTL5"
                     /translation="MVTVQTETPPSKPSKQFWKTFLSNPKSISSDSLMGNQSEQSDYG
                     MNSSTKLLRRPTITSKNISAPSKSEKTNISSMEGQNQKMNNDANFKSHRDDFILNKHG
                     FTGTVFGTSLENSLRVASAEVIVQNEFVTFGRIPIVVAKSGAYLKANALDVSGIFRIS
                     GSNKRVKQLQHIFSTPPDYGLKFTEWDTYTVHDIGTLLRRYLNNLDEPLIPLDLYEKF
                     REPLESKPKLMKYITDMGSQPRLTVKSNDDKPEESIEQKKKEKKRKRKIAKDIKQTIL
                     EYQELFSLLSSESRQLTVYLLDLLSLFAKHSEKNLMTGKNLSAIFQPSMLSHPNDDLD
                     PKQYEISRIVLEFLIEFSYKLLPYILKLKTEGQIKHKDSTPETSLTNEQIKNTTSSSF
                     ITDNDINKTETENINAIDANGISDKHLLIPRHNDSNRNAKNSHNRKYSKSFSSVANPS
                     DVIDHNKSFTLTSENITDSGENIEDDLDGSSEESNSSIVSSLNNDEAVSLANEPKLHV
                     TNVVINGSPERQGRRSRRSSWFSKLYSRSTSRSNSISMSRSNSHH"
     gene            complement(<304130..>305503)
                     /gene="TPHA0E01500"
                     /locus_tag="TPHA_0E01500"
                     /db_xref="GeneID:11531402"
     mRNA            complement(<304130..>305503)
                     /gene="TPHA0E01500"
                     /locus_tag="TPHA_0E01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685630.1"
                     /db_xref="GeneID:11531402"
     CDS             complement(304130..305503)
                     /gene="TPHA0E01500"
                     /locus_tag="TPHA_0E01500"
                     /inference="similar to DNA sequence:INSDC:YDR388W"
                     /note="similar to Saccharomyces cerevisiae RVS167
                     (YDR388W); ancestral locus Anc_5.470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685678.1"
                     /db_xref="GeneID:11531402"
                     /db_xref="GOA:G8BTL6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8BTL6"
                     /translation="MSFKGFTKAITRAPQNFRQKFNMGEQTEDPVYEDAERRFKELED
                     ETKKLSEESKKYSVAVNGMLSHQIGFAKAMEEIFKPISGKMSDPNATVPEDNPDGIEA
                     SEQYRSIVAELQETLKPDLALIEEKIVKPCQELLKIITYIRKMSTKRNHKKLDLDRRL
                     NSVTKLENKKEQTPKDEEKLYKAQAEMEVAQQEYDYYNNLMKDQLPILFSLEAQFVQP
                     LFVSFYYMQLNIFYTLYNKFQDMKIPYFDLNSDIIEAFHFKRGNVEEQADSLTITHFK
                     IGYSKAKLEMTRKRFGVDSNTPPGSAGTTGYGAAPGAATAGYGAAPGAVGYGAAPGAA
                     TAGYGAAPGAAPTAAAVGYGAVPAAAGYGAADAKAQEAYGAAGVAPAAAQGYQAVPPA
                     YTTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPG
                     NYVQLNQ"
     gene            complement(<306091..>307950)
                     /gene="TPHA0E01510"
                     /locus_tag="TPHA_0E01510"
                     /db_xref="GeneID:11531403"
     mRNA            complement(<306091..>307950)
                     /gene="TPHA0E01510"
                     /locus_tag="TPHA_0E01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685631.1"
                     /db_xref="GeneID:11531403"
     CDS             complement(306091..307950)
                     /gene="TPHA0E01510"
                     /locus_tag="TPHA_0E01510"
                     /inference="similar to DNA sequence:INSDC:YDR386W"
                     /note="similar to Saccharomyces cerevisiae MUS81
                     (YDR386W); ancestral locus Anc_5.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685679.1"
                     /db_xref="GeneID:11531403"
                     /db_xref="GOA:G8BTL7"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:G8BTL7"
                     /translation="MSLPFDLKQHYVDWLQELINSYGSHQEQVQITYERAKRNLIDSQ
                     ETFHFPSDLKKVKGIGEAIAKKLEVKLKEYCKKNSFEFPSKIENEIASNKRSTTTLRS
                     TTIDSDVTSRPLKKKRKYIPKKRSGGYAILLALLESGATEKGLTKDDIIEIAQKYCNN
                     SMLPNYTTKELHGSWSSITSLRNNYLILEEGRPKRFSLTEEGHELAKTLKEADGIIFE
                     NEGNTTLNQNKFWNDPNEVTADLTGLFANKSFPSQPDQGNSSKIIDVTFKENENLVHG
                     IISQTGTTNKANYTLANKEGLIGNGLINGSATEASNIVQKRYNNISYQLWNRGSYDIF
                     PIIDHREVKSVTDREFFINAFHRKGVHSELRQLSLGDIIWVARHKVTKTICILDTIIE
                     RKRLDDLASSIRDNRFMEQKTRLEKSGCQNKIYLIEETIGINNNNIQVNMDEALKTAL
                     WLILVYYKFSMIRTSNSEETVEKLCYLHEVISKHYLEKDLIVIYPDNITSQESYYNIL
                     HDFKKEFERNKSIECCHTIECFQEIMGKSESRTIGEITINILMLIRGVSLEKAIAIQS
                     IYPTLNHILKAYQSCKSPSEAKLLLYNKLGNAPGTKRITKSLSEKISEVFYDN"
     gene            complement(<308327..>310855)
                     /gene="TPHA0E01520"
                     /locus_tag="TPHA_0E01520"
                     /db_xref="GeneID:11531400"
     mRNA            complement(<308327..>310855)
                     /gene="TPHA0E01520"
                     /locus_tag="TPHA_0E01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685632.1"
                     /db_xref="GeneID:11531400"
     CDS             complement(308327..310855)
                     /gene="TPHA0E01520"
                     /locus_tag="TPHA_0E01520"
                     /inference="similar to DNA sequence:INSDC:YDR385W,YOR133W"
                     /note="similar to Saccharomyces cerevisiae EFT2 (YDR385W)
                     and EFT1 (YOR133W); ancestral locus Anc_5.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685680.1"
                     /db_xref="GeneID:11531400"
                     /db_xref="GOA:G8BTL8"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTL8"
                     /translation="MVAFTVDQMRALMDRVTNVRNMSVIAHVDHGKSTLTDSLVQRAG
                     IISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMADEDVKDIKQKTEGNAFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVCINKV
                     DRALLELQVEKEDLYQTFARTVESCNVIISTYADEVLGDVQVYPQRGTVAFGSGLHGW
                     AFTIRQFATRYAKKFGVDKEKMMERLWGDSFFNPKTKKWTSKETDADGKPLERAFNMF
                     VLDPIFRIFAAVMNFKKDEVNALLEKLEVSLKGEEKDLEGKALLKVVMRKFLPAADAL
                     LEMIVMHLPSPVTAQFYRAEQLYEGPADDKNCIAIKNCDPKADLMLYVSKMVPTSDKG
                     RFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFVKAIQRVVLMMGRFTEPIDDCPA
                     GNILGLVGIDQFLLKTGTLTTDETAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRET
                     VEAESSQSALSKSPNKHNRIYLKACPIEEELSLAIEAGKVNPRDDFKARARVMADEFG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIKDSVVAAFQWATKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWATLNTDPLDPTTKAGEIVVAARKRHGMKEEVPGWQEYYDKL"
     gap             311033..311848
                     /estimated_length=816
     gene            <313509..>314159
                     /gene="TPHA0E01540"
                     /locus_tag="TPHA_0E01540"
                     /db_xref="GeneID:11531323"
     mRNA            <313509..>314159
                     /gene="TPHA0E01540"
                     /locus_tag="TPHA_0E01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685633.1"
                     /db_xref="GeneID:11531323"
     CDS             313509..314159
                     /gene="TPHA0E01540"
                     /locus_tag="TPHA_0E01540"
                     /inference="similar to DNA sequence:INSDC:YOR131C"
                     /note="similar to Saccharomyces cerevisiae YOR131C;
                     ancestral locus Anc_5.465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685681.1"
                     /db_xref="GeneID:11531323"
                     /db_xref="GOA:G8BTL9"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BTL9"
                     /translation="MTNFQLKETVRTNRIKSVVFDMDGTLCLPQPWMFVEMRKSISLH
                     DKSVDILDFIKWLPTEEARAVASSNIASVENKAMLEMVPQPGLIPLLKYLHQNNISKN
                     ICTRNLIGPVHYFISNFIEPTVLQNFENILTRDFVPTKPNPDPILNIMQKLDLRADEI
                     LMVGDSMDDMLSGKAAGCTTILLENEINKHLKDTNREYIDIVVKDLSEIIDIIERL"
     gene            <316183..>316974
                     /gene="TPHA0E01550"
                     /locus_tag="TPHA_0E01550"
                     /db_xref="GeneID:11531330"
     mRNA            <316183..>316974
                     /gene="TPHA0E01550"
                     /locus_tag="TPHA_0E01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685634.1"
                     /db_xref="GeneID:11531330"
     CDS             316183..316974
                     /gene="TPHA0E01550"
                     /locus_tag="TPHA_0E01550"
                     /inference="similar to DNA sequence:INSDC:YDR384C"
                     /note="similar to Saccharomyces cerevisiae ATO3 (YDR384C);
                     ancestral locus Anc_5.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685682.1"
                     /db_xref="GeneID:11531330"
                     /db_xref="GOA:G8BTM0"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:G8BTM0"
                     /translation="MNKESGSEHVYDQSSSNIERTTIQDITCDGDIIAMGSNLYRKSD
                     LIKILSENNGLAYAPQHQQSTARKLANPVPLGLASFSLSCLTLSLVNANVRGVTENKL
                     LISTFMFFGGAIELFAGLLCFVTGDTYAMTVFSSFGGFWISYGCINTDQFHSISAYAD
                     DPVMLQNVTGFFLAGWVVFTFLVLMCTLKSTWGLFGLLFTLDLTFLFLCIGNFIGNNN
                     VKMAGGYFGIISSCCGWYSLYCMLADSKNTYFPIPATTMPNFPDA"
     gene            complement(317255..317326)
                     /gene="TPHA0Etrna3D"
                     /locus_tag="TPHA_0Etrna3D"
                     /db_xref="GeneID:11531517"
     tRNA            complement(317255..317326)
                     /gene="TPHA0Etrna3D"
                     /locus_tag="TPHA_0Etrna3D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11531517"
     gene            <318471..>319214
                     /gene="TPHA0E01560"
                     /locus_tag="TPHA_0E01560"
                     /db_xref="GeneID:11531394"
     mRNA            <318471..>319214
                     /gene="TPHA0E01560"
                     /locus_tag="TPHA_0E01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685635.1"
                     /db_xref="GeneID:11531394"
     CDS             318471..319214
                     /gene="TPHA0E01560"
                     /locus_tag="TPHA_0E01560"
                     /inference="similar to DNA sequence:INSDC:YDR383C"
                     /note="similar to Saccharomyces cerevisiae NKP1 (YDR383C);
                     ancestral locus Anc_5.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685683.1"
                     /db_xref="GeneID:11531394"
                     /db_xref="UniProtKB/TrEMBL:G8BTM1"
                     /translation="MYSEILDYIEKEVNNSVNTSINNISKLDDIPHDLLYLITQEYNK
                     NQGLKLSQNKKDLLAKNIYDLEQELRRSQILQINEFVGEVPKYSIGTEILKQNAKSKD
                     LNDSISINKLISDIFNLPQMSLVRGLDEDTEDEQEKKYLTTLNEYNNIRDELTNKCTA
                     IIYGESILKNIHEDTEILTTLFKAIEQFQGSETQNNGNSNPSTYLNNYNSDLKRNLQE
                     LELLLEETVKSRSVTKVTKEKIDTLFNNL"
     gene            <320205..>321113
                     /gene="TPHA0E01570"
                     /locus_tag="TPHA_0E01570"
                     /db_xref="GeneID:11531472"
     mRNA            <320205..>321113
                     /gene="TPHA0E01570"
                     /locus_tag="TPHA_0E01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685636.1"
                     /db_xref="GeneID:11531472"
     CDS             320205..321113
                     /gene="TPHA0E01570"
                     /locus_tag="TPHA_0E01570"
                     /inference="similar to DNA sequence:INSDC:YOR130C"
                     /note="similar to Saccharomyces cerevisiae ORT1 (YOR130C);
                     ancestral locus Anc_5.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685684.1"
                     /db_xref="GeneID:11531472"
                     /db_xref="GOA:G8BTM2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BTM2"
                     /translation="MSADLEPKHSSVELSQNDALTDIFYGSIAGCLGKIIEYPFDTVK
                     VRLQTQSSTLFPNTWSCIKYTYKNEGIRRGFFQGISSPLVGAAMENAVLFLSYNQCSK
                     FLESRSNLQLSSLQNIIVSGAFAGSCASFVLTPVELIKCRLQVLNIHNATNVTIKYSN
                     KILPTIFDVLKSNGVFGLWKGQSSTFIRESVGGVAWFSTYELLKSSLLKRRQKKNPEI
                     KDNCTWELLISGGSSGLAFNATIFPADTVKSVMQTEHKSLTEAFKSIMLKQGIKGFYR
                     GLGITLIRAVPANATVFYVYETLSKI"
     gene            <321492..>321941
                     /gene="TPHA0E01580"
                     /locus_tag="TPHA_0E01580"
                     /db_xref="GeneID:11531473"
     mRNA            join(<321492..321520,321632..>321941)
                     /gene="TPHA0E01580"
                     /locus_tag="TPHA_0E01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685637.1"
                     /db_xref="GeneID:11531473"
     CDS             join(321492..321520,321632..321941)
                     /gene="TPHA0E01580"
                     /locus_tag="TPHA_0E01580"
                     /inference="similar to DNA sequence:INSDC:YDR381C-A"
                     /note="similar to Saccharomyces cerevisiae YDR381C-A;
                     ancestral locus Anc_5.459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685685.1"
                     /db_xref="GeneID:11531473"
                     /db_xref="UniProtKB/TrEMBL:G8BTM3"
                     /translation="MNSNAFEALGKKLAIITVIGFGALFVAKNNVKSKKASKFQPNVK
                     VSATEQNTGDYYSNLAKIKPGFPLPKDDSSDAGGSKYQRKSKYEGSGNSYLSRKGGDR
                     LGFLDRREND"
     gene            complement(<322289..>324616)
                     /gene="TPHA0E01590"
                     /locus_tag="TPHA_0E01590"
                     /db_xref="GeneID:11531494"
     mRNA            complement(join(<322289..322756,324326..>324616))
                     /gene="TPHA0E01590"
                     /locus_tag="TPHA_0E01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685638.1"
                     /db_xref="GeneID:11531494"
     CDS             complement(join(322289..322756,324326..324616))
                     /gene="TPHA0E01590"
                     /locus_tag="TPHA_0E01590"
                     /inference="similar to DNA sequence:INSDC:YDR381W"
                     /note="similar to Saccharomyces cerevisiae YRA1 (YDR381W);
                     ancestral locus Anc_5.458"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685686.1"
                     /db_xref="GeneID:11531494"
                     /db_xref="GOA:G8BTM4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BTM4"
                     /translation="MSAALDKSLDEIIGSRKKPARARITNTRRAAGPRRVAKNAVAGR
                     RVALTQRNVRARVQRAAAPVNAAQRVAALLQNTKEARVNVEGLPREIKQDAVREFFSS
                     EVGGVQRVLLSYNERGNSTGMATITFRNGEMAKRAVAKFNGAPIDGGRSRLKLNLIID
                     PTAQPVRTLNERITALPRGVPSQRGQQRPHQRGQQRPQQRGQQKPQQRGQQRAPSRKA
                     AAAKAEKQKRREKPVKKSLEELDKEMADYFEEKK"
     gene            complement(<325811..>327766)
                     /gene="TPHA0E01600"
                     /locus_tag="TPHA_0E01600"
                     /db_xref="GeneID:11531529"
     mRNA            complement(<325811..>327766)
                     /gene="TPHA0E01600"
                     /locus_tag="TPHA_0E01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685639.1"
                     /db_xref="GeneID:11531529"
     CDS             complement(325811..327766)
                     /gene="TPHA0E01600"
                     /locus_tag="TPHA_0E01600"
                     /inference="similar to DNA sequence:INSDC:YDR380W"
                     /note="similar to Saccharomyces cerevisiae ARO10
                     (YDR380W); ancestral locus Anc_5.456"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685687.1"
                     /db_xref="GeneID:11531529"
                     /db_xref="GOA:G8BTM5"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8BTM5"
                     /translation="MAPVLGDVVHSDTSLSDLNEHSNKMTISSLITSTPNRIPFGKYI
                     FRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAAYAADGYS
                     RYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFHHLIPN
                     KENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFLFIP
                     EEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAIIGDI
                     LVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQ
                     CDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFI
                     HVLKRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDI
                     LLCDTGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDD
                     SIIKTQPKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDY
                     NDIQPWNWTMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDSLNFIEVQL
                     GRLDVPHILQDFMDRMKKRATAKALSD"
     gene            <328888..>329127
                     /gene="TPHA0E01610"
                     /locus_tag="TPHA_0E01610"
                     /db_xref="GeneID:11531364"
     mRNA            <328888..>329127
                     /gene="TPHA0E01610"
                     /locus_tag="TPHA_0E01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685640.1"
                     /db_xref="GeneID:11531364"
     CDS             328888..329127
                     /gene="TPHA0E01610"
                     /locus_tag="TPHA_0E01610"
                     /inference="similar to DNA sequence:INSDC:YDR379C-A"
                     /note="similar to Saccharomyces cerevisiae YDR379C-A;
                     ancestral locus Anc_5.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685688.1"
                     /db_xref="GeneID:11531364"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:G8BTM6"
                     /translation="MRGKFSGLQKEAIHLYRNSLRIAYKKPIENQSHFFKYIHDEFDK
                     NKSISRKDFTTIEYLIRVGNKKLESFSRSEVKDIH"
     gene            complement(<329373..>332666)
                     /gene="TPHA0E01620"
                     /locus_tag="TPHA_0E01620"
                     /db_xref="GeneID:11531488"
     mRNA            complement(<329373..>332666)
                     /gene="TPHA0E01620"
                     /locus_tag="TPHA_0E01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685641.1"
                     /db_xref="GeneID:11531488"
     CDS             complement(329373..332666)
                     /gene="TPHA0E01620"
                     /locus_tag="TPHA_0E01620"
                     /inference="similar to DNA sequence:INSDC:YDR379W,YOR127W"
                     /note="similar to Saccharomyces cerevisiae RGA2 (YDR379W)
                     and RGA1 (YOR127W); ancestral locus Anc_5.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685689.1"
                     /db_xref="GeneID:11531488"
                     /db_xref="GOA:G8BTM7"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8BTM7"
                     /translation="MTEILKIDSPKCVNCKLVIDDNKFFRIDDDKWHMNCFECYNCRD
                     KLNIDSDFLRIGNDQKLLICSKCSNYQCASCNDHITNMAIILTNNEAYCKKCFKCFKC
                     EKEIEGLKYAKTKKGLLCMGCHEVILNRKSAIEQQKKKDKLYLQEHNRSRSLDTYQSN
                     LVIPKRSTRRTVVSPNRNAQSNRNSKLISTEEINKINSKGELLKDISTSNHSEDIDKF
                     PDFLVSNDRKISSHIKSNSESVIPQFLPGENSNSKPNQDTNQKVHDRKTSIDEILNST
                     LENFDFDEESKIRKASLKAPNVEIRKNSTSSTDAKNLTMDDKNIMVSPKRHGIIVSNQ
                     MKADVNSEHLNYLSADKQETTNSIFYGKFRTPVGSIDLTNNAINSPISVNASDFKGGL
                     TTDLRLNSTQEHDDKVEKVNGLAINFQTTDKENIDATSNPHLIDPQLNTSDSGQSSND
                     LSLPVITNTNTTNSNQNSLSDNGGKKKLSRSLSKISRNLVSNFKPKQTGNFKPAQPNN
                     DSPYVTKIDDSLDTHSGWGVFSQKNNTSNIDNITSSKATKETRHSSRGKSDSTIYSDQ
                     KARTIDNTAMGSTFSHADEDAKYTHLRSNSNLANKSLNTPESAAELSSVTPSMDTNST
                     FTRFNATPSTSSHHYRKSSLQGVDNILKEDVAALSLSVPQSMATYSLDPKEVSSPTAA
                     MLSKELAELDLSLRKMKLELRNMETSKSRLSNEIDNLRKLKDSLIGEVEQLKSERNSL
                     ASLYPTKTEQSIKEEETDELYTGLTPKKQTNSVNELTNIHSSNSKSKFWKLFSSDSPS
                     VYGSPQQQSNTKLSPQPPNKKLFGNNPKNLGNSSEHPKLDISEPINLKSNVFEYPTDK
                     SRSLGKPSFSGYNLNNSLSGENLYGSLLVKRCIYEGAMVPMLITTCISYIEKNENNLK
                     TEGIYRKSGSQKLIEEIENEFKPIKSTQEMSETLKSLLDSDVNAVSNVLKRYLRKLPN
                     PLIPFEVYEPLIEITKNSDLITALPNNEEQKNSKTIELFNFTLSSFKKLLNTIPVEHY
                     VLLRILSNHVNKIAQFSQWNLMNLSNLAIVFSPSIIHDITGEKDMIDMKFRNYVTQFI
                     FKNYEELFL"
     gene            <333787..>334032
                     /gene="TPHA0E01630"
                     /locus_tag="TPHA_0E01630"
                     /db_xref="GeneID:11531533"
     mRNA            <333787..>334032
                     /gene="TPHA0E01630"
                     /locus_tag="TPHA_0E01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685642.1"
                     /db_xref="GeneID:11531533"
     CDS             333787..334032
                     /gene="TPHA0E01630"
                     /locus_tag="TPHA_0E01630"
                     /inference="similar to DNA sequence:INSDC:YDR378C"
                     /note="similar to Saccharomyces cerevisiae LSM6 (YDR378C);
                     ancestral locus Anc_5.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685690.1"
                     /db_xref="GeneID:11531533"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8BTM8"
                     /translation="MSAETNSVSSQFLSNIIGKPVNVKLYSGMLYNGKLESIDGFMNI
                     ALSNTTEHYENNANGMLRRYENDVFLRGTQVMYISEV"
     gene            complement(<334427..>335917)
                     /gene="TPHA0E01640"
                     /locus_tag="TPHA_0E01640"
                     /db_xref="GeneID:11531350"
     mRNA            complement(<334427..>335917)
                     /gene="TPHA0E01640"
                     /locus_tag="TPHA_0E01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685643.1"
                     /db_xref="GeneID:11531350"
     CDS             complement(334427..335917)
                     /gene="TPHA0E01640"
                     /locus_tag="TPHA_0E01640"
                     /inference="similar to DNA sequence:INSDC:YDR376W"
                     /note="similar to Saccharomyces cerevisiae ARH1 (YDR376W);
                     ancestral locus Anc_5.450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685691.1"
                     /db_xref="GeneID:11531350"
                     /db_xref="GOA:G8BTM9"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR021163"
                     /db_xref="UniProtKB/TrEMBL:G8BTM9"
                     /translation="MSSQFVRNLSSLVKRKRISIVGAGPSGFYVAHHLFKKSHIPLHI
                     TVWDKLPSPFGLSRYGVAPDHPEVKNCEETFTQTADKYFIATPDSNHKFEFIGGVSIG
                     SDISLKTILENQDAVVLSYGCSGDRKLNIPGESTVKGVFSSRQFINWYNGHPGGDKSE
                     ELTKYNWANVSNVGIIGNGNVALDIARLLLSNKVKEIWESTDISPIALSCLRRAPIKN
                     VKIIARRDFYNSKFTNKELRELFELEKYGIHGKISDKYFKSEELEKLSSDRAFKRRIE
                     ICSEYLKSFDERTKKNYKKAEPVELANDNIRKEWELDYLKSPVKIEANASGVIKSLEL
                     DQNKFTEDNKLIKDVDQPQIKYDIDLLITSLGYMGRPLKDFDDLNIKFSRDHLATENG
                     RAINSKTNEIYPKLYGSGWIQTGSQGVIMSTMMNAFNVADEVLIDLEKDTSFKGKDIN
                     LDNIKHTTWSDWKYLDKSEIELGQLQNKKRVKYSTLEEAYSLLSKK"
     gene            <336223..>336951
                     /gene="TPHA0E01650"
                     /locus_tag="TPHA_0E01650"
                     /db_xref="GeneID:11531413"
     mRNA            <336223..>336951
                     /gene="TPHA0E01650"
                     /locus_tag="TPHA_0E01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685644.1"
                     /db_xref="GeneID:11531413"
     CDS             336223..336951
                     /gene="TPHA0E01650"
                     /locus_tag="TPHA_0E01650"
                     /inference="similar to DNA sequence:INSDC:YOR126C"
                     /note="similar to Saccharomyces cerevisiae IAH1 (YOR126C);
                     ancestral locus Anc_5.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685692.1"
                     /db_xref="GeneID:11531413"
                     /db_xref="GOA:G8BTN0"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:G8BTN0"
                     /translation="MSMVYDSFLLFGDSITEFCYNSDMENMQGTQFTLGAALSNVYTR
                     KMSIIQRGFSGYTSRWGVKILPKVLEQDSSIKIAYIFFGSNDASSGGLQHVPLEEYKE
                     NTKKMLHMLKKKGIKPILIGPAVHNLEYWNSTKPEEAASGNFRTNKAFKAYSDACSAL
                     ANEEGIPFVNLNAAFTKAGDDSWKNLLGDGLHFNGAGYKVMFDELMKEISNHYPEYSP
                     ANMAYKLPNWREISPSGDSLDKFL"
     gene            <337199..>338557
                     /gene="TPHA0E01660"
                     /locus_tag="TPHA_0E01660"
                     /db_xref="GeneID:11531414"
     mRNA            <337199..>338557
                     /gene="TPHA0E01660"
                     /locus_tag="TPHA_0E01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685645.1"
                     /db_xref="GeneID:11531414"
     CDS             337199..338557
                     /gene="TPHA0E01660"
                     /locus_tag="TPHA_0E01660"
                     /inference="similar to DNA sequence:INSDC:YDR375C"
                     /note="similar to Saccharomyces cerevisiae BCS1 (YDR375C);
                     ancestral locus Anc_5.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685693.1"
                     /db_xref="GeneID:11531414"
                     /db_xref="GOA:G8BTN1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTN1"
                     /translation="MSDSDGIEARESKPLTVDIPITSNNNDDSFKGKIKSLINNAMEN
                     NPYFAAGGGLMILGTGLALAKSGVAMGSSLLYRNLIVDLEIQSKDKSYSWFLTWMAKH
                     PQRISKHLAVKTQYVQHNNGSVTTKFDFVPGPGNHWIRYKGAFIYVKRERSSRMVDLT
                     NGSPFETVSLTTLYRDRYLFNEILTEAKELAVKSSEGKTVLYTSFGPEWRPFGQPKAK
                     RAIESVILDKNIKEDILKDVNDFLRNGQWYSERGIPYRRGYLLYGPPGSGKTSFIQAL
                     AGALDYNICILNLSENNLTDDRLNHLMNNMPERSVLLLEDIDAAFNKRTLNSESGYQT
                     SVTFSGLLNALDGVTSSEETITFMTTNHPEKLDPAILRPGRVDFKQFVGNATEYQIKN
                     MFLKFYPNENTLCNEFMKKAASLKKPISTAQLQGLFVMNKDDPKAAVATINTISDPIN
                     FN"
     gene            complement(<338639..>338878)
                     /gene="TPHA0E01670"
                     /locus_tag="TPHA_0E01670"
                     /db_xref="GeneID:11531411"
     mRNA            complement(<338639..>338878)
                     /gene="TPHA0E01670"
                     /locus_tag="TPHA_0E01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685646.1"
                     /db_xref="GeneID:11531411"
     CDS             complement(338639..338878)
                     /gene="TPHA0E01670"
                     /locus_tag="TPHA_0E01670"
                     /inference="similar to DNA sequence:INSDC:YDR374W-A"
                     /note="similar to Saccharomyces cerevisiae YDR374W-A;
                     ancestral locus Anc_5.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685694.1"
                     /db_xref="GeneID:11531411"
                     /db_xref="UniProtKB/TrEMBL:G8BTN2"
                     /translation="MSNNILQNYLLRELKNSSNVDTIDIEDNDFLILNCIYDQLLIKI
                     IETANDFAKQDRSLDVLPEHINRAYRQIANEDSVV"
     gene            <339941..>340936
                     /gene="TPHA0E01680"
                     /locus_tag="TPHA_0E01680"
                     /db_xref="GeneID:11531333"
     mRNA            <339941..>340936
                     /gene="TPHA0E01680"
                     /locus_tag="TPHA_0E01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685647.1"
                     /db_xref="GeneID:11531333"
     CDS             339941..340936
                     /gene="TPHA0E01680"
                     /locus_tag="TPHA_0E01680"
                     /inference="similar to DNA sequence:INSDC:YDR374C"
                     /note="similar to Saccharomyces cerevisiae YDR374C;
                     ancestral locus Anc_5.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685695.1"
                     /db_xref="GeneID:11531333"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="UniProtKB/TrEMBL:G8BTN3"
                     /translation="MDYTTYSSQSSVFSPFPNYKPLTENTFHNEQQQQPHRTIEDSLR
                     GLESFFTNDLLGNPIVENNSLETNTIDIKHKTDFNCNDNNYLHDNISLNHIQHNGLTY
                     DTSGKIASPNNLYYNSQSYEYKNADTFLSLSQQQPQYNDQIPRSIPFDMSAKSIYLNP
                     KLSMAIVPKWVNVPEGSKFFVIKSSNIEHIQKSYYNRIWSSTYFGNKRLSEAFISLEY
                     DSKIFLLFSVTKSGRFCGVAEMTSNIQDNLDTSIWEDDDKKFGQAFKVRWVFVRDVHN
                     RNLKHFLIPANEMKPITNSRDTQEIPFSIGNSIIKLFKDKTKNTAITSFLDECYE"
     gene            <341388..>342092
                     /gene="TPHA0E01690"
                     /locus_tag="TPHA_0E01690"
                     /db_xref="GeneID:11531490"
     mRNA            <341388..>342092
                     /gene="TPHA0E01690"
                     /locus_tag="TPHA_0E01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685648.1"
                     /db_xref="GeneID:11531490"
     CDS             341388..342092
                     /gene="TPHA0E01690"
                     /locus_tag="TPHA_0E01690"
                     /inference="similar to DNA sequence:INSDC:YOR125C"
                     /note="similar to Saccharomyces cerevisiae CAT5 (YOR125C);
                     ancestral locus Anc_5.445"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685696.1"
                     /db_xref="GeneID:11531490"
                     /db_xref="GOA:G8BTN4"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:G8BTN4"
                     /translation="MFCKQCSKSLIQRRTFSVLGNLKKSNNVGKPFKQNNNSQIRYSP
                     LDDAQTAYLDRVIRVDQAGELGANYIYAGQFFVLANKFPHLKPILQHMWDQEIHHHNT
                     FNELQIRNRVRPSLITPFWKLGAFFMGAGTASISSEAAMACTEAVETVIGKHYNEQLR
                     CLSNQYVQNKTDGSKGLPDEVKSLTDVITQFRDDELEHLNTAIEYDSKKAVPYIMLTE
                     AIKSICRVAIWSAERV"
     gene            complement(<342422..>342994)
                     /gene="TPHA0E01700"
                     /locus_tag="TPHA_0E01700"
                     /db_xref="GeneID:11531477"
     mRNA            complement(<342422..>342994)
                     /gene="TPHA0E01700"
                     /locus_tag="TPHA_0E01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685649.1"
                     /db_xref="GeneID:11531477"
     CDS             complement(342422..342994)
                     /gene="TPHA0E01700"
                     /locus_tag="TPHA_0E01700"
                     /inference="similar to DNA sequence:INSDC:YDR373W"
                     /note="similar to Saccharomyces cerevisiae FRQ1 (YDR373W);
                     ancestral locus Anc_5.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685697.1"
                     /db_xref="GeneID:11531477"
                     /db_xref="GOA:G8BTN5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:G8BTN5"
                     /translation="MGAKASKLTKDDIASLKQSTYFDRREIQQWHKGFLRDFPSGKLT
                     REDFVNIYKQYFPFGYPEEFANHIFNVFDKDHREFIDFYEFITILSITSRGTQEEKLA
                     WAFRLYDLNNDGYITYDEMYTIVSSIYKMMGSMVKLSEDEATPELRVNKIFKIMDKDD
                     DGYITLEEFREGSKVDPSIVGALNLYSGLV"
     gene            <343977..>347828
                     /gene="TPHA0E01710"
                     /locus_tag="TPHA_0E01710"
                     /db_xref="GeneID:11531325"
     mRNA            <343977..>347828
                     /gene="TPHA0E01710"
                     /locus_tag="TPHA_0E01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685650.1"
                     /db_xref="GeneID:11531325"
     CDS             343977..347828
                     /gene="TPHA0E01710"
                     /locus_tag="TPHA_0E01710"
                     /inference="similar to DNA sequence:INSDC:YOR124C"
                     /note="similar to Saccharomyces cerevisiae UBP2 (YOR124C);
                     ancestral locus Anc_5.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685698.1"
                     /db_xref="GeneID:11531325"
                     /db_xref="GOA:G8BTN6"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8BTN6"
                     /translation="MLEDTLINHIEYELDSESMDVDNDVNSTSNLQIDSNVSRDVGTD
                     VELSDEIQVPVSVIGNEMGLNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMK
                     VINSKENCNTLRYNEQFNNSILKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKS
                     VTCPNHNKIEVFMGVLIDSTQKANTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSK
                     FHLVKELHPFDQKDLLTFDKNAANLIDHAIYVSEDTNKLILIEIFNPEFDSQEERGLF
                     TPNVINQRYLHSLAEGEEPSTEDIPTGIECINTLFKVFKGPLTRKSSNDPIKRINSDN
                     PILRLHMNPEWLVSKYGFNMVLEKDVETGDEFTEYEPPDLTDYVSNQQTRKIRESVTR
                     KCLELIFFGKMMINLLSKEELEKSSKSLRTFNLLQTSFSTSFFKLLIQERGVGLPIEN
                     QSNYNIDYHFINLSVSYHYSERDIIQMFEVISKVDPDNIGHYYDSLQFIANAKGSYQL
                     IAYCSKLDIVGQESLETAIKTFNLDLSVTALSSLEDSVIMSIYQAELKNKSLSQERHV
                     NLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAYNMLEIDESIDDDIIQTAYSIKVND
                     APGLKLDCDRALYTIAIARRSISLFNFLLENNLIFQEYYTADTFSYTSALSLLQVNEN
                     ASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKIAFQRNSKLISNFLETGVIDPSCL
                     PAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTVDDIENNLQLQGITRRV
                     GGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELAYLAFAPSNVEVEFDSE
                     DGKSQRDNISTETVDVGADGKNDNLLVDFDSNIGANGRDEKLLVDLDSNISDKIKEEE
                     VKKINTLKPVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDD
                     EEQNDLLKNCFLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFN
                     DELLQMEEYGEVRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDR
                     YAELDNKELIDTKNKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDV
                     LDNNGIDVPMKTSLISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLF
                     AVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLV
                     YVKNENIDDIEPLKRIVSDCA"
     gene            complement(<348101..>349714)
                     /gene="TPHA0E01720"
                     /locus_tag="TPHA_0E01720"
                     /db_xref="GeneID:11531326"
     mRNA            complement(<348101..>349714)
                     /gene="TPHA0E01720"
                     /locus_tag="TPHA_0E01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685651.1"
                     /db_xref="GeneID:11531326"
     CDS             complement(348101..349714)
                     /gene="TPHA0E01720"
                     /locus_tag="TPHA_0E01720"
                     /inference="similar to DNA sequence:INSDC:YDR371W"
                     /note="similar to Saccharomyces cerevisiae CTS2 (YDR371W);
                     ancestral locus Anc_5.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685699.1"
                     /db_xref="GeneID:11531326"
                     /db_xref="GOA:G8BTN7"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="UniProtKB/TrEMBL:G8BTN7"
                     /translation="MVNPNIYIFSSCIFIAAVTFGFEMVLYNIYKKYTDQLQRFDAKP
                     GNISSELNQHDREYDPIMKPENSEQNNGTENSLYSMGVYYSNWSPYSPRLFFPHDIDT
                     SRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLYLSLGQVDNDFDSVPISMKKE
                     LLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGWSNREAFPKMVRDPQKVDKFIN
                     SCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMKMLELEATIYKDAISHNT
                     SYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLFSPP
                     DVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKSKTN
                     GKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDN
                     SQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNIDKQKSMFSNRK
                     VLEYYLMKYGKQGFLSGYILSVLNRMNET"
     gene            <350455..>351864
                     /gene="TPHA0E01730"
                     /locus_tag="TPHA_0E01730"
                     /db_xref="GeneID:11531510"
     mRNA            <350455..>351864
                     /gene="TPHA0E01730"
                     /locus_tag="TPHA_0E01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685652.1"
                     /db_xref="GeneID:11531510"
     CDS             350455..351864
                     /gene="TPHA0E01730"
                     /locus_tag="TPHA_0E01730"
                     /inference="similar to DNA sequence:INSDC:YOR123C"
                     /note="similar to Saccharomyces cerevisiae LEO1 (YOR123C);
                     ancestral locus Anc_5.440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685700.1"
                     /db_xref="GeneID:11531510"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:G8BTN8"
                     /translation="MSAEESAQDPVNSMAAVTGEKNANENATIVEDNSVAEQVEEQGG
                     EQVEAEEEEIDDLFGDDDNEEDDGEDESILRKKRGVAESGDDDDEHNDHDDIARRRRG
                     YMDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDN
                     SKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDEN
                     TIRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQ
                     ELMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEK
                     KELEKKQSQIFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPSYDPRRE
                     RADEYEEDDFIVDDEGEEDDDVEDDVEDEEDEDEEEEEEEEERNLERLKNSKTQNDFE
                     VEEDSKRRKVAVIDDEDDE"
     gene            <352358..>352821
                     /gene="TPHA0E01740"
                     /locus_tag="TPHA_0E01740"
                     /db_xref="GeneID:11531470"
     mRNA            join(<352358..352370,352454..>352821)
                     /gene="TPHA0E01740"
                     /locus_tag="TPHA_0E01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685653.1"
                     /db_xref="GeneID:11531470"
     CDS             join(352358..352370,352454..352821)
                     /gene="TPHA0E01740"
                     /locus_tag="TPHA_0E01740"
                     /inference="similar to DNA sequence:INSDC:YOR122C"
                     /note="similar to Saccharomyces cerevisiae PFY1 (YOR122C);
                     ancestral locus Anc_5.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685701.1"
                     /db_xref="GeneID:11531470"
                     /db_xref="GOA:G8BTN9"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:G8BTN9"
                     /translation="MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEAT
                     EIAKGFDDPSGLQTTGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYP
                     PTVQAGEATKIVEQLADYLIGVQY"
     gene            <353257..>354636
                     /gene="TPHA0E01750"
                     /locus_tag="TPHA_0E01750"
                     /db_xref="GeneID:11531217"
     mRNA            <353257..>354636
                     /gene="TPHA0E01750"
                     /locus_tag="TPHA_0E01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685654.1"
                     /db_xref="GeneID:11531217"
     CDS             353257..354636
                     /gene="TPHA0E01750"
                     /locus_tag="TPHA_0E01750"
                     /note="ancestral locus Anc_5.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685702.1"
                     /db_xref="GeneID:11531217"
                     /db_xref="UniProtKB/TrEMBL:G8BTP0"
                     /translation="MIRDSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVIS
                     NPVKSVQDVNLIFQNIRNNLILSGLYKNVDVKLDLDERASLLNHSLKLSTEQIGIESV
                     VPISATLNMTPLYLTPYKNYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQ
                     TKSEIDKKSIDAKFTMPLLRNSSIRTILESKCSIAKPRNDTMKQFELNIGLTKLKLIG
                     GIKSLPIFYSGLNIQRKQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFY
                     TSKFPSGGHLFKLVHQHVLNETNSISNEIKKNISNINMSFEKHISTLNDQITSSFIFD
                     GHVGVPLQSTFANLNSGEFWDNEKEIFKTLCQNDIKVSHKVGLVSSFRVPNIPITSPI
                     RFQLSVLGINKSKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLIHGNDNKHSGL
                     SFDVAVTYC"
     gene            complement(<354862..>355794)
                     /gene="TPHA0E01760"
                     /locus_tag="TPHA_0E01760"
                     /db_xref="GeneID:11531220"
     mRNA            complement(<354862..>355794)
                     /gene="TPHA0E01760"
                     /locus_tag="TPHA_0E01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685655.1"
                     /db_xref="GeneID:11531220"
     CDS             complement(354862..355794)
                     /gene="TPHA0E01760"
                     /locus_tag="TPHA_0E01760"
                     /inference="similar to DNA sequence:INSDC:YDR368W,YOR120W"
                     /note="similar to Saccharomyces cerevisiae YPR1 (YDR368W)
                     and GCY1 (YOR120W); ancestral locus Anc_5.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685703.1"
                     /db_xref="GeneID:11531220"
                     /db_xref="GOA:G8BTP1"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8BTP1"
                     /translation="MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAG
                     YRHIDTAAIYGNEEEVGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLD
                     YVDLYLMHWPVPINDAQCKKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKSK
                     VKSIGVSNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYS
                     PLGSTGAPILELGTINEVSKKLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTM
                     ELPAEEFSKLNNISSEVGEKRSVKPNWTPFIPFV"
     gene            complement(<356743..>357396)
                     /gene="TPHA0E01770"
                     /locus_tag="TPHA_0E01770"
                     /db_xref="GeneID:11531150"
     mRNA            complement(<356743..>357396)
                     /gene="TPHA0E01770"
                     /locus_tag="TPHA_0E01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685656.1"
                     /db_xref="GeneID:11531150"
     CDS             complement(356743..357396)
                     /gene="TPHA0E01770"
                     /locus_tag="TPHA_0E01770"
                     /inference="similar to DNA sequence:INSDC:YDR367W"
                     /note="similar to Saccharomyces cerevisiae YDR367W;
                     ancestral locus Anc_5.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685704.1"
                     /db_xref="GeneID:11531150"
                     /db_xref="InterPro:IPR013862"
                     /db_xref="UniProtKB/TrEMBL:G8BTP2"
                     /translation="MVIGTSGRVRMQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCS
                     GIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDT
                     ICTCFFTIYFCSHWFTEESNAGDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSR
                     FYFNFILASFTQQLFLHPKYMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA"
     gene            <357819..>359345
                     /gene="TPHA0E01780"
                     /locus_tag="TPHA_0E01780"
                     /db_xref="GeneID:11531294"
     mRNA            <357819..>359345
                     /gene="TPHA0E01780"
                     /locus_tag="TPHA_0E01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685657.1"
                     /db_xref="GeneID:11531294"
     CDS             357819..359345
                     /gene="TPHA0E01780"
                     /locus_tag="TPHA_0E01780"
                     /inference="similar to DNA sequence:INSDC:YOR119C"
                     /note="similar to Saccharomyces cerevisiae RIO1 (YOR119C);
                     ancestral locus Anc_5.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685705.1"
                     /db_xref="GeneID:11531294"
                     /db_xref="GOA:G8BTP3"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:G8BTP3"
                     /translation="MSLEGKFDKLKVHESEHINSKILEKYGHKIKTDELSDTKGKTNK
                     DKANRATVENVLDPRTMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNA
                     EVLPQISELEDVLNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRE
                     RYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVME
                     FLGRGDGFASPRLRDHQYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHD
                     DKLYVIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDK
                     FTGDPRSSVDLRNYIAHYLPVKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGK
                     FDLLKTLIASDNQKNFTASTQFDFNNDLSNLDANNDESDDNGESCDDSDSENDNESEE
                     DDDEYSDEEKQLKGKRYEDKDDKKKRKQEAKDVKREKRKTKVKKHIKKNLVKKTKSKK
                     "
     gene            <359679..>361004
                     /gene="TPHA0E01790"
                     /locus_tag="TPHA_0E01790"
                     /db_xref="GeneID:11531295"
     mRNA            <359679..>361004
                     /gene="TPHA0E01790"
                     /locus_tag="TPHA_0E01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685658.1"
                     /db_xref="GeneID:11531295"
     CDS             359679..361004
                     /gene="TPHA0E01790"
                     /locus_tag="TPHA_0E01790"
                     /inference="similar to DNA sequence:INSDC:YDR364C"
                     /note="similar to Saccharomyces cerevisiae CDC40
                     (YDR364C); ancestral locus Anc_5.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685706.1"
                     /db_xref="GeneID:11531295"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BTP4"
                     /translation="MRLSIDYSSSSESETISDNDNGKLHVSTKSQELHGSKRPFNLTK
                     SDLKRKRKQRKTKGPWGSWDSTTDNESITSEIDELEIKNYPDEVVSEDSDIEEISEFY
                     GSYLKDYKGRSFLTPSNDIDIDLQKPALSFKSYLPKKQLYRYKGHTNGTTDLKFFPNT
                     AHMFLSGGNDNMIRLWDFYHDRRCIRDYKGHKKAVRSVDFNNNGTVFFSSSYDQTVKI
                     WDTETGKVKAKVKCNSIPNDVKPRPLSDSEYIVGLSNSKINHYDQRVSSKNGLVQTYD
                     HHQGSILCLKYFPDGSKFISSSEDKTVRIWENKINIPIKQIADTTQHSMPYMDIHPEG
                     HYFSTQSMDNTIYSYGMKPKYKRQNKKVFKGHQSVGYKISLSFSPDGRYICSGDTNSR
                     VFIWDWKTTKLLRCLTINGNKPITQVTWHPQETSKLLCSGGSGYIYIYD"
     gene            complement(<361866..>362138)
                     /gene="TPHA0E01800"
                     /locus_tag="TPHA_0E01800"
                     /db_xref="GeneID:11531184"
     mRNA            complement(<361866..>362138)
                     /gene="TPHA0E01800"
                     /locus_tag="TPHA_0E01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685659.1"
                     /db_xref="GeneID:11531184"
     CDS             complement(361866..362138)
                     /gene="TPHA0E01800"
                     /locus_tag="TPHA_0E01800"
                     /inference="similar to DNA sequence:INSDC:YDR363W-A"
                     /note="similar to Saccharomyces cerevisiae SEM1
                     (YDR363W-A); ancestral locus Anc_5.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685707.1"
                     /db_xref="GeneID:11531184"
                     /db_xref="InterPro:IPR007834"
                     /db_xref="UniProtKB/TrEMBL:G8BTP5"
                     /translation="MKNTESENTTPTTSNDASKKKTLEDDDEFEDFPADVWQNYEKVQ
                     NKTNIQNDLWEDDWDDVEVDDDFTKELRAELEKQKQSQNQNQNQNQ"
     gene            complement(362423..362495)
                     /gene="TPHA0Etrna5K"
                     /locus_tag="TPHA_0Etrna5K"
                     /db_xref="GeneID:11531340"
     tRNA            complement(362423..362495)
                     /gene="TPHA0Etrna5K"
                     /locus_tag="TPHA_0Etrna5K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11531340"
     gene            complement(<364173..>365534)
                     /gene="TPHA0E01810"
                     /locus_tag="TPHA_0E01810"
                     /db_xref="GeneID:11531431"
     mRNA            complement(<364173..>365534)
                     /gene="TPHA0E01810"
                     /locus_tag="TPHA_0E01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685660.1"
                     /db_xref="GeneID:11531431"
     CDS             complement(364173..365534)
                     /gene="TPHA0E01810"
                     /locus_tag="TPHA_0E01810"
                     /inference="similar to DNA sequence:INSDC:YDR363W"
                     /note="similar to Saccharomyces cerevisiae ESC2 (YDR363W);
                     ancestral locus Anc_5.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685708.1"
                     /db_xref="GeneID:11531431"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BTP6"
                     /translation="MSDDGDDDDFFMNTDDDPDSYVQEEQVFVNSTEQNITKVVVSEE
                     IHNISKTKVPQTSIFIDSESESETGHTSSSDQNIQKQYVLEVRKLHTGSKRRESDIKS
                     NSANSTDFSDTGSLEMVNYNNTDRTYRSKRRRSQRENIIDEREIRPSGIDADDEFFKA
                     IREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPIL
                     NTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISELEIILI
                     SKEEEQKFEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWNSKD
                     FNVTNDVLDVSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNKK
                     IFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIGDNDIEDEDIVEM
                     IIE"
     gene            complement(<365822..>367819)
                     /gene="TPHA0E01820"
                     /locus_tag="TPHA_0E01820"
                     /db_xref="GeneID:11531151"
     mRNA            complement(<365822..>367819)
                     /gene="TPHA0E01820"
                     /locus_tag="TPHA_0E01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685661.1"
                     /db_xref="GeneID:11531151"
     CDS             complement(365822..367819)
                     /gene="TPHA0E01820"
                     /locus_tag="TPHA_0E01820"
                     /inference="similar to DNA sequence:INSDC:YHR109W"
                     /note="similar to Saccharomyces cerevisiae CTM1 (YHR109W);
                     ancestral locus Anc_5.419"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685709.1"
                     /db_xref="GeneID:11531151"
                     /db_xref="UniProtKB/TrEMBL:G8BTP7"
                     /translation="MQSLIEWYKLNTGIRVHDNVIIKESFDGSVSAGFGLYLNRGELF
                     DTIDRNKDTQIVLLRIPKHNTFNINTLLEILKDRNQYDSIEDFENTNKIISNLFKKFT
                     TFLSGNNLMNIFLSETTIIIFYFSIFSWMIKQNMFIPEQFKYYLMKVLQVTKIDSKYN
                     YKLPILRDIYKQYPFMDTVEKHIEAYETFFYDNEIKIDEDTLLQLYFAITSRVLEIPE
                     ALANVNTKDDELKDTEDYVVSSTLVPILDFVNHSNQYTNAYFDIDRKTDDVLLVFDIE
                     KYQSLPIKYTLTTGEYIEVYISYSKVEEVNHFLNVYGFLPKPNTGSDTKTFQSYTLSF
                     DRDYLTKVPMSISNEDEDVNIRDFYKWFEISPAISLVNINGEWKISRDVQLLQVLLPF
                     ISKESNSFYWEYDKHYAKLLAYLNSLVEGLEEELGHVKFLYELYESHIRSRIQNPEND
                     RVGVPQLAWILHKVEYQTESEDSKKSSDDSGKYSEDSEGDLEDSKKHLTYPLICRPSL
                     ETVMEYVYDKVKYDATPACFLSYLKDFCSSRLNILKEKSKLSIKTGNKIETGRIAIEE
                     RILQNLTDQLLAIINGEAPSQSLFCTNYDTPSRFPYLSKETKVLDCLSLNDINDDIDK
                     NSVEDIDNLFKNEDMDYFSQYIHFFIDVSRGNIPYLEVEPN"
     gene            <369068..>370321
                     /gene="TPHA0E01830"
                     /locus_tag="TPHA_0E01830"
                     /db_xref="GeneID:11531230"
     mRNA            <369068..>370321
                     /gene="TPHA0E01830"
                     /locus_tag="TPHA_0E01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685662.1"
                     /db_xref="GeneID:11531230"
     CDS             369068..370321
                     /gene="TPHA0E01830"
                     /locus_tag="TPHA_0E01830"
                     /inference="similar to DNA sequence:INSDC:YHR107C"
                     /note="similar to Saccharomyces cerevisiae CDC12
                     (YHR107C); ancestral locus Anc_5.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685710.1"
                     /db_xref="GeneID:11531230"
                     /db_xref="GOA:G8BTP8"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTP8"
                     /translation="MSSIPVSAENTSQIVGISNLPNQRYKIVNEHGGHFTMMVCGESG
                     LGKTTFVNTLFQTTLKHCVQRPTSSSNTTSSRKTVEIDVIRAVLEEKNFKLRVNVIDT
                     PGFGDNVNNNKAWQRIIDFLDDQHDSYMRQEQQPYRDIKFDLRVHVVLYFIKPTGHGL
                     KPLDIETMKKIATRANLIPVIAKSDTLTQQELNTFKLRIRQVIEAQDIKIFTPPIDEN
                     VMGSSGNPIADANTDENSVAFNNTAAMEHARQLIESMPFAVVGSEHKFTNAQGTEVIA
                     RKYPWGLVEVENDAHCDFRKLRSLLLRTNLLDLILSTEDIHYESYRALRLGGSKQEET
                     DNSSVPIPTPARKLLSSNPKYKEEENALKKYFTEQVKAEEQRFRQWEQNIVNERLRLN
                     SDLKDIQDKVKKLEDQVRNLQLKKY"
     gene            complement(<370631..>371683)
                     /gene="TPHA0E01840"
                     /locus_tag="TPHA_0E01840"
                     /db_xref="GeneID:11531231"
     mRNA            complement(<370631..>371683)
                     /gene="TPHA0E01840"
                     /locus_tag="TPHA_0E01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685663.1"
                     /db_xref="GeneID:11531231"
     CDS             complement(370631..371683)
                     /gene="TPHA0E01840"
                     /locus_tag="TPHA_0E01840"
                     /inference="similar to DNA sequence:INSDC:YDR353W,YHR106W"
                     /note="similar to Saccharomyces cerevisiae TRR1 (YDR353W)
                     and TRR2 (YHR106W); ancestral locus Anc_5.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685711.1"
                     /db_xref="GeneID:11531231"
                     /db_xref="GOA:G8BTP9"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8BTP9"
                     /translation="MSMLGNILLRKGLTYSSPQNSATSNEVLKKMVHNKVTIIGSGPA
                     AHTAAIYLARAEYPPTLYEGMFANGIAAGGQLTTTTEIENFPGFPDGLDGSELVERMK
                     QQSIKFGTTVITETISKVDLSSRPFKLWTEFNEDADPITTDALIIATGASAKRMHVPG
                     EDTYWQKGISACAVCDGAVPIFRNKPLAVVGGGDSACEEAEFLTKYGSKIFLLVRKDH
                     LRASTIMQRRVEKNPKIDILYNTELKEAKGDGKLLQSLAIFNNKENTNSDLPVNGLFY
                     AIGHTPATAIVKGQVDQDEVGYIKTVPGTSLTSVKGVFAAGDVQDSRYRQAITSAGSG
                     CMAGLDAEKYLQELYD"
     gene            complement(<372162..>372659)
                     /gene="TPHA0E01850"
                     /locus_tag="TPHA_0E01850"
                     /db_xref="GeneID:11531141"
     mRNA            complement(<372162..>372659)
                     /gene="TPHA0E01850"
                     /locus_tag="TPHA_0E01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685664.1"
                     /db_xref="GeneID:11531141"
     CDS             complement(372162..372659)
                     /gene="TPHA0E01850"
                     /locus_tag="TPHA_0E01850"
                     /inference="similar to DNA sequence:INSDC:YHR105W"
                     /note="similar to Saccharomyces cerevisiae YPT35
                     (YHR105W); ancestral locus Anc_5.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685712.1"
                     /db_xref="GeneID:11531141"
                     /db_xref="GOA:G8BTQ0"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ0"
                     /translation="MNNLKSVTPEPINLIDEENDDLEVVLNKNNGSDEITGIHKVIVS
                     DYNIIENEIVVWKLTVVLLRRRENIEKKLELYKYKRFSDFKTLRDKIIADNKKKDVPL
                     KFNLPELPPSVPWYNKWQYVSYNLNPNWLNKRQQGLEYFINYIICDSRILKQNKEIIY
                     EFLNL"
     gene            complement(<373074..>374054)
                     /gene="TPHA0E01860"
                     /locus_tag="TPHA_0E01860"
                     /db_xref="GeneID:11531337"
     mRNA            complement(<373074..>374054)
                     /gene="TPHA0E01860"
                     /locus_tag="TPHA_0E01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685665.1"
                     /db_xref="GeneID:11531337"
     CDS             complement(373074..374054)
                     /gene="TPHA0E01860"
                     /locus_tag="TPHA_0E01860"
                     /inference="similar to DNA sequence:INSDC:YHR104W"
                     /note="similar to Saccharomyces cerevisiae GRE3 (YHR104W);
                     ancestral locus Anc_5.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685713.1"
                     /db_xref="GeneID:11531337"
                     /db_xref="GOA:G8BTQ1"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ1"
                     /translation="MSKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFD
                     GAQDYGNEKEVGEGINQAISEGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKL
                     DYLDLYYIHFPIAFKFVPFEEKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLAT
                     DGLIKSIGISNFNGALIQDLLRSCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAY
                     SSFGPQSFLELNVQKALDAKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKS
                     SKKERLLENLLIDEKLTLSEQELSTISDLNIGLRFNDPWDWNNMKFPIFA"
     gene            complement(<375186..>376178)
                     /gene="TPHA0E01870"
                     /locus_tag="TPHA_0E01870"
                     /db_xref="GeneID:11531332"
     mRNA            complement(<375186..>376178)
                     /gene="TPHA0E01870"
                     /locus_tag="TPHA_0E01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685666.1"
                     /db_xref="GeneID:11531332"
     CDS             complement(375186..376178)
                     /gene="TPHA0E01870"
                     /locus_tag="TPHA_0E01870"
                     /inference="similar to DNA sequence:INSDC:YDR352W"
                     /note="similar to Saccharomyces cerevisiae YDR352W;
                     ancestral locus Anc_5.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685714.1"
                     /db_xref="GeneID:11531332"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ2"
                     /translation="MLSCKESGWTVLSDVAGSLAFLTSFISLMPQIIETYNIKTVEGL
                     SPYFLLCWLMGDITSTIGAIITEQLFFQILLSLYFFANDLTVCLQYYYYGIIHNNELA
                     TLSHESKLILGDSDLIGDDDINNLDSPGVIERIRSRVSNSTISGRSAMVVASIASLAN
                     QASAHPIEIFTNQPNLHVLEKKYKNQGLGLFMSWLGASFYVGARIPQLIKNYQRKSTD
                     GLSPFLFLTTLLSNIAYNVSIFTSCKYLENDNKSDFLIYELPFIFGSAGTVIFDVIYF
                     YQHYVLYSKDMKFRQLERDVFTSLNDNLGDIPQYESLETNIRKNRATEQTPLLT"
     gene            complement(<376865..>379270)
                     /gene="TPHA0E01880"
                     /locus_tag="TPHA_0E01880"
                     /db_xref="GeneID:11531483"
     mRNA            complement(<376865..>379270)
                     /gene="TPHA0E01880"
                     /locus_tag="TPHA_0E01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685667.1"
                     /db_xref="GeneID:11531483"
     CDS             complement(376865..379270)
                     /gene="TPHA0E01880"
                     /locus_tag="TPHA_0E01880"
                     /inference="similar to DNA sequence:INSDC:YDR351W,YHR103W"
                     /note="similar to Saccharomyces cerevisiae SBE2 (YDR351W)
                     and SBE22 (YHR103W); ancestral locus Anc_5.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685715.1"
                     /db_xref="GeneID:11531483"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ3"
                     /translation="MSASNYDRFNRRSTDGRDMDFNSSQISATKRIGLGIAKRPGDNL
                     TAFSSSNGTNLGSTPIKGLASLMNRFSIESVDSDEMDQSVISSMDESSFITNNKIEVS
                     ANDKLYQLANEYTVDDGNTNPTQETSRKNNDGDMTPRTKYFFQNNTSKSKSHASLPIN
                     HDLKGNYNVKNKSGSRSSTALPSQNNLQHPPMNSQKFDNSKYARTNNHPVSQVKNIHG
                     ASKGIEYSQSTPTLPNTYHQANNVRTGKPMTPSQKYRSHKSNASLRRSIRRKEKYYEQ
                     EDANDSMELVEADVNNSLIWNVPMASYSTSSFLDAQVNLNKKNNKSYLVHSGQTGNEF
                     RPPSKFNIDYQRHSNNAASAPHLPAYDFSSMPLSPIPGINAKSDLQFIKETTQSLSSV
                     YLQSSNRLSKSKLLERTDSAETLPIELKDASNNGMEDLILVSENKLNMVSHTRPSWLP
                     PKDTEEKKKHESQISKSMSIASIDQLDRNKDSEERRLKDETNRAKFTLLLETGITRNS
                     SIKTLKKLIWETSLPTELRYAIYDESLQSNIRFISSSYIESFPQMMQLFNNMSFPRIK
                     EIEIEKLIESGITSKINGNYEISENLALLLQLKSISQQGLVAGDEMLFHHFLLDPSIS
                     GSLEKVWDIVNLIQLTCFNDVVHSKYDEKILEPNGVIYRHIGVDPSYKNEFNSDTLNF
                     LTWWNILERIDHNLFMWVIDIIVIHNTQSFKNYPIKKEDFGNKSWEYYKTKRVVSNYK
                     ILLSFTLSVLLNYHFQYNDLKSLALLDDQSFCIPMPLDELVDETYVNSVFIKKWLQYY
                     TKF"
     gene            <380319..>380873
                     /gene="TPHA0E01890"
                     /locus_tag="TPHA_0E01890"
                     /db_xref="GeneID:11531484"
     mRNA            <380319..>380873
                     /gene="TPHA0E01890"
                     /locus_tag="TPHA_0E01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685668.1"
                     /db_xref="GeneID:11531484"
     CDS             380319..380873
                     /gene="TPHA0E01890"
                     /locus_tag="TPHA_0E01890"
                     /inference="similar to DNA sequence:INSDC:YHR100C"
                     /note="similar to Saccharomyces cerevisiae YHR100C;
                     ancestral locus Anc_5.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685716.1"
                     /db_xref="GeneID:11531484"
                     /db_xref="InterPro:IPR010021"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027706"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ4"
                     /translation="MINYSATLNCFKLFYNPKLCMPNMTVPSFNQIPLPIGSNIKAIV
                     LDKDNCFAYPYKNEVWPEYIDKWNQLKRQYPDKSILIVSNSVGSSDDVGYNEAQLLEK
                     KLGIPVLRHKIKNQDVKMRYWNIFILKIIDNPNQIAIVGDRLFTDVMMANLMGAYSVW
                     VKDGVSISDSPISKFEKRLYDFLK"
     gene            complement(<381017..>392239)
                     /gene="TPHA0E01900"
                     /locus_tag="TPHA_0E01900"
                     /db_xref="GeneID:11531201"
     mRNA            complement(<381017..>392239)
                     /gene="TPHA0E01900"
                     /locus_tag="TPHA_0E01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685669.1"
                     /db_xref="GeneID:11531201"
     CDS             complement(381017..392239)
                     /gene="TPHA0E01900"
                     /locus_tag="TPHA_0E01900"
                     /inference="similar to DNA sequence:INSDC:YHR099W"
                     /note="similar to Saccharomyces cerevisiae TRA1 (YHR099W);
                     ancestral locus Anc_5.402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685717.1"
                     /db_xref="GeneID:11531201"
                     /db_xref="GOA:G8BTQ5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ5"
                     /translation="MSFAEHIDHFVSLCNDENATLQSKHTELSEVCDAIELLNSQDDY
                     EGFLKAVIPVLLKELNTVSCNFNTASAEHKFRNSILDILNRCPMNELFEPHVDVVLDS
                     LIKILPEENEENGVLCMKVLTALFKSYKHILQDKVPLFIDIISKVYKDTPQLVLDIFS
                     EEKEDDNMLELEENPDDNLLEDSSIYSQSNSLTDDNKGDSFDAVTNSKAQSSMHSFKI
                     LAECPITMVTLYSSYRQLTSVSLPEFTPLVMDLLNIQIEQQKKSREEAEANGKRFISV
                     SPNIKNRPAFFDFILAQIKAISFLAYIFIRGYAPNFLQNYVEQVPDLIIRLLQDCPSK
                     LSSARKELLHATRHILSTNYKSLFLPKLHDLFDESVLIGTGFTTHETLRPLAYSTIAD
                     FIHNIRAELQLNDIEKTIKKYTNYMLDPTLALTVQIMSAKLLLNLVERILKLGKENPQ
                     EAQRAKKLLMTIIDAYTKRCHMINMKYDSILKSSEEYEQKKREKAKELQNSAFNDNSY
                     SKEFMDKLFLIEDSNNNESDQSDDKNKTEDNEDESFKNEGNEKEDVVFNKFDLKSYTP
                     IQIVPDSTNDPIKDAFYLYRTLMSFLKTIIHDLKVFNPPYNEYTAANPKLWASVSRGF
                     SYEEVLVFKNLFHECIIGLKFFSVLIKNLISHEKHFDITMPSLPVSATKDGRELMDYL
                     AIMFIQLDSSTFNEIIESEIEFMYESMLNDSALLYVAQSFLTSETTSPNFAGILLRFL
                     KKNLKDLGNIDFNESNILIRLFKLSFMSVNLFPNINEIVLLPHLNDLILDSIKFSTTA
                     EEPIVYFYLIRTLFRSIGGGRFENLYRSIKPILQHLLQALNDMIVTARLPHERELYVE
                     LCITVPVRLSVLAPYLPYLMKPLVYALQGYPDLISQGLRTLELCIDNLTAEYFDPIIE
                     PVIEDIMASLFSLLKPQPFNHTISHTTVRILGKLGGRNRRLLKDTSNLKSKDEYDSEI
                     EALFSVNGMVEDIPFSITPGVKSAINILQDDRVDIHYKKSAYKYVSSVLLLMIKSSTV
                     FPDNYSGIIETITKSSFFEDIEQPPNFELEPLIDEVEFSKQEELFVKLLEGLFFATSI
                     PDVKEEATNVLNLLTDHFCLLQLNRTLSDKRRFSTVFNVDMKQPKIRINPNVLTKALL
                     FALSYYISDVRETGLKIIERIYTQSKIIYTEEYYLSHSFVYELLKQFIHHCYEEAYYD
                     KNAGVLGIKALCENLHVPVDFLEKYRFELVDALLFVLKDTPYEAPTAIVKTAENLIID
                     ILSTTCKNITESDLSMKSLQNTLTDIVCELSNANVRVRKACQDFLSVISELSNIPIVK
                     LMDHSKNFLLSPIFTKPLRALPFSMQIGNVSAVTYYLELPDTFLSFDEELFRLLQETI
                     VLADAEDESLSTMQRVSEYKTSEQLVQLRVACVKLLAAALKNEKIATSQQGNVRIRIL
                     AVFFKCMLKSSPEIIDTTYDALKGVLSENSKLPKELLQNGLKPMLMNLSDHQKLTVHG
                     LESLARLLEILIAYFKVEIGKKLLDHLTAWCKCEVLDTIFGQDITDQMPTKIISSIVN
                     IFHLLPAQADMFLNELLLKVMLLERRLRLQLNSPFRTPLAKYMNRFHETVTEYFKKNM
                     GLRQLVLMMCSILKRPEAHDLADDFERELDNFYEYYLTNIPNNQVRVVSFFTNMVDLV
                     VTISDIRGKGWLKDKGDLIVKLKKLFELTLKTIKQNSFYIDNLQLNQAIEKLQLLYVQ
                     YMEFHMDKKELLFDFIEFSYSNEFALSSHIEDFIFSRIVKCDNVEEQNAYLNDALQFA
                     LSDRNIDAGIFILKNIVNASFIYESRKSGNIEKYFVEGQKPEWYSQIESKVWKSSNTV
                     LLSNLAGQHDIYRFELLQISTAFIKWAPDTISDIKMDVIKFIWHFIKVEDTLIKESAY
                     LVISHFICKFDLPVKVVTQVFVAILRCTQSEARYLVRQSLDILAPIIHRRMIEEGTPG
                     VWITWVKRVIFENNSNQNNALYKFLINHHGLFYDLRELFILNIIHHMNKITFIPNPNP
                     ESHTLAIDLVAMILKWEEHTNELRSKKVAIMEKESNIKTDAEGDVEMDDMITSENVTS
                     INDYIIPTHVREMYVAFLIRYICASNHRASESELGLKAICVLSSLLSKDHWNDVTVKL
                     NYFEKFFNYQDPSSENMVHYSMNALDVIYILFTNRSPEWIMENLATIQKLLDKCIRAD
                     HHDIQKVVQKVINLILKAIKVKEVIIDTEEETVGKTFVNTLVSIIDQDLQGTSSVVAG
                     VMLEWTLFMNFPQKVDSLLGSTMKTFSKLCKDHLSTSQPKDAAAIEEARITTKLLEKV
                     LCLLSKKVSNLGDSRRPFLSTVALLIDRSMNQNFLRKIIVIAKKWVFNNDLFPTVKEK
                     AAILTKMLAFEVRGEPSLSKMFYEIILELFDKSNFNNTEITVRMEQPFLVGTRVQEVT
                     IRKKFMEILDNSIERDIKERLYYIIRDQNWEFIADYPWLNQALQLLFGALDPDYELNL
                     SKSFSLPVPTELQDYSRSNIVIPEKASNTTLVEFIDGHIPKIKQLCDIKSKDIISPLI
                     EIFYQDSSTIHNTWVDVFPKIYTCIPRNEKYGFVRSLISLLSKDYHTKQLSSRTNVIT
                     MLLDSISRVDSLELPPHLVKYLALSYNSWYQSIKILEGIQDSSTIDNTKIIEANEDAL
                     LELYQNLQEDDMFYGLWRRRAKYTETNIALSYEQLGMWDKAQQVYELAQVKARSGSLP
                     YSESEYAVWEDNWVMCAEKLQHWDILTELAKHEGFTDLLLECGWRVADWNADKEALEQ
                     SVKSVMDVPTPRRQMFETFLSLQDFANKKTGDHEVRRLCDEGIQLSLQKWTSLPERFT
                     PSHKWLLHGFQQYIEFLEATQLYTNLHSTTIQNLDSKGQEIKRVLQAWRDRLPNITDD
                     VNMWNDLVTWRQHAFNVVNAAYLPLIPALQQASGNNNINTHAYRGYHEIAWVINRFAH
                     VARRHNMPKVCVNQLARIYTLPNIEIQEAFLKLREQAKCHYQNLTELTTGLDVISNTN
                     LVYFGTVQKAEFFTLKGMFLSKLRANEEANQAFATAVQIDLNLAKAWAQWGVFNDKRL
                     SEEPTNINYASNAISCYLQAAGLYKKAKTRRLLCRILWLISLDDTSGALSNAFDSFRG
                     EVPVWYWITFIPQLLTSLSHKEANMVRQILIRVAKSYPQALHFQLRTTKEDFAVIQRQ
                     SQAVMADKSNPKAQSPNEQISRQPWEYLQELNNILKTAYPLLALSLESLVAQINDRFK
                     TTTDEDLFRLINVLLFDATFNYNHLPLPRGNPKLPSNTEDNLVRFSETLLSAHIRPKF
                     NADFIDSKPDFETYIKRLRYWRRRIENKLDRVPRVEYLERLCPHLSNFHHQKFEDIEV
                     PGQYLLNKDNNAHFTKIVKFLPEVDFVRTTHSSYRRITIRGHDGSLHTFAVQYPAVRH
                     SRREERMFQLFRLFNKTLDKNVETGRRNCNFTLPIAVPLSPQVRLMNDSPSFVTMHQI
                     YDHHCAKNNTEPDAIQDYVLEQLDFAHDKALPTPDITAVKVEIFSSIQSMFMPTTVLK
                     NYFSSLYTQFEEFWLFRKQFTSHYASFIFMTYMMMINNRTPHKIYVDKKSGNVFTLEM
                     LPSRYPFERIKPYMPNSDIKLPNDAPIFHNNEPVPFRLTPNIQKLIGDSGLEGVLSVN
                     IFAISKALMEPENELNTYLTLFIRDEIISWYSNLHRPIVENPQLHEMVQTNVDLIIRK
                     VAQLSHIGSAPLVTTQFILDCISSAVNPRNLAKTDIVYIPWF"
     gene            complement(392769..392841)
                     /gene="TPHA0Etrna1M"
                     /locus_tag="TPHA_0Etrna1M"
                     /db_xref="GeneID:11531386"
     tRNA            complement(392769..392841)
                     /gene="TPHA0Etrna1M"
                     /locus_tag="TPHA_0Etrna1M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11531386"
     gap             393102..393927
                     /estimated_length=826
     gene            <393982..>395856
                     /gene="TPHA0E01920"
                     /locus_tag="TPHA_0E01920"
                     /db_xref="GeneID:11531393"
     mRNA            <393982..>395856
                     /gene="TPHA0E01920"
                     /locus_tag="TPHA_0E01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685670.1"
                     /db_xref="GeneID:11531393"
     CDS             393982..395856
                     /gene="TPHA0E01920"
                     /locus_tag="TPHA_0E01920"
                     /inference="similar to DNA sequence:INSDC:YDR349C"
                     /note="similar to Saccharomyces cerevisiae YPS7 (YDR349C);
                     ancestral locus Anc_5.401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685718.1"
                     /db_xref="GeneID:11531393"
                     /db_xref="GOA:G8BTQ6"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ6"
                     /translation="MVSRSLLLTFASVITIVHPSYAATTTKSIATSAEAVNSFPTLAV
                     GKDSKALYYVNISIGIPSQEENVRVDIAQPYIWLPAKNSTCETSSCVVTSSFNNQTSN
                     SSVLLQDGQIFSLDFIDSISLNGTFYKDDLTCSNLVQPLKLNESLKSPDGLYTTNTTD
                     DSITLVALSFINAIDYQGLTIGSLGLASSTTSDLSGASLDFVDDSFSFLTYLSNSEVI
                     DTPSYSLWLGGDTLPYTNMTSINSTTIDYCGNLVLGAVDQRYYEGRLVQFDMLPALLN
                     NVTEAVTYGLPIIPMGPIYIENSSGTQLNLTTTNFLEPVLLDSRYTNARLPLNTVIQI
                     ATQLNAAYVEEFGSWIVECSLAEMNVNLNFNFQGLTIPVSLNDFLSRVINSTTGEPIK
                     FSESSEDACALAVYPNTDIGFNILGGPFLKNIYLAIDNEGRSVAIAKAVKEDDTSAIN
                     SISSNSSDNETHISTSVKKTTSHSGNSTVTTSTKSETFGSIQSGTIPFATSYNITATS
                     RLTLIRDVHDELSTYPIEFTAILTSNGLVSSMRSYFTTDRITSSTVKTSQSQFVSIPV
                     RSGLNGTATTYTASAIANKIAVLNKNMNSNTNSNIFKNPLNLTFLTCFITLIVISWAF
                     "
     gene            <397291..>400107
                     /gene="TPHA0E01930"
                     /locus_tag="TPHA_0E01930"
                     /db_xref="GeneID:11531512"
     mRNA            <397291..>400107
                     /gene="TPHA0E01930"
                     /locus_tag="TPHA_0E01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685671.1"
                     /db_xref="GeneID:11531512"
     CDS             397291..400107
                     /gene="TPHA0E01930"
                     /locus_tag="TPHA_0E01930"
                     /inference="similar to DNA sequence:INSDC:YHR098C"
                     /note="similar to Saccharomyces cerevisiae SFB3 (YHR098C);
                     ancestral locus Anc_5.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685719.1"
                     /db_xref="GeneID:11531512"
                     /db_xref="GOA:G8BTQ7"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ7"
                     /translation="MQNENFNSQNNMQSVENGVRNLFLKKGKRPHRAFHNLSVSNISK
                     NQLPPVTQDLNSVYDNGIYGDVASSNPNQMNFQGGNVGYQNQGSSVVAQEMNSVNGFE
                     NPQSGRVFTPKHFDSPLSTPSVNEVINQGSYAFHSPNNLPIQSMSHIIAKQRWEDQLE
                     YLTKSFNTKDNSIPPLSTTQYYCNDQGSCDPRLLALTMYNIPKNEHFRSATKLPLGLT
                     IQPFAKLIPNENIPLVESTQESGPLRCNRCRAYVNPSFQFTYDSSVVCNICKMRTKLS
                     NEHFAPLGPDGNRSDMGARPDLYKGCVDFAVPDIYNCKAGEAPLPLHYVFLIDVSLIA
                     NENGSSLAAVEGVRSAIEYIGDFQPKCKVAIISYDSKLKFYNLSPELASAQEYVITEI
                     NDVFLPFYEGLFVRPNDSTKTINDTLRKISQYITMDKFSHVPHVCYGSALEAAKLALD
                     TVTNGQGGKIVCTLNSLPTIGNGNLSLRKDDNMKRHLKCDNDFYSKLAREMLSSYISL
                     DLYVTSAGFVDMATVAHPVYMTSGNLKYYPHFIHEKDEFTLVNDMTENIASITGYQAL
                     LKIRCSSGLAVYQYYMGASEGSDRDPIIPVLTSNTTIDVLLKYVEKLKEGTDMSFQAA
                     LLYTNIDGDRRVRSINTSGAVSGNIREIFKFLNQQVILRIMVKDILNALGDADFAKVR
                     QSIDDKMVDILTQYRALVSGNSSSQLVLPDTLKTLPTYMLSFQKSELMKPNAQSTRDN
                     QRVYDLFKYYMFNRAQFSYKLYPQIIPTHVLLEDTDLTFYDAHYQLLMIKQSSIDNVT
                     VKDAYMQFTDGGCYLIFNGETCYLWFNENTNKLLLEDLLDVGANTAYNQITLCSNSLP
                     KISTHINKKANNTVKNWTQTTNKSIIPVILLRPNVDQYYSKVFTSIIVEDPTMNKVDS
                     ADNYLVNMHRRIQENLTKTNYVEN"
     gene            <400958..>402508
                     /gene="TPHA0E01940"
                     /locus_tag="TPHA_0E01940"
                     /db_xref="GeneID:11531356"
     mRNA            <400958..>402508
                     /gene="TPHA0E01940"
                     /locus_tag="TPHA_0E01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685672.1"
                     /db_xref="GeneID:11531356"
     CDS             400958..402508
                     /gene="TPHA0E01940"
                     /locus_tag="TPHA_0E01940"
                     /inference="similar to DNA sequence:INSDC:YDR348C,YHR097C"
                     /note="similar to Saccharomyces cerevisiae YDR348C and
                     YHR097C; ancestral locus Anc_5.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685720.1"
                     /db_xref="GeneID:11531356"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ8"
                     /translation="MINRNDSQRSNRRPFSSTNPFRNALNDSSLQEYNNDKQFMEWTK
                     NNGVQSPPYLSNSGSRHNSNFSFVDSVEEEGPEDDVYAHNGRAHSPVVTRLSTSPTPI
                     ASNNPFLGDVAGEGKTFSTESSISQTSDNRNASVRSDSTRNYPTAREEKDRLRQSYME
                     TSNVNRQSESQGYRKKSSPGNFAPPSYEEAAGTKTSRSQYPREKEHRSHRSNSSHGHS
                     SSGNPHRRSYYPDSDQKRESDRERSRDDSRDSRYRHHSSKSSSSKSKRKNKVVIPKNV
                     DSIDKLDVTGLFGGSFHHDGPFDAVTPHRNKNMKAAPVMAFPADGPNSTIGGASSKPS
                     TLNEVFGRDEYADDNNGMARSKGNVDYRRSVYMGSLPSNSSSTLDAIKNHSDVSQFDP
                     KTLTSKVSGPTTIGLGSTTFLDGAPASKTAIRDDVIQHAHQSRGVQRHKSLSQRFNIG
                     RSNTEISHRHGTSSTTNNSSLNDDDIYLSRSSDKTSKGITFDDNAKKESSGNTFLRRV
                     KSLKVSRK"
     gene            complement(<402763..>403758)
                     /gene="TPHA0E01950"
                     /locus_tag="TPHA_0E01950"
                     /db_xref="GeneID:11531268"
     mRNA            complement(<402763..>403758)
                     /gene="TPHA0E01950"
                     /locus_tag="TPHA_0E01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685673.1"
                     /db_xref="GeneID:11531268"
     CDS             complement(402763..403758)
                     /gene="TPHA0E01950"
                     /locus_tag="TPHA_0E01950"
                     /inference="similar to DNA sequence:INSDC:YDR347W"
                     /note="similar to Saccharomyces cerevisiae MRP1 (YDR347W);
                     ancestral locus Anc_5.398"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685721.1"
                     /db_xref="GeneID:11531268"
                     /db_xref="GOA:G8BTQ9"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:G8BTQ9"
                     /translation="MSYILVTKKIVSSLIRAHVITRSYITPSLDHLNEKDGLPGLYSS
                     QGLRNAWYERVQHHTDELNKFVDENTDERPILQLINDHSKSFTKRNLVKNAAMIHNLT
                     FANNSLTASNVNFDYQLPLANKKTTLIKDSVDIKLNYKNEPDKITYKKLYPAILSSFG
                     SMVEFRTLLLNSNLGISGDGFTWLVARKHQAYDYSMESSNYSEVKFDRLFVVNTYNAG
                     TPFNFNKSNQMTELKLFQEKELKTQQTEEQIEELAKKDENKEKDINDVLEAHSYDKNV
                     SYIPLLAIDASPKCWLHDYGVFGKEQYLNNVWESINWDVVESRMPELSQQYKVVI"
     gene            <404727..>406052
                     /gene="TPHA0E01960"
                     /locus_tag="TPHA_0E01960"
                     /db_xref="GeneID:11531269"
     mRNA            <404727..>406052
                     /gene="TPHA0E01960"
                     /locus_tag="TPHA_0E01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685674.1"
                     /db_xref="GeneID:11531269"
     CDS             404727..406052
                     /gene="TPHA0E01960"
                     /locus_tag="TPHA_0E01960"
                     /inference="similar to DNA sequence:INSDC:YDR346C"
                     /note="similar to Saccharomyces cerevisiae SVF1 (YDR346C);
                     ancestral locus Anc_5.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685722.1"
                     /db_xref="GeneID:11531269"
                     /db_xref="GOA:G8BTR0"
                     /db_xref="InterPro:IPR013931"
                     /db_xref="UniProtKB/TrEMBL:G8BTR0"
                     /translation="MLKWIQGGISAVTGLAEPEYGKEFIHSAADKVNEQQINPFNTAT
                     SDDLKWLCPDYTNVETSTFYVNDLNTGIIGLAQVIHSNIVGLHQTAQFNCRIVDSNDV
                     KNFNVWTSTKLENFRIDGTNFYADNLKIELNEDGNQFHVVANVNEIVSLDLFFTRVTD
                     GCKLGNDPNTYFGDNVEEPWGKIRHIFWPRNKLVGTINIKYEEPREEQGNQKEGEEEQ
                     QLKSFIEKTIKFTEEKPALSMFVLAFQGMKPHHAAKAWNFINFQSDEYSVILIEFITP
                     KSYANTKVSIGIVTDSEKILSVATNNNFEHIDSTVDSIGWPVPKAIKCTFNGISADLS
                     DDQVKKMYGENNGTLKEQEIAVVNVNLTNLIERIDVMNEIPQFVKNIVSGVAGTKPYI
                     YQYAGDEDFNIEINNKKVKGLGMLEVIFISEHDDEELVNAVAAVKLSDE"
     gene            <406803..>408842
                     /gene="TPHA0E01970"
                     /locus_tag="TPHA_0E01970"
                     /db_xref="GeneID:11531290"
     mRNA            <406803..>408842
                     /gene="TPHA0E01970"
                     /locus_tag="TPHA_0E01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685675.1"
                     /db_xref="GeneID:11531290"
     CDS             406803..408842
                     /gene="TPHA0E01970"
                     /locus_tag="TPHA_0E01970"
                     /inference="similar to DNA sequence:INSDC:YDR341C,YHR091C"
                     /note="similar to Saccharomyces cerevisiae YDR341C and
                     MSR1 (YHR091C); ancestral locus Anc_5.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685723.1"
                     /db_xref="GeneID:11531290"
                     /db_xref="GOA:G8BTR1"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BTR1"
                     /translation="MIKSCSSTLLHNINSFTSVCKNKRLSNFLANRFNYNFDLNYLHI
                     DKNPTSIRFYSNKKLHKPEIKREASEKYKMSTEHISQQLTKLSLALPAVVEGSNPDVN
                     VVDLMRNYISQELSKISGVDTKLIFEALEWTNTPERGDLLIPVPRLRIKGSNPKDLAT
                     EWAEKFPVGDYIDKVEANGPFLQFFFKPSALFNIVIPDILERGDDYGSYKMEQKKTVV
                     FDFSSPNIAKPFHAGHLRSTIIGGFISNLYEKLGWNVVRLNYLGDWGKQFGLLAVGFE
                     KYGNEESLSKDPIHHLFDVYVKVNKDIEKEGDSLPEEESSNGRAAEFFKRMEDGDEEA
                     LKIWKRFRELSIEKYIETYARLNIQYDVYSGESQVSKERLDEAIKILNDKNLTHEDRG
                     ALLVDLTKFNKKLGKTIVKKSNGATLYMTRDIGAAMDRYEKYHFDKMIYVVAVQQDLH
                     LAQLFEILKQMGFGWSDRLSHINFGMVQGMSTRKGTVVFLDNILEETKEKMHEVMKKN
                     EVKYAQIQNPEEVADLIGISAVMIQDMQSKRINNYEFKWERMLSFEGDTGPYLQYAHS
                     RLRSVERNASEITPEKWANADLSLLTEPAAVLLIRLLAQYPDVLRNALKTHEPATIVT
                     YLFKLTHQVSSCYDVLWVAGQTEELATARLALYASARQTLYNGMRLLGLTPVERM"
     gene            complement(<409080..>411005)
                     /gene="TPHA0E01980"
                     /locus_tag="TPHA_0E01980"
                     /db_xref="GeneID:11531228"
     mRNA            complement(<409080..>411005)
                     /gene="TPHA0E01980"
                     /locus_tag="TPHA_0E01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685676.1"
                     /db_xref="GeneID:11531228"
     CDS             complement(409080..411005)
                     /gene="TPHA0E01980"
                     /locus_tag="TPHA_0E01980"
                     /inference="similar to DNA sequence:INSDC:YDR419W"
                     /note="similar to Saccharomyces cerevisiae RAD30
                     (YDR419W); ancestral locus Anc_5.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685724.1"
                     /db_xref="GeneID:11531228"
                     /db_xref="GOA:G8BTR2"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:G8BTR2"
                     /translation="MSKYKWKDLILLTSKTDAYSSPLACLAHIDVNAFFAQAEQIRCG
                     YTKDDPVVCVQWSSIIAVSYAARKYNIKRMENIMEALKKSDNKIIPIHTAVYKKGEDF
                     WQYHDGYGKWNKDPDKQLSPEKYKVSLNPYRREGRKIFKLMKEWCDLVEIASSDEGFL
                     DLSRLVLQKLLFDEDITNFNDDTTQSRTIQDMFVNGDYNLEDNLPPVPKYLKKLKYEG
                     ILYAGDEGDNIEDWDDLFLCLGSIIMSELRNEIETTLGYTTSCGIARTKTVCKLASNF
                     KKPNAQIIIRNSKLELFLDNENYEITSFWTLGGNSGKDIVKVLQLPSKGSLKYIRESW
                     PTSSNDLKTYIDVKIKETIENGEPTDIDTTKTAILASKLFDLCRGIWLTPINTRPLVK
                     SMMSNKNLRGNSCNSIVDCIQWFDIFSSELFGRVEELSEEYNKIFIPKTVSISFITNK
                     SKNMTKSTALQCRGTKIQATDISIATSKLINAVYSQFDPNDSTSFFPLKQLSTSISNF
                     EIIDNKKTVIDMFGKQIQKSTIIESSSKVIETNSDGNNQADENTKSHETFECDICKIS
                     FNERKDFVEHKDFHIAERLSESINGRSEDSLYLSVGERRLLSSSKNKVIKKEVKKPKK
                     IDNKISGSQNILNFFKK"
     gene            complement(<411660..>412157)
                     /gene="TPHA0E01990"
                     /locus_tag="TPHA_0E01990"
                     /db_xref="GeneID:11531406"
     mRNA            complement(<411660..>412157)
                     /gene="TPHA0E01990"
                     /locus_tag="TPHA_0E01990"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_003685677.1"
                     /db_xref="GeneID:11531406"
     CDS             complement(411660..412157)
                     /gene="TPHA0E01990"
                     /locus_tag="TPHA_0E01990"
                     /inference="similar to DNA sequence:INSDC:YDR418W,YEL054C"
                     /note="similar to Saccharomyces cerevisiae RPL12B
                     (YDR418W) and RPL12A (YEL054C); ancestral locus Anc_5.522"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_003685725.1"
                     /db_xref="GeneID:11531406"
                     /db_xref="GOA:G8BTR3"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:G8BTR3"
                     /translation="MPPKFDPSEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKEKNVKHSG
                     NLQLDDIIEVARQMREKSFGKNLASVTKEILGTAQSVGCRVDYKNPHDIIEAINAGEI
                     EIPEN"
     gene            complement(<413181..>415433)
                     /gene="TPHA0E02000"
                     /locus_tag="TPHA_0E02000"
                     /db_xref="GeneID:11531279"
     mRNA            complement(<413181..>415433)
                     /gene="TPHA0E02000"
                     /locus_tag="TPHA_0E02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685678.1"
                     /db_xref="GeneID:11531279"
     CDS             complement(413181..415433)
                     /gene="TPHA0E02000"
                     /locus_tag="TPHA_0E02000"
                     /inference="similar to DNA sequence:INSDC:YEL053C"
                     /note="similar to Saccharomyces cerevisiae MAK10
                     (YEL053C); ancestral locus Anc_5.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685726.1"
                     /db_xref="GeneID:11531279"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:G8BTR4"
                     /translation="MFKNYPNNDELIDVTDIFKNLGKNLKEPTIIKASYFDLFEGTRS
                     LEVENARLDSTLIHLTEIEKNFNCNAIIGDENDLEVQLDNIISISDRLLRNVISWLNN
                     YQTLPTTILSCTYVEHILLASEKSHKIEPLSTGNELYDKTLSGLCIGICYFGKFVLHL
                     MKSGVLMEEEDLNFNFMGLDFLTFQESSKEVLELLEESLTYLDTLENGKKQYLKDFIR
                     ITICLVHIEETCTTYSTDLKFLNELAELGEKYNSIEVLTSDVPEGSFSMGIQKRMSNQ
                     YPPRKLVNVTNNYSGYKDMAMDIKRVLLIHEEKSALEMLQFSYYFGNLQQRHVLARGI
                     FSLFFMRDNLTILGKYKMPDFVIMQLNEFSLTGCTSSIENLTPEQKLFLEPVLEEATK
                     VLLEFYQNFTQNNCRIRQGYNRQLLLWDSLQAQFENAETLLEQNGVINVVSNEPVVTY
                     FPYSLWAYFQKVTLMIDFVLKGFDLEIYQPYETFAMYYFVYYLTYKREYALRSVQQFI
                     EKKIHSIQAMNKKIKKLKTVEKKEALKVQYKKLMETVMPSLQRNKQYLNFLTLRNTIT
                     KSLSLCQFVQFGVLKSYGIIDNHSSSISEFIDHELIHKLRFKSFSSIGVPELPTYEIF
                     ESTLKEFTLSEPNLDSKVSNTIGFVNKECTKTIESLDSILQAIKAGDNNGTMLTGSRL
                     IKEDALKHYEQLKYSCQDIQKNIVTLTKKINVISERPLSEHFKVILKFSDNGSSFFPL
                     LSLEDKTKID"
     gene            complement(<415780..>418380)
                     /gene="TPHA0E02010"
                     /locus_tag="TPHA_0E02010"
                     /db_xref="GeneID:11531280"
     mRNA            complement(<415780..>418380)
                     /gene="TPHA0E02010"
                     /locus_tag="TPHA_0E02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685679.1"
                     /db_xref="GeneID:11531280"
     CDS             complement(415780..418380)
                     /gene="TPHA0E02010"
                     /locus_tag="TPHA_0E02010"
                     /inference="similar to DNA sequence:INSDC:YDR416W"
                     /note="similar to Saccharomyces cerevisiae SYF1 (YDR416W);
                     ancestral locus Anc_5.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685727.1"
                     /db_xref="GeneID:11531280"
                     /db_xref="GOA:G8BTR5"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BTR5"
                     /translation="MDNFIKDDDDIAYEYELQKDPNNRLTWERYINKKKNESDIDKTN
                     IIWLYERCCLQLSETDIIECLNIYSVFFNYLILEIDFKDCKYLVENLFINKLLKYYKN
                     SKYSKKKIIVFEKICFELLNFCISRNEIQYIHILVNEFLKSTIGNNNSIESHRKLWTL
                     LLEYIKLILNSDDRQEIIDIDNGNVTLNNEEVAIIGILRDNIGNHDHEETKEVYSNLF
                     ASDLIERYLIVCPKSNLNYILELLFKTNDYPKIKSAYEKYLLIDKNFNKKIPLKLKLN
                     YLLSLEKCNLVESYEKYILQLLNSELDSENEEFTIITIFCKFFIKHKKIEQLNSFIND
                     TLSLENKPKTASPNLYVKLYDYFINVEKNIIDIYIEQQLENRSLITNQLNFFKQLLYS
                     KDLKINDLKIAKNENQVINWLERLNIVDSNKYKIYSDQQIVLKKAEIYNEAIVRIDPA
                     SSSLLPGSFSKIWISYATFYWDLKQYDTAKELYERSVKVPFKYLQDLEAIWLSWVKHI
                     ISLKGNENMKAAIKILESALSTSGNPEAVYENFMKNYKLNLKPRIPAQAILFSSKKLW
                     NYYLDLVESSNNLYSDAAYVEKIMSIYEKMIELKVATPINFISYAEFLSRDKILAAFQ
                     IYERAIAIFPPTTKYLIWTAYLTKTLENKSLLSTEHIRELFAESIRMMNENSIECSTL
                     YTMFSDFEEIENKMYTRSVNILIEGILQSVKKKTKINTILKLWDLVIMKTKSLLGLIH
                     LRPIYEQCIQLLPNSVVTKYIIDFSKLELQLTEVVRARQILHFGSQLLPPAKNTELWN
                     FWEEMEIKYGTKEKYKDMLKLKKKLEEEMFTDTAAVTKAEGRIEFVASSTSKDDVERV
                     INPDELELDL"
     gene            <419816..>421852
                     /gene="TPHA0E02020"
                     /locus_tag="TPHA_0E02020"
                     /db_xref="GeneID:11531445"
     mRNA            <419816..>421852
                     /gene="TPHA0E02020"
                     /locus_tag="TPHA_0E02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685680.1"
                     /db_xref="GeneID:11531445"
     CDS             419816..421852
                     /gene="TPHA0E02020"
                     /locus_tag="TPHA_0E02020"
                     /inference="similar to DNA sequence:INSDC:YML042W"
                     /note="similar to Saccharomyces cerevisiae CAT2 (YML042W);
                     ancestral locus Anc_5.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685728.1"
                     /db_xref="GeneID:11531445"
                     /db_xref="GOA:G8BTR6"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G8BTR6"
                     /translation="MLHSKQFANTQFRRTMTTAKQFNNNLKRFEFKTKNNEYYLANNS
                     NEYYQKNIYNNTFRNLTYSKQDILPDLPIPELETTVKKYLKSIKPFLQNNESEYNLQK
                     LKCKDLLENMGPILQKRLIEYKNSNSYNKRNWLSTFWDKQAYLNYNDPVVPYVSYFYS
                     HKNITNQKNKFIENDYLLKSTAIIKIISDFIESLKNESVPFELIKGSPFCMNSFQLMF
                     NTSRIPDLDPNSNDIDTNVFYSIYENNFIIVICKGNFYKLWINDEKTLKPLSVGQIYQ
                     QLLSIVESVNKNVKNDNIGILTSLPRDEFKKSYETLIKNPQNKDSLDRIHKSAFILCL
                     DTDVTAITLEEKSRNAWHGDGYNRYFDKALQFIVAKNGASGCLNEHSKMDGTPTLFLN
                     SYLCNQLNLIDSETFLKEIKESAQQPNISMETNKLQFQIEDNIKNQVVVAKTKFDSLL
                     KEHDLKVWHYNRYGKSTIKKHKFSPDAFIQQIIQLAVFKYTGKVLPTYEAASTRKFFK
                     GRTETGRSVTSESELFVKNWNNPKLNNNERIQLLRNAAAAHSKNLGESANGQGIDRHF
                     FGLKNMVDEKKDNMPELFSDKLFNYSSTWLISTSQLSSEYFDGYGWSQVNDKGFGLAY
                     MLNTNWLHINIVNKPDKANLSCARMHYYLSEAADEIMDILENSELENIALKSKY"
     gene            <422306..>423046
                     /gene="TPHA0E02030"
                     /locus_tag="TPHA_0E02030"
                     /db_xref="GeneID:11531487"
     mRNA            <422306..>423046
                     /gene="TPHA0E02030"
                     /locus_tag="TPHA_0E02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685681.1"
                     /db_xref="GeneID:11531487"
     CDS             422306..423046
                     /gene="TPHA0E02030"
                     /locus_tag="TPHA_0E02030"
                     /inference="similar to DNA sequence:INSDC:YDR410C"
                     /note="similar to Saccharomyces cerevisiae STE14
                     (YDR410C); ancestral locus Anc_5.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685729.1"
                     /db_xref="GeneID:11531487"
                     /db_xref="GOA:G8BTR7"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:G8BTR7"
                     /translation="MSDSSKEDIPIIINGKPYPDIVKNPLNEIALTSYILGALFGISL
                     GLIPFVSFRAFNLYLMALSTFHFLEFYITAKYNRGKVHSESFLINNGVEYISAHLVAI
                     CECSIERVFFNSAKRSDSSFINSIIFIVGLCLVIIGQVIRSLAMYTAGQSFSHIVKTS
                     KIEDHDLVTDGIYSFFRHPSYFGFFWWAIGTQMMLLNPISFVLFSFVLWRFFSKRINY
                     EEKYLVEFFGKKYLDYKKTVPVRIPFIN"
     gene            complement(<423271..>425634)
                     /gene="TPHA0E02040"
                     /locus_tag="TPHA_0E02040"
                     /db_xref="GeneID:11531371"
     mRNA            complement(<423271..>425634)
                     /gene="TPHA0E02040"
                     /locus_tag="TPHA_0E02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685682.1"
                     /db_xref="GeneID:11531371"
     CDS             complement(423271..425634)
                     /gene="TPHA0E02040"
                     /locus_tag="TPHA_0E02040"
                     /inference="similar to DNA sequence:INSDC:YDR409W,YOR156C"
                     /note="similar to Saccharomyces cerevisiae SIZ1 (YDR409W)
                     and NFI1 (YOR156C); ancestral locus Anc_5.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685730.1"
                     /db_xref="GeneID:11531371"
                     /db_xref="GOA:G8BTR8"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:G8BTR8"
                     /translation="MSTGGGGLQGEMNQVLDMLEDLRVYELKFVCKAAKLPVTGRKAL
                     LQDRIKVFLKKSLTMGHIDPWRPKTIKELIKQAQNGVIDPPDYEVLWTAIKTGRLTDR
                     NQPASVSRVPAITHNNPQTVNSTNTHHAKVNKYTKQTIILHFKESPFYKVLKLIPHSV
                     GLIKKTTGRGVCTTSFRFTDSEWRLLQSDKEKYKLYLFSGILNASGQRSNEPIQFPHP
                     NEIKFNNIQIKDNVIGLKSKPGTGKPANLTPYTYPPSQVNVLEIVHAFTANEYSVYCY
                     IVENVTPEELLQNIIKNPKILRTATLQYIKKTLNDEEDDDLITTSTVMSLQCPISYTR
                     MKYPAKGINCQHLQCFDALWYFHSQKQLPTWQCPVCQLPLKVGTMAICEFVEEILRST
                     GDDIEQIELAVDGSWVPLNEDGEKVPSAGKLETKPVNHMSNNLAIKKEDSTLAIPKQD
                     QINNSSTIPHGHSEQVIISLDSEEEDDIALAHHVDEENNEITATQVQPPNNHALNSIN
                     SSREPILQLSREESNGNNNQNNGSNSNELSTTSSTVLPTTNIDQLSQRNALSTTESGQ
                     NGTSILGIGTLNDVDIMSVSLGTPNGESPHNNANENPQNYTENRTAEMNTNLWIDHPT
                     GNNTQMLSLSNGSNNSNILGISGNSEQLFEPINQGPENSDASPELGNVTGTVTDAQNE
                     CSGQSKGYLGNTAVPGRHKSSNVSPFIPKKPYLNRLPQKRQMHNNSGVTLSEGAPRIA
                     RTTIPNNHMHNNIPNSNPAFNLNNNISSTPTNPVESSRMDIIDLTSD"
     gene            complement(<426185..>426970)
                     /gene="TPHA0E02050"
                     /locus_tag="TPHA_0E02050"
                     /db_xref="GeneID:11531349"
     mRNA            complement(<426185..>426970)
                     /gene="TPHA0E02050"
                     /locus_tag="TPHA_0E02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685683.1"
                     /db_xref="GeneID:11531349"
     CDS             complement(426185..426970)
                     /gene="TPHA0E02050"
                     /locus_tag="TPHA_0E02050"
                     /inference="similar to DNA sequence:INSDC:YOR157C"
                     /note="similar to Saccharomyces cerevisiae PUP1 (YOR157C);
                     ancestral locus Anc_5.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685731.1"
                     /db_xref="GeneID:11531349"
                     /db_xref="GOA:G8BTR9"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BTR9"
                     /translation="MSGLSFDNYQRNTFLASKSYAQPKATSTGTTIVGVKFKGGVVIA
                     ADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGSNIELHSLYTERA
                     PRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYHTLGSGS
                     LAAMAVLESQWKQDLSKEDAIKLASEAILAGIWNDLGSGSNVDLCVMEVGKDAEYLRN
                     YITPNVREPKQKSYKFARGTTAVLKESIVNICDINEEVVDVTS"
     gene            <428295..>432125
                     /gene="TPHA0E02060"
                     /locus_tag="TPHA_0E02060"
                     /db_xref="GeneID:11531428"
     mRNA            <428295..>432125
                     /gene="TPHA0E02060"
                     /locus_tag="TPHA_0E02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685684.1"
                     /db_xref="GeneID:11531428"
     CDS             428295..432125
                     /gene="TPHA0E02060"
                     /locus_tag="TPHA_0E02060"
                     /inference="similar to DNA sequence:INSDC:YDR407C"
                     /note="similar to Saccharomyces cerevisiae TRS120
                     (YDR407C); ancestral locus Anc_5.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685732.1"
                     /db_xref="GeneID:11531428"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:G8BTS0"
                     /translation="MNNFGTYSGFVDPAKVHVLVVPIGNWEREDFKSSIDIMKKYNEL
                     RLLDISPIDSLLFTPQGFPNGRIFLNYKTSTFTNEADLFLYDFEPFRKIFIVIGLVND
                     DSDPLDNYKKLKELYPDIISHNLMYTNTDRTDLKETLVGDKKNDEDIGSKLFLCNLAN
                     NVEHNNNIQTVICDIAKNFLKSLDHYYSSYKHVTLRSPGAIGGSKILKTTLSPSLLNS
                     GTSKSSQTSKASSHSKRLSTFEMTSNIKRSASLQLARSLATSDNKAQQKSQGRQLKIL
                     GNFQLLSGRYSDALNSFTEAIILLHVVRDYLWLGSALDGIAICFLLLKYLDISFKIPS
                     VITELCPIEKLEPTNESVTNLLRKSTSSQSNVLSPRNSINSSVPPLEILNSEIILPYL
                     IKSISDKALYYYDSSLAHNSEYVPQNVYCELLLKTTTFMVVCKNDIEISKFSMKKIIN
                     YNYSEIGIIDRTSEKIVFANEEIYYFISNIFELQVKDMEMYSQKDIYFTLAEIYGALG
                     YYKKKTFVLRLLLVALAATSDKGIWQPSYHALLLKMVDLYNISSINPESSIVDASKTT
                     WVTFQKKALILLIKVADKVHDKECLATFSLLLFTRFSHLMTQNEQKMHLLTYIQPLVT
                     NSYISNYWDPFLLRDLTLEIDNNASAEVEQRLLSLKDNVMSSELAELSLSNGDLEEKK
                     VFNPFKIRTLSNLTSTSEVKVQKPKIAQVGDNAFLKVKLQNPFKFEVYVTSFEMKEET
                     KKYIKLDNDSVDANHPLIIQPESFIEISFPVSFISQTSSHNLVIDSLLISVFDMKPTP
                     FNVIKKDSQLHCKEDNSNSIRGCKSSFEVQILPELPELEIKKTSKMINNQWMILEGSS
                     DFFKLEIGNRSLRSNIDYISLSYRTNIEASIKSNYWKNMKKDDLFDYETRLEWLKNDL
                     IKFYYYPASLLANEKSEIKFEVNSGLEFLEFLKFDIDIEYGMKSDDGQWLYIKTISIP
                     HQLTIKKSIEIPGIDMMQLTDTFSDATYTVDWISYINEQLKRDRTSKITDYIILLLDV
                     RNSWVDAAEVNFSFESYSSTPFIIESGHTSRVIIPIKKLGVKKHLFSNKPVPKVHKWR
                     QFIQTGMTEDEKIRMREKFWCREYILENLKCDWVLQNGTYSGDVKFRPYIEKFSDSFM
                     SLFYNESLEYNIDMSIDTKDINNMTAGQPFDLIVLLKRSKFSQNDSQESFRMNYMIYD
                     INGNRHTLVADNRILSNGNMYTIFHIINSLECKLNFIPIESGKYLIEVNLCPSETSDQ
                     NIKLASQSISFEIK"
     gene            complement(<432294..>432578)
                     /gene="TPHA0E02070"
                     /locus_tag="TPHA_0E02070"
                     /db_xref="GeneID:11531429"
     mRNA            complement(<432294..>432578)
                     /gene="TPHA0E02070"
                     /locus_tag="TPHA_0E02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685685.1"
                     /db_xref="GeneID:11531429"
     CDS             complement(432294..432578)
                     /gene="TPHA0E02070"
                     /locus_tag="TPHA_0E02070"
                     /inference="similar to DNA sequence:INSDC:YOR159C"
                     /note="similar to Saccharomyces cerevisiae SME1 (YOR159C);
                     ancestral locus Anc_5.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685733.1"
                     /db_xref="GeneID:11531429"
                     /db_xref="GOA:G8BTS1"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:G8BTS1"
                     /translation="MFERSKAVIPPINSVFNFLQQQTLVSFWLYEQVGFRIRGKVAGF
                     DEFMNVVIDNAIEIPVDAETGIERVTDGKKLGRILLKGDNITLITTVDEN"
     gene            <432932..>435829
                     /gene="TPHA0E02080"
                     /locus_tag="TPHA_0E02080"
                     /db_xref="GeneID:11531339"
     mRNA            <432932..>435829
                     /gene="TPHA0E02080"
                     /locus_tag="TPHA_0E02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685686.1"
                     /db_xref="GeneID:11531339"
     CDS             432932..435829
                     /gene="TPHA0E02080"
                     /locus_tag="TPHA_0E02080"
                     /inference="similar to DNA sequence:INSDC:YOR160W"
                     /note="similar to Saccharomyces cerevisiae MTR10
                     (YOR160W); ancestral locus Anc_5.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685734.1"
                     /db_xref="GeneID:11531339"
                     /db_xref="GOA:G8BTS2"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BTS2"
                     /translation="MSKPFTIENIQVALQCISSNVTQFEKTEALGYLEHFQKSTEAWK
                     TCHEILGMNNGALVELGVFAAQTLRNKVTYDLNQLDGNLSQFKESLINFLILHTNKLI
                     VTQLNVALARLAIQYLQWINPITEIINYLNPYPDKLLGFLKILPEETLDVNSTPLSED
                     EFNSRTHELVTTIGGDVLKFLVTCEELLKSNTAQNVITLEHILRCLSSWSFEFPLDEL
                     LSVQSLISLVFETLQNKNEDDPDAFDAAVDCLSVIIKESRDASNEQLILSLYEQLLTL
                     QMKHLPNILTAASCDEYDDDLMESMTRIFVEAGEAWIVFISKSPQTYHQLVTILLMFT
                     SKNSDLEIAAYTFPFWFDLKQNLVLPRYQDSKIQYTPIFIELIGCIITHLQYPLESFS
                     SKEEEDKFKDFRYHMGDVLKDCTAVVGTTNALTQPLNRIKDAISTQKSWQHIEAPLFS
                     LRTMASEVSLSEKVLLPEIFNILVTLPEQPQIRYAATLVLGRYTEWTAKHPELLELQL
                     QYIFKGFEIANGSSDTLTASSHSLMYFCSDCSTLLSTYIDQLFEFYFNVQDSIDIISC
                     FELSQGLSAVLNKQPNEVISSKFQILIDNNLGKLNKLVLSWQNDRSKYSNLVADQIDL
                     LYAFFEELKPRYDYPQQGQEPLLPQLEYIWSALHHLLVDLGALDDTLIVERTTKLLRK
                     LFENFHIFCGPFLSSVVEFLANGYRVTGLGSYLWCTGAIVVVYGDDESLPISPEIKEA
                     VWQFAVSQNNTFIQNFKSIDKSTLDNYFESIMDFFSMISDLLMFYPEHFIMSEELLGN
                     VTDVALESVTNLGNYDAYTFILRCLDDLISWGFKTPPISTIALEYVPDEWRKMIINEL
                     VIKRGSQITMSIFVGLVTNFNNNVHSDAISCLVKLFRIALETNNNDPIICITWLTQAL
                     AQFNNISVKEKDDLTNSVVKGLNARDYRKAREGIRGFINWYLRRNVDTRYD"
     gene            complement(<436141..>436635)
                     /gene="TPHA0E02090"
                     /locus_tag="TPHA_0E02090"
                     /db_xref="GeneID:11531457"
     mRNA            complement(<436141..>436635)
                     /gene="TPHA0E02090"
                     /locus_tag="TPHA_0E02090"
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /transcript_id="XM_003685687.1"
                     /db_xref="GeneID:11531457"
     CDS             complement(436141..436635)
                     /gene="TPHA0E02090"
                     /locus_tag="TPHA_0E02090"
                     /inference="similar to DNA sequence:INSDC:YOR150W"
                     /note="similar to Saccharomyces cerevisiae MRPL23
                     (YOR150W); ancestral locus Anc_5.496"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /protein_id="XP_003685735.1"
                     /db_xref="GeneID:11531457"
                     /db_xref="GOA:G8BTS3"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G8BTS3"
                     /translation="MSQKIGHSALAFGRLWHHVNVAQEERTLGRLASSIAIALIGKHK
                     PVYHPSEDCGDYVVVTNCQLLKVTGKKMSQKNYWSHSGKPGHLKLVPMEKLIADKGTK
                     EVLKKAVSGMLPKNRLRKIRLERLKIFDGSEHPYKNNIMAFAKEQSQIKSSTNTETNS
                     VKQP"
     gene            complement(<437113..>438912)
                     /gene="TPHA0E02100"
                     /locus_tag="TPHA_0E02100"
                     /db_xref="GeneID:11531341"
     mRNA            complement(<437113..>438912)
                     /gene="TPHA0E02100"
                     /locus_tag="TPHA_0E02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685688.1"
                     /db_xref="GeneID:11531341"
     CDS             complement(437113..438912)
                     /gene="TPHA0E02100"
                     /locus_tag="TPHA_0E02100"
                     /inference="similar to DNA sequence:INSDC:YDR403W"
                     /note="similar to Saccharomyces cerevisiae DIT1 (YDR403W);
                     ancestral locus Anc_5.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685736.1"
                     /db_xref="GeneID:11531341"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="UniProtKB/TrEMBL:G8BTS4"
                     /translation="MTGPPQEKRIEPDDNSIPHEGTDASTFSKFLAIFTANCDDYSII
                     TITEKQQCQFKSSWNEIVKYLLPENSSDNSINSDVKEYTIPSSLANKFTNDLGLDLKI
                     SLLKKDNEKQIRGCVTSIENENSFNDWFIYHILSKTNIDRDCIDNTSVTSDSYNELFT
                     TYFAENVKNAVQNEQWDFGGKEYFTERVKYYTDRNIPIEAVLPAFPCKSSNFDKVNGV
                     EPDKGEELALRRIIQIIDDVKTFYPPGMKVWIISDGHVFSDCIGVDDDVVDTYTMRLH
                     ELYKSLSVGKENYIQFYGLNEIFFGDAKTIQYFNKEWTKDVEICHLTGSKINAKADLS
                     REVLMKGCDTDDGRLKKHINTDGHARLYLYRGFSKFMSEDLQLQPLFQAMSKKKFKKT
                     VSKVAFNMIKRNDAYSNLVELMFPHHLRFSIHAHNNAGPKYGIKVISREQCAIVKDLK
                     NPEEPIFEDLLHIPTPWHNCIVSFEGNIKDLDSDEDNTELQLLKETSKLSVSSSSSDN
                     LNSNEYNSSASTSTVSTIYSNKSGSQLSSDLITPLSSQSSNQSTFKQQPLYYLTRSRE
                     VKDAIEKGLYDGEWRETSFEDGIGGYYILRKRY"
     gene            <439994..>441469
                     /gene="TPHA0E02110"
                     /locus_tag="TPHA_0E02110"
                     /db_xref="GeneID:11531466"
     mRNA            <439994..>441469
                     /gene="TPHA0E02110"
                     /locus_tag="TPHA_0E02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685689.1"
                     /db_xref="GeneID:11531466"
     CDS             439994..441469
                     /gene="TPHA0E02110"
                     /locus_tag="TPHA_0E02110"
                     /inference="similar to DNA sequence:INSDC:YDR402C"
                     /note="similar to Saccharomyces cerevisiae DIT2 (YDR402C);
                     ancestral locus Anc_5.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685737.1"
                     /db_xref="GeneID:11531466"
                     /db_xref="GOA:G8BTS5"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:G8BTS5"
                     /translation="MIDHITGTATVLIASLIFLFLFKIYMPPLDFPRNIPTIPFYVQF
                     LPTLFRIDQVDVYNMYIRESMEKYGAVKFFFGSRWNILVSKPEYLKQMFKNEDTFAKS
                     GNQRKIPYSLIAAYTGDNVISAHGDNWKLYRSSITNGLQHYDGTPMVSNAILFCSLIK
                     KSINSTEGTVTVGPLIQKLTLANISQIVLGFDFGTLSKEHSTIHDNLLKNKKKIFNPL
                     FLTFPFLDLLNLPQRKTGFQEVNKFREELVATVEQELINNYKFEQTTFAASDLIRAYN
                     NEQLNFKQLADNLTILLVAGHENPQLALTSIFYYFGKYADTWQKRIREEVSKVSEINE
                     LYNLPLLNAFIYETLRILPPLNIIINRCTTETSQLGPNIVIPKNTYVGYHNFGTTHDK
                     NVWGLRCEEFDPYRWGCDILEIKTNWKHAKNLCKLPTFHGGKRACLGEKFANQELIIT
                     LAESLKRFEWVINNDCSQKMTPGGPLCPADLKLKFKCLDKD"
     gene            complement(<441599..>442675)
                     /gene="TPHA0E02120"
                     /locus_tag="TPHA_0E02120"
                     /db_xref="GeneID:11531467"
     mRNA            complement(<441599..>442675)
                     /gene="TPHA0E02120"
                     /locus_tag="TPHA_0E02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685690.1"
                     /db_xref="GeneID:11531467"
     CDS             complement(441599..442675)
                     /gene="TPHA0E02120"
                     /locus_tag="TPHA_0E02120"
                     /inference="similar to DNA sequence:INSDC:YDR400W"
                     /note="similar to Saccharomyces cerevisiae URH1 (YDR400W);
                     ancestral locus Anc_5.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685738.1"
                     /db_xref="GeneID:11531467"
                     /db_xref="GOA:G8BTS6"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:G8BTS6"
                     /translation="MTKEKIPIWLDCDPGHDDAIAILLSCFHPAFKLVGISACYGNAS
                     PNNTHYNARSILTAIGKANDIPVLNGAQQPWKRLPIYAPDIHGESGLDGTTLLPVPIG
                     DINNDSYIDYIEEKIEENEGELFISTGSLTSIATVLKEKPHLKKKLKYLAIMGGGLSV
                     GNINENKSAEFNIWVDPDSANFLFTDEVIKNKCIVTPLDLTHKAIATQEVMENILGTS
                     GSNLRRLFYELFLYFGNSYKNAQGFETGPPIHDPLALIPLLVLYGWEPDMVIQYVYKR
                     VDLKVIVDENDADIGKLVILKEYDANDSHGTVVGIDLNYKYFWTQVYLGIAEAEKLST
                     IELIAKDVVRKELMQEELSNDDIV"
     gene            <443169..>444128
                     /gene="TPHA0E02130"
                     /locus_tag="TPHA_0E02130"
                     /db_xref="GeneID:11531328"
     mRNA            <443169..>444128
                     /gene="TPHA0E02130"
                     /locus_tag="TPHA_0E02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685691.1"
                     /db_xref="GeneID:11531328"
     CDS             443169..444128
                     /gene="TPHA0E02130"
                     /locus_tag="TPHA_0E02130"
                     /inference="similar to DNA sequence:INSDC:YDR288W"
                     /note="similar to Saccharomyces cerevisiae NSE3 (YDR288W);
                     ancestral locus Anc_5.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685739.1"
                     /db_xref="GeneID:11531328"
                     /db_xref="InterPro:IPR002190"
                     /db_xref="UniProtKB/TrEMBL:G8BTS7"
                     /translation="MSDQEAEYMEGTPNSDPTATDIKIVHIAHAMIRYILSVATNTNT
                     VITRSRLQDKIRDLKIKENAPNVKFELIFERINAILLDVYGYKLIGYQSSSSHQHTEN
                     SNGETNTESNAKEGSDADEIENKNVVSDKFAHRSNSFILINNLKYVHSFESFISLQKS
                     LQYRKTIVDGEYIGNDNDQPASQTLDNSIGTDKLLAMNGILAIVISMIAFSKNNILHN
                     ELTGYLQQFGIPIDDTANIPILEMKFSELLKVFVKREYVAKIEENSSMEGDIVTYRLG
                     RRTKAEFPIKSLVSMVQTILNIPNEQLPNLKKDIIKNIGDTYS"
     gene            <445640..>447712
                     /gene="TPHA0E02140"
                     /locus_tag="TPHA_0E02140"
                     /db_xref="GeneID:11531359"
     mRNA            <445640..>447712
                     /gene="TPHA0E02140"
                     /locus_tag="TPHA_0E02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685692.1"
                     /db_xref="GeneID:11531359"
     CDS             445640..447712
                     /gene="TPHA0E02140"
                     /locus_tag="TPHA_0E02140"
                     /inference="similar to DNA sequence:INSDC:YHR042W"
                     /note="similar to Saccharomyces cerevisiae NCP1 (YHR042W);
                     ancestral locus Anc_5.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685740.1"
                     /db_xref="GeneID:11531359"
                     /db_xref="GOA:G8BTS8"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8BTS8"
                     /translation="MNKTDIIVLGVLVVCVLLYTKRETIKAIIADIIGGDDSDISADS
                     SGSRDIAQVLSQNNKNYLVLFASQTGTAEDYAKKFAKELTSKYQLNVMCVDVENYDFE
                     TLNDIPSKCMVSLFISTYGEGDFPDGAVKFEDFLSEAADSNGLANISISTFGLGNSTY
                     EFFNGAGKKAVEHMTNAGATIVGDLGCGDDAAGTTDEDYMAWKERIFEELKEKLQLDE
                     HDESFESSFKYEPLESITDDVSLGEPSFQYLPASKLSFNDAGIQLGPFDASHPYVAPF
                     VKSVELFKSDDRNCIHSEIDISGSNMKYTTGDHLGIWPSNANEKVDQFLKVFGLNGKN
                     IFNLTPKDATVKVPFPVPTTIDSAVRHYLEITGPIARQLFAQLVEFAPNEEIKKKLTV
                     LSQDKDLFAKEITSKKFNLADALLYLSNGEYIWTSVPWEFLLENVSPLLPRYYSISSS
                     SLSEKQTIHITSVVENSPNEHAEIGNTIGVATNLIRNIQLAQNKVDIASSNLPVTYDL
                     SGPRDLFSGFKLPMHVRRSTFRLPTNPSTPVIMIGPGTGVAPFRGFIRDRVHMVDTQE
                     NVKFGKHMLFYGSRNTDDYLYQEEWPEYAKKLDTSFEMITCHSRIPGQKKVYVQDMLS
                     ERAADISTLINDGAFIYVCGDAGRMAKDVNSVITNIISSNKGISTEDAAEIVKMLKTS
                     GRYQEDIW"
     gene            complement(<448011..>448760)
                     /gene="TPHA0E02150"
                     /locus_tag="TPHA_0E02150"
                     /db_xref="GeneID:11531389"
     mRNA            complement(<448011..>448760)
                     /gene="TPHA0E02150"
                     /locus_tag="TPHA_0E02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685693.1"
                     /db_xref="GeneID:11531389"
     CDS             complement(448011..448760)
                     /gene="TPHA0E02150"
                     /locus_tag="TPHA_0E02150"
                     /inference="similar to DNA sequence:INSDC:YHR043C"
                     /note="similar to Saccharomyces cerevisiae DOG2 (YHR043C)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685741.1"
                     /db_xref="GeneID:11531389"
                     /db_xref="GOA:G8BTS9"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BTS9"
                     /translation="MPSISVDYCLFDLDGTIVSTTIAAERTWRSYCSKHGVDPEELFR
                     VSHGSRTNEMLSRFFPNIDNTDNKAVKELELDLATNHLDTVTLIKGAEDLLLSLDKDT
                     ETGKPLKSRKWAIITSGSPYLAFSWFDSILKHVGKPDVFVTGFDVKVGKPDPEGYKKA
                     AVELSEIWEKPAEDISKLQTVVFEDAPVGIMAGKAMGAKTIGITSSYDKSVLFEAGAD
                     YVVSDLRQVRVTQNSNDGKIILEITNPLSRD"
     gene            complement(<449466..>450377)
                     /gene="TPHA0E02160"
                     /locus_tag="TPHA_0E02160"
                     /db_xref="GeneID:11531474"
     mRNA            complement(<449466..>450377)
                     /gene="TPHA0E02160"
                     /locus_tag="TPHA_0E02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685694.1"
                     /db_xref="GeneID:11531474"
     CDS             complement(449466..450377)
                     /gene="TPHA0E02160"
                     /locus_tag="TPHA_0E02160"
                     /inference="similar to DNA sequence:INSDC:YDR280W"
                     /note="similar to Saccharomyces cerevisiae RRP45
                     (YDR280W); ancestral locus Anc_5.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685742.1"
                     /db_xref="GeneID:11531474"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:G8BTT0"
                     /translation="MAKEIITPVAESKFILDALKENQRLDGRSFDKFRDVDISFGKEY
                     GDATVTLGKTKVQCRVSCSITQPYEDRPFEGLFIISTEMSPMAGPQFENGSNTGDDEV
                     LCSRIIEKAIRRSGALDVEGLCIVAGSKCWAIRADVHVLDCDGGIIDASCLAVICALL
                     HFRKPDVSILGEQVTVHPINEREPVALGILHIPICVTFSFFNPQDVEENIKGAGNNEI
                     AIIDATLKEESLRDGVLTVTLNKNREVVQVSKAGGLPMDALSLMDCCHKAYDITERIT
                     DQILALIKEDSQKRNKFAQILSSENAR"
     gene            complement(<450763..>451842)
                     /gene="TPHA0E02170"
                     /locus_tag="TPHA_0E02170"
                     /db_xref="GeneID:11531475"
     mRNA            complement(<450763..>451842)
                     /gene="TPHA0E02170"
                     /locus_tag="TPHA_0E02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685695.1"
                     /db_xref="GeneID:11531475"
     CDS             complement(450763..451842)
                     /gene="TPHA0E02170"
                     /locus_tag="TPHA_0E02170"
                     /inference="similar to DNA sequence:INSDC:YDR279W"
                     /note="similar to Saccharomyces cerevisiae RNH202
                     (YDR279W); ancestral locus Anc_5.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685743.1"
                     /db_xref="GeneID:11531475"
                     /db_xref="GOA:G8BTT1"
                     /db_xref="InterPro:IPR019024"
                     /db_xref="UniProtKB/TrEMBL:G8BTT1"
                     /translation="MTVGTTKIILFTPKAFEEKKIDLAGFNLPHPSNIKTKPCLQLVK
                     AVTSGDSPIDTVYSLKSHTFSKGSKINNSTDLANDIYHYTDDGVPLKSFILTNEKARS
                     DAWILESGDVKYLQKFDLTYCLIGFYFKESISKSEAEYSKSVKQQLTVPNSKLETALN
                     DQKKYLSLRDYKELLCEAHDENWCHVDENILQKALSNISEEINEAGDLYYQIKNDKIM
                     DFISEKIGKIAKHFPKSLPLPNNLPENILECCKILMSLNLLISLIPKECYTKLLQYEG
                     NSLIPSTVNIHKSHKEYIEYMNTNKDAMKEKELLLKAAMNVGLTGDQPVRKQINKITK
                     KTVVSKPKVAQGKGAIDGFFKRTKK"
     gene            <452593..>454299
                     /gene="TPHA0E02180"
                     /locus_tag="TPHA_0E02180"
                     /db_xref="GeneID:11531452"
     mRNA            <452593..>454299
                     /gene="TPHA0E02180"
                     /locus_tag="TPHA_0E02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685696.1"
                     /db_xref="GeneID:11531452"
     CDS             452593..454299
                     /gene="TPHA0E02180"
                     /locus_tag="TPHA_0E02180"
                     /inference="similar to DNA sequence:INSDC:YHR045W"
                     /note="similar to Saccharomyces cerevisiae YHR045W;
                     ancestral locus Anc_5.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685744.1"
                     /db_xref="GeneID:11531452"
                     /db_xref="UniProtKB/TrEMBL:G8BTT2"
                     /translation="MALDLYLTLKLVATIIVVYFSSNWIIANVIFPLTRDLSDVSLLE
                     QASISAVRKDNETAHYRNFLIPSNFPLTTGLNIALGYKFRNGNFGDVWNAILTNSDKN
                     FIRFSNDSNKKYNLQEINSLAKLISKKHFSGNEYKQVGITVNISSLYGFIISLATMMA
                     TIRQGDVIPHFLSSVPRQKVDDLDVLVIDSWKSFKLLNGSLSWYKLLIVCDTLANKPH
                     DLNSEIKVVCWDELVEDCKFDDNTFEYSSSDDKADDFKSFAYITSPSNETTCFAQMNL
                     VSSIAAFFKIFPIGKELTSDDELAVAGSFTRSSLSIQLWNKVFAVLLVGGSVSFVNNY
                     ALSVSQPTLLFTGSEDLTPIAEKMEDTSNSSLFKKITLSWSTTLLSEGIFSKIAQTST
                     ENSSNSLNKLRCIFLGEIQAKSNTISSMKSSIPRMKKGIRSTLTTIQLNKIRALFGSR
                     VVAELYFPYMIMGPLAATNYYDYRVISNSVESAVSFHGALCTSLEAKFVATDENEHLD
                     ISSRQGMLCIRGFTIGKPYERTRLDNAIQLSEKVGGGEGWMPMVGIFGLFGHDGCLYT
                     YN"
     gene            complement(<454396..>455280)
                     /gene="TPHA0E02190"
                     /locus_tag="TPHA_0E02190"
                     /db_xref="GeneID:11531469"
     mRNA            complement(<454396..>455280)
                     /gene="TPHA0E02190"
                     /locus_tag="TPHA_0E02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685697.1"
                     /db_xref="GeneID:11531469"
     CDS             complement(454396..455280)
                     /gene="TPHA0E02190"
                     /locus_tag="TPHA_0E02190"
                     /inference="similar to DNA sequence:INSDC:YHR046C"
                     /note="similar to Saccharomyces cerevisiae INM1 (YHR046C);
                     ancestral locus Anc_5.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685745.1"
                     /db_xref="GeneID:11531469"
                     /db_xref="GOA:G8BTT3"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G8BTT3"
                     /translation="MTIDLNQIEKFISELVLDKVGPIIKKKSGSQQNYDLKTGSRRVD
                     IVTEIDKEVEQLIWKTLKDEYPTFQFVGEEGYVEGVTEITNDPTFIVDPIDGTTNFVH
                     DFPFSCTSIGLTISKVPVVGVIYNPHLDLLVTASKGNGVKVNGEQFDYTQKYQTMGPL
                     VLNKSIVALQPGSAREGENFTCKMKTYQNLLAYEKGFVHGFRNLGSSAMTLAYITLGH
                     LDSYWDGGCYSWDVCAGWCILTESGGRIVGANKGEWDIPVDNRTYLAVRGTANNDKET
                     QEKYINDFWNCVEGKLKY"
     gene            complement(<455739..>458444)
                     /gene="TPHA0E02200"
                     /locus_tag="TPHA_0E02200"
                     /db_xref="GeneID:11531526"
     mRNA            complement(join(<455739..458328,458407..>458444))
                     /gene="TPHA0E02200"
                     /locus_tag="TPHA_0E02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685698.1"
                     /db_xref="GeneID:11531526"
     CDS             complement(join(455739..458328,458407..458444))
                     /gene="TPHA0E02200"
                     /locus_tag="TPHA_0E02200"
                     /inference="similar to DNA sequence:INSDC:YHR047C,YKL157W"
                     /note="similar to Saccharomyces cerevisiae AAP1 (YHR047C)
                     and APE2 (YKL157W); ancestral locus Anc_5.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685746.1"
                     /db_xref="GeneID:11531526"
                     /db_xref="GOA:G8BTT4"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G8BTT4"
                     /translation="MYSLHLLYFCCIICFAFAFVNVLDTNVIPIHYNLLLYANMTSFE
                     TQGIVKIDVIVNNPAINVIRINSYKLGILGASLEGIKSTSIKINDEQQFIDIEFPSDT
                     ISPIKKLLKSKSVLEIIFQGKLSDDMLGFYRAQYKDKNTNTSEIIATTHMEPIYARRA
                     FPCFDEPKLKATYSITLLSDPAYTHLSNMDVKESFMMENGLKVTKFNRSPKMSSYLVA
                     FVVAKLEYIETNNFRVPVRVYTIPGHKEEGKYAATLAAETLKFFENVLKIRYPLPKLD
                     NIAIPEFSAGAMENWGLITYRTSDLLLDKNSSTLKKIQRVTEVIQHEVAHQWFGNLVT
                     MQEWGQLWLNEGFATWMSHFAMSKFYPFWNVEERSISETLRAAFSLDMLASSHPIEVN
                     IDNESDIQQIFDAISYSKGSSLLKMISDKIGETAFITGISYYLKNNMYKTTNTSTLFK
                     YLSFAANEDISYIREWTTKPGFPLISVVENKDNIILTQSKFLATTNTTISTNDILYPI
                     PVQILTKDGERNITMKEQSMKIELNLERFIKINYNGSGFYVTKYSEERLNKLFSMINI
                     LSVSDQLSLLNDIYFLTVSGSLSTDKLINYLQYLKSSNSYLIWEMIYKIVISVKEVYK
                     FDYHITNLLDKFVISMAAQKFYFLGWEISKDDSQDVKQLKIILFILLNNANDPIIEVV
                     SKELYLNYKANITAKIPKAYITTLFEQCGKRGDIEDYEFLLKVYKDSDDLNIQQSALM
                     SLGYFKESDLLHKTISMLLTDDVLKQDIHILMSGIRSSPEGTYQLWEWLKLNWVDILK
                     RYPVGSSSLGSIVKLCTIGFVSQEQYSQIKYFFKDKSVITYSKLLDQSLEMIIIKSTW
                     RDRDFMRLSNYLNNTNNIH"
     gene            <459394..>460125
                     /gene="TPHA0E02210"
                     /locus_tag="TPHA_0E02210"
                     /db_xref="GeneID:11531137"
     mRNA            <459394..>460125
                     /gene="TPHA0E02210"
                     /locus_tag="TPHA_0E02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685699.1"
                     /db_xref="GeneID:11531137"
     CDS             459394..460125
                     /gene="TPHA0E02210"
                     /locus_tag="TPHA_0E02210"
                     /inference="similar to DNA sequence:INSDC:YHR049W"
                     /note="similar to Saccharomyces cerevisiae FSH1 (YHR049W);
                     ancestral locus Anc_5.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685747.1"
                     /db_xref="GeneID:11531137"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BTT5"
                     /translation="MSTTVPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDA
                     PVILDKKDLPFEMDDEKWQATLDAEVNKAWFYHSSISKELDLSESIKFVSNYIKENGP
                     YDGIVGFSQGAALSTILTNKITELVPNHPNFKVSLIISGYSFTEPDPENEGQLRITEK
                     FQESFTPNTDSNTKLLFIYGESDQAVPSIRSKYLHDLYKSKLPTEKHDLLKSFPHPGG
                     HMVPNKKDIIRPLVEEITSALTVTE"
     gene            <460753..>462585
                     /gene="TPHA0E02220"
                     /locus_tag="TPHA_0E02220"
                     /db_xref="GeneID:11531525"
     mRNA            <460753..>462585
                     /gene="TPHA0E02220"
                     /locus_tag="TPHA_0E02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685700.1"
                     /db_xref="GeneID:11531525"
     CDS             460753..462585
                     /gene="TPHA0E02220"
                     /locus_tag="TPHA_0E02220"
                     /inference="similar to DNA sequence:INSDC:YHR050W"
                     /note="similar to Saccharomyces cerevisiae SMF2 (YHR050W);
                     ancestral locus Anc_5.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685748.1"
                     /db_xref="GeneID:11531525"
                     /db_xref="GOA:G8BTT6"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:G8BTT6"
                     /translation="MVNVKFSALQEDGVISHSNDIESTSIQTSPTVADLNENIITSSA
                     SAATASPEDDINEFEITSNPLENDDYQNLNLYMSQYQNTSTLGKVVGFLREYARFIGP
                     GLMVSVSYMDPGNYSTAVAAGSAHRYKLLFSVFVSNLMAAFWQCLCAKLGAVTGLDLA
                     QNCKKHLPYRVNITLYILAEVAIIATDLAEVVGTAIALNILFKVPLALGVVLTVIDVL
                     IVLMAYKPNGDLRLIRWFEAFVSLLVVLTVICFGFELHYAELGPAKEIFKGFLPSAAA
                     FQGDGLYLSLAILGATVMPHSLYLGSGVVQPRLRDYDINHGHYKPDEVDTENNHEDYK
                     PSFEAIDATLHYTIAELLISLFTVALFVNCSILIVSGATLYGTTQDSQEADLFSIYDL
                     LCETLSKTAGTIFVLALLFSGQSAGIVCTLSGQMVSEGFLNWTIPPALRRSLTRAVAI
                     TPCLILVLVAGRDGLSGALNASQVVLSLLLPFVSAPLLLLTSRKDIMSVEISDNVNRT
                     SHVNSTIKSGSLFSFSQSLKKNKNKNAHSDEEYIQLRHMDSEGEEQDDNQVLAVPLNT
                     DNVAYKDMSNSWFTTVAAAALWLAVSLLNFYMLISFATGKDVHF"
     gene            <463453..>463926
                     /gene="TPHA0E02230"
                     /locus_tag="TPHA_0E02230"
                     /db_xref="GeneID:11531178"
     mRNA            <463453..>463926
                     /gene="TPHA0E02230"
                     /locus_tag="TPHA_0E02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685701.1"
                     /db_xref="GeneID:11531178"
     CDS             463453..463926
                     /gene="TPHA0E02230"
                     /locus_tag="TPHA_0E02230"
                     /inference="similar to DNA sequence:INSDC:YHR051W"
                     /note="similar to Saccharomyces cerevisiae COX6 (YHR051W);
                     ancestral locus Anc_5.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685749.1"
                     /db_xref="GeneID:11531178"
                     /db_xref="GOA:G8BTT7"
                     /db_xref="InterPro:IPR003204"
                     /db_xref="UniProtKB/TrEMBL:G8BTT7"
                     /translation="MFSRSLFRTPVLRRMAIARTSPIVGKSMTIQPTLSKFQLRNYSE
                     SQHDNETFEEFTARFEKEFDDAYDLFEVQRVLNNCFSYDLVPAPVVIEKALKAARRVN
                     DLPTAIRVFEALKYKVENQAQYEAYLDELKEVREDLGVPLREVLFNAETAQPHHN"
     gene            complement(<464332..>464766)
                     /gene="TPHA0E02240"
                     /locus_tag="TPHA_0E02240"
                     /db_xref="GeneID:11531179"
     mRNA            complement(<464332..>464766)
                     /gene="TPHA0E02240"
                     /locus_tag="TPHA_0E02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685702.1"
                     /db_xref="GeneID:11531179"
     CDS             complement(464332..464766)
                     /gene="TPHA0E02240"
                     /locus_tag="TPHA_0E02240"
                     /inference="similar to DNA sequence:INSDC:YKL160W"
                     /note="similar to Saccharomyces cerevisiae ELF1 (YKL160W);
                     ancestral locus Anc_5.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685750.1"
                     /db_xref="GeneID:11531179"
                     /db_xref="InterPro:IPR007808"
                     /db_xref="UniProtKB/TrEMBL:G8BTT8"
                     /translation="MGKRKKSSRGPAKKVVQKLDLKFNCLFCNHDKSVSCTLDRKNSI
                     GSLSCKICGQNFQTHINGLSQPVDVYSDWFDAVEEVNAGRGSESDNDDDDSESDYESD
                     SDEPNSRSKSVAADPDEEEVDSDEEIGLAKRGRGRLVDSDEE"
     gene            <465630..>466862
                     /gene="TPHA0E02250"
                     /locus_tag="TPHA_0E02250"
                     /db_xref="GeneID:11531317"
     mRNA            <465630..>466862
                     /gene="TPHA0E02250"
                     /locus_tag="TPHA_0E02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685703.1"
                     /db_xref="GeneID:11531317"
     CDS             465630..466862
                     /gene="TPHA0E02250"
                     /locus_tag="TPHA_0E02250"
                     /inference="similar to DNA sequence:INSDC:YHR052W"
                     /note="similar to Saccharomyces cerevisiae CIC1 (YHR052W);
                     ancestral locus Anc_5.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685751.1"
                     /db_xref="GeneID:11531317"
                     /db_xref="GOA:G8BTT9"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="InterPro:IPR028365"
                     /db_xref="UniProtKB/TrEMBL:G8BTT9"
                     /translation="MSKATPNKTPATVGSRSNSKKNTPVNTPTKTKKKSASNTPNSVK
                     GKNAKKATSKNNTPIKVKEVKEVKSDSVVPKERIEKAIEELGKFIKKQSASGEKSQLL
                     NEDDDLNNLLQLIVVNNDSFTGSKKVFKLKLIDIKNSFYKIWKAASATEVKDFKTLLI
                     LKDSDVSKVTEDELYDGLSKSDITVDKVICGKDLKTVYKAFEARRALLSEYQLILADD
                     SIITTLPKLLGAKAYNKVETTPISIRTSCGKGFSKETLINSIKKVYLNKLPVNLPRSN
                     TANIHLGNYNWYEDNEKDLIENIESVITQMIDAFKIRSVFIKSNSSPALPLYFNVDVI
                     TEIQKKVKDVNREEMVAVTIDGVELKLSAFDQALMQVSNPTEHSNIFAKNIQAVKRKA
                     ESKAESKAESKDVKKSKK"
     gene            complement(<467259..>469202)
                     /gene="TPHA0E02260"
                     /locus_tag="TPHA_0E02260"
                     /db_xref="GeneID:11531329"
     mRNA            complement(<467259..>469202)
                     /gene="TPHA0E02260"
                     /locus_tag="TPHA_0E02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685704.1"
                     /db_xref="GeneID:11531329"
     CDS             complement(467259..469202)
                     /gene="TPHA0E02260"
                     /locus_tag="TPHA_0E02260"
                     /inference="similar to DNA sequence:INSDC:YHR032W"
                     /note="similar to Saccharomyces cerevisiae YHR032W;
                     ancestral locus Anc_5.276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685752.1"
                     /db_xref="GeneID:11531329"
                     /db_xref="GOA:G8BTU0"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:G8BTU0"
                     /translation="MSKQFQNRTERTTSFVYSTSLGKSGLYTPADYINNNLSSETENA
                     CDNSHTHAWEEDDLNEDYMDGIDTNVDSISHVGDVQPFSDEQAPLLNNDTIDSSQTYE
                     TLKPKIHTTKSNASVSKHRNSLLFSKKLVNEERDLLKDNKLLNAYNHPNYNPSLDNSF
                     NEVSDEEEREIIATWESAIQSGKKITTTYKREVQVLATNAFPLIFTFILQNSLSVASI
                     LSVSHLGTKELGGVTLGSMTANITGFAAIQGLCTCLDTLCSQAYGAKNYHLVGVLLQR
                     CCILTIIAFLPIMYIWWFWSESLLELIITEKELCILAANYLKVIAFGVPGFILFECGK
                     RFLQCQGIFHASTIVLAFCAPLNALMNYLLVWNSKIGIGYLGAPVSVAINYWAMALGL
                     YLYTVMTDHDVVPMKCWNGFIKTDQVFKNWRKMFNLALPGIVMVEAEFLGFEILTIFS
                     SRLGPEVLGAQSIVSTIASLAYQIPFSISIATSTRVANFIGASLHKACVITCEVSLLL
                     SFVCSTMNIFIIFNFKVFLAKLFSNEPEVVELVIKTLPYLAFMQLFDAFNASTAGCLR
                     GQGRQKIGGYINLFAFYCVGIPLSYILAFKFGFGIIGLWSGITCALFTMSIFQGYAVF
                     HVNWKDIIAASKNRNAEHVSVCA"
     gene            <471696..>472916
                     /gene="TPHA0E02270"
                     /locus_tag="TPHA_0E02270"
                     /db_xref="GeneID:11531343"
     mRNA            <471696..>472916
                     /gene="TPHA0E02270"
                     /locus_tag="TPHA_0E02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685705.1"
                     /db_xref="GeneID:11531343"
     CDS             471696..472916
                     /gene="TPHA0E02270"
                     /locus_tag="TPHA_0E02270"
                     /inference="similar to DNA sequence:INSDC:YHR030C,YKL161C"
                     /note="similar to Saccharomyces cerevisiae SLT2 (YHR030C)
                     and YKL161C; ancestral locus Anc_5.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685753.1"
                     /db_xref="GeneID:11531343"
                     /db_xref="GOA:G8BTU1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BTU1"
                     /translation="MEEVNKTKNGKHRTERRKAYTAHGEQMLISENFDIFKIIHNNHH
                     STIALSNFANAVVEKTNVTIKKFKTMSSTKNETEILKNYKRIVREVKLLNFLKFSSNI
                     IQLYDIDVICTNDIQIPMDVYLYEEAMESDLDKIIKSNQHLSDLHYQNFLNQLLSAVK
                     YLHSAGIIHGDIKPSNVLVNSDCQIKLTGFSYSVSTETKITSNDTIKSNDSQSSKWYR
                     APELILNYNEVSEASDVWSIGCVLAELFSKRAFLKSKDYLGQLNRLLQILGTPPQSVL
                     SKIKSSSVKDYINRLGIIPRVRFNKFFSNINFISIDMLEKMLQYDTTERITIDDALNH
                     TYLKIWHEPKDEFVSKEKFSFEFENITSLTELCQLIIREVDDDSTSMDENGNIQYAEK
                     PTLQDTDSSEEWIT"
     gene            <473229..>474146
                     /gene="TPHA0E02280"
                     /locus_tag="TPHA_0E02280"
                     /db_xref="GeneID:11531160"
     mRNA            <473229..>474146
                     /gene="TPHA0E02280"
                     /locus_tag="TPHA_0E02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685706.1"
                     /db_xref="GeneID:11531160"
     CDS             473229..474146
                     /gene="TPHA0E02280"
                     /locus_tag="TPHA_0E02280"
                     /inference="similar to DNA sequence:INSDC:YHR029C"
                     /note="similar to Saccharomyces cerevisiae YHI9 (YHR029C);
                     ancestral locus Anc_5.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685754.1"
                     /db_xref="GeneID:11531160"
                     /db_xref="GOA:G8BTU2"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="UniProtKB/TrEMBL:G8BTU2"
                     /translation="MVNKLLFKQMDVFTSKPFKGNPVAVVNCMDISEDEISSETMLSI
                     ANWTNLSETTFLFKPTDPTKSNYKLRIFTPANELPFAGHPTIGSCKAYLQFTDQIQTL
                     KYIRQECEVGIIDLVSDVDTGIISLKAEKTDLDKLEADVVKLYQESLTNNGKPIKPID
                     SPYVLHVGPEWVVFLVEDSETCYNANPDFGKMAEISLKYGHSGIILAGKKSKFDENSS
                     VLEMEMRAFVPAYNVNEDPVCGSGSIALIRYLQQKYNFSKTTRINISQGGRMTREGHI
                     YAEIKVTSDGISYHCGGDALCVVDGVINV"
     gene            <474485..>477076
                     /gene="TPHA0E02290"
                     /locus_tag="TPHA_0E02290"
                     /db_xref="GeneID:11531161"
     mRNA            <474485..>477076
                     /gene="TPHA0E02290"
                     /locus_tag="TPHA_0E02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685707.1"
                     /db_xref="GeneID:11531161"
     CDS             474485..477076
                     /gene="TPHA0E02290"
                     /locus_tag="TPHA_0E02290"
                     /inference="similar to DNA sequence:INSDC:YHR028C"
                     /note="similar to Saccharomyces cerevisiae DAP2 (YHR028C);
                     ancestral locus Anc_5.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685755.1"
                     /db_xref="GeneID:11531161"
                     /db_xref="GOA:G8BTU3"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BTU3"
                     /translation="MTEFHDTEYQSFGNEPEDLRELTQRKRERVSYYSNRYFKPSIIL
                     ILLIWGSYLLINTVETFYNTNKSKEKLDTPNSYKLPNSLVTDNGQLKVNFNNVRNNTF
                     VPEFHSLQWIKNDVTSDNLDMGLYMTYIDEKYLIKSVYDKEYEKVLFHGKKFEYDGKS
                     IDIDSIIASSNLKYLIIKANVISNWRHSTLATYFEYDIKKKSIKLIGDNISFVEWSPN
                     SNEIAYVQDNDIFIYSIAESKTIIRVTADGNTQIFNGRPDWVYEEEVLENDKALWWSE
                     KGDYLSFLKIDETNVNEYTIPYFVQEASLNLVSPYPEMRSIKYPKSGTPNPTVDVWIF
                     KRQDRTSYPAKISSVIRDSADTEIKALKWESLLVTEVVWIGNTHVLIKTSDRSSEVLT
                     ILLIEVENQKTIITRQDTSIDGWWEISHDLLYVSSDASKNRTSDGYIDLYPVDGYNHL
                     AYFSPANSSEPIALTRGEWEVVKGPATFDPETNDVYFIGTKKSSMERHLYKVNLHNPE
                     KVTDITNTTEEGVYSVSFSTGSRFALLSYMGPNIPYQKIVDFKSSNYDDKKVNSSFQP
                     GETLYYLETNEKLAKRMELYSVPARTFRELNIGEDNDGNDILVNSYEILPDNFDPEKK
                     NYYPVFFYAYGGPNSQQVVESFAVGFNEVAAAQLDAIVVVVDGRGTGFKGGKFRYLVR
                     DNLGDVEAQDQISAAKLYSKKPYVDAEKISLFGWSYGGYLTLKTLEKDAGKYFKYGIS
                     VAPVIDWRFYDSVYTERYMHTPQENDIGYQKSKVSNVTAIGESQRFLLMHGTGDDNVH
                     FQNSMKFLDLLDINEVENYDVHVFPDSDHSIRHHNANDMLYNRLLNWVKLAYTDRFHK
                     DTLIFQK"
     gene            <477722..>480631
                     /gene="TPHA0E02300"
                     /locus_tag="TPHA_0E02300"
                     /db_xref="GeneID:11531276"
     mRNA            <477722..>480631
                     /gene="TPHA0E02300"
                     /locus_tag="TPHA_0E02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685708.1"
                     /db_xref="GeneID:11531276"
     CDS             477722..480631
                     /gene="TPHA0E02300"
                     /locus_tag="TPHA_0E02300"
                     /inference="similar to DNA sequence:INSDC:YHR027C"
                     /note="similar to Saccharomyces cerevisiae RPN1 (YHR027C);
                     ancestral locus Anc_5.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685756.1"
                     /db_xref="GeneID:11531276"
                     /db_xref="GOA:G8BTU4"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /db_xref="UniProtKB/TrEMBL:G8BTU4"
                     /translation="MVDISEDKNEIKAELPNTPSKDDKSKNKKQEEGEELSEEDFKLK
                     SDLELLVDILKDSDTALFETSLNQLKEFIKNSTSSMTAVPKPLKFLRPAFPDLCSVYD
                     KWEDKKLKALIADVLSVLAMTYSQDKKHDSLRFRLLSDVNGIQSWGHEYMRHLSLEIG
                     EVYNEQAEQEASKSAENGTKVTTSEETYNFSKDELLHLALEIVPYFLKHNAEVDAVDL
                     LLELEAIDKLPQYVDEGTYRRVCQYMVECVPLLPPPEDIAFLQTAYTIYLSEAQLTDA
                     LELAIRLGDDGLIRNVFDASPDESVHKQLAYILANQKSSFEYESVQDIIGNTKLSEHF
                     LYLAKALNLTAPKVPEDVYKSHLDNSKSVFTGTGLDSAQQNLAASFVNGFLNLGYCND
                     KLVVDNDNWVYKTKGNGMTSSVASIGSIYQWNLDGLQQLDKYLYVDEPEIKAGALLGI
                     GISAAGVHDGDVEPALLLLQDYITNKDQKISSAASLGLGIAFAGSQNEEVLGLLLPIA
                     GDTSLPMETSVMASLALSHVFVGTSNGDITTSIIDNFLERSASDLKTEWTKFLTLSLG
                     LLFLGQGDEVDDVLETMSAIDHPMVSAMEVLISACAYTGTGDVLLIQDLLHRLTPKSV
                     KKGNEEEVEEEDTKEALSEFLGEQTENATKLENADEMDVDEEPTVKAQEDGTSIKTKT
                     ENDDDAKEKDSKSKKDEEEKDEEELNVDITYAVLGIVMIVLGEDIGKEMSLRHFSHLM
                     HYGNEHVRRMVPLAMGLVSLSDPQMKVFDTLSRYSHDPDIDVSINSIFAMGLCGAGTN
                     NARLAQLLRQLASYYSREQDALFVTRLAQGLVHLGKGTMTFDLFNDAHVLNKVTLASI
                     LTVVIGMSTPSFMLEHHELFFMLNSGVRPKYIITLNEDGEPIKVNVRVGQAVNTVGQA
                     GKPKTITGWITQSTPVLLNHGERAELENDEYISLTKNIEGVVILRKNPDFNEAEK"
     gene            complement(<480904..>481977)
                     /gene="TPHA0E02310"
                     /locus_tag="TPHA_0E02310"
                     /db_xref="GeneID:11531338"
     mRNA            complement(<480904..>481977)
                     /gene="TPHA0E02310"
                     /locus_tag="TPHA_0E02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685709.1"
                     /db_xref="GeneID:11531338"
     CDS             complement(480904..481977)
                     /gene="TPHA0E02310"
                     /locus_tag="TPHA_0E02310"
                     /inference="similar to DNA sequence:INSDC:YHR025W"
                     /note="similar to Saccharomyces cerevisiae THR1 (YHR025W);
                     ancestral locus Anc_5.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685757.1"
                     /db_xref="GeneID:11531338"
                     /db_xref="GOA:G8BTU5"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8BTU5"
                     /translation="MVRGFSIKVPASSANIGPGYDVMGIGLNLYLELEATIDPSNASE
                     TNSDANNCKISYSKDSEGYDSVPLASDANLITRTALYVLRCNNIRSFPSGTKVFIKNP
                     IPLGRGLGSSGAAVVAGVMLGNEVGKLGFSKQRMLDYCLMIERHPDNITAAMMGGFCG
                     SFLRDLTPQEVERREIPLSEVLPEPSGGEDTGLVPPLPPSDIGRHVKYQWNPKIKCLA
                     IIPNFELSTADSRGVLPKAYTTSDVVFNLQRLAVLTTALTLDPPNPELIYPAMQDRLH
                     QPYRKTLVPGLSDILSSLTPSTFPGLLGICLSGAGPTILALATENFEEIAQEIINRFA
                     KNKVECTWKLLEPATEGAVVENL"
     gene            complement(<482429..>488176)
                     /gene="TPHA0E02320"
                     /locus_tag="TPHA_0E02320"
                     /db_xref="GeneID:11531361"
     mRNA            complement(<482429..>488176)
                     /gene="TPHA0E02320"
                     /locus_tag="TPHA_0E02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685710.1"
                     /db_xref="GeneID:11531361"
     CDS             complement(482429..488176)
                     /gene="TPHA0E02320"
                     /locus_tag="TPHA_0E02320"
                     /inference="similar to DNA sequence:INSDC:YHR023W"
                     /note="similar to Saccharomyces cerevisiae MYO1 (YHR023W);
                     ancestral locus Anc_5.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685758.1"
                     /db_xref="GeneID:11531361"
                     /db_xref="GOA:G8BTU6"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR027401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTU6"
                     /translation="MSTCSSSSSSLFWIPTDTEELFVKAELVTEDPSSNNNSKNGNSV
                     EQQVTLRKLSDNKQVQVSINYIWPVNPNIFDKVNDLSELTHLNEPSVLYNLQNRYMED
                     SIYTYSGLFLVAINPYKQLNIYGHEFIKKYHNQKAKEELNVQTSSEYNSNARINNQLP
                     PHVYNITENVFQNLLKNKQNQSILVTGESGAGKTENTKKILQYLTSITEDHSIESSNK
                     FEKKILNSNPILESFGNSQTVRNNNSSRFGKFIKIKISNFNQKILGAEIEWYLLEKSR
                     IITQTNDERNFHVFYELLAALKQEKYADLKKKLLIESTAYSSYNILNDIHSSNDGRNF
                     EDLINALDTIGFSETEISDIFRIISAILHIGNLQYNHTTGNKNDKQARFSNPELLNKI
                     GELLGITDINELEQSLIKPKSKAGKEWVAKSKNIQQSKSILHALSKNLYTDLFDYIVE
                     KINKTLNLNNTEINSDDTGSSLDVNYIGLLDIAGFEIFQKNSFEQFCINYTNEKLQQF
                     FNNHMFILEQKEYLKENIDWDYIDFGKESKATIDLIEVKSSNPTGILPLLDEESIIPN
                     SSDESFFNKLINNWGDNKNQDSRFKRSKKPDCFILKHYAGDVEYDTLGWLTKNRDPLN
                     EHLLTILSSSSVKIIATFFASDDYYNNSIKVTTASKHREQLKSLVDQLQSTNPHFVRC
                     IIPNNSKLPMDLDRRLVLDQLRCNGVLEGIRIAREGYPNRILFKEFYQRYHFLLDKNM
                     LTSLDLRNYKHNCEILISNIMNISPTLYKIGKTKLFFKAGVLANMEEMIEEKLMQVTV
                     KFNSKIKGLLVRKSVEHELAEIYATQEIGQSFRSYNKLINSSPWFNLYIKLKPLLNSS
                     DDIVKNRKIQENVKNMEEAIKITESQCVDLTRKLCDKESELTNVQALLQEESKKLKEH
                     EMLAEEAKVQEGILTEKLDELRTINKEIESNQAILASENKDYIEKIESLEKSINEQEQ
                     ETKTLYEKREQKYIIEISELEADLKAKKETLHSLTLNNNELTDKLSKLTKVESEQRLK
                     IKDMELQLSNSENDLDSKLVTLEKNCNVALVRLKTLLNDNSSLKTQIATLKRDHELFE
                     QQLKLKIAETDALQQKLFQQNQTLKTLQQEKSKILLENTSMTKELNKTKENLKVYIQN
                     FQELEQKHRALEEQQRSVKSGDEGRIMKLETRISEESARNKNLSEEIKRMNNDRAMEL
                     SINRSIVNESDHNVEKMASKIDLLEAELQDLTVAFNKATENEKNMTSKLRFTETKLAS
                     TVLEIQTVTSQRNKLRKIIESSDLKVNLDNELLKVDNTSEISAKQLTLEAQYLRKQLE
                     IETKARYDAEAKLSSLSKKFEKSSGDAISSPNLITKLKASEEKVRQLEIRLKSMSPLR
                     DRTNINPPAGNIFLNRENIGKYEDEVRFYKLENYKLQEFLNNADKKINSLVHSLKQSD
                     TKTALLIDNLERLKVDTEKTNEHNDVLTSKLKQNETQLTNTFNQLDNSNHKIAELSHA
                     LNQAENDVQGMAKLIDDLKSTNKEMDKSIWDVEMQRNDISTKLQECMVDLQKKDDQIN
                     ILKSSIDHYKGEMIKMESNLTNVDELERLREELHSFSKIETEYKKTISNLNYNLETLQ
                     NDYEANVAELLRENSHYTSKLEQLTLDRDNIIAENQDISKRYSESIVTQNNLIKELDD
                     IRDFCANLEKKLSSMDIELVTTKDKLYKTITENTDLLNNKAYLEDALKLQGEQIERSS
                     QLIEKLQMEVNDSKLKYDDLKQKKIDVSEENTTINKLNMKLNNDIKLLEKQLADTSEK
                     DLWSSRLNELQDQLTSETNMKYELIKENKVLGNDLEDLKNLNTKQMEIIKIANEERKK
                     LEGDSMEYINKVSNLEKQLSKQQLDIKRMIRDNSYFEEKVEELDKEVEYWKQKFQSLS
                     PNKNDANVNSQQIMT"
     gene            <490922..>491932
                     /gene="TPHA0E02330"
                     /locus_tag="TPHA_0E02330"
                     /db_xref="GeneID:11531451"
     mRNA            <490922..>491932
                     /gene="TPHA0E02330"
                     /locus_tag="TPHA_0E02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685711.1"
                     /db_xref="GeneID:11531451"
     CDS             490922..491932
                     /gene="TPHA0E02330"
                     /locus_tag="TPHA_0E02330"
                     /inference="similar to DNA sequence:INSDC:YHR022C"
                     /note="similar to Saccharomyces cerevisiae YHR022C;
                     ancestral locus Anc_5.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685759.1"
                     /db_xref="GeneID:11531451"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTU7"
                     /translation="MSFSLLFDYEMNFCIESRYKDLTNNRITLFASQNVNKTGLLYKF
                     LRYPRSPPENTKEDIYKLNLLLSSVSKILKENSRCDTTTIIKQNRKLIKYLMDRKSVN
                     AFQIQILDTDTSTDSSYSSSNFEFNELKIMQIKQSDVFVLCYNASDIDSLYELKRCYI
                     NIVACFDNLKDMIPPIYFVGLQDENSYPLATLNNDPVTFFNDLGIDINTYPYLVQISE
                     LNATSDSYKSLLVKIILSAIKFKIEREKLIEPNEVESNQNVNNNNNNNRISAKIQNKV
                     QTNSILTNTFDHNVADTDIAPNSTTAIHSNEVSSNKRTVVRKTRSIQKENLHKNPCCI
                     IC"
     gene            493523..493594
                     /gene="TPHA0Etrna4D"
                     /locus_tag="TPHA_0Etrna4D"
                     /db_xref="GeneID:11531372"
     tRNA            493523..493594
                     /gene="TPHA0Etrna4D"
                     /locus_tag="TPHA_0Etrna4D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:11531372"
     gene            <494049..>499073
                     /gene="TPHA0E02340"
                     /locus_tag="TPHA_0E02340"
                     /db_xref="GeneID:11531396"
     mRNA            <494049..>499073
                     /gene="TPHA0E02340"
                     /locus_tag="TPHA_0E02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685712.1"
                     /db_xref="GeneID:11531396"
     CDS             494049..499073
                     /gene="TPHA0E02340"
                     /locus_tag="TPHA_0E02340"
                     /inference="similar to DNA sequence:INSDC:YJL039C"
                     /note="similar to Saccharomyces cerevisiae NUP192
                     (YJL039C); ancestral locus Anc_5.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685760.1"
                     /db_xref="GeneID:11531396"
                     /db_xref="GOA:G8BTU8"
                     /db_xref="InterPro:IPR021827"
                     /db_xref="UniProtKB/TrEMBL:G8BTU8"
                     /translation="MNWNPLLLQSLYASIEAGDIDYELFKQCLPDLANLNLKDSFPKN
                     HQSRTSLEKGTLEINGTTYKLNKEFIFAAIKISDDLNLDELAITKLLINSQNDPQKSN
                     NTNDSISLINLGKVQYYLSRQYILQIVNYIVNCSTPGDKLWDGLLSTKSNNQNSIATN
                     ILLAFDNIHKELREIKESIDKAMLLDITNTIVFKKDIKFRRDFLLKEYDILSTTMFGL
                     VNHGTLLNKQFVIDIINNVSKLDANDYFIVYHIPSIIQAFVILDEMNDQDVLALHSKF
                     IQDLTSDGEIYTKPIKVTIIFLFLCYFIGWCKKKPDSRAVNIDFKTQIDEPMMKAVSL
                     GALEQLLILTADTSETLKTGLSNIYYDMRALLERHIPRLVPVQLYETSNGLQQKHMLN
                     ALSSTGSSLDITSTGSPVISLSEQSESIFLTTLNNAIQTIISNGAFLLTKIKDEEEDS
                     LLSGEDLNLDDISVKADLERFFLATYYFFFNRPSLSKEFWSDNESDAYGFIEWASKCT
                     DSLMRSCFYIMISGLSHNEENSLNIYHFFNNGNTVSWAIISQCISDYIIKINNLTQVI
                     SLRQQQNETEDVDQTTIALEEGLNEETIIFLSSLLSLIGSVAKDINYEFKEKISEIFI
                     DILFEFVKVETPLVGAIFKTISHLVHRDETKRIKIWRSLDTLIFSNTFTLPSSDSYKT
                     SFSSLLGSYSEIMGFLNLFHSLTENESLASDNNFLTFGKLTFPERLGQGYRKVGVWPY
                     YEYILNELFVNSFKMRDYQKKEQLQLTILNIITNGLSSFDYSVILNSNIANVDLNKLV
                     STTNFFSYVHESAAVVLFNYIFTEKIFTGIYKLMSIGVDNLRIDIDGGHEQKMLIQSS
                     LQIVKMIFKYQDTYLEELCPIIVKQRIDNYFVPRRFGSHGLKSFFDTVVFNLSAIAHL
                     GLYIGSDDNKLASESLQILQIISLRYNNDNFGSNIILTTFDSVDESARIKESFIFRID
                     RPIETLSDLSVKLGILDYIADNLTFNDLQPTVSHLLLGFQVTNIISMGPDLNTFISSG
                     TSLLQSLINLLISALNALSPNNVNYAPMRLASQSIGILMKLCRNPLTANLTLDYLAEQ
                     ELFSTLLSIGPQVSKYTQWNGRMYDNNSAEDCKIFIETESIGALLSFLSFRGCLLQYL
                     SLSIHRLSFHGTPSQTKLLIEELTSNAMYSAGIFSFLDSSNLGNFHKEHDLRQNLNHF
                     KFLPISLENIQLTNYLEGNIYDFTNLNSLLNLYTRSKLSTSLNSTNPELEKEIKSEYS
                     RVKQFATNNISHSRVLELLLLNVHTWVQLVQIVVTDGGMETLTRSNFILQVFSTVVPK
                     INDYVEYDIAFSEELVSLCVFLFDIYHKDCQGIGAQNKFDVRLYELFKACIHGINSSV
                     TSPSLRSDFYVLANNYLTDILKDEYMVKNILHDLQMNSSRLIDIICSDAVSGEGTNRI
                     TSILLLDSLFQLGTHNKDNFILESLASGTHLLLLILSIKNIDSHFKISLDNVTLSSFL
                     YELTVLKTTVNMLTRIAQYKGGAQLLIRNKLFSSIEECDYLSLDPDVGLNLLLENING
                     NKINTLSFNVTRENMLQAHEDPNNISLLELYIPIFQLLSAVVIVMGSSNKSTLQSVRG
                     LLNKHNKLCSSILKKSTLIHSSVDKDDQNPSKENLKILTRLIVILCSLTSYQTDNMSN
                     MFVEIK"
     gene            complement(<499288..>501142)
                     /gene="TPHA0E02350"
                     /locus_tag="TPHA_0E02350"
                     /db_xref="GeneID:11531373"
     mRNA            complement(join(<499288..501023,>501142))
                     /gene="TPHA0E02350"
                     /locus_tag="TPHA_0E02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685713.1"
                     /db_xref="GeneID:11531373"
     CDS             complement(join(499288..501023,501142))
                     /gene="TPHA0E02350"
                     /locus_tag="TPHA_0E02350"
                     /inference="similar to DNA sequence:INSDC:YJL041W"
                     /note="similar to Saccharomyces cerevisiae NSP1 (YJL041W);
                     ancestral locus Anc_5.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685761.1"
                     /db_xref="GeneID:11531373"
                     /db_xref="GOA:G8BTU9"
                     /db_xref="InterPro:IPR007758"
                     /db_xref="InterPro:IPR026010"
                     /db_xref="UniProtKB/TrEMBL:G8BTU9"
                     /translation="MNFNTPNKSTGFSFNFNGAGSTPAGNAPSAFGAASNTNNTNTSN
                     LNLGNQTPAFGNNNSASNVPSFGNNGATNSIATAPSTSAFSMNSAATSNNQASSINTA
                     TTSSGFGMHNSNTAGSQPSSLFGAATTSSQPSNSAFGSALNSGLNSSSTAGTTTNKFG
                     SANLNQKPAFGGFSAASTNSGNKPAFGAATPVSTDNKKTFSFGNNTDDATKSTGGLFG
                     SNTSSAFGAKTGDEKAAFSLGVKLESKPDNKPAFSFGAKPDEKKEDKPSLSFGAKSDG
                     KPAISFGAKSDGKPAFSFGAKPDEKKEDKPSFSFGSKPDENKDAKPAFSFGAKPDEKK
                     DDKPVSSVFGSDKVSSPSNLSNKANDTLGNISSTTSTSDSIKMKPTEVKPISLENNTL
                     DDIITRWTKQLSDTSSHFDGYAKNLNQWDNILVQGGSQISQLYNDNILAEQTQNKVEQ
                     SLHHIERQQDDLELFLDNYEGKIETLLSDLLASGSGSVSNNNDQKRQLAYKTAEKLDL
                     NLSYLSQNLSSLIEEVNNVSNIFNKATNINLNNKHESIQLVKLLNTHLDALKSLDQTS
                     TSLENKLKLTNK"
     gene            complement(<501671..>505477)
                     /gene="TPHA0E02360"
                     /locus_tag="TPHA_0E02360"
                     /db_xref="GeneID:11531321"
     mRNA            complement(<501671..>505477)
                     /gene="TPHA0E02360"
                     /locus_tag="TPHA_0E02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685714.1"
                     /db_xref="GeneID:11531321"
     CDS             complement(501671..505477)
                     /gene="TPHA0E02360"
                     /locus_tag="TPHA_0E02360"
                     /inference="similar to DNA sequence:INSDC:YJL042W"
                     /note="similar to Saccharomyces cerevisiae MHP1 (YJL042W);
                     ancestral locus Anc_5.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685762.1"
                     /db_xref="GeneID:11531321"
                     /db_xref="UniProtKB/TrEMBL:G8BTV0"
                     /translation="MSAHEYDNVDPSVEKYLEKGTLPNLDVDWLIGGKNVQNDVLHND
                     RSNEGHLETIGSSPKSEVGNTRGSENSRPAREENIPIRKVNSIPVKGTSYMHANGDTL
                     RRSVTASKPMEEQKHHGFFSSLFRSSSKHRQEKERSMPPSLEMQTPTSHTTHSEHHSV
                     SSATMSPSNHNEVHIESSANKMSFNETSESRYVHPRNKKLEEFIEYYKKNGFSVSAFK
                     NQNYVDSQDSQDSDINKSHQDSPSKPNSAVDARGRQIPAHPKRSKFPPAIKLSSLRRL
                     EDNSISEEELNRMQQQEHPAGTSISNSSRFGSFLSRVTSHGNAGAVGSSQSLASKQSN
                     TALSNIESTRELQTSVAKQNRKKDTKLVVPGLEKVEPLKFVAFAQNTYFNDPPQQISS
                     KNPRPGEVEVKPDGSVIIHRLTPEERREVSSSFSPGMVIGGTGRLHLLSEFEPPASDD
                     NTQPETAIQGNNEQLDKHKQPNEVASHDEHTQVASKEASERAKVARNDSDNEDEGEVE
                     ISDMASKLKIDKQLVHAPASDAADYELKIEDVDDTPYPPNEDIPHDEVYTRCCHLREI
                     LPIPATMRQIKKGSTSPIPILKLHNPHPSMIEILTFSDFIRAVPIVSLSLDGVHLSVQ
                     MLRILLSSIIFNKSLIKLSMRNTPLDSEGWKLVCYFICNRKELKSVDLSMAPSIITSA
                     QKLKHNVLKKSDTRMNYNPENRSELNWDLLTASIAKKGGLEEIIIAGAQMSLDQFENF
                     IEVACMATERLGLAFNKLTKEQCDLLSKWLVQNNVTGLDVGFNDLRGKLSSFSDAIWN
                     KIQNAGYQDALSYLSFNGTNLEVLDGATSNDNEVLKLITVLCYCENLQFLDLSNNPKI
                     FPACSRTLIKCLPVFVDLVRLHLDYNNIQNTEIVMLTEILPLCSKLNYFSMLGSKLEV
                     ATYKLLMDAVRKSNSIITLNVDSQDFSEDLTNELSILTLRNLQDQFKTLNAVDEKNVP
                     LPNLQEELAKILTKRGKDDPEFDKEVDDFINNLSNSRVTIIKVVNDLFNLQAKGQLNT
                     EGKETLIRLCFTNDCLEKGIRLLKSKRGEHDINKHDLRGSNTDYSPTETMPALSSYLN
                     LNKLNHYAPYQRELVREFDPSTEVSEQKTNLITATTSKVYSQTSEEGKIFKKSALLST
                     HVDHECHDLVDEELGANTKEPVNSDLIKDLILRNDISNSVDIIDELHKHGYHLHEIFK
                     KSPVSEQGTLKHYISRERNGSNSDSTDPENKSDQKENPSNLNGEDQKAIDAAYDSVLD
                     QFISKK"
     gene            <506126..>507529
                     /gene="TPHA0E02370"
                     /locus_tag="TPHA_0E02370"
                     /db_xref="GeneID:11531368"
     mRNA            <506126..>507529
                     /gene="TPHA0E02370"
                     /locus_tag="TPHA_0E02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685715.1"
                     /db_xref="GeneID:11531368"
     CDS             506126..507529
                     /gene="TPHA0E02370"
                     /locus_tag="TPHA_0E02370"
                     /inference="similar to DNA sequence:INSDC:YJL044C"
                     /note="similar to Saccharomyces cerevisiae GYP6 (YJL044C);
                     ancestral locus Anc_5.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685763.1"
                     /db_xref="GeneID:11531368"
                     /db_xref="GOA:G8BTV1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8BTV1"
                     /translation="MMCDIRDIVINKYDGIEQLIQNGIWRGELYNNHVVTENNRGWLW
                     KTIVLHGDVIDNTLNNGENVDGNFNNILIPVPIVTDQNGNTLIANLKNNNDGRNLNKP
                     NRGIRRLTPMQAEINPLSDNNNEGDTKYENEKRKEASNDDDELITMSLEDTLEIIDLD
                     LSRLLLNPIFQHPTVHSQMRQILFNYIYSIQNNAENINTSVIQVNKNYQQGFHELLGM
                     IYLQLFRYSNSLATSINHEHDNNIILMNDVFQIYKKLMKQMVPTFYTRANLIRWENEK
                     FKPILKLCSKKLYEVLYTKNEELTNLIWLLRWIRLIFLRELPMDYVVVIWDHILTFQY
                     PIDLFMICLIVSLLLNIYEDLITDDDDYDKDDIIEKLLHFEETAGTKLISCIELCKMS
                     GNLCELYMYENYQDMACICDTFVKVRIGEDTFEKLSQLDADKQPMKKQPSIDPNRKRL
                     EDKLKSRVKKLTSTFRK"
     gene            complement(<507841..>508584)
                     /gene="TPHA0E02380"
                     /locus_tag="TPHA_0E02380"
                     /db_xref="GeneID:11531420"
     mRNA            complement(<507841..>508584)
                     /gene="TPHA0E02380"
                     /locus_tag="TPHA_0E02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685716.1"
                     /db_xref="GeneID:11531420"
     CDS             complement(507841..508584)
                     /gene="TPHA0E02380"
                     /locus_tag="TPHA_0E02380"
                     /inference="similar to DNA sequence:INSDC:YKL152C"
                     /note="similar to Saccharomyces cerevisiae GPM1 (YKL152C);
                     ancestral locus Anc_5.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685764.1"
                     /db_xref="GeneID:11531420"
                     /db_xref="GOA:G8BTV2"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8BTV2"
                     /translation="MPRLVLVRHGQSEWNEKNLFTGWVDVKLSAKGEQEAARAGQLLK
                     EKNVHPDVLYTSKLTRAIQTANIALTNADRIWIPVHRSWRLNERHYGDLQGKDKAETL
                     AKFGEEKFNTYRRSFDVPPPAIDPASEFSQKGDERYSDVDPSVLPETESLALVIDRLL
                     PYWQDVISKDLLAGKTVMIAAHGNSLRGLVKHLENISDADIAGLNIPTGIPLVFELDE
                     NLKPTKPSYYLDPEAAAAGAAAVANQGKK"
     gene            complement(<509576..>510589)
                     /gene="TPHA0E02390"
                     /locus_tag="TPHA_0E02390"
                     /db_xref="GeneID:11531362"
     mRNA            complement(<509576..>510589)
                     /gene="TPHA0E02390"
                     /locus_tag="TPHA_0E02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685717.1"
                     /db_xref="GeneID:11531362"
     CDS             complement(509576..510589)
                     /gene="TPHA0E02390"
                     /locus_tag="TPHA_0E02390"
                     /inference="similar to DNA sequence:INSDC:YKL151C"
                     /note="similar to Saccharomyces cerevisiae YKL151C;
                     ancestral locus Anc_5.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685765.1"
                     /db_xref="GeneID:11531362"
                     /db_xref="GOA:G8BTV3"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR017953"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8BTV3"
                     /translation="MSILNRASHSELIKLAYERIIPPLLPTLYKGQSSKICVIGGSED
                     YTGAPYFSANAASLMGCDLTHIICEENAATVIKSYNPNLMVHPYLVTSRDNATSNFEK
                     IKTLLARMYTIVIGPGLGREAKMINDVKRILKIVLNDCEGKIPIILDADSLYVLSIDD
                     EMVELVKQFPLGKIILTPNVIEFKRICDRLLQSDKDVNESIEEQSIKISELLNCTVFC
                     KGETDQIVASIKNNKSESIILNNTVSGSNKRVGGQGDTLTGTIACMLAYSRAVHDFKI
                     LGERKNDLKWIEYVLLSCYIGSSITRTCSNIAYKEKGRAMQTTDMNSHVGKVFQKFFP
                     DKS"
     gene            <511507..>512406
                     /gene="TPHA0E02400"
                     /locus_tag="TPHA_0E02400"
                     /db_xref="GeneID:11531354"
     mRNA            <511507..>512406
                     /gene="TPHA0E02400"
                     /locus_tag="TPHA_0E02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685718.1"
                     /db_xref="GeneID:11531354"
     CDS             511507..512406
                     /gene="TPHA0E02400"
                     /locus_tag="TPHA_0E02400"
                     /inference="similar to DNA sequence:INSDC:YKL150W"
                     /note="similar to Saccharomyces cerevisiae MCR1 (YKL150W);
                     ancestral locus Anc_5.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685766.1"
                     /db_xref="GeneID:11531354"
                     /db_xref="GOA:G8BTV4"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G8BTV4"
                     /translation="MFARVLRTNPKYIPLTVGAAAILIGAAYNFAVSRNNFISNSSGK
                     VLVGDGKWVDIPIAKIENLSSDTKKFTFKLPSEDDVLGTEYASAILAKFVTPKGSNVI
                     RPYTPVSPVDTKGNFELVIKHYEGGKMTEHLFGLKENDTVAFKGPMLKWKWIPNGFKE
                     VTLIGGGTGITPLFQLIRAICENPNDKTVVKLFYGSKSPSDILLKKDIDEFQKQFPNQ
                     LKVTYFVDKSEDKTDYKVGYISKDFVRENCSKPAKDSHVFICGPPGFMDALSGQKKSP
                     TDQGEITGIFKELGYTNDDIYKF"
     gene            <512919..>514490
                     /gene="TPHA0E02410"
                     /locus_tag="TPHA_0E02410"
                     /db_xref="GeneID:11531355"
     mRNA            <512919..>514490
                     /gene="TPHA0E02410"
                     /locus_tag="TPHA_0E02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685719.1"
                     /db_xref="GeneID:11531355"
     CDS             512919..514490
                     /gene="TPHA0E02410"
                     /locus_tag="TPHA_0E02410"
                     /inference="similar to DNA sequence:INSDC:YGL078C"
                     /note="similar to Saccharomyces cerevisiae DBP3 (YGL078C);
                     ancestral locus Anc_6.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685767.1"
                     /db_xref="GeneID:11531355"
                     /db_xref="GOA:G8BTV5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTV5"
                     /translation="MSKDELKIQKRKNEDDVVVDKKKHKKDKKDRKSKKDKRDKKEKK
                     SKKHDETETVDEATEENSTPVSVNSNGSYTQSDDLTNVPQSEIDTFYEENEVTVDDNG
                     SSKLRPLLSFNHVKLNKKIQDEISKFPKPTPIQSVSWPYLLTGRDVIGVAETGSGKTF
                     AFGVPAINNLVDANGQLKYKKGIQVLVISPTRELASQTFDNLVILTDKLGLHCCCVYG
                     GVPKDPQRTQLKVSQVVVATPGRLLDLLQEGSVDLSNVNYLVLDEADRMLEKGFEEDI
                     KNIIRETASVGRQTLMFTATWPKEVRELASTFMERPVKVSIGNRDELTANKRITQIVE
                     VIDPFKKDRKLLDLLKKYHSGPKKDEKVLIFALYKKEASRVERNLQYNGYQVAAIHGD
                     LSQQQRTQALNEFKSGKCNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRT
                     GRAGQTGTAHTLFTEQEKHLAGGLVNILNGANQPVPEELKKFGTHTKKKEHSAYGAFF
                     KNVDMNAKPKKITFD"
     gene            <515073..>515981
                     /gene="TPHA0E02420"
                     /locus_tag="TPHA_0E02420"
                     /db_xref="GeneID:11531144"
     mRNA            <515073..>515981
                     /gene="TPHA0E02420"
                     /locus_tag="TPHA_0E02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685720.1"
                     /db_xref="GeneID:11531144"
     CDS             515073..515981
                     /gene="TPHA0E02420"
                     /locus_tag="TPHA_0E02420"
                     /inference="similar to DNA sequence:INSDC:YPL196W"
                     /note="similar to Saccharomyces cerevisiae OXR1 (YPL196W);
                     ancestral locus Anc_6.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685768.1"
                     /db_xref="GeneID:11531144"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:G8BTV6"
                     /translation="MLYDMKNAINRLKSSFSQSETSSLSSNSSLSKTNKDEDKIDSSW
                     MNDDEMLCLPSVKLNGYSPSTKKRLLTPDMCDELRTLMPSRIQLYTEWNLLYSLEQHG
                     ASLHSLYDNVKPESKTPMRVGYIIVVKDKLNGIFGAYSNEYFHPTDARRYYGNGECFL
                     WRMDKVPSPTFNSKNNDDLKSTTNNNYETNNNNNNNNNNNNNNNNNNNNNNNDDDDDD
                     DVEELERECKWHFRGYPVTGLNEFAIYCTSTFLSMGAGDGHYGFWLDDRLLNGVSDPS
                     LTYGNDVLSKEGNKFHIFGVEVWRVG"
     gene            complement(<516407..>516829)
                     /gene="TPHA0E02430"
                     /locus_tag="TPHA_0E02430"
                     /db_xref="GeneID:11531232"
     mRNA            complement(<516407..>516829)
                     /gene="TPHA0E02430"
                     /locus_tag="TPHA_0E02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685721.1"
                     /db_xref="GeneID:11531232"
     CDS             complement(516407..516829)
                     /gene="TPHA0E02430"
                     /locus_tag="TPHA_0E02430"
                     /inference="similar to DNA sequence:INSDC:YGL080W"
                     /note="similar to Saccharomyces cerevisiae YGL080W;
                     ancestral locus Anc_6.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685769.1"
                     /db_xref="GeneID:11531232"
                     /db_xref="GOA:G8BTV7"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:G8BTV7"
                     /translation="MSQKVQQAATRSLMQKYINKETLKYVFTTHFWGPVSNFGIPIAA
                     IYDLKKDPTLISGPMTGALVMYSGVFMKYALAVTPKNYLLFGCHIINESAQLVQGCRF
                     INYNYFKTDEEKLAIQESYAKAEREQELKKLELAAKKP"
     gene            complement(<518295..>519563)
                     /gene="TPHA0E02440"
                     /locus_tag="TPHA_0E02440"
                     /db_xref="GeneID:11531485"
     mRNA            complement(<518295..>519563)
                     /gene="TPHA0E02440"
                     /locus_tag="TPHA_0E02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685722.1"
                     /db_xref="GeneID:11531485"
     CDS             complement(518295..519563)
                     /gene="TPHA0E02440"
                     /locus_tag="TPHA_0E02440"
                     /inference="similar to DNA sequence:INSDC:YGL081W"
                     /note="similar to Saccharomyces cerevisiae YGL081W;
                     ancestral locus Anc_6.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685770.1"
                     /db_xref="GeneID:11531485"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:G8BTV8"
                     /translation="MLDIRQRIFDLNESRRDAGVIEIIGRASDRIESRNSDTNNFYFN
                     DRFLSRNHASLCIKLLQPTLSDTSVVDQFRIFVTDLDSSYGIVDLYCNDQKQDVIDIK
                     NGEYFGLIDLKNNESDSRILYKLRCRVVIFQDPLSKGYICQLEVENLVNEDDIVSLSD
                     SYELSDSSVNEKIVADFNEARLGDNLFDTRSEREEDEISISYSKVSNDLDPDSSNLSS
                     FENIIYSDTRTSESGSEELSPSPETVDDCFETRSELIDEKYSVVSLHAEDRQEYPKNN
                     DFVILDTSKISKKGSQSIDPIITYPANNFTADIDISGTDEIIQDSVPAVTSNITSPCT
                     IYDDKFNHNYSKHKSSKRSLQPEFQEINLRKICSPIKKRKKINAITKTLRSKKELIIC
                     GLVGLAVGSIGTFGLLIAVANKLEQNQKLD"
     gene            <520692..>523397
                     /gene="TPHA0E02450"
                     /locus_tag="TPHA_0E02450"
                     /db_xref="GeneID:11531172"
     mRNA            <520692..>523397
                     /gene="TPHA0E02450"
                     /locus_tag="TPHA_0E02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685723.1"
                     /db_xref="GeneID:11531172"
     CDS             520692..523397
                     /gene="TPHA0E02450"
                     /locus_tag="TPHA_0E02450"
                     /inference="similar to DNA sequence:INSDC:YGL233W"
                     /note="similar to Saccharomyces cerevisiae SEC15
                     (YGL233W); ancestral locus Anc_3.554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685771.1"
                     /db_xref="GeneID:11531172"
                     /db_xref="GOA:G8BTV9"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:G8BTV9"
                     /translation="MTQDNQTDISSGLQQVILSTSVVGKNNREKELQYRKIDKIQDFN
                     DVSDGRSIDDFFELDSLTFDKWVPLLRKSIEAEQLHPLVDNLYNSIDDHFEGLETQLL
                     QDAQISDKLKTSIPQISNIQDIIEGSLSADISNLQNALTKSTTEVILKKEVYLNNKKI
                     SSKVKETSILISKVLRILELANNCQDLIIEKNFFKALQNIETLEQIYLQEFKNYNFQF
                     LNEIYGSIPFLKSSIKDECVNLIKNSFNLNLGKNLLTVGDQFFQVYRDELLPVWIEVK
                     DTMKLGNFKFNSPIEISLRDQNITSKLNLSNFFDLDEFHDSILIFQKLNEFDYLFTEL
                     TTEYAFRKNKIIHPLSWKNATNGISNTPGSSGNTGNANNSGNSEAFQKLLSVKFLKEY
                     FLKLLGFLLYDINLNRATDYIIVCNNYNATNEFWDGIMQLISPSLEYFVQNILNTEEE
                     LTEFKDFMCIFIAILENYELNIDSLYAFLISIFKKFCKLATNAFEEEFQVLLNDDDFM
                     PLTINDRQLYEKVTKICWMKDSDDMLVEQNGNDDDFIVTLPFSPLYPMTCTLIKKTYT
                     KLISFISSFFRHELHTVNSILVTTVDHLFNDIVNHKIRAKLDTTSREEIAQILINLDY
                     FIIAANKFSKLMETENIMQNPDIGIKLSSINNYEESRKQAESQLIELIDNKVSDILET
                     VELDWNATVTREEPDFSIVDIAQFLEMMFSSTLVNLPYSVQTLLIFREFDSLTTQFLN
                     ILLHETPAKITKESVLNFEVDIKYLKSIISRIFPSSDGIEDEENDLNGLRAPPTPISQ
                     VNNSIHSPSLIENNIKSLKATFTELEQCLDLLKLDNVEEYSDPEIRMRRFARIRPDDA
                     SILLNKVKPITSQREVVSASRDSTSPLPMESLNTHRIAKFFKNKK"
     gene            <523928..>524671
                     /gene="TPHA0E02460"
                     /locus_tag="TPHA_0E02460"
                     /db_xref="GeneID:11531173"
     mRNA            <523928..>524671
                     /gene="TPHA0E02460"
                     /locus_tag="TPHA_0E02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685724.1"
                     /db_xref="GeneID:11531173"
     CDS             523928..524671
                     /gene="TPHA0E02460"
                     /locus_tag="TPHA_0E02460"
                     /inference="similar to DNA sequence:INSDC:YGL232W"
                     /note="similar to Saccharomyces cerevisiae TAN1 (YGL232W);
                     ancestral locus Anc_3.553"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685772.1"
                     /db_xref="GeneID:11531173"
                     /db_xref="GOA:G8BTW0"
                     /db_xref="InterPro:IPR004114"
                     /db_xref="UniProtKB/TrEMBL:G8BTW0"
                     /translation="MQELGLLFEEKMEEMYRKELKELSEEQNPEQNADENESEEELSI
                     EDQIKQELSELKPKTNDDGSKIRKKDPLSFIDLNCECVIFCKTRKPIVPEDFVKKIIE
                     DLADPNDMQKRTRYVMKLTPITNSCNATMEQFILLLNRVLAPHFHEADKAEKSIKFAV
                     DLTRRNFNTIERMDLITQVVKQVIKDGKYKHVVDLKAYDKLILVECFKNNIGVSVVDG
                     SFGSKYKKYNVQQIFEAKMKAKDKQNEQK"
     gene            complement(<524807..>525355)
                     /gene="TPHA0E02470"
                     /locus_tag="TPHA_0E02470"
                     /db_xref="GeneID:11531391"
     mRNA            complement(<524807..>525355)
                     /gene="TPHA0E02470"
                     /locus_tag="TPHA_0E02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685725.1"
                     /db_xref="GeneID:11531391"
     CDS             complement(524807..525355)
                     /gene="TPHA0E02470"
                     /locus_tag="TPHA_0E02470"
                     /inference="similar to DNA sequence:INSDC:YGL231C"
                     /note="similar to Saccharomyces cerevisiae YGL231C;
                     ancestral locus Anc_3.552"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685773.1"
                     /db_xref="GeneID:11531391"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:G8BTW1"
                     /translation="MSSNDKIHGWAVNLINDSYLKSIKDGTSRKLPSPPGFKGAISKK
                     DAAPSINNKDLKDFQIQRSWEIATQPARSIPMNMFMSYMSGTSLQIIPIMTALMLLSG
                     PIKAIFSVKSNFKPLLGHKNGITENEIYCHMLVYILFQVALMLIGLHKLYSMGLFPTT
                     KSDWVSWEKPIQMLDSLQIFMF"
     gene            <526447..>527247
                     /gene="TPHA0E02480"
                     /locus_tag="TPHA_0E02480"
                     /db_xref="GeneID:11531336"
     mRNA            <526447..>527247
                     /gene="TPHA0E02480"
                     /locus_tag="TPHA_0E02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685726.1"
                     /db_xref="GeneID:11531336"
     CDS             526447..527247
                     /gene="TPHA0E02480"
                     /locus_tag="TPHA_0E02480"
                     /inference="similar to DNA sequence:INSDC:YFR043C"
                     /note="similar to Saccharomyces cerevisiae YFR043C;
                     ancestral locus Anc_3.550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685774.1"
                     /db_xref="GeneID:11531336"
                     /db_xref="UniProtKB/TrEMBL:G8BTW2"
                     /translation="MRPRDKLLVLFSNDEEVTKIKSFILQKVFKLDNSILENGYNVSI
                     LKDLVWENKYYSLNYDLYVDEYDNIETWIKEYISKECDVLREVLSGIIIIDKFDNKTD
                     TNELLSISKSLSVNKGSENIFNIFINTNMDFEDSKLEEINDSILASEFDHAIEFLKIS
                     YSDIDENISFVPMDNVTKYGERVGLSRAIDIIDTSDWEGCIRVMTKQKTSIKNKEIRQ
                     DNDNEEHNNLDLLLKQLHIAREQFNASQNKIEAEKLANDLAEEISKLI"
     gene            complement(<527340..>527969)
                     /gene="TPHA0E02490"
                     /locus_tag="TPHA_0E02490"
                     /db_xref="GeneID:11531511"
     mRNA            complement(<527340..>527969)
                     /gene="TPHA0E02490"
                     /locus_tag="TPHA_0E02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685727.1"
                     /db_xref="GeneID:11531511"
     CDS             complement(527340..527969)
                     /gene="TPHA0E02490"
                     /locus_tag="TPHA_0E02490"
                     /inference="similar to DNA sequence:INSDC:YFR042W"
                     /note="similar to Saccharomyces cerevisiae YFR042W;
                     ancestral locus Anc_3.549"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685775.1"
                     /db_xref="GeneID:11531511"
                     /db_xref="UniProtKB/TrEMBL:G8BTW3"
                     /translation="MAIIALDRLIHRLYQYYQISTTFLYVALIARWIILFPLVSSKFL
                     PGGIHEFLIYLLGISSIVEMLWQFYFHGVIRSLKSRTVLKDMNFIYLVRVIHFYDDYE
                     HAVILKNTSYSSFILALGFTQAYSHFNKIFKGNKVSKRSWFWKINAFIMLPTLYLSEF
                     YLLLLNLNNYNYHSTLLLDKINYLVLIVFLPLSCLLYKGEFTSSSMQRV"
     gene            <528367..>529239
                     /gene="TPHA0E02500"
                     /locus_tag="TPHA_0E02500"
                     /db_xref="GeneID:11531520"
     mRNA            <528367..>529239
                     /gene="TPHA0E02500"
                     /locus_tag="TPHA_0E02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685728.1"
                     /db_xref="GeneID:11531520"
     CDS             528367..529239
                     /gene="TPHA0E02500"
                     /locus_tag="TPHA_0E02500"
                     /inference="similar to DNA sequence:INSDC:YFR041C"
                     /note="similar to Saccharomyces cerevisiae ERJ5 (YFR041C);
                     ancestral locus Anc_3.548"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685776.1"
                     /db_xref="GeneID:11531520"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G8BTW4"
                     /translation="MFKNKFSLLLLLFSVATLVLSFTTDEVEIFRLQKEIATRYGEEI
                     SFYKFLKLPDLDKSTSNQIKKNLKKLAKKYHPDKNPKYKKFYSRLNEVTKILVNESSR
                     KSYDYYLKNGFPDYNFNKGGFYFKRVQPKTWFTLSFIYIIASAMHYVILIIQYSSNQK
                     RISSFIKNCKENDDTNGLGEKRLIFKQYQGDEGKEFLVKFGEVFAFEEDGSTTLISPD
                     TVEQPSIYDCMFFSLPKYLWNTSIGRLFNRNTTEPTGKKLGKRKPKKNIKKEPKVYEI
                     ENDNDTYEDVKKRK"
     gene            complement(<529459..>532203)
                     /gene="TPHA0E02510"
                     /locus_tag="TPHA_0E02510"
                     /db_xref="GeneID:11531334"
     mRNA            complement(<529459..>532203)
                     /gene="TPHA0E02510"
                     /locus_tag="TPHA_0E02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685729.1"
                     /db_xref="GeneID:11531334"
     CDS             complement(529459..532203)
                     /gene="TPHA0E02510"
                     /locus_tag="TPHA_0E02510"
                     /inference="similar to DNA sequence:INSDC:YFR040W,YGL229C"
                     /note="similar to Saccharomyces cerevisiae SAP155
                     (YFR040W) and SAP4 (YGL229C); ancestral locus Anc_3.547"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685777.1"
                     /db_xref="GeneID:11531334"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:G8BTW5"
                     /translation="MSFWPFGQNLQQHSNIHKILEEYLQILHNDNENNNDNNDVYDNP
                     PLTISENSSSSLTELLNESIQINRSDSKMINDSNSSININNRTSSFLRSTPNSISDDF
                     LSKRIALKKILDNSFIDRILEETDLLNELMRQNNSLIDFICLGYFYDYESEIIENDND
                     GEAERKTTNTSPSTLNEEQLEDKKYKKVYHLEYLIDLLMKSVDHIDICEIDGVTPNPD
                     IPNTKVNNHRDEFPTSDNEANVTKNESINNTEVTLSFDSSSSSLNVTSDNPAFNKYFN
                     TANLISDIFSLDIWMLTETLVKNQTYLSKIWSILNHKNCNSERSPLVLIFLKITQNLL
                     ATRQDQFLNFIRNLPNFVDNMLRHIEITSLMDFFLKCISTDKLEAPTGIIEFVHDQNL
                     IKKCINYFDNDKYNPDTQICVYEFLKALISISANAPLDEMSIGPNSLTRELASAHVIK
                     QCIDIVITQRGHALNNIVSIVIELIRKNNSDYDQINLLETTIQDNPPSTRDPIYLGYL
                     LKHFASNFSKLFKIIEELTENNEKTFKNQMNEDYSPLGFECFRIAELMAELLHCSNMA
                     LMNSRKVENIAKKRDHFRDQLVNQLQDALEDLGIDDNESINKKRSSLDDINGVKETVD
                     NDNVTNFDSESDYEVDESFEIPYINQNQDDKLRTKSTIGDLFKISLYDTRVLNKLLEL
                     FLLHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLETSKRYGPDTSPQLSTK
                     FSITEDFLLKGYKMSFDYFELHHMNLGYMGHLVLIAEEIVKFSKLYKVELISPDIFTI
                     LQKKEWQFYSKEILDNTRIMYSKILGGGNYVDDGNGNIIPQIPEFTQNSKDYNNEESE
                     NDSDSTFSDEGSTNSIHTAGGGLINVEALDDSMRNFTESDLHDKLRKLWNDNSLVVEI
                     "
     gene            <534308..>536029
                     /gene="TPHA0E02520"
                     /locus_tag="TPHA_0E02520"
                     /db_xref="GeneID:11531335"
     mRNA            <534308..>536029
                     /gene="TPHA0E02520"
                     /locus_tag="TPHA_0E02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685730.1"
                     /db_xref="GeneID:11531335"
     CDS             534308..536029
                     /gene="TPHA0E02520"
                     /locus_tag="TPHA_0E02520"
                     /inference="similar to DNA sequence:INSDC:YFR039C,YGL228W"
                     /note="similar to Saccharomyces cerevisiae YFR039C and
                     SHE10 (YGL228W); ancestral locus Anc_3.546"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685778.1"
                     /db_xref="GeneID:11531335"
                     /db_xref="UniProtKB/TrEMBL:G8BTW6"
                     /translation="MRFINCVVSFICFILSIRLFYCSDDSIGKPLVHFLGGSANVGLY
                     LDSVCHYSSPDTWSEYLDDKNGYYQKDIKPYFSALYHETVYPLYLESNKHLNEYYNIY
                     LRKHVELAQQKIVDFINTNETTQKTLEKVNELYQQVSLLKQRLPHIIAEKSAQISKLF
                     VSSLQILKKLLLSLQHYLITKYRLQLKQNEPIQNSQKYKEVTSTSVASTSATGTVAET
                     NLVTGSSSANNNQEVIPLSEWEIVKEEFNAWFTTVDKKSSKVFDILDKDIDNYLKSKI
                     EEWDPKLQDLFKEYQTVAKKHFNLIVAKLDNIECTNSIDKDTGKITYFDAKGETQLSE
                     YVTRPIITKLFNDAEKEINALGKQISEHLISNVDMIDEEIKSIHDESVELYEEWADIM
                     ISEWSKRMAYIDIVAAHQDNEENNEDDDSNEETSKKYWRQFLKLKKRVIKTREGLINH
                     NIDLISVNDYLSNIQNDFETIAKETTDYLTVLKTKSELLFEKRDLKDKKLEQAKIQSQ
                     KDESERIRKAQESKIESLKNAEIKSTSTESTTNITRKPISKETTTSKLTKKDINKDSK
                     ESTVNTN"
     gene            <537027..>538376
                     /gene="TPHA0E02530"
                     /locus_tag="TPHA_0E02530"
                     /db_xref="GeneID:11531185"
     mRNA            <537027..>538376
                     /gene="TPHA0E02530"
                     /locus_tag="TPHA_0E02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685731.1"
                     /db_xref="GeneID:11531185"
     CDS             537027..538376
                     /gene="TPHA0E02530"
                     /locus_tag="TPHA_0E02530"
                     /inference="similar to DNA sequence:INSDC:YER043C"
                     /note="similar to Saccharomyces cerevisiae SAH1 (YER043C);
                     ancestral locus Anc_3.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685779.1"
                     /db_xref="GeneID:11531185"
                     /db_xref="GOA:G8BTW7"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:G8BTW7"
                     /translation="MSAPAHNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYADVQ
                     PLSGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFA
                     WKGETEEEYLWCIEQQLFAFKDDKKLNLILDDGGDLTSLVHEKYPEMLTNCFGLSEET
                     TTGVHHLYRMMKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKV
                     SVVAGYGDVGKGCAAALRGMGSRVIVTEIDPINALQAAMEGYEVNTMDAVASIGQVFV
                     TTTGCRDIINGTHFEQMPEDAIVCNIGHFDIEIDVAWLKANAKECVNIKPQVDRYLMN
                     SGRHIILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKADDKAFRQKFVEFEK
                     TGPFEVGVHVLPKILDEAVAKFHLGKLGVKLTKLSDVQSEYLGIPEAGPFKADHYRY"
     gene            <539071..>541722
                     /gene="TPHA0E02540"
                     /locus_tag="TPHA_0E02540"
                     /db_xref="GeneID:11531524"
     mRNA            <539071..>541722
                     /gene="TPHA0E02540"
                     /locus_tag="TPHA_0E02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685732.1"
                     /db_xref="GeneID:11531524"
     CDS             539071..541722
                     /gene="TPHA0E02540"
                     /locus_tag="TPHA_0E02540"
                     /inference="similar to DNA sequence:INSDC:YGL227W"
                     /note="similar to Saccharomyces cerevisiae VID30
                     (YGL227W); ancestral locus Anc_3.544"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685780.1"
                     /db_xref="GeneID:11531524"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:G8BTW8"
                     /translation="MSFYQTEEDEITLRTIFPQYLLQQPVEKELKSLYFQNKKLFSTF
                     ASKEYRNISNRSSKTTEDRIHQSENSISKLPYSVRKEIWTKLMKLGVLGTISFDKASD
                     KYLLQIYSYFYPDSLFQTLGLHDFSTSTITAFELPQGDEISSKYGKSTEQESLANVDV
                     QGSFNSESIREEEFNDTDEPDDEDINVGIIGSAISDGTQSSANTEEPRDDNYNSNQSG
                     NEDESNPDNIDDVDMDTDPSHSNLLTEESGLLSSKPSSLEIVRIYSESNRAQLLSKSK
                     FNSTPVEFYQLINYFLPSRWVAQPSTPIMLTKDGVTGLGNSSSRDSSNSRQPISTRIS
                     RTKVSKKNMNEYAITVANNPISTSNLGIFYYEVKILNSKKIGNETNVIVGYKVWDSLM
                     NSEILSSEDNSQRPRVFSDTNSNRTSTISFPHRPNTNSTDTTSETWDGMYGICGIDGT
                     VLGENKKPLTTPFTVEQTIGCGINYIDGSIFFTKNGLLLGSGYESIEETELIPFIAIK
                     PGTEVRTNFGLYDHFLFDILGYQDHWKAKGYQEIFSEDTTPHMNNTDTVAYEKKSPKA
                     TTFTSPSKIDFDDDLMSYPDQTDTLEIKEHRIINNEMIKPEGVKINFLNLKDDSLQST
                     LKTVINEYLVHEGLIDVAKGFLDDLKKSTIKNDDIFDPIDRNEKVIKFNEKKIVLEES
                     NLKVRQKVRRLVNEGKINECILLLNNEFPELLSNNDTLYFELEVASYLNTILASSEIT
                     IIDIIQLGRELSNKFVYSSSISEVLKPTFKNTLDDLSRLLVYEDPVNDAPGELKKYLS
                     SEYLKERLFQIVNTSILNHLNKGNEDSLENIISYTRTMLQTMSEQNIKNPSVANKSTI
                     ESDSNVHNSSSDYKYYKLINIDDLLKF"
     gene            complement(<541839..>542189)
                     /gene="TPHA0E02550"
                     /locus_tag="TPHA_0E02550"
                     /db_xref="GeneID:11531152"
     mRNA            complement(join(<541839..542090,542169..>542189))
                     /gene="TPHA0E02550"
                     /locus_tag="TPHA_0E02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685733.1"
                     /db_xref="GeneID:11531152"
     CDS             complement(join(541839..542090,542169..542189))
                     /gene="TPHA0E02550"
                     /locus_tag="TPHA_0E02550"
                     /inference="similar to DNA sequence:INSDC:YGL226C-A"
                     /note="similar to Saccharomyces cerevisiae OST5
                     (YGL226C-A); ancestral locus Anc_3.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685781.1"
                     /db_xref="GeneID:11531152"
                     /db_xref="InterPro:IPR020294"
                     /db_xref="UniProtKB/TrEMBL:G8BTW9"
                     /translation="MGYEQLYNEFNIAPPFEASFTLDSQPTYAIIGALISLLLLSMST
                     TVTSSKTFANTNFIIKFISFAIVSAVTALFCGITAVFTSNSFGVYI"
     gene            <542501..>542983
                     /gene="TPHA0E02560"
                     /locus_tag="TPHA_0E02560"
                     /db_xref="GeneID:11531530"
     mRNA            <542501..>542983
                     /gene="TPHA0E02560"
                     /locus_tag="TPHA_0E02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685734.1"
                     /db_xref="GeneID:11531530"
     CDS             542501..542983
                     /gene="TPHA0E02560"
                     /locus_tag="TPHA_0E02560"
                     /inference="similar to DNA sequence:INSDC:YGL226W"
                     /note="similar to Saccharomyces cerevisiae YGL226W;
                     ancestral locus Anc_3.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685782.1"
                     /db_xref="GeneID:11531530"
                     /db_xref="GOA:G8BTX0"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:G8BTX0"
                     /translation="MWNLSRSNGIAGVNLVRPIIRSMIYSHRRTLNTLYDSYDSKMLG
                     TVYTPPNLGTVIADWSKLKYDLKEEIKEYLIWKMEGDWHNMSKEEMQVIYFLSYGKYG
                     PRSNESTEYNNPLYLILKSTFSVILFGSVVLSAINIKQDRLVQKKLEELKVKSPGIQH
                     "
     gene            complement(<543097..>543648)
                     /gene="TPHA0E02570"
                     /locus_tag="TPHA_0E02570"
                     /db_xref="GeneID:11531499"
     mRNA            complement(<543097..>543648)
                     /gene="TPHA0E02570"
                     /locus_tag="TPHA_0E02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685735.1"
                     /db_xref="GeneID:11531499"
     CDS             complement(543097..543648)
                     /gene="TPHA0E02570"
                     /locus_tag="TPHA_0E02570"
                     /inference="similar to DNA sequence:INSDC:YER042W"
                     /note="similar to Saccharomyces cerevisiae MXR1 (YER042W);
                     ancestral locus Anc_3.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685783.1"
                     /db_xref="GeneID:11531499"
                     /db_xref="GOA:G8BTX1"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:G8BTX1"
                     /translation="MPTISKTIKYNPSTDKLITLAAGCFWGTEHIYRKYLDDKIIDCK
                     VGYANGNEDLKDASNAISYKRVCKGDTDFAEVLQLSYNPQVISLKELIGFFFRIHDPT
                     TSDSQGPDKGTQYRSGIYTHSDEDYTECLKLKQEWQPKWHNKIVTEVNEIKNFYDAEE
                     YHQLYLDKNPEGYACPTHYLREL"
     gene            <544893..>545912
                     /gene="TPHA0E02580"
                     /locus_tag="TPHA_0E02580"
                     /db_xref="GeneID:11531500"
     mRNA            <544893..>545912
                     /gene="TPHA0E02580"
                     /locus_tag="TPHA_0E02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685736.1"
                     /db_xref="GeneID:11531500"
     CDS             544893..545912
                     /gene="TPHA0E02580"
                     /locus_tag="TPHA_0E02580"
                     /inference="similar to DNA sequence:INSDC:YER039C,YGL225W"
                     /note="similar to Saccharomyces cerevisiae HVG1 (YER039C)
                     and VRG4 (YGL225W); ancestral locus Anc_3.538"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685784.1"
                     /db_xref="GeneID:11531500"
                     /db_xref="GOA:G8BTX2"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:G8BTX2"
                     /translation="MSDLKLQESAGYFSNIVNNGPVSIFSYCLSSILMTVTNKFVVNG
                     ANFNMNFVMLFVQSAVCTLLLIVLKTLGYAKFRAFNKTDAKNWLPISFLLVLMIYTSS
                     KALQFLAIPIYTIFKNLTIILIAYGEVLFFGGNVSSMELSAFLLMVFSSVVAAWGDSQ
                     AVAVKNAALVAEDVTVGSADLISTFNIGYVWMLTNCLSSAAFVLIMRKRIKLTNFKDF
                     DTMFYNNVLALPILIIFSFIVEDWSSENLAQNFSSDTATAMIISGMASVGISYCSGWC
                     VRVTSSTTYSMVGALNKLPIALSGLVFFDAPKNFLSISSIFIGFLSGLVYAVAKQKKS
                     QSPSK"
     gene            <546268..>547575
                     /gene="TPHA0E02590"
                     /locus_tag="TPHA_0E02590"
                     /db_xref="GeneID:11531460"
     mRNA            <546268..>547575
                     /gene="TPHA0E02590"
                     /locus_tag="TPHA_0E02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685737.1"
                     /db_xref="GeneID:11531460"
     CDS             546268..547575
                     /gene="TPHA0E02590"
                     /locus_tag="TPHA_0E02590"
                     /inference="similar to DNA sequence:INSDC:YER038C"
                     /note="similar to Saccharomyces cerevisiae KRE29
                     (YER038C); ancestral locus Anc_3.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685785.1"
                     /db_xref="GeneID:11531460"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:G8BTX3"
                     /translation="MSNSFIHDSQDSSVTDDVLRENIKINNSIVLSSDSSDSDLDSSF
                     HIDVGNDPILKTLKSRQKSINQEESNVLNLAGNNLFKQVKIQQFDLGSNFDKNITKNL
                     TVLNNESMASDGINDNLLQANTFVSQAEIDTKKLISFLGKSTLKKYHNIEYYINMLVN
                     ERVSSKYLDWFFFNQDSTITDISDIISNADFFLLGNNWPKLKELILKKYPTISDLLMS
                     IGVSNEKLERLGDGNCLQLTTDRTYDPLAKLLPFDSVLQIIAFYCHEKGFLKIYFAIM
                     LDRNFYELSNSYDNNLYDFLKIFSNEQILDSYFQLVSKDDYFMHYRFSRMIPQYKNIL
                     VNYLWKTDSDNIDESLEKLANEFNNLYDNSKYESLLYYILFIYGSDLLPIKMSVEKDM
                     ISVNHNNLKEYFINCIHNSTGHLTNDVELPLIKNILGIFNKIS"
     gene            complement(<547643..>548515)
                     /gene="TPHA0E02600"
                     /locus_tag="TPHA_0E02600"
                     /db_xref="GeneID:11531516"
     mRNA            complement(<547643..>548515)
                     /gene="TPHA0E02600"
                     /locus_tag="TPHA_0E02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685738.1"
                     /db_xref="GeneID:11531516"
     CDS             complement(547643..548515)
                     /gene="TPHA0E02600"
                     /locus_tag="TPHA_0E02600"
                     /inference="similar to DNA sequence:INSDC:YER037W,YGL224C"
                     /note="similar to Saccharomyces cerevisiae PHM8 (YER037W)
                     and SDT1 (YGL224C); ancestral locus Anc_3.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685786.1"
                     /db_xref="GeneID:11531516"
                     /db_xref="GOA:G8BTX4"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BTX4"
                     /translation="MSTTYYTQYEEETEKQLAENINHLESLTYPGSKITFEVDPVELP
                     KPDPNLKVFFFDIDNCLYEKSSKIHNLMHISILRYFQYHLNLSEEDARQLHLRYYKDY
                     GLAIRGLVTHHNIDALQYNKMVDDSLPLQNILSPNLTLRNLLIELKGNKQVDKLWLFT
                     NAYKNHGLRCVRLLGIADLFDGITYCDYSQPDNLICKPDVKAFEKAKLQSGLGDYKNA
                     WFIDDSGSNIKTGVELGFRKCVHVVEDEKDYYHQLLGNAPEATPIIKNIRDLKDAVPE
                     LFERFYEPLNYAFK"
     gene            complement(<548973..>550283)
                     /gene="TPHA0E02610"
                     /locus_tag="TPHA_0E02610"
                     /db_xref="GeneID:11531537"
     mRNA            complement(<548973..>550283)
                     /gene="TPHA0E02610"
                     /locus_tag="TPHA_0E02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685739.1"
                     /db_xref="GeneID:11531537"
     CDS             complement(548973..550283)
                     /gene="TPHA0E02610"
                     /locus_tag="TPHA_0E02610"
                     /inference="similar to DNA sequence:INSDC:YGL223C"
                     /note="similar to Saccharomyces cerevisiae COG1 (YGL223C);
                     ancestral locus Anc_3.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685787.1"
                     /db_xref="GeneID:11531537"
                     /db_xref="UniProtKB/TrEMBL:G8BTX5"
                     /translation="MSSVSEAQILDLFRQNTIVEIKDYNIELSQKTVKVKDEFKEALY
                     QNYQQILNVTNDIDSLLTNLKTTNTEFTKLCFDDNSFKLNKLPDFISPQPNATDIDLS
                     DNHIEEDLNSTTSNILIVSQWSIAVSDFICRFNASSTSSEELLDNLIRLFFKLSDNID
                     VILKKFKVSVERNSKQFIDFLFDVSSYGNHTFFSLKQWIMIYKLVNDEKISKLAWDKS
                     ILTKLNNAFFQNIFKFSENELFYHNYTKMNNNNFNKDSSLIKDFIETDIFKTKYIENL
                     ESQIDNKFKIINSIRNEIEKENGDIRNNELNIPKVTLRFYPETTHNSISISELVANSY
                     NQSLGLTTSKRNDLYVNIKPLLTLLSQLKKHSENDFNKANCKKQSDKLIKILEEIIPK
                     VSETELEINKDETVNMFVDDFVNLSSDLKFRDLLNKLIKEIKEI"
     gene            <550712..>552163
                     /gene="TPHA0E02620"
                     /locus_tag="TPHA_0E02620"
                     /db_xref="GeneID:11531491"
     mRNA            <550712..>552163
                     /gene="TPHA0E02620"
                     /locus_tag="TPHA_0E02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685740.1"
                     /db_xref="GeneID:11531491"
     CDS             550712..552163
                     /gene="TPHA0E02620"
                     /locus_tag="TPHA_0E02620"
                     /inference="similar to DNA sequence:INSDC:YPL235W"
                     /note="similar to Saccharomyces cerevisiae RVB2 (YPL235W);
                     ancestral locus Anc_6.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685788.1"
                     /db_xref="GeneID:11531491"
                     /db_xref="GOA:G8BTX6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTX6"
                     /translation="MSIQTTDQNEVSESIKSLSLIASHSHITGLGLDDNLQPLESANG
                     MVGQLQARRAAGVILKMVLNGTIAGRAVLVAGPPSTGKTALAMGMSKSLGKDVPFTAI
                     AGSEIFSLEVSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLT
                     IKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGA
                     DTKFVQCPEGELQKRKTVIHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQIDT
                     KVAEWKEEGKAEIIPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGISKTR
                     GTNYKSPHGLPLDLLDRSIIITTGAYNEKEIKMILSIRAQEEEVELTPEALDLLTKIG
                     TETSLRYSSNLIATSNQIAIRRQGHVKNSAIAVDVVDVKRAYLLFLDSSRSVKYMQEN
                     QSQYIDDNGKVEISSSLLVKSKTEEVDSMDTTE"
     gene            complement(<552401..>552892)
                     /gene="TPHA0E02630"
                     /locus_tag="TPHA_0E02630"
                     /db_xref="GeneID:11531492"
     mRNA            complement(<552401..>552892)
                     /gene="TPHA0E02630"
                     /locus_tag="TPHA_0E02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685741.1"
                     /db_xref="GeneID:11531492"
     CDS             complement(552401..552892)
                     /gene="TPHA0E02630"
                     /locus_tag="TPHA_0E02630"
                     /inference="similar to DNA sequence:INSDC:YPL234C"
                     /note="similar to Saccharomyces cerevisiae TFP3 (YPL234C);
                     ancestral locus Anc_6.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685789.1"
                     /db_xref="GeneID:11531492"
                     /db_xref="GOA:G8BTX7"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:G8BTX7"
                     /translation="MSSELSEYSPFYAPFFGFAGCSAAMVLSCLGAAIGTAKSGIGIS
                     GIGTFKPELIMKSLIPVVMSGILAIYGLVVAVLIAGNLNPTEEYTLYNGFMHLSCGLC
                     VGFACLSSGYAIGIVGDVGVRKFMHQPRLFVGIVLILIFSEVLGLYGMIIALILNTRG
                     SEK"
     gene            <553290..>553961
                     /gene="TPHA0E02640"
                     /locus_tag="TPHA_0E02640"
                     /db_xref="GeneID:11531459"
     mRNA            <553290..>553961
                     /gene="TPHA0E02640"
                     /locus_tag="TPHA_0E02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685742.1"
                     /db_xref="GeneID:11531459"
     CDS             553290..553961
                     /gene="TPHA0E02640"
                     /locus_tag="TPHA_0E02640"
                     /inference="similar to DNA sequence:INSDC:YPL233W"
                     /note="similar to Saccharomyces cerevisiae NSL1 (YPL233W);
                     ancestral locus Anc_6.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685790.1"
                     /db_xref="GeneID:11531459"
                     /db_xref="InterPro:IPR013950"
                     /db_xref="UniProtKB/TrEMBL:G8BTX8"
                     /translation="MNSNGKIAVGIDELGSIYEQLHRELEERIELHLPGAGEAEKSNE
                     VRVLVQRYLDDVVGMCVKSMDVTDAPDGGAAGALAAGGAPSHVTVKKLLEKRQRHYVE
                     PFDLQLHEEVRDKYGEWEDWVVRVSEMRTRGPSQINAGYTERKEAFLQLIDERIGRAL
                     LALASENDDAHDTGAPRPDDVARWEGAKHEYMQALASLSRCSETGLKQELDRAKNLVT
                     YLENK"
     gene            <554820..>555743
                     /gene="TPHA0E02650"
                     /locus_tag="TPHA_0E02650"
                     /db_xref="GeneID:11531489"
     mRNA            <554820..>555743
                     /gene="TPHA0E02650"
                     /locus_tag="TPHA_0E02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685743.1"
                     /db_xref="GeneID:11531489"
     CDS             554820..555743
                     /gene="TPHA0E02650"
                     /locus_tag="TPHA_0E02650"
                     /inference="similar to DNA sequence:INSDC:YMR182C,YPL230W"
                     /note="similar to Saccharomyces cerevisiae RGM1 (YMR182C)
                     and YPL230W; ancestral locus Anc_6.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685791.1"
                     /db_xref="GeneID:11531489"
                     /db_xref="GOA:G8BTX9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BTX9"
                     /translation="MKSKSPAPTKRPASNKKKFKCEGFGECKMAFTRQEHLARHQRRH
                     TGEKPFQCEICLKFFSRFDNMNQHRDAVHLTRRSGSAKQFIIEQNIHSSMNMLPSDST
                     MQLNTQQYMMQNPSYLSVCQHTTPHQNNVMVQSVLQHPSFQRSSSPLLRSQSLLQPQA
                     KSLPTPQLVRRTSPLPYLHPQQQFMAPMPQTYIDTPRGTNSPVSMMGGASGLRHIKLP
                     PIIFNTAETNSMPKDSISAPAINPYRPHSPLDQTTLSSMRVLAPHHNNTNPNSFNNLN
                     MSSTSNQANSNVRLPMLSTALGDHASNIISR"
     gene            complement(<555916..>556941)
                     /gene="TPHA0E02660"
                     /locus_tag="TPHA_0E02660"
                     /db_xref="GeneID:11531223"
     mRNA            complement(<555916..>556941)
                     /gene="TPHA0E02660"
                     /locus_tag="TPHA_0E02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685744.1"
                     /db_xref="GeneID:11531223"
     CDS             complement(555916..556941)
                     /gene="TPHA0E02660"
                     /locus_tag="TPHA_0E02660"
                     /inference="similar to DNA sequence:INSDC:YPL227C"
                     /note="similar to Saccharomyces cerevisiae ALG5 (YPL227C);
                     ancestral locus Anc_6.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685792.1"
                     /db_xref="GeneID:11531223"
                     /db_xref="GOA:G8BTY0"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BTY0"
                     /translation="MNFTLICGKLNGMSLAGLALTVIILIVSSLYLIIYAFSHNPRAA
                     LPEEDTFIVSIDSNGHEVKQDVTKVTKDNIDSTGDVLLSVVVPSYNETKRIETMLTEA
                     VEHLQKSFPNQWEIIIVDDGSSDGTTKFCLDLSKEKFNLKNNELKVIKLAKNRGKGGA
                     VRHGLLRIQGKYGLFADADGASKFSDASKLIESIQEQETQDIKDNSPKAAIAIGSRAH
                     MVNTEAVVKRSFLRNTLMYGFHALVYLFGIRSIKDTQCGFKLFNRQSIHEILPYLHTE
                     GWIFDVEILMLGIRKGISIVEVPVSWHEVDGSKVDLARDSINMAIDLVVIRMAYLLGV
                     YNDSKEC"
     gene            complement(<557519..>559447)
                     /gene="TPHA0E02680"
                     /locus_tag="TPHA_0E02680"
                     /db_xref="GeneID:11531366"
     mRNA            complement(<557519..>559447)
                     /gene="TPHA0E02680"
                     /locus_tag="TPHA_0E02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685745.1"
                     /db_xref="GeneID:11531366"
     CDS             complement(557519..559447)
                     /gene="TPHA0E02680"
                     /locus_tag="TPHA_0E02680"
                     /inference="similar to DNA sequence:INSDC:YMR179W"
                     /note="similar to Saccharomyces cerevisiae SPT21
                     (YMR179W); ancestral locus Anc_6.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685793.1"
                     /db_xref="GeneID:11531366"
                     /db_xref="UniProtKB/TrEMBL:G8BTY1"
                     /translation="MSESVYMNLKILYSLENSESIVTTYLSRSKTSKEVQVMTVALNS
                     GGDNNETINSKIGAVPLHDVLDEIYESSPELIDHKVETQGFDYNIYYKDVCEIGEPLV
                     SLGFLSKIRSQKENKELMVKSSAIENEDEDELIVIGSVCSNFASLLKKSYINSSKKGN
                     NKLMGKLKDNVSIETLEIKLQFSKIFKQTVKPAATKYVKPAVKGVRSAVKRQTNPKPA
                     PKAIRTQSLPIWNPMQVPGQALPASSIAHKIYMADKQNETKNSCNQPTNNSQKGRVNI
                     NSKVKINDSVSKRFDFMLKKKKTTKFVKSPNPNTATRAHRMNTTPVIMESNFASATFK
                     EKSTKNINQIHRKNSIDFGDIANFANNKLSSNLKKVTNFEEQNSLEADKENIQPSTLN
                     GKPNSSAINMNSNANAFNLLTSPDFNLKKDLDWLDDYDIFNSSIINNESVNVNALFTT
                     PNDANACNTNQTEELDNDFPNSNDFEVQAVDMQTAVTNEIGRTSPMTKQHNNGNINAD
                     LDNSNDVDNTSIVFAPTSVINSPDGEKSVEISDNFVNSINVTSKRPCESELEYEVNNN
                     IKKQRTIPSSPVNMFQYQATDDNDNDSVDPINSDDKNELFSSYINVKSYNYQNSHNST
                     PVSSYLANSSDALDDFQK"
     gene            <561382..>561819
                     /gene="TPHA0E02690"
                     /locus_tag="TPHA_0E02690"
                     /db_xref="GeneID:11531462"
     mRNA            <561382..>561819
                     /gene="TPHA0E02690"
                     /locus_tag="TPHA_0E02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685746.1"
                     /db_xref="GeneID:11531462"
     CDS             561382..561819
                     /gene="TPHA0E02690"
                     /locus_tag="TPHA_0E02690"
                     /inference="similar to DNA sequence:INSDC:YPL225W"
                     /note="similar to Saccharomyces cerevisiae YPL225W;
                     ancestral locus Anc_6.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685794.1"
                     /db_xref="GeneID:11531462"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="InterPro:IPR021148"
                     /db_xref="InterPro:IPR023139"
                     /db_xref="UniProtKB/TrEMBL:G8BTY2"
                     /translation="MSTFDAENADNLEDIEKQFAVVAVEQAETYWKLLTKIPGSKLKL
                     TSMDDEIYTNFMEKFPEYKDLERLRKFEESELKSKDAKERWRLFCNEYEKSVEDYNFG
                     TLLRTDASQEYGQFSTIFAVRIQFYAFEIARNRHGLNDWIVGK"
     gene            complement(<562009..>563604)
                     /gene="TPHA0E02700"
                     /locus_tag="TPHA_0E02700"
                     /db_xref="GeneID:11531463"
     mRNA            complement(<562009..>563604)
                     /gene="TPHA0E02700"
                     /locus_tag="TPHA_0E02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685747.1"
                     /db_xref="GeneID:11531463"
     CDS             complement(562009..563604)
                     /gene="TPHA0E02700"
                     /locus_tag="TPHA_0E02700"
                     /inference="similar to DNA sequence:INSDC:YMR177W,YPL224C"
                     /note="similar to Saccharomyces cerevisiae MMT1 (YMR177W)
                     and MMT2 (YPL224C); ancestral locus Anc_6.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685795.1"
                     /db_xref="GeneID:11531463"
                     /db_xref="GOA:G8BTY3"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:G8BTY3"
                     /translation="MNKVGLCNSGFEQLVCMNVKVLNKSNPYLFALRPSVLLLSRDLL
                     KYSRGLNRSFHLISKLDSESKNNKDSNKRDILHKHEHEHASHSLGHSHTHKAANPLLV
                     VSTEQFKKNPGVRITWIGLGINVGMTCGKFLGGIMFHSQALIADSVHALSDVVSDFLT
                     LFSVGFAKTKPTPEYPNGNGKIETIGSLAVSSILTFAGVSIGWASFTSIVGPLIPATV
                     IETITSLIGHVHVHSHTSIDDVTNVNAAWIAAASIVAKEWIFQATKKVAIQTNSNVLL
                     ANAWHHRVDSLTSLVALVTITSGYFFNIVSLDAVGGLLVSGLVIKAGATGMMSSVKEL
                     IDKSISHDEERYIEIKAGINESLKNLISNNNSGKPYQIKALDILASGPYYHVKLTLEV
                     PAQKWDNVLSMREGENIIKYLRKALSKDFSDIIKLDVEFEDEIIPLTTEQIEEKRKQE
                     KEELEEAKNFHDHYHGDILSHTHLDGELSYDNDLLGSDTTKATLESVAHSHNMDSCAD
                     QSHSHDHSHSQSHNHTDSNTQSR"
     gene            complement(<564373..>568932)
                     /gene="TPHA0E02720"
                     /locus_tag="TPHA_0E02720"
                     /db_xref="GeneID:11531458"
     mRNA            complement(<564373..>568932)
                     /gene="TPHA0E02720"
                     /locus_tag="TPHA_0E02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685748.1"
                     /db_xref="GeneID:11531458"
     CDS             complement(564373..568932)
                     /gene="TPHA0E02720"
                     /locus_tag="TPHA_0E02720"
                     /inference="similar to DNA sequence:INSDC:YMR176W"
                     /note="similar to Saccharomyces cerevisiae ECM5 (YMR176W);
                     ancestral locus Anc_6.247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685796.1"
                     /db_xref="GeneID:11531458"
                     /db_xref="GOA:G8BTY4"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BTY4"
                     /translation="MDGKPSTLKISSLLNSFTEDETVREIPVDDFKKGNKFSLSNILN
                     SSDNDIATTNVNSQVTNNIKSETVKVEKPIKQQQRNVNNYLYAQPRSRSFANPFDLNL
                     VDKTKLTLTTDSTNNIKIYHENSQLYYTLPEGSVPCFIIDDFEAFKFKTPIAFYEAVS
                     DLGEKYGAVKLTITDPRFNITNDLIETHELANEQFWFKTRKQYLSSFDTEAQKILEFH
                     KDLFQFHKNIKKTNITKIPNIDKRKLDIYRLWSCVQLRGGFDTVSSQKLWAQIGRELG
                     YSGRIMSSLSTSLRAAYVKVLQEFDLYREQLREKQREKENTVNINHIYEQNQLNVHAS
                     TPQITHLSNYETNNINTNKRISSENLDHLDSINNYNIKKLKIENPLIDNIKFITSSAA
                     EYLRIRDIKYSKGLYVSFDNITEIKKNITTNTERTIPGYDFSFWNKGQEVYDKSVYNC
                     KASSIFSVKQFYEKSQRNIKKLRQLYDGKLNLNSISSKNSQISDEEFEYSLDTMLSNP
                     SLDYEIDTALDIMPMIHNADYILNRITYGKKLKALELWKLNNVPLEENSLLKYLDIDY
                     GHVTRPKLEIGMHFSTRGWSVTDNFMPLVDYNHLGSTKLWYVIPPSEIEKFETLIKTI
                     NESRPFNTFNVRNLLPNEIEENFKSSEFYKNFLETNDDNPVIFGSKRKNVHSILNNET
                     IKSTNLGLLPNDLYLKSRFLKDNGINLKKIAQDEGSFIFQFPKSYSSSYGTGFYLSEN
                     ALFAPKSWLKNSIEGEQWLSNRNILPSMYMTQFLSNIAFNNLELRFQSSDLLGKIIRE
                     ELHNRSMFRSKHGTTHERIDKFDFISDLSLESTGFSKVVISDDYDCMSISLREFLSLK
                     GDELFSNDSNKSQKDLSISLHLSHDDDALTQLLCFSEAQNTTKTAKLLEDTFEINLFN
                     LINSKYVNKKVPFHEMKDLVSKYDPEIIEKYFDKTIIKECEILVAETKAILSKLQNIS
                     MINDAIQFGDNIKLKILTVPDNDKLLLKLEKVKDSFSTCSFYFPEMEQTNHIYQRILK
                     LTSNSIQALSTNDLKTLKEVYIKSFEVPIKHSLLKTVADKIHSLEWVDSYNKYILKVD
                     DEINYASEIFTVKSLLQFFNFGVQCCNVEDVERLENVKNIILKTNELIGLLSKQFKPK
                     KQHSKISIEILKNIIERAKEGNLPIGATMLRLIQNIITRISDIELEFTPINKLLNVNE
                     EKKNDILRIIYGDDNIGYEIFQYFNGSEKDLRANVSDFSGVKLLNDACKNAKTWSLDL
                     SKSTNKKLDKYHLRIKKALDISSDTYENKLKRLANPNDIIETSATYCYCRDGDKGGTM
                     IECEICKDWYHKSCINEGQWNLPTNTDDIFICALCNLDNNSGFFTQRFTLTFEMIEAL
                     IISSINLKVISDRIALMQLIDMYLDIIKFKKFVRSHLFDENDNVKEEITVAELKFTLR
                     KIIGSRVIFNDPLIKKIWERYSILEMSTFQNFQKPGQNIITGYNSSGTEKMIKENSNL
                     PSYDRLVERPFEVTVDKKIVHEEKI"
     gene            complement(<569419..>569946)
                     /gene="TPHA0E02730"
                     /locus_tag="TPHA_0E02730"
                     /db_xref="GeneID:11531331"
     mRNA            complement(<569419..>569946)
                     /gene="TPHA0E02730"
                     /locus_tag="TPHA_0E02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685749.1"
                     /db_xref="GeneID:11531331"
     CDS             complement(569419..569946)
                     /gene="TPHA0E02730"
                     /locus_tag="TPHA_0E02730"
                     /inference="similar to DNA sequence:INSDC:YMR175W,YPL223C"
                     /note="similar to Saccharomyces cerevisiae SIP18 (YMR175W)
                     and GRE1 (YPL223C); ancestral locus Anc_6.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685797.1"
                     /db_xref="GeneID:11531331"
                     /db_xref="UniProtKB/TrEMBL:G8BTY5"
                     /translation="MSNLLNKFADKLQGKNEEDQSEQQYQQGSQRQQGSQRQQGSQRT
                     EQPQYGLGHQGSQMRGTNQNEYDYDPNDFSGGSGGRSGLGSNQDTSGGGGRNFQGSEN
                     LQGQQLHGAGDSSFKSQMPRDYEEGEGDWGPSSIDQGDSMASGNTSGRTTRSQGQSQR
                     GGNQGHNRYQFDDQQ"
     gene            <571748..>574129
                     /gene="TPHA0E02740"
                     /locus_tag="TPHA_0E02740"
                     /db_xref="GeneID:11531468"
     mRNA            <571748..>574129
                     /gene="TPHA0E02740"
                     /locus_tag="TPHA_0E02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685750.1"
                     /db_xref="GeneID:11531468"
     CDS             571748..574129
                     /gene="TPHA0E02740"
                     /locus_tag="TPHA_0E02740"
                     /inference="similar to DNA sequence:INSDC:YGL139W,YPL221W"
                     /note="similar to Saccharomyces cerevisiae FLC3 (YGL139W)
                     and FLC1 (YPL221W); ancestral locus Anc_6.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685798.1"
                     /db_xref="GeneID:11531468"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:G8BTY6"
                     /translation="MKLIFKLCLLILNFNCILAKRTLVANSLVTCKEDSALSANSFDV
                     VFNPDDNSLHYTLDLVTQLSGNLHATVDVYAYGFKIITEDIDFCNLEWKQFCPIYPGD
                     VQIESIEYISTEYTDQIPGIAYQVPDIDAYARLNIYNNESDYLACLEIFFTNGKTVSQ
                     TGVKWASAVVAGIGLLLSAVLSTFGKSTAASHISANTMSLFLYFQSVVIVSMQHVHRV
                     PPIAEAWAENLAWSMGLIRVSFMQKIFRWYVESTGGNPTLYLTSTTISVLTQRSLDYL
                     KKRASNILYGNTNTLIFRGIKRLAFNINIENTSVVCTGFTFFVLCGYVLAGFIMCCKY
                     CIELSFRLGWIKDQNRFYTFRNAWRIILKGSLLRYVFIGFSQLTLLSFWEFTEVDSGA
                     VVTIACLFVVLSIGLMAWSAFRTHYFAQKSIKQYNNPAALLYGDDQILSKYGFFYTMF
                     NAKHYWWNTVIICHSLIRSLFVGFSQASGKTQALAIWLCDLFYVVAVIRYQPYLDRPT
                     NIINIFISVITVLNSFFFLFFSDLFGQPYTVSAIMGWIFFIMNAAFSFILLMMILTFT
                     AMIVFSKNPDLRFKPANDDRNSFQRNFNSQTGAAANELLALGDLVKDHTELFDRDIQD
                     QKDSNKSSSLDEYDLDEKKVITNDSTSLNDKSFSGKVLRNLTFKGLLGKKSKRPDNRT
                     SNSNNNLPITSLSGDEMSKGAESPQEHSFFNENKKNYPGHIRQESESNNGLITSYDDE
                     NGGRLSNPFHLSQPNIFETRSESKSSSIANLERDSSYDSLGGPQDATRNANII"
     gene            <574999..>576816
                     /gene="TPHA0E02750"
                     /locus_tag="TPHA_0E02750"
                     /db_xref="GeneID:11531432"
     mRNA            <574999..>576816
                     /gene="TPHA0E02750"
                     /locus_tag="TPHA_0E02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685751.1"
                     /db_xref="GeneID:11531432"
     CDS             574999..576816
                     /gene="TPHA0E02750"
                     /locus_tag="TPHA_0E02750"
                     /inference="similar to DNA sequence:INSDC:YGL134W,YPL219W"
                     /note="similar to Saccharomyces cerevisiae PCL10 (YGL134W)
                     and PCL8 (YPL219W); ancestral locus Anc_6.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685799.1"
                     /db_xref="GeneID:11531432"
                     /db_xref="GOA:G8BTY7"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:G8BTY7"
                     /translation="MYGSEKYDDDLNEVLTSGSAYEISDVDEEFTKLRDLPLKSKIFT
                     KSNNFSQLDEFLESRSNTPMPKKVRFDKEKDANKQDLTLDTDNNTLLSNDFERIDKSN
                     YSTVEKSKIEQETSREISNFVELPIHTKSRESATESIASSNTTRNKHHVEDIIEYASQ
                     VNNYLEQNLENIDSFRADIMKSGGIYKPFSNLATENSSVWDSTSNFELSADELDENDK
                     SNSFLFMNNFDRSSTSLPSGLLSSNLSLKLMSRTNNESGFKISSSASLTDFFEENRIN
                     NSNNNSNDNLKEYNIHKSDNNKIDIKSNEDNQDNHDDNLNLNFVDSNIYTLENSPTIM
                     GGSQCNNIPEDMILGDSEICEMNVPNFKFLKIGDNSFNEEATSNNYFEDKLLVDYESI
                     FKIRPIDDQNNMDIVPKTSEDSKTSVEEQKCPTINMLTDIIDILLKLTKNNNELHFIS
                     PEASKTEVYEQSKEKYDVFKMKSTPTVTYQNFIERIQSKCLFDETIYLGTIVLLQSLF
                     LVREKETNLIKLKYPLEESYVHRLLIASIRVSSKVLQDFVHSHEYISKVFGVSKRLLT
                     KLEVSLLLCIKNEGLMISAERLLASDKISCELKKLIENQ"
     gene            complement(<577205..>579604)
                     /gene="TPHA0E02760"
                     /locus_tag="TPHA_0E02760"
                     /db_xref="GeneID:11531433"
     mRNA            complement(<577205..>579604)
                     /gene="TPHA0E02760"
                     /locus_tag="TPHA_0E02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685752.1"
                     /db_xref="GeneID:11531433"
     CDS             complement(577205..579604)
                     /gene="TPHA0E02760"
                     /locus_tag="TPHA_0E02760"
                     /inference="similar to DNA sequence:INSDC:YGL131C"
                     /note="similar to Saccharomyces cerevisiae SNT2 (YGL131C);
                     ancestral locus Anc_6.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685800.1"
                     /db_xref="GeneID:11531433"
                     /db_xref="GOA:G8BTY8"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR029617"
                     /db_xref="UniProtKB/TrEMBL:G8BTY8"
                     /translation="MQAFENNNDVSVLMNINKAVADAQNKFENTNRDHETQSRELNED
                     RPWNFIPAIPPSFRKDIRFSNILDLDDSIVDFHKQCLLSSDNNVLLDQNDTIYTVATS
                     PGEPYYIGRVVGFEINHAYKDFVEKSLEISEKLPSNYFVLRMNWFYRPRDIGKLESTF
                     DPRRLYATQMEDIVPIESFRGKCVVSHELELIDKIPSESEVYIRPNIFYYKELYDIYT
                     DRFYTVLPTDMLLHMFTNSSYLYVLNRKVRYIFTEKDFPIEHIINKYITVDGMKDKSN
                     TFLWDNICTVCKEWCSSTDYTNCDECNRSIHKVCIEPLMQNKLNNDIVWLCNICMKRE
                     DGNKDNINEAKTMEINEKKQNLSYKRYLESESLKVFETTASYNKENYWFYYFGKNTIS
                     DFKTLLDWHLFLPYPITLKNNFNEEGNLSTWSSHPYNNDTLANLDDLAEFTTSNVDPN
                     IPHPELETFLGRAKEILGKSDSGIHYTSEEIKTTLSFFFEAQDFDIELALITCGVLFK
                     SSFFMGRLMTIEELEKFKRGINRFGNELQLVQIYIGSCELKTIIKYFSFWKDTIMGNS
                     ILNKYSIENSPRKIYLSNTRNTDDKNNIKDLKALISFDNLLKYSSELAPKYINAYIDD
                     SSVEMGSKLIQKNEPDCSICQTTASYMWYKHTRDSQVIEKLNPNSPNTRVLNNFSSIN
                     DLICIRCARLWRRYAVIWQHPVSVFAKLLEGTEMDFTHYLTEMLEESNDNYFISSAIQ
                     AHKKLIEYELVQDSEMIFRQREKMCEDPNFWTKYNSKITINRRLLSRQTRKKLTVIQK
                     S"
     gene            <580118..>581470
                     /gene="TPHA0E02770"
                     /locus_tag="TPHA_0E02770"
                     /db_xref="GeneID:11531434"
     mRNA            <580118..>581470
                     /gene="TPHA0E02770"
                     /locus_tag="TPHA_0E02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685753.1"
                     /db_xref="GeneID:11531434"
     CDS             580118..581470
                     /gene="TPHA0E02770"
                     /locus_tag="TPHA_0E02770"
                     /inference="similar to DNA sequence:INSDC:YGL130W"
                     /note="similar to Saccharomyces cerevisiae CEG1 (YGL130W);
                     ancestral locus Anc_6.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685801.1"
                     /db_xref="GeneID:11531434"
                     /db_xref="GOA:G8BTY9"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR017075"
                     /db_xref="UniProtKB/TrEMBL:G8BTY9"
                     /translation="MDRAAPEIPGILESGNVTQDLKMIVSKLLNSPKPLKTFPGSQPV
                     SFQHSDMKEKLSSHDYYVCEKTDGLRVLMLIVINPMTKEQSTFMIDRENNYYLVNGFH
                     FPKLPKKDKKELIETAQDGTLIDGELVIQTNPMTNLTELRYLMFDCLTMNGRNLTHSP
                     TSSRLAHLGKEFYKPYFDMRSIFPDRCINFPFKISMKQMNFSYDLVNVYKTLDKLPHL
                     SDGLIFTPVNTPYVVGAKDSYLLKWKPEEENSVDFKLILQIPMVEDTSLPRKDPNRWY
                     YNYDTKPTFELYVWQGGSDVNRKLEVFDQPFNKKEMNLLENTYRKFTDLEISDEKWEE
                     LKALNEPLNGRIVECTKDPETDEWLMLRFRDDKLNGNHSSVVQNVLESINDSVKIEDL
                     TEIVPIIKNNWDLRKNRHSNESSTSHAHINNRTQHQQQQNSSSSMPEPKYVDDDDWSE
                     "
     gene            complement(<581630..>582955)
                     /gene="TPHA0E02780"
                     /locus_tag="TPHA_0E02780"
                     /db_xref="GeneID:11531419"
     mRNA            complement(<581630..>582955)
                     /gene="TPHA0E02780"
                     /locus_tag="TPHA_0E02780"
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /transcript_id="XM_003685754.1"
                     /db_xref="GeneID:11531419"
     CDS             complement(581630..582955)
                     /gene="TPHA0E02780"
                     /locus_tag="TPHA_0E02780"
                     /inference="similar to DNA sequence:INSDC:YGL129C"
                     /note="similar to Saccharomyces cerevisiae RSM23
                     (YGL129C); ancestral locus Anc_6.227"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /protein_id="XP_003685802.1"
                     /db_xref="GeneID:11531419"
                     /db_xref="GOA:G8BTZ0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017082"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ0"
                     /translation="MLRVQLRQFSRASILEATSPVKGRAQGFAKKQSGGKTSKKNTSG
                     SYVKKWIDTVSTSGFNKFAKPVDMPVFEATKNLEAALNNVSKYHDSQYKSLYHMGSFK
                     KNQFNELFFRPISLVREKSTQKFIDLMNTSSNKKFIITGEPGIGKSVLLAQIHAYASD
                     SKHIVINISHPDLLVNGRNDFFYDKNLKLYIQPMYLKKFLRKILKSNDETTMKSIKLA
                     SDYKFTNADPKDNLVRKFVTLTKDTNSFYDLLTTKTTPAQRGEQFKAIITELSNQKTT
                     PVLVSVDNFSRLLTTSLCDYKNESNERIETLEFQIAKFVMDSISGEIKYKNPESAVVL
                     ATSGEDRTNKTLPVALNKIPEDIYLKRYHYDPVYANILKQGKVKEFEVPKLGKDEVQK
                     LIEFYLKANIMPRYAVGTKPLEQLINEKFIISGNGNPRELLKSIVLSYF"
     gene            complement(<583642..>585318)
                     /gene="TPHA0E02790"
                     /locus_tag="TPHA_0E02790"
                     /db_xref="GeneID:11531357"
     mRNA            complement(<583642..>585318)
                     /gene="TPHA0E02790"
                     /locus_tag="TPHA_0E02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685755.1"
                     /db_xref="GeneID:11531357"
     CDS             complement(583642..585318)
                     /gene="TPHA0E02790"
                     /locus_tag="TPHA_0E02790"
                     /inference="similar to DNA sequence:INSDC:YGL063W,YPL212C"
                     /note="similar to Saccharomyces cerevisiae PUS2 (YGL063W)
                     and PUS1 (YPL212C); ancestral locus Anc_6.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685803.1"
                     /db_xref="GeneID:11531357"
                     /db_xref="GOA:G8BTZ1"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ1"
                     /translation="MFLSKSNMIIKKPIFYSNFILLTLILNELLFFFLYSKNNVNDTP
                     STIKGDEIKLDDNGNPIPQEVRKPKRKVAVMVGYCGAGYHGMQYNPPNDTIESELFRA
                     FVRAGGISLANSNDLKKNGFMRAARTDKGVHAGGNLISLKMIIEDPDIKDKINEALPE
                     SIRVWNIERVNKAFDCRKMCGSRWYEYLLPTYTLLGPRPGSILYNDIEESKKELPNVL
                     DEDSESADFWKSVEEEQSKHFTKEEIEAIKSYVPPPRDEFDDSDGLYQKVKQFKLIEN
                     LHRRKYRISPAKLIKFRGAMQKYLGAHNFHNFTLGKDFSEPSSIRYMKEITVSEPFVI
                     GEAKTEWVSIKIHGQSFMLHQIRKMISMATLITRCGCPLERIDASFGPQKINIPKAPA
                     LGLLLESPVFEGYNKRLETFGYNPIDFSKFKNEIDEFKLKHIYDKIYKEEVDENVFNA
                     FYTYIDSFNMATGANGVETEEKSGANVQKSIFDFLTARGIPVLSNEEIDKIAKQNTNF
                     QKREAKANKKDKKNNQSNNKKFQKQEKKDEAKVETKESPAKKSYFGCSIQ"
     gene            <586578..>587123
                     /gene="TPHA0E02800"
                     /locus_tag="TPHA_0E02800"
                     /db_xref="GeneID:11531379"
     mRNA            <586578..>587123
                     /gene="TPHA0E02800"
                     /locus_tag="TPHA_0E02800"
                     /product="ribosome biogenesis protein NIP7"
                     /transcript_id="XM_003685756.1"
                     /db_xref="GeneID:11531379"
     CDS             586578..587123
                     /gene="TPHA0E02800"
                     /locus_tag="TPHA_0E02800"
                     /inference="similar to DNA sequence:INSDC:YPL211W"
                     /note="similar to Saccharomyces cerevisiae NIP7 (YPL211W);
                     ancestral locus Anc_6.225"
                     /codon_start=1
                     /product="ribosome biogenesis protein NIP7"
                     /protein_id="XP_003685804.1"
                     /db_xref="GeneID:11531379"
                     /db_xref="GOA:G8BTZ2"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005155"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016686"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ2"
                     /translation="MRQLTEEETKVVFEKLAGYIGRNISFLVDNKEHPHVFRLQKDRV
                     YYVPENVAKMATAVARPNLMSVGICLGKFTKTGKFRLHITSLSILAQHAKYKIWVKPN
                     GEMPFLYGNHVLKAHVGKMSDDIPEHAGVIIFSMNDNALGFGVSAKSTSESRNLAPTA
                     IVAFRQADIGEYLRDEDTLFT"
     gene            complement(<587446..>589374)
                     /gene="TPHA0E02810"
                     /locus_tag="TPHA_0E02810"
                     /db_xref="GeneID:11531505"
     mRNA            complement(<587446..>589374)
                     /gene="TPHA0E02810"
                     /locus_tag="TPHA_0E02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685757.1"
                     /db_xref="GeneID:11531505"
     CDS             complement(587446..589374)
                     /gene="TPHA0E02810"
                     /locus_tag="TPHA_0E02810"
                     /inference="similar to DNA sequence:INSDC:YPL210C"
                     /note="similar to Saccharomyces cerevisiae SRP72
                     (YPL210C); ancestral locus Anc_6.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685805.1"
                     /db_xref="GeneID:11531505"
                     /db_xref="GOA:G8BTZ3"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013699"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR026270"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ3"
                     /translation="MAKDNLTQLLSQLDVQSSKDEHNKVEETCLKLLQNGCSNPGEVL
                     RQYMVALIKQDSYPKTLEVLSKYKHIDEKFGKSLIIEKLYVYYKLNMVKKFDQLYYSV
                     FPKDTDLNQLKNINKNLTKRGILHVRAQFCYKNGYYPEAYEIYQFLSQNNQLHIDSEI
                     ELACNERVPLTAAPELNNIKPIISASDEHSYDLLFNDSFLLVANGEYDEAIQFLTKAL
                     EGAKEENFQNDIDTIEVQLAYVYQLSGDKNTSKTLLSKLLERLDKSSPLYLVANLNYR
                     SFSDLSKYHDNINMILREINVEKLNSLNLQQFTFQQWSMIQKNCLFLNLFNDNTIQSK
                     NSLISRTLSKYQSLINGVAHESYKTQAKKLYHNTISSISSGVDGSVIGQIILTIQLQL
                     IEKNYDNAIRLGELFLNKSWENSTTLKDADYLVCYILFELYTTIGRSSSKSQLLQKLK
                     SLTETDITHNLTFWKHVGFQYLSLNKSNEAIKLFKQILNEDRSKVETEYNDLIISILS
                     NDDFDKRKGIALVEDLDVEKIINDGVKPLEASFKRNKITKPNKLRMKLLENKKSKKAK
                     KLAIFLKDRDLTVLPDSERWIPLKDRSNYKAKKKQGAKQTQGGVMNKKAEQALDITKK
                     KAPDNKNKNKKTKKKGRK"
     gene            complement(<589816..>590970)
                     /gene="TPHA0E02820"
                     /locus_tag="TPHA_0E02820"
                     /db_xref="GeneID:11531506"
     mRNA            complement(<589816..>590970)
                     /gene="TPHA0E02820"
                     /locus_tag="TPHA_0E02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685758.1"
                     /db_xref="GeneID:11531506"
     CDS             complement(589816..590970)
                     /gene="TPHA0E02820"
                     /locus_tag="TPHA_0E02820"
                     /inference="similar to DNA sequence:INSDC:YPL209C"
                     /note="similar to Saccharomyces cerevisiae IPL1 (YPL209C);
                     ancestral locus Anc_6.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685806.1"
                     /db_xref="GeneID:11531506"
                     /db_xref="GOA:G8BTZ4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ4"
                     /translation="MVIKDKRQSLQQRNMLLNMRLNSSNPNLSNHSTAATAVAGNNKI
                     LKNNNTSALNIMSNATSSSANNGSGINKKNELKNKLWRMSFSPKSKPMTSTKNTTLIG
                     AGSKRSPVAFVGSYPMKDLKFCDFEIGKKLGKGKFGKVYCCRHIKTGFICAIKIMDKS
                     EILTYNVTKQFRNEIEIQSNLNHENLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKN
                     GPFNDIVASNFVFQLTNAIRYLHKKRIIHRDLKPENILIDFNNVIKITDFGWSVYNEA
                     GNKRKTLCGTIDYLSPELINSKEYDGLIDVWALGIIAYELIVGTPPFEEDTKELTYKR
                     IKNCDLNFPAHVSQDAKNLISSLLKLNPSERITLTDVLKHPWINKNKPFW"
     gene            <591805..>593364
                     /gene="TPHA0E02830"
                     /locus_tag="TPHA_0E02830"
                     /db_xref="GeneID:11531342"
     mRNA            <591805..>593364
                     /gene="TPHA0E02830"
                     /locus_tag="TPHA_0E02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685759.1"
                     /db_xref="GeneID:11531342"
     CDS             591805..593364
                     /gene="TPHA0E02830"
                     /locus_tag="TPHA_0E02830"
                     /inference="similar to DNA sequence:INSDC:YPL204W"
                     /note="similar to Saccharomyces cerevisiae HRR25
                     (YPL204W); ancestral locus Anc_6.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685807.1"
                     /db_xref="GeneID:11531342"
                     /db_xref="GOA:G8BTZ5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ5"
                     /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRS
                     RHPQLDYESRVYKYLSGGVGIPFLRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSF
                     KTVIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVNVIDFGLSKKYRDFN
                     THRHIAYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKA
                     TTKKQKYDRILEKKLSINVETLCGGLPQEFSEYISYCKNLKFDERPDYLYLARLFKDL
                     SIKLDYHNDHLFDWTMLRYTKAMVEKQQQQQQNTIASNTNNNNNNGITPASNNNNSNT
                     NIASITDNQDNSQTTANDQRKDKNDSFNKVKTLAMKNFPTHFHYYLIENDSYYPSPDE
                     IKKQTVANNNAVVEDSSLLKAIGKGMERLKQNSLQNNTNLTSNEANPADAQMNSNVIQ
                     PLLQKQQQQQQQQVQQEQRSTYYPPQVQTSVDATLKQQQQQQQQQQQLQNQASAQNNI
                     PNQGSGQDIWL"
     gene            <594381..>595589
                     /gene="TPHA0E02840"
                     /locus_tag="TPHA_0E02840"
                     /db_xref="GeneID:11531324"
     mRNA            <594381..>595589
                     /gene="TPHA0E02840"
                     /locus_tag="TPHA_0E02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685760.1"
                     /db_xref="GeneID:11531324"
     CDS             594381..595589
                     /gene="TPHA0E02840"
                     /locus_tag="TPHA_0E02840"
                     /inference="similar to DNA sequence:INSDC:YPL203W"
                     /note="similar to Saccharomyces cerevisiae TPK2 (YPL203W);
                     ancestral locus Anc_6.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685808.1"
                     /db_xref="GeneID:11531324"
                     /db_xref="GOA:G8BTZ6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ6"
                     /translation="MDSNIKEYPAPSNDTSVYQQQQQQQLYQRQQLQQQHQLQQGQQY
                     YYETAKSDQQPQASLAPFPGDGTDSSNSQHLVFQKSSVSKGKYTLQDFQILRTLGTGS
                     FGRVHLVRSIHNRRYYAIKVLKKQQIIRMKQIEHTNDERRILKMVEHPFLIRMWGTFQ
                     DSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALDYLHSHGIIYRDLKP
                     ENLLLDRLGHIKMTDFGFAKEISTVTWTLCGTPDYIAPEVVASKPYNKSVDWWSLGIL
                     IYEMLAGYTPFYDTTPMKTYEKILNGKVNYPSFFHPNIVDLLSNLITADLTRRFGNLQ
                     SGAEDIKSHAWFSEVVWSKLLARDIVTPYEPPIQSEVGDTSLFDQYPEEHFDYGIQCE
                     DPYTQYFTDF"
     gene            <596109..>596477
                     /gene="TPHA0E02850"
                     /locus_tag="TPHA_0E02850"
                     /db_xref="GeneID:11531453"
     mRNA            <596109..>596477
                     /gene="TPHA0E02850"
                     /locus_tag="TPHA_0E02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685761.1"
                     /db_xref="GeneID:11531453"
     CDS             596109..596477
                     /gene="TPHA0E02850"
                     /locus_tag="TPHA_0E02850"
                     /inference="similar to DNA sequence:INSDC:YGL070C"
                     /note="similar to Saccharomyces cerevisiae RPB9 (YGL070C);
                     ancestral locus Anc_6.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685809.1"
                     /db_xref="GeneID:11531453"
                     /db_xref="GOA:G8BTZ7"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ7"
                     /translation="MTTFKFCRDCNNMLYPREDRENMRLLFECRTCSYVEEAGTPLVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHGKDNCFFQSQQRRKDTSMVLFFV
                     CLSCSHIFTSDQKNKRTQFS"
     gene            complement(<596872..>599019)
                     /gene="TPHA0E02860"
                     /locus_tag="TPHA_0E02860"
                     /db_xref="GeneID:11531387"
     mRNA            complement(<596872..>599019)
                     /gene="TPHA0E02860"
                     /locus_tag="TPHA_0E02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685762.1"
                     /db_xref="GeneID:11531387"
     CDS             complement(596872..599019)
                     /gene="TPHA0E02860"
                     /locus_tag="TPHA_0E02860"
                     /inference="similar to DNA sequence:INSDC:YGL071W,YPL202C"
                     /note="similar to Saccharomyces cerevisiae AFT1 (YGL071W)
                     and AFT2 (YPL202C); ancestral locus Anc_6.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685810.1"
                     /db_xref="GeneID:11531387"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ8"
                     /translation="MEIFKTENGDSISPIISMNDNFFLDKANSKSTTTNKNTKKLEVE
                     STDNIPVIVKSKASDKYIHLDPIPDFKDRNEIKPWLQKIFYPQGVELVIERSDTIKVV
                     FKCKAAKRGKTSKGDKDTEQNYIPKNDEDIKEKPTNDIKDVKNTERKKKRVVSRFNTC
                     PFRIRATLSSRRNKWAVVIINNKHSHNVAFNPESKEYKKFKEGLREVDDIQAIKKFDE
                     LEYRFHANLPIIPSLVPCDCGLTSEVKSFEVIMPSNCVTTTVSGEGALQSTRKNLDPN
                     SINNTMYCPNYPVNVSKPKKLKNKKLSSLNLSQETILKKSASAKFHVNLPHTHIHTNS
                     ADAFSGTNSNADTPFMERNSSFDSLISNVINNKNLETHTHSHSHPHSHPYDVTQNAYP
                     NEFILPSTFLEGSSDVALQTGIMSNFTSDLNEIDFTGIFNKSIHHKPNNGKMTELNSP
                     SLSFSPDTSQYSMSKIQEPISTDPALLNEQDLLNNTFLGGPMNELSSSITTSTSNMIN
                     NSEPPEHFNTDGNTLMMSELPVIENYVNTNNNFSNAVPKNSTSKSSTNRASKAQQGNT
                     YSPFIKTEEEQLRLMNEIDKINNLTATTFQSDKHEQSSPAFIDFTNCFPVQSKMRNKL
                     IAKKEDVSDNSFEQDVFNLQNSQGHDIPEYINFMLQNETDIFKKEDSLQGQEFNLHDN
                     DLVMSINEGNSVKTNDKSNLPLFQTNWDNEFNS"
     gene            complement(<600688..>602061)
                     /gene="TPHA0E02870"
                     /locus_tag="TPHA_0E02870"
                     /db_xref="GeneID:11531388"
     mRNA            complement(<600688..>602061)
                     /gene="TPHA0E02870"
                     /locus_tag="TPHA_0E02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685763.1"
                     /db_xref="GeneID:11531388"
     CDS             complement(600688..602061)
                     /gene="TPHA0E02870"
                     /locus_tag="TPHA_0E02870"
                     /inference="similar to DNA sequence:INSDC:YPL201C"
                     /note="similar to Saccharomyces cerevisiae YIG1 (YPL201C);
                     ancestral locus Anc_6.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685811.1"
                     /db_xref="GeneID:11531388"
                     /db_xref="UniProtKB/TrEMBL:G8BTZ9"
                     /translation="MGLPVFLYNTQGIRDGEDDKEEQRRVDFYAKRNFVEKNFATNTN
                     VNQSLINNVLLNNFFRESINNIFPIDDGMNDILNNYYNNNNDAYYRDNEINGSEINYD
                     FKLNSRNDCILSDEVNEYLNKGYENLIYQKNNDEKFWIYYYNNFIVSDILFFDFNSNI
                     TYKIDAETYSIDISKISFIDCKYVGGNCTKLMVVISSLSGELYLFEIENGNIIFKKFN
                     IGHNTKILNVWLGLIDQNLILSFNLNYGIIITNVMTNRNYAIPIECQNLNITNAKIDF
                     PGLTIFNSSEIYFVSNFLDATARGQINEIKIMKRENELFESITYKMISSRPTLLVETN
                     QRLLSISNCHTSINSNTVNWYKDTHTILQKNNLITNYEENAPKYQYSILNDFLVVCED
                     HLYDTTLIIYKYSKISNEWLFLGFTDIKSKFNLKKIKNLSITRFNTNFIINLLNDKNE
                     KYEFDII"
     gene            complement(<603237..>605393)
                     /gene="TPHA0E02880"
                     /locus_tag="TPHA_0E02880"
                     /db_xref="GeneID:11531358"
     mRNA            complement(<603237..>605393)
                     /gene="TPHA0E02880"
                     /locus_tag="TPHA_0E02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685764.1"
                     /db_xref="GeneID:11531358"
     CDS             complement(603237..605393)
                     /gene="TPHA0E02880"
                     /locus_tag="TPHA_0E02880"
                     /inference="similar to DNA sequence:INSDC:YGL073W"
                     /note="similar to Saccharomyces cerevisiae HSF1 (YGL073W);
                     ancestral locus Anc_6.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685812.1"
                     /db_xref="GeneID:11531358"
                     /db_xref="GOA:G8BU00"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G8BU00"
                     /translation="MVKNTAAHNNEPNTKSSMINNNNTVSNKEAALFSPMPELHDGDD
                     QEQHNSINNFIYNKDGKNDNKNSNITVEEIEDITNPSNEFNNMLSPLQFPEEISSSHN
                     GNNDLVDRNVSTSTQLVRRQPNIGLYQPYLSKEGNNYIGTSASDVHLDATSKVSNQPK
                     RTNINKAKPTFVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSN
                     FASFVRQLNMYGWHKIQDVKSGSIQSSIEDKWQFANDYFIRGREDLLEHIVRQKSTPL
                     ANQNPTFSNYIGGYNNLLLSDVPNNDAPNSDSNNNASLDRSLKVLLTELETIKYNQMS
                     ISKDLSRISKDNEMLWKENMLARDRHRNQQDALEKIFRFITSAIPNLDQKMLTDRIMK
                     TDNVNTVNTLNNLDGMHSNNSVNDVEFSSASNINYNINNDYIKNQTTGLNQMGNTNNK
                     LGVDDVLNFHMDTPKESNYDSNKLVPSEVPPYSQRSLYLLKNRSASGSPHNSDNINDN
                     IIQDSSKFSTNNDILAASNIIGFPPTNNSNQNMNNNGIQKINSHASSLHTIESSGRIS
                     EIPPHEDEVEENKRINVATKKAINDTYPLDDGEMFLSHLHNNINEQDARIQHLESLVS
                     DLTPHNFEMPEYFSNEDVNTNINSISNVQGNNIHSHKNTNDQVETNAPLYFNFDDLNT
                     SPTMATDNQNKRIIESADNSPPLLEVKETDAKRRKL"
     gene            <606504..>607772
                     /gene="TPHA0E02890"
                     /locus_tag="TPHA_0E02890"
                     /db_xref="GeneID:11531401"
     mRNA            <606504..>607772
                     /gene="TPHA0E02890"
                     /locus_tag="TPHA_0E02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685765.1"
                     /db_xref="GeneID:11531401"
     CDS             606504..607772
                     /gene="TPHA0E02890"
                     /locus_tag="TPHA_0E02890"
                     /inference="similar to DNA sequence:INSDC:YGL075C,YPL200W"
                     /note="similar to Saccharomyces cerevisiae MPS2 (YGL075C)
                     and CSM4 (YPL200W); ancestral locus Anc_6.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685813.1"
                     /db_xref="GeneID:11531401"
                     /db_xref="UniProtKB/TrEMBL:G8BU01"
                     /translation="MSDDKSSTSMILDVAWAELDNKNQDFIYAKDFPNLVNIINNFLN
                     RSSNDGSKHTLLSSTGESVINTFAKEKEFFKIYKDEFKEIFYGLIGKSFKELVNESIN
                     FGEIDISHLKENVKMSKKGDQESPYRHENDHAHHILNNSSSNIYNSSADNVQTKIYGN
                     DESNDESILKLKENENIIESPLRNLSYKRELENDLLITKKDLKFKDDIIMEKDREIIE
                     LTRKVGDLKDKYNFLQREFSFYKKRGENRNSLTTDDDKTNDETNLNIQKNDVTKHEFI
                     IDEMNRRIHEQMLIINALKEELQNDNPNGNSKFGYLYNSMRKQLSRNPSYSSTLYVII
                     SIFFFLSIVVISGSTIFTSFSQDDRMGAYDSYRYKYLESFGASWWEQNTLLRFIMNLF
                     FGKGTEPYEFSDPYVTTAASSNAYDNLFNQ"
     gene            complement(<607901..>608641)
                     /gene="TPHA0E02900"
                     /locus_tag="TPHA_0E02900"
                     /db_xref="GeneID:11531416"
     mRNA            complement(<607901..>608641)
                     /gene="TPHA0E02900"
                     /locus_tag="TPHA_0E02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685766.1"
                     /db_xref="GeneID:11531416"
     CDS             complement(607901..608641)
                     /gene="TPHA0E02900"
                     /locus_tag="TPHA_0E02900"
                     /inference="similar to DNA sequence:INSDC:YPL199C"
                     /note="similar to Saccharomyces cerevisiae YPL199C;
                     ancestral locus Anc_6.207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685814.1"
                     /db_xref="GeneID:11531416"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:G8BU02"
                     /translation="MSAAVALQNITPHNGSQRDYNHATDPEYIRLRGLAEAAHERRKQ
                     YSQDSQNAYKSGDHKKAKEFSEKSKEQNKIAEGYNLQAAEYAFATNNADSESDEIDLH
                     GLFVKEVQWILQKRIALAVRNHEQYLKVVVGKGLHSKNGISKIRPAVEELCQQGNLRN
                     YYDNKNAGVLIIELTNARIPTDWGSTDYVTFASKSSYKTQSNNYSHQNQPQYQQQHQQ
                     YNNNNNNNNGGLLSMVLQLFCSCLQKNI"
     gene            <610000..>611663
                     /gene="TPHA0E02910"
                     /locus_tag="TPHA_0E02910"
                     /db_xref="GeneID:11531447"
     mRNA            join(<610000..610010,610455..610548,611034..>611663)
                     /gene="TPHA0E02910"
                     /locus_tag="TPHA_0E02910"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_003685767.1"
                     /db_xref="GeneID:11531447"
     CDS             join(610000..610010,610455..610548,611034..611663)
                     /gene="TPHA0E02910"
                     /locus_tag="TPHA_0E02910"
                     /inference="similar to DNA sequence:INSDC:YGL076C,YPL198W"
                     /note="similar to Saccharomyces cerevisiae RPL7A (YGL076C)
                     and RPL7B (YPL198W); ancestral locus Anc_6.206"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_003685815.1"
                     /db_xref="GeneID:11531447"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:G8BU03"
                     /translation="MAANKVLTPESQLKKSKANQKTAEEVKAERVARKAANKEKRAVI
                     LQRNAAYQKEYETAERAVIEAKREAKATGSYYVEAQQKVVFVIRIKGINKIPPKPRKV
                     FQLLRLNQINSATFVKVTKATAELLKLIEPYVAYGYPSYSTVRQLVYKRGYGKINKQR
                     IPLSDNSIVEANLGKYGILSVDDLIHEILTVGPHFKQVNNFLWPFKLSNPSGGWGVTR
                     KFKHFIQGGSFGNREEYINQLVKAMN"
     gene            <612901..>614661
                     /gene="TPHA0E02920"
                     /locus_tag="TPHA_0E02920"
                     /db_xref="GeneID:11531448"
     mRNA            <612901..>614661
                     /gene="TPHA0E02920"
                     /locus_tag="TPHA_0E02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685768.1"
                     /db_xref="GeneID:11531448"
     CDS             612901..614661
                     /gene="TPHA0E02920"
                     /locus_tag="TPHA_0E02920"
                     /inference="similar to DNA sequence:INSDC:YGL077C"
                     /note="similar to Saccharomyces cerevisiae HNM1 (YGL077C);
                     ancestral locus Anc_6.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685816.1"
                     /db_xref="GeneID:11531448"
                     /db_xref="GOA:G8BU04"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004756"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:G8BU04"
                     /translation="MSEFNRTFFENGSDTTSNKVIHVNSHAISRNTSNIELSTNGAKL
                     DDQQLNHHVGDGEVHLRKSFSAWSILGVGFGLTNSWFGISTSLVTGISSGGPLMVVYG
                     IIIIALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPPKHRKFAAYLCGSFAYAGSVF
                     TSASTTLSVATEVVGMYALKHPEFKPQRWHVFICFELLHLFLMLFNCYGKSLPLISSS
                     SLYISLTSFFTITVTVLACSSGKFNDSKFVFASFYNETGWKNNGIAFITGLINPAWSF
                     SCLDCATHMAFEVEKPEKIIPLAIMGTIAIGFVTSFCYVIAMFFSIRDLDKLLNSTTG
                     APILDIFNQALGNSSGAIFLGCLILFTSFGCVIACHTWQARLCWSFSRNKGLPYSHLW
                     SQVNPNVGVPLNAHLMSCALISIIGVLYIASSTAFNSLITACIAFLLLSYIIPVICLL
                     LKRRQIKHGPFWLGKFGLFSNIVLLCWTIFAIVFFSFPPQLPVTKDNMNYVSVVIVGY
                     SIYAILYWHFKGSKEFHFTEEEETQKSMDTDYDNDSNESIVSDLNDEVSNGSLNVDIE
                     EYNVSSTLKKSKTPTTIELH"
     gene            complement(<615001..>616914)
                     /gene="TPHA0E02930"
                     /locus_tag="TPHA_0E02930"
                     /db_xref="GeneID:11531226"
     mRNA            complement(<615001..>616914)
                     /gene="TPHA0E02930"
                     /locus_tag="TPHA_0E02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685769.1"
                     /db_xref="GeneID:11531226"
     CDS             complement(615001..616914)
                     /gene="TPHA0E02930"
                     /locus_tag="TPHA_0E02930"
                     /inference="similar to DNA sequence:INSDC:YJL045W,YKL148C"
                     /note="similar to Saccharomyces cerevisiae YJL045W and
                     SDH1 (YKL148C); ancestral locus Anc_5.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685817.1"
                     /db_xref="GeneID:11531226"
                     /db_xref="GOA:G8BU05"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR011281"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="InterPro:IPR015939"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G8BU05"
                     /translation="MLHLKRNFINKQRSISSSLYKYTTARGLATAKNNIDDLTSKYNL
                     IDHEYDCVVVGAGGAGLRAAFGLAEAGFKTACVSKLFPTRSHTVAAQGGINAALGNVH
                     PDNWKWHMYDTVKGSDWLGDQDSIHYMTKEAPASIIELEHYGMPFSRLPDGKIYQRAF
                     GGQSKDYGKKGQAYRTCAVADRTGHAMLHTLYGQALNHDTHFFIEYFAMDLLTHNGEV
                     KGIIAYNQEDGTIHRFKAHKTIIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQD
                     LEFVQFHPSGIYGSGCLITEGARGEGGYLINSEGERFMERYAPTAKDLASRDVVSRAI
                     TMEINAGRGVGKNKDHMLLQLSHLPPEVLKERLPGISETASIFAGVDVTKQPIPILPT
                     VHYNMGGIPTKYTGEALTIDEETGEDKVIPGLFACGEAACVSVHGANRLGANSLLDLV
                     VFGRAVSHTIADQLQPGLPHKPLPQDIGKESLQRLDRIRNSSGKIPTADIRLKMQKAM
                     QKNVSVFRIQDTLDKGVEEVTAIDKTYKDDVHVSDRSMIWNSDLVETMELENLLTCAM
                     QTATSAAARKESRGAHAREDYPTRDDDHWMKHTLSWQKNTGDKVDLKYRKVIYKTLDE
                     KECPSVPPAIRSY"
     gene            <618215..>618982
                     /gene="TPHA0E02940"
                     /locus_tag="TPHA_0E02940"
                     /db_xref="GeneID:11531227"
     mRNA            <618215..>618982
                     /gene="TPHA0E02940"
                     /locus_tag="TPHA_0E02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685770.1"
                     /db_xref="GeneID:11531227"
     CDS             618215..618982
                     /gene="TPHA0E02940"
                     /locus_tag="TPHA_0E02940"
                     /inference="similar to DNA sequence:INSDC:YJL035C"
                     /note="similar to Saccharomyces cerevisiae TAD2 (YJL035C);
                     ancestral locus Anc_5.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685818.1"
                     /db_xref="GeneID:11531227"
                     /db_xref="GOA:G8BU06"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G8BU06"
                     /translation="MTLFRLNDHIHFMNLTVQLAKFTLENNETPVACIFVNKKNKNII
                     SYGMNKTNENLNGISHAEFIAIDKLINDKNIDYNFNDIIVYVTVEPCIMCASALKQLG
                     INYIVFGCGNERFGGNGTVLSIHNDNSTINESSSSMTIIPGILRKECIFLLRLFYYKE
                     NDTAPTPRSKKNRNLDKNEFPNIDWNLYLNELQFKKLFGHENLNNFKIKNDINECQNI
                     NWDLFENNEITAKREVNIIEYLDSLIKETNPNNNYKN"
     gene            619454..619535
                     /gene="TPHA0Etrna5S"
                     /locus_tag="TPHA_0Etrna5S"
                     /db_xref="GeneID:11531380"
     tRNA            619454..619535
                     /gene="TPHA0Etrna5S"
                     /locus_tag="TPHA_0Etrna5S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11531380"
     gene            <619747..>621927
                     /gene="TPHA0E02950"
                     /locus_tag="TPHA_0E02950"
                     /db_xref="GeneID:11531444"
     mRNA            <619747..>621927
                     /gene="TPHA0E02950"
                     /locus_tag="TPHA_0E02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685771.1"
                     /db_xref="GeneID:11531444"
     CDS             619747..621927
                     /gene="TPHA0E02950"
                     /locus_tag="TPHA_0E02950"
                     /inference="similar to DNA sequence:INSDC:YJR005W"
                     /note="similar to Saccharomyces cerevisiae APL1 (YJR005W);
                     ancestral locus Anc_5.229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685819.1"
                     /db_xref="GeneID:11531444"
                     /db_xref="GOA:G8BU07"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:G8BU07"
                     /translation="MSDQRIFTRYRASEIGVDLQNSESKKLKNNVLGRKTALRKIIAN
                     LTLGNVNEMSYLLPEILKYWQIEDDYEVKRICHEYIRKLGPSKPKNVQEALPYILNDL
                     KSKNQKLQILSLKTLVVVPSPEFFNEAFEFVSQTLNRLSTVKDELTKEAIYCISVLDE
                     ADHDRVLPLIDTLMDIIENESKEPSFIVAALNVVCIISERNTNMSNMTVRVDIAIDIL
                     EMLPTLNEWEKAFVMECFTGKVVPQTHMESTNIIQLVIPQLQHGNTSVALNTLRFIFY
                     LLNYVEFTTEELSIKLSSSIIALLNKPPELEFLILRNIILLLLSRENSILNLDVSYFF
                     VEYNDPIYIKDTKLECLYLLANEVTLPLILEELEQYATDIHIQMSRKAIRAIGNLAVK
                     LNKESADKCVECLLDLLEFGVDYVIQETISVFRNILRKYPDRYRNNIDILVNCIDYIQ
                     ESEAKNAMIWILTNYSDSMHNCLEIFKVFSSNIKDETLEVQFSILNSSIKFLMRYGTK
                     ESESICMEVLKCCTEEIDNPDLRSRAYMYWRLLTLLQTKDNHMTNETVLDIIDGDLPV
                     IELNTKLDPLILQELELNIGSIASIYLKPVSQIFRLNRPKLLISSPVLNPDHDSLKII
                     KSNSTYDEFGNESKNLDNQRMDRRSHEMVSTNSTMNAIMEDYDKPAETINQLKGNMKS
                     SSTRQSRLSRKPSQLLRRLTKKNHSNELIIHFLSGNGCLMFFHI"
     gene            <622226..>623698
                     /gene="TPHA0E02960"
                     /locus_tag="TPHA_0E02960"
                     /db_xref="GeneID:11531410"
     mRNA            <622226..>623698
                     /gene="TPHA0E02960"
                     /locus_tag="TPHA_0E02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685772.1"
                     /db_xref="GeneID:11531410"
     CDS             622226..623698
                     /gene="TPHA0E02960"
                     /locus_tag="TPHA_0E02960"
                     /inference="similar to DNA sequence:INSDC:YLR005W"
                     /note="similar to Saccharomyces cerevisiae SSL1 (YLR005W);
                     ancestral locus Anc_5.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685820.1"
                     /db_xref="GeneID:11531410"
                     /db_xref="GOA:G8BU08"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BU08"
                     /translation="MAPTIRVESDEDEETVMVSSTNNRKQKKLVHFSNEEENEVTSKE
                     AKKIKAEPIENPNNVTVQSSSRTDSASKSNHFKSNDKDKERKSKKKKITNDQLAGTSG
                     GYSWEDELKRSWDLVTVDDENDMASLVASIVEARKKRSAQKVVTPYQRGIIRSLILIL
                     DCSEVMSEKDLRPNRNAMSIQYAIDFIQEFFDENPISQLGIVIMRNGLANLLSPIGGN
                     PQAHIDALKSIRREEPKGNPSLQNALEMARGLLLPVPSHCTREVLIVFGGLSSTDPGD
                     IHQTIQSLVNEKIRVKVIGLSAQVAICKELCKATNYDDESFYRVILDEVHFKELYDEA
                     VTPLPVNKINKAFTLVKMGFPTRVFEENPTFCACHSKLVYGGYFCPNCNSKVCSLPTV
                     CPCCDLMLILSTHLARSYHHLMPLKTFSEVPTSETFETENCFSCQMTFPSLRNKKTGE
                     LLTSSRYRCQDCENDFCIDCDLFIHEILHNCPGCESSPTI"
     gene            <624212..>624883
                     /gene="TPHA0E02970"
                     /locus_tag="TPHA_0E02970"
                     /db_xref="GeneID:11531415"
     mRNA            <624212..>624883
                     /gene="TPHA0E02970"
                     /locus_tag="TPHA_0E02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685773.1"
                     /db_xref="GeneID:11531415"
     CDS             624212..624883
                     /gene="TPHA0E02970"
                     /locus_tag="TPHA_0E02970"
                     /inference="similar to DNA sequence:INSDC:YEL072W"
                     /note="similar to Saccharomyces cerevisiae RMD6 (YEL072W)"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685821.1"
                     /db_xref="GeneID:11531415"
                     /db_xref="UniProtKB/TrEMBL:G8BU09"
                     /translation="MTQSESLVIVLPVTQLKKSSPNTIYSLFSIVNKGYEKPTNEYKI
                     VLNKRIESPDLFFEDLGFSKCHERAFFYVLVDSSLLNNPQFASSFKKVQATSNYFEYS
                     YTDNEQSLNFGFPFDQVLATVGYKPISNGSFEITGYTSFGKGCGVELFNKSLFHLTTQ
                     VNVTTLIAMVIVEHNLVGYYEKKLGFTEIERIIVKKTDPKSSGFQGNFKCAKDIHISH
                     LQKAI"
     gene            complement(<625398..>627680)
                     /gene="TPHA0E02980"
                     /locus_tag="TPHA_0E02980"
                     /db_xref="GeneID:11531408"
     mRNA            complement(<625398..>627680)
                     /gene="TPHA0E02980"
                     /locus_tag="TPHA_0E02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685774.1"
                     /db_xref="GeneID:11531408"
     CDS             complement(625398..627680)
                     /gene="TPHA0E02980"
                     /locus_tag="TPHA_0E02980"
                     /inference="similar to DNA sequence:INSDC:YLL001W"
                     /note="similar to Saccharomyces cerevisiae DNM1 (YLL001W);
                     ancestral locus Anc_5.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685822.1"
                     /db_xref="GeneID:11531408"
                     /db_xref="GOA:G8BU10"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BU10"
                     /translation="MSTLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSI
                     LETLVGRDFLPRGTGIVTRRPLVLQLNNIPLNSPLIEKENNLDFNQGENNTELSLEEH
                     LQKNNNGYSPTIQTSNRNEWGEFLHKPGKRFYDFSEIRKEIAYETERIAGNNKSISKI
                     PINLKIFSPHVLNLTLIDLPGITKVPIGEQPPDIERQIKNLLMEYIATPNCIILAVSP
                     ANIDLVNSDALKLAREVDPMGKRTIGVITKLDLMDSGTHALDILSGKLYPLKLGFVGV
                     VNRSQQDIQSNISVKESLDNEEDFFKRHAVYRTISNRCGTRYLSYILNQILMNHIRDK
                     LPDIKVRINTLIGQTEEELASYGGEGKITDENRASLVLQLMNKFASKFISSIDGTYSE
                     IGTKELCGGARIYYIFNDIFGKSLNSISPTVNLSIKDIRTAIRNSTGPRPSLFVPELA
                     FDLLVKPQIQLLLDPSQRCVELVYEELVKICHSSSFTELSRYPKLQSMLIEVISNLLR
                     ERLTPTRAYVESLIDIHRAYINTNHPSFISATDAMSSIAQAKKKENSNKITAPATNSP
                     TASITQDGNLVTESTTPINESESKSDIDFSESPDAQNIKQSKESFLNYFFGKDPKSQL
                     LNSQYSLNEPLISNQYSTGDGNVNLNSLNINDDENSQLFNLTEREQLECELIKKLIES
                     YFSIIREMIQDQVPKAIMCLLVNYCKETSQNTLVTKLYKESMFDELLIEDLSISQNRE
                     NCLKLLRTYREASNIINDIL"
     gene            complement(<628441..>629091)
                     /gene="TPHA0E02990"
                     /locus_tag="TPHA_0E02990"
                     /db_xref="GeneID:11531409"
     mRNA            complement(<628441..>629091)
                     /gene="TPHA0E02990"
                     /locus_tag="TPHA_0E02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685775.1"
                     /db_xref="GeneID:11531409"
     CDS             complement(628441..629091)
                     /gene="TPHA0E02990"
                     /locus_tag="TPHA_0E02990"
                     /inference="similar to DNA sequence:INSDC:YJL001W"
                     /note="similar to Saccharomyces cerevisiae PRE3 (YJL001W);
                     ancestral locus Anc_5.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685823.1"
                     /db_xref="GeneID:11531409"
                     /db_xref="GOA:G8BU11"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BU11"
                     /translation="MNGIQVDINRLKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAY
                     IANRVTDKLTRVQDKIWCCRSGSAADTQAVADIVQYQLELYTAQFGEPSTKVAASIFK
                     TMCYDNKDNLSAGIIVAGFDDKENKGEVYSIPLGGSLHKQKYAIAGSGSTFIYGYCDK
                     NYKENMTKDETVDFMKHSLSQAIKWDGSSGGVIRMVVVTKDGVERLIFYPDEYENL"
     gene            complement(<629588..>632389)
                     /gene="TPHA0E03000"
                     /locus_tag="TPHA_0E03000"
                     /db_xref="GeneID:11531322"
     mRNA            complement(<629588..>632389)
                     /gene="TPHA0E03000"
                     /locus_tag="TPHA_0E03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685776.1"
                     /db_xref="GeneID:11531322"
     CDS             complement(629588..632389)
                     /gene="TPHA0E03000"
                     /locus_tag="TPHA_0E03000"
                     /inference="similar to DNA sequence:INSDC:YLL003W"
                     /note="similar to Saccharomyces cerevisiae SFI1 (YLL003W);
                     ancestral locus Anc_5.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685824.1"
                     /db_xref="GeneID:11531322"
                     /db_xref="InterPro:IPR013665"
                     /db_xref="InterPro:IPR018907"
                     /db_xref="UniProtKB/TrEMBL:G8BU12"
                     /translation="MENEDSTDLLLNDNYIQQKVNKAEDLLSDASVRATTNSLLNKDL
                     EELLRRVSISDSKLTQKQDVNGSLFEIHKSLDPNFKFTNENQDDRPLNSILDTIYNRI
                     QVFLIRNKMSLDFLKIFKKYVHFIEESGSDPLADKYLIDISTQLDLSFDMTPFMNELY
                     SKLLLYPETLEMRFAYLQCHSERKLLEKYFQKVQLTSIFNACLRKLENEWNEYMLKKH
                     FMKWINKQTTHDVNNNKAMIFNSRRLLVYGFDNIYTNLLKINSYNKAVDEYSKKKIFA
                     TMSNIMERQKQMEIKAMDALKLNTLKHFFKRLHLNHKSLTYKPKGIYLQQQVLKRWKS
                     KITTYRQLEEKAELSKSIHLLQPLFKKWVSKIKIADKEYDKLIELERKYILKKFFRIL
                     TKKLEEQQKLAFVQVSLNKIYKKMIFQSVWRYKFEKNLSFYSFQSIQEDRTKKNILRK
                     WKLSFNHKISALNTYDKNIFKNAFKKWKYRFSLVNNEKRIVNYLLHSKFERWNRLYDL
                     HERARISNKKLVLNKHLKNWKQKRDRMACLEMEAERHYMYTELKNGLKSWKDSAENIK
                     EMSKKVATFQELMLFKRFQKKFEKITSISNKQLEFQHKSEKRLTMKVFKSWSERYIIQ
                     KRDALDEASHTFRKKFVNQKKIKFLQVWKGKHILLNDYNDKAAYLGDFLLREKIMKVL
                     NEKLNHNYALSKVASNLRNETLQGNSFTVWKEKLIQSSKLEVILKQELDNKNIVLLLN
                     YLNIISLKMLKIRRNREMIKIFRDRWDRAILRGLILLWKTRMQNSPKKVRLRRKSPFN
                     EVDRLETPKKSINTSGNTIPGSELVKNYKVEAMKSRYSRVRHSIPSPIKNSSTIGSTI
                     KRRFNQRNLNVSPFPASPPKLNLYRRYNISDNKNLEIDFNELPYVKLEPIVDKSEMEQ
                     EIDNLEFHESPTQKTSRSS"
     gene            <633187..>635904
                     /gene="TPHA0E03010"
                     /locus_tag="TPHA_0E03010"
                     /db_xref="GeneID:11531360"
     mRNA            <633187..>635904
                     /gene="TPHA0E03010"
                     /locus_tag="TPHA_0E03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685777.1"
                     /db_xref="GeneID:11531360"
     CDS             633187..635904
                     /gene="TPHA0E03010"
                     /locus_tag="TPHA_0E03010"
                     /inference="similar to DNA sequence:INSDC:YLL005C"
                     /note="similar to Saccharomyces cerevisiae SPO75
                     (YLL005C); ancestral locus Anc_5.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685825.1"
                     /db_xref="GeneID:11531360"
                     /db_xref="GOA:G8BU13"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="UniProtKB/TrEMBL:G8BU13"
                     /translation="MDAIPSEGINLFEYLSENLYTYLDIDDSTSILILKNTNTSNIYS
                     KKFLSNTTYNLLSALLNTARTGSAHKHAGISLSAFLTSILMSFMIFIIQAIIFILLRN
                     HLKELYQTTILSKYHSSSEISSNSVSSIINGELNENATYFGWIKTVYKANMEKYLKSS
                     GVDAYLFIRYLYVLIFFNLTLAVVIIPVLLPIHICSGSKDEMDFATTSLDILNMSNIS
                     SDNSNMLIFHFLLTIFVVIWFHVVLLNELRFIKNLSSSDYVLQNKSQLLFVDNIPNEY
                     VTHTIKIKNYFNKILPDSAMEVIPLPLSINKLRKENSKLKRLDNKIEIKLLHIVLYKY
                     FSQSQENVRIVNVLNKKYLRIFWNKNKIKFYFRKVAFWIRTSHNHFHFKTKRKEIQFN
                     VFNGIRFKIFILQRRTFLETAYSQLQDLVSAKNSCQKYFQNEMTVTNSQRNEDDEREL
                     LIGQHQGYYNKVFVSFGSKFSAYMVGSFLNSFNIDTWNTALILPNTKGIIWSNLLKTK
                     NYKTLLRSGFAFTISVFVILGWIIPVAFITLISHIPYLTSLIPIISKLNNQPTIISKL
                     LNSVIPILSLVIITELVPFIYRYLSYIRYCRTQEELEINIQLWFFIFLFVHLFIVVTI
                     SSGMSLLIEKIINNPVMITTLLAHELPKSSNFFCSFVIIRGFTYSGGNFLQIKELILE
                     LFYYPTRYYSTKKKIKKMEKSLCYSWGSIYPLFSVLGCIGIIYSVISPIILPICSLSF
                     FLIFFSVKYQFEFQCCGVNIAETNGILYINALTQLYTGIYCLEFSMIGLFTLYNSYRL
                     SFAMLLLFIITLVIHHNISLNRISKIHKPTIKSITDNSSWNCPSYSSYTENNKLFSIL
                     NFDIGRTILIPQDPLDIGTKERSFIFNKYGMKCEFDKTTISTTGTITYL"
     gene            complement(<635943..>637424)
                     /gene="TPHA0E03020"
                     /locus_tag="TPHA_0E03020"
                     /db_xref="GeneID:11531221"
     mRNA            complement(<635943..>637424)
                     /gene="TPHA0E03020"
                     /locus_tag="TPHA_0E03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685778.1"
                     /db_xref="GeneID:11531221"
     CDS             complement(635943..637424)
                     /gene="TPHA0E03020"
                     /locus_tag="TPHA_0E03020"
                     /inference="similar to DNA sequence:INSDC:YLL006W"
                     /note="similar to Saccharomyces cerevisiae MMM1 (YLL006W);
                     ancestral locus Anc_5.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685826.1"
                     /db_xref="GeneID:11531221"
                     /db_xref="GOA:G8BU14"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR027537"
                     /db_xref="UniProtKB/TrEMBL:G8BU14"
                     /translation="MDNAKDNKFNYDNLNELDDDEFLLGNSSNLDLDNGYSNNSNISL
                     DDYINNVLPLHLEKIFREHNILQYNGNELDNSSLDQRSDSHNAYSHDTNYNRDGNVDD
                     DDDDVMSKYNKLMEILNKPSNQLNYNNDYFYNNKMLQTKFNRSTFSTWSFVEGMIIGQ
                     CSVMIVIVLVMKFFFFSDESDSVTTTSYSISRSNSSSSNKFDKKNLTLSNQFLPSIVK
                     RGGKDQNQVNNENFYRHSHLKTILEKTCYDVDTHIPESLDWFNVLIAQIIQQFREEAL
                     LKDNIVHSLNDYLTKRSDELPSYLDGIKITELDIGDDFPIFSNCRIQYSPNSNKKKLE
                     AKIDIDLTDRIAIGIQTKLLLNYPKLRTAILPVDLTLSIIRFQACLTVSLTKAEDLVP
                     TSDDSSVQGDDNAYYLMFSFLPGYEMEFDIGSLIGSRSKLENIPKISSLIEHHIKKWF
                     CERCVEPRFQCIKLPGIWPRSKNTREEKVSTDDDISVFPEKDI"
     gene            <637946..>640252
                     /gene="TPHA0E03030"
                     /locus_tag="TPHA_0E03030"
                     /db_xref="GeneID:11531213"
     mRNA            <637946..>640252
                     /gene="TPHA0E03030"
                     /locus_tag="TPHA_0E03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685779.1"
                     /db_xref="GeneID:11531213"
     CDS             637946..640252
                     /gene="TPHA0E03030"
                     /locus_tag="TPHA_0E03030"
                     /inference="similar to DNA sequence:INSDC:YLL007C"
                     /note="similar to Saccharomyces cerevisiae YLL007C;
                     ancestral locus Anc_5.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685827.1"
                     /db_xref="GeneID:11531213"
                     /db_xref="UniProtKB/TrEMBL:G8BU15"
                     /translation="MKSTDKIKKILEDTKEDDAKLSFQDSVAFYKSLIVSADLSEIRY
                     ADLISTFFLVCDEDVLLNKVFVDQKSFQVIASIVNSVDYYKKPNIRIIEDIFNKLCRT
                     FGKAVRSSGGFSYDFDKIYNNFIETDLIKNVFLLIDDISNNYILDDFLISFICTTLKG
                     ISLLFDILNRFLKNDTEKAIRYIFHDSNLLILNEGTHLFVKFLTDKTIKSTTNDILVP
                     SLLSFSHITREIEFKGFWTDLLTKVASRLNKIFDYKIIFNPTGDNTSFKYYSHKDFQL
                     SEYIDSMIFLNSYNLAFQKSVGEQLLFDKDNNFSIFDCLGCNSLILRKFISSFEEDAL
                     FQPLLAGLLLGKNLIMFELMNKFLKFWITSHANGTSKHDFLSIADLIEVTMHKLKKNI
                     SDDYASLKDDPSKLINTCIDFLNGIAYEEARNIQVHYVYRKHVLKWAPKMQNFEELLF
                     GQVFDYVKHQKIVQLQKGFWFYTENPLRSNLENPKVSYLIISDNQRDILIREFDVKTT
                     DKPYFINNEIICDSVDPINHKGVRKPKTKTITISFSEIKRFTTEKNILSKSNKMGTND
                     HKDSTSLNSVDKSVSSDRITDTSISVSDDFKRRNSTDNAFIKSLDRQKVISIKAVNNK
                     EEPLIEFFFINNEDSLIDDLKFLLYSYDHEKIPVHSKAKKADYSEFKVLYLDDIMDPN
                     TVNSPHLTMMNNIIRDLTLATQEQIKTLIHVRYNIKMINLSVVDTNKSKDEKTDTELV
                     NVDEHDSNEDDVYNFDTLISLSKNTYYA"
     gene            <640682..>640870
                     /gene="TPHA0E03040"
                     /locus_tag="TPHA_0E03040"
                     /db_xref="GeneID:11531435"
     mRNA            <640682..>640870
                     /gene="TPHA0E03040"
                     /locus_tag="TPHA_0E03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685780.1"
                     /db_xref="GeneID:11531435"
     CDS             640682..640870
                     /gene="TPHA0E03040"
                     /locus_tag="TPHA_0E03040"
                     /inference="similar to DNA sequence:INSDC:YLL009C"
                     /note="similar to Saccharomyces cerevisiae COX17
                     (YLL009C); ancestral locus Anc_5.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685828.1"
                     /db_xref="GeneID:11531435"
                     /db_xref="GOA:G8BU16"
                     /db_xref="InterPro:IPR007745"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:G8BU16"
                     /translation="MSTEQKNTNNSTEDKPKPCCVCKVEKEERDNCLLFNGQESGKCA
                     EFIEKYKACMKGYGFEAK"
     gene            <641521..>642486
                     /gene="TPHA0E03050"
                     /locus_tag="TPHA_0E03050"
                     /db_xref="GeneID:11531436"
     mRNA            <641521..>642486
                     /gene="TPHA0E03050"
                     /locus_tag="TPHA_0E03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685781.1"
                     /db_xref="GeneID:11531436"
     CDS             641521..642486
                     /gene="TPHA0E03050"
                     /locus_tag="TPHA_0E03050"
                     /inference="similar to DNA sequence:INSDC:YLR017W"
                     /note="similar to Saccharomyces cerevisiae MEU1 (YLR017W);
                     ancestral locus Anc_5.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685829.1"
                     /db_xref="GeneID:11531436"
                     /db_xref="GOA:G8BU17"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="UniProtKB/TrEMBL:G8BU17"
                     /translation="MTVSDLPTEFKKDIQLAIIGGTGLYNLEFLEPVAVLPNISTPWG
                     VTSSPITISKYNGDSVNDKEFFVAFIARHGINHEHPPTKVPFRANIAALKFLKVKAIL
                     AFSAVGSLQQEIKPRDFVLPQQIIDRTKGIRESSYFNETGLVGHVGFGCPFSEAFAKY
                     IYQFRDVLTNPESSEPCILHFDRDKTVICMEGPQFSTRAESKMYRSFGGDVINMSVLP
                     EAKLARECELPYQMVCMSTDYDAWKDGEDPVTVETVIGNLSNNARNANALIAEIISGM
                     AEEVPEFMINGDGLKGSIKMSITSKASVMSEDALNELKFLFPEYY"
     gene            complement(<642663..>643955)
                     /gene="TPHA0E03060"
                     /locus_tag="TPHA_0E03060"
                     /db_xref="GeneID:11531296"
     mRNA            complement(<642663..>643955)
                     /gene="TPHA0E03060"
                     /locus_tag="TPHA_0E03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685782.1"
                     /db_xref="GeneID:11531296"
     CDS             complement(642663..643955)
                     /gene="TPHA0E03060"
                     /locus_tag="TPHA_0E03060"
                     /inference="similar to DNA sequence:INSDC:YLR018C"
                     /note="similar to Saccharomyces cerevisiae POM34
                     (YLR018C); ancestral locus Anc_5.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685830.1"
                     /db_xref="GeneID:11531296"
                     /db_xref="InterPro:IPR012578"
                     /db_xref="UniProtKB/TrEMBL:G8BU18"
                     /translation="MEFKTPVRPLSNEQFRSLSEKIRKESPGLYRKNILTDPIKANYK
                     KFDNGPDHEEKTQSIFSNVKVDDNIFNSVKNTAVSNNFNVESYLNTISQNEKNKPLDD
                     DQLTVNNTIFGKTGLESKDVENKTDGRIYDNSSVDNDITVNSRIIGNYENPILTKLSE
                     RTVNKEVEFQKIITNILFYFILNLLKKSTVFFVSYTTMGQSLTSLVTNFIMNNKNSSF
                     YSEFSKILSNNSNWLLSWLDCAVNCIIVLNVTLSIWNLTKKTDINDLELSSKQMALLG
                     LDNNINNSNYLLHKQNNKPHLVTRNKVSSNKHDVEIELPINQSIDSNFDGGIVNQNTP
                     YLFKSLQTPLKMKVQQNQLPPQSVISDKFATAFNYNHNLDLRKEILSRNNFNRNVSSL
                     FGANKIDDDKNQGNNSSGYTSSNKYAYLMNSPSPRKRF"
     gene            <644651..>646135
                     /gene="TPHA0E03070"
                     /locus_tag="TPHA_0E03070"
                     /db_xref="GeneID:11531438"
     mRNA            <644651..>646135
                     /gene="TPHA0E03070"
                     /locus_tag="TPHA_0E03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685783.1"
                     /db_xref="GeneID:11531438"
     CDS             644651..646135
                     /gene="TPHA0E03070"
                     /locus_tag="TPHA_0E03070"
                     /inference="similar to DNA sequence:INSDC:YLL010C,YLR019W"
                     /note="similar to Saccharomyces cerevisiae PSR1 (YLL010C)
                     and PSR2 (YLR019W); ancestral locus Anc_5.202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685831.1"
                     /db_xref="GeneID:11531438"
                     /db_xref="GOA:G8BU19"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BU19"
                     /translation="MGQSSSIFCCTTIDKHENNLSKEINKNKNIERITSMSAIKINNN
                     TAQSHGTAHVANDVSNLSFVDKEVNKKLKESNHGIPDENITNSKLDNFDSLENKKRNN
                     TSIIANERLNSTSTDISNKKNRYENISKINSKKFSGNNDSSVNNTSVILNENEDSDID
                     EYDDINKEKNDSYTYESKVIGNIAYDGLDIDGSSVETFITTENDPINIITNGSDSASD
                     SNSHAIITTETATSSMSLSDSSSIQAQEANIPEFSSANSNSVVTQVNQNDPVMNNMSL
                     NYAEINENNKMIDGNLIDLSKLQANQVSATGYETLLAPKEIKRFGRKKCLILDLDETL
                     VHSSFKYVDSADFVIPVTIDNQTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYG
                     DPLLNILDPANTIIHHRLFRESCYTYEGNYVKNLSQLGRPLNEIIILDNSPASYIFHP
                     QHAIPISSWFSDIHDNELLDILPLLDNLANPDVLDVGNILDVTI"
     gene            complement(<646691..>648157)
                     /gene="TPHA0E03080"
                     /locus_tag="TPHA_0E03080"
                     /db_xref="GeneID:11531219"
     mRNA            complement(<646691..>648157)
                     /gene="TPHA0E03080"
                     /locus_tag="TPHA_0E03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685784.1"
                     /db_xref="GeneID:11531219"
     CDS             complement(646691..648157)
                     /gene="TPHA0E03080"
                     /locus_tag="TPHA_0E03080"
                     /inference="similar to DNA sequence:INSDC:YLL011W"
                     /note="similar to Saccharomyces cerevisiae SOF1 (YLL011W);
                     ancestral locus Anc_5.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685832.1"
                     /db_xref="GeneID:11531219"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BU20"
                     /translation="MKIKTIKRSSDDYVPVKSTQESQMPRNLNPELHPFERAREYTKA
                     LTATKMERMFAKPFIGQMGYGHRDGVYTIAKNYNQLNKLASSSADGVVKYFNMSTREE
                     ICSFKAHYGLVTGLCVRPETSATNKNEHYMISCGDDKTVKLWSVDSNDFSNNKKDDTI
                     HKGDGLLKTYYGDHAFFGLDHHRNNSTFVTGGAQIQLWDANRSKPISNLTWGADNVTS
                     VKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIRQSMRTNAICWNPMEAFNFVIANE
                     DHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYKTNQGHSR
                     EVYHTKRMQHVFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKSTREKNKLEYDE
                     KLKERFKYMPEIRRISRHRHVPIVVKKAQEIKGIELNSIKRRETNERRTRKDLSFVSE
                     RRKQLVGAAFEYEDDNRKRKGKGSNKDEDADDVENEDI"
     gene            complement(<648784..>650733)
                     /gene="TPHA0E03090"
                     /locus_tag="TPHA_0E03090"
                     /db_xref="GeneID:11531313"
     mRNA            complement(<648784..>650733)
                     /gene="TPHA0E03090"
                     /locus_tag="TPHA_0E03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685785.1"
                     /db_xref="GeneID:11531313"
     CDS             complement(648784..650733)
                     /gene="TPHA0E03090"
                     /locus_tag="TPHA_0E03090"
                     /inference="similar to DNA sequence:INSDC:YLL012W,YLR020C"
                     /note="similar to Saccharomyces cerevisiae YEH1 (YLL012W)
                     and YEH2 (YLR020C); ancestral locus Anc_5.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685833.1"
                     /db_xref="GeneID:11531313"
                     /db_xref="GOA:G8BU21"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BU21"
                     /translation="MLGLNHSFRFARRILSFILPLFLKNVIKSVCSFIILNIFLTYLL
                     MFAIVNNIVLHIAKKNRNYYFRDTRSSLTKILPKKFRSIIKKHTSNLFLVKNTSSKDL
                     NIKIINEIDNDIANNIVYDHYVTDVDKIEYEKDDDCIGEIENEENPFKNSFENLTKHD
                     KFLISDLNYYFQKYNIDIETIEIETDDGFIIELWHLIPNSNSNIKTHGHPVLLLHGLL
                     QSSGSFASSGKKSLAYFLCTSGYDVWLGNNRCGFEPKYNHSKLKKDDVWDWDVKEMIK
                     YDLRAMIEKILVDTDYQKLTLVGHSQGTAISIYGLINGEDIFEDGFRLIDKIENFVAL
                     APAVYPGPLLEDKLFIRLLRDYINNDICFGTKSFLPIMMFVRNYFEKRVFAYLCYTMF
                     NYLFDWNDKLWNNNIRNRHFMFSPVYVSVKLMKWWLSPDENDHSFIRNSDIMFPDSKV
                     WFPIKDDVKKSNRKILETHTNAPKGSLNDLPNLLFFVLKQDRLVDGERLINHLINYED
                     HNLFKIWYIEEYSHMDVLWANDIIERVGRPLINNLREPKQNMHNLIESVSISNFISKA
                     EDNAETEYEAIDSDSELISTEEIISVPSPEFISKLTNSTISNLRSGNSIDGDKSETEI
                     EETENETEIQNTIKNKKLTVIESNI"
     gene            <652133..>652678
                     /gene="TPHA0E03100"
                     /locus_tag="TPHA_0E03100"
                     /db_xref="GeneID:11531314"
     mRNA            <652133..>652678
                     /gene="TPHA0E03100"
                     /locus_tag="TPHA_0E03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685786.1"
                     /db_xref="GeneID:11531314"
     CDS             652133..652678
                     /gene="TPHA0E03100"
                     /locus_tag="TPHA_0E03100"
                     /inference="similar to DNA sequence:INSDC:YLR021W"
                     /note="similar to Saccharomyces cerevisiae YLR021W;
                     ancestral locus Anc_5.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685834.1"
                     /db_xref="GeneID:11531314"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:G8BU22"
                     /translation="MYSQEAKFTEFPINLFNIANEESRELYISSIHYSNYVLLQIRFN
                     GELDTTYEISQKGLRSVSFDRPLAGSLMMNDEQRSDDDEFDFTIDNLSDYQIVTKLGN
                     SNDMKLPVICTQIVELYNKIILPKLHPDKKDDISKNKFIITLNSRIWGSNPNADSSTS
                     SNVDFNRLVFLLKCIKSIYLS"
     gene            complement(<652728..>653483)
                     /gene="TPHA0E03110"
                     /locus_tag="TPHA_0E03110"
                     /db_xref="GeneID:11531367"
     mRNA            complement(<652728..>653483)
                     /gene="TPHA0E03110"
                     /locus_tag="TPHA_0E03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685787.1"
                     /db_xref="GeneID:11531367"
     CDS             complement(652728..653483)
                     /gene="TPHA0E03110"
                     /locus_tag="TPHA_0E03110"
                     /inference="similar to DNA sequence:INSDC:YLR022C"
                     /note="similar to Saccharomyces cerevisiae SDO1 (YLR022C);
                     ancestral locus Anc_5.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685835.1"
                     /db_xref="GeneID:11531367"
                     /db_xref="GOA:G8BU23"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018023"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:G8BU23"
                     /translation="MAINQPSGQIKLTNVSLVKLRKNKKRFEIACYQNKVQDYRKGVE
                     KDLDEVLQIPQVFVNVSKGLAAPKDDLLKSFGTDDIDLIIKEILLKGEIQLHEKERQI
                     MLNKINNEMLTIISTKCINPKSKKRYPPTMIYKALQELKFSPVINKPAKSQALEAIRL
                     LVSKQIIPIARAKMDIKITIENLELVESKDSEIIPKITKYFLQPTINKTDAIKKWVCS
                     GLIDPVSYRDLVTICTGIATIQVLDMAVIDTST"
     gene            complement(<654079..>655788)
                     /gene="TPHA0E03120"
                     /locus_tag="TPHA_0E03120"
                     /db_xref="GeneID:11531536"
     mRNA            complement(<654079..>655788)
                     /gene="TPHA0E03120"
                     /locus_tag="TPHA_0E03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685788.1"
                     /db_xref="GeneID:11531536"
     CDS             complement(654079..655788)
                     /gene="TPHA0E03120"
                     /locus_tag="TPHA_0E03120"
                     /inference="similar to DNA sequence:INSDC:YLR023C"
                     /note="similar to Saccharomyces cerevisiae IZH3 (YLR023C);
                     ancestral locus Anc_5.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685836.1"
                     /db_xref="GeneID:11531536"
                     /db_xref="GOA:G8BU24"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:G8BU24"
                     /translation="MPDTIEIPVNDDLRLTQKNSYSKRMYDAVVNGGNSIGNIQKIKQ
                     KSKNVMANNNPSNIPSTILKSGYTKLNNYYSSGSERGKKMLSRFNSNNSTNKNTYAYD
                     SDGDENINENEKNLYNSFRNEESAKSRFILMNRESQDTLVGMDTDSDSLFSGSASTLF
                     SNNNLKDNKLAKEVLVRNARISPIQNTSSSVTLVEENAHFEQEECLRKLRVILKKEEL
                     TSTDIRNYNIAFNHDVAFDLGKERHLHYYELPFPWRENKYIIHGYRFHDKFYQLILSV
                     FNWYGVHNETTNIWTHMLAAFYLIYLLTVDFQKTFIVLDTEHVPATTKYIIYMFLGAG
                     IKCMFASVFWHTFNGTTSIRLRPKFCCVDYTGITLLISASIMSAEYITLYDYPKAMSF
                     YMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFFVLLAAVGGLSFVNLVCLEGLSRAI
                     WLFSPVTNKSVIYYIIGVFFYGSFIPERFRSDYLIDEKIPTTKELSSDVHVITTERDL
                     HFRKNPTSTCHCIDHRVSFRSLWWVDYYCNSHSIWHIFVFLGVVGHYNAILDMATKKW
                     LLP"
     gene            <658470..>664481
                     /gene="TPHA0E03130"
                     /locus_tag="TPHA_0E03130"
                     /db_xref="GeneID:11531507"
     mRNA            <658470..>664481
                     /gene="TPHA0E03130"
                     /locus_tag="TPHA_0E03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685789.1"
                     /db_xref="GeneID:11531507"
     CDS             658470..664481
                     /gene="TPHA0E03130"
                     /locus_tag="TPHA_0E03130"
                     /inference="similar to DNA sequence:INSDC:YGR184C"
                     /note="similar to Saccharomyces cerevisiae UBR1 (YGR184C);
                     ancestral locus Anc_5.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685837.1"
                     /db_xref="GeneID:11531507"
                     /db_xref="GOA:G8BU25"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013993"
                     /db_xref="UniProtKB/TrEMBL:G8BU25"
                     /translation="MSDWNLNELESSNMTEYTTELRTLLNTIHTVNEFVDVRGFRERM
                     ELETHLNYYIGRILNYFLLDEGKNINYLYNTETEHDQGPFKESIEKIRNEVENVSSYI
                     VSPKTDNNDTSSKCHAGRSCGRKFRNGEPIYRCQECGFDDTCVLCINCFEPKDHVNHH
                     VYTGISNDNFNTGICDCGDNEAWNVTLSCKADNDLLENEKKDDSLNIFETEHNRKIFE
                     AVLFEAIDYVIDVFNHQVEVLYPTHSEFTSFIRKTYHDITDESLRISTIRRFIDDFSY
                     RNKSFDIEENKGYTLIVYNDEFHNYSQATTALRQGKPDNPHIDILTTRIDTEGRAVIK
                     TSPTLTDDFIRSLFAIETNGLTAFIFQWQEYLHQESANRIMWWISQCLELENPSFQKV
                     FRQSLTKVLCTKFDKDSTTNLANEFDFRGIKIGLSKDHFRYSELSILNEENSIPQISH
                     KILDFTSLNDINDYHIPPNRCSSTIEVDPVPYSGLRLQYILYFDNRFWKALRKNVQSI
                     IIPIVSSDADYKKLFSDEFLQIFSHMLRSVAYNDREPHLTIIKELIVQLLTVPTNVES
                     LMNNKHMFEEIMWSIIDFFCKFAKVDNGQLVWQRVQISNITKSYNFLFKQSLYFIEIV
                     LGKVMDYRKLLEPNNFITLLNFLKLFNGAWKINRKEGEHVLHEDQYFIPYLEYTTYIY
                     NIIENFDVILRKNIESARNDPMLHGAIKILLNYLISANSTNATFKKLDSFGNRSVIKF
                     DVSKERTTYMNPVSTLFSILVDKISIDDFVRLVSEVPEKDKFIFSADVEMRTLVLCSQ
                     VECGFWIRNGMSVLHQLSYYKNNQELDSYGRDLHVVQLGAINSCSNKEEGMTEELETF
                     TYNMLDRWGLIECLNKPYNSEKTIYEDKLYPMIQQFIVFCYHMLTTRIFFEEFQDAEE
                     NRIEQLQTMIIYKLFSKPLSYSKLLKSIPNYLIENNNNQDFDISLEKLSIFEEPKGLS
                     DNGVYKLKKQNYSLIDPLNMFNMGNDFESSVNIIKSKLAGKVRKPEEIIIEPYFNEKV
                     RDERIGRFLRTTIFVNLIENLLEEVILSNNATYLYELLHLLHAIFKDYRLCNNYSNKI
                     PPEYKSESIISSLIAVLKDSSNKQFSGNIIAKANWVLESIIQDNQKKFYEKLSKLYGS
                     EFSENFRLKRSNEDNARAEVESEIDKKRRLAKKRQKKLMARFDNQQAKFMEEHKNSFE
                     KPLHDSAQSYMNCSGDKGKEVTAIEDSTCVLCQDDVDNEVFIIPAYHDYSPIFRGSSK
                     VDLYDVKYEWDGFKNDSDNLTYYDDATIKNIINSSSSGSKKVFTSCNHAIHSNCFRRF
                     IQKKRLSVHGFICPLCQTYSNCIIPVVPSSNYKLNLSLKSIIDNSLTVNEFSELFSSG
                     KFDSVVDKSNPLSTVLNFSIYHANSFDIDIHKIIDGKKENVTLILSMHWANTISMLEI
                     ASRTDENPQISFLITREQKYKTLKNILCFIMLIYKVYGQPDLNFKPYDFKGKNRIENQ
                     LFHYIVYNFLYSKMPLRKIVTNALSTYLRQLVKLSIDNIHELKNEKKLDILLDCKEVS
                     PIHVSLKKRIEKIVMDHIIIDYDDKVYCLIYKYLVRSILPTLRRCLIIVKVFHDTIKV
                     SENDTFIVDDKRLEDLLDVDDLCEYVNLMIDLLTDYESLEYLLDAECSTPSDILLKKI
                     PIESSKIIKMANLVNNLNTYITNSKELRLREEHFISKYKLEDRLDFKICLTCGSKVHM
                     RSDHHEMSHHLQRECFKSYGAFLVPNNNEVCLFLANPPSVVYISAPYLNSHGESGKNA
                     MKRGDLTTLSTRRFEYLNTLWVNNEIPGYISRAMGDDFRLNILSNGFLFAMNRIPPQF
                     RRRDDGDSDSSGEEDLNFSDEEEGGLRVEDMTRVEFEEAFEFFNPTENDGLNDDDVET
                     GNRERRRVRTLPFAILQEQIRRLDGMGGNGTQVFNLADLLDGARNPVTETATPPTNAQ
                     LGTPVENIIDSINLTDENETREENNTNPNEENSDREWEDDDMTHW"
     gene            <665008..>665524
                     /gene="TPHA0E03140"
                     /locus_tag="TPHA_0E03140"
                     /db_xref="GeneID:11531522"
     mRNA            join(<665008..665010,665309..>665524)
                     /gene="TPHA0E03140"
                     /locus_tag="TPHA_0E03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685790.1"
                     /db_xref="GeneID:11531522"
     CDS             join(665008..665010,665309..665524)
                     /gene="TPHA0E03140"
                     /locus_tag="TPHA_0E03140"
                     /inference="similar to DNA sequence:INSDC:YGR183C"
                     /note="similar to Saccharomyces cerevisiae QCR9 (YGR183C);
                     ancestral locus Anc_5.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685838.1"
                     /db_xref="GeneID:11531522"
                     /db_xref="GOA:G8BU26"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="UniProtKB/TrEMBL:G8BU26"
                     /translation="MSFSTLYKVFFKRNAVFVGTIFALGFVFQDSFDTGVTAWYNAHN
                     KGKLWVDVKQNLNLVNNGDDADADVEDE"
     gene            complement(<666045..>666494)
                     /gene="TPHA0E03150"
                     /locus_tag="TPHA_0E03150"
                     /db_xref="GeneID:11531353"
     mRNA            complement(<666045..>666494)
                     /gene="TPHA0E03150"
                     /locus_tag="TPHA_0E03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685791.1"
                     /db_xref="GeneID:11531353"
     CDS             complement(666045..666494)
                     /gene="TPHA0E03150"
                     /locus_tag="TPHA_0E03150"
                     /inference="similar to DNA sequence:INSDC:YGR174C"
                     /note="similar to Saccharomyces cerevisiae CBP4 (YGR174C);
                     ancestral locus Anc_5.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685839.1"
                     /db_xref="GeneID:11531353"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="UniProtKB/TrEMBL:G8BU27"
                     /translation="MDTPLWLRWAKVYAAGGVIIGTGLLLFKYVTPTDEQLLNSFSPE
                     VRLEYEQQKKLREAEQQELMKVVQQTSTSNDPIWKTGSIVSPWERADEGKNDPNQRYA
                     FQKLKSSEVQKDELKKIRDELQQLRVQSEAKTNQIVQEKMKNWWKFW"
     gene            complement(<667236..>668714)
                     /gene="TPHA0E03160"
                     /locus_tag="TPHA_0E03160"
                     /db_xref="GeneID:11531146"
     mRNA            complement(<667236..>668714)
                     /gene="TPHA0E03160"
                     /locus_tag="TPHA_0E03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685792.1"
                     /db_xref="GeneID:11531146"
     CDS             complement(667236..668714)
                     /gene="TPHA0E03160"
                     /locus_tag="TPHA_0E03160"
                     /inference="similar to DNA sequence:INSDC:YGR175C"
                     /note="similar to Saccharomyces cerevisiae ERG1 (YGR175C);
                     ancestral locus Anc_5.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685840.1"
                     /db_xref="GeneID:11531146"
                     /db_xref="GOA:G8BU28"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="UniProtKB/TrEMBL:G8BU28"
                     /translation="MSGKTVAPELLTADENVKYDALIVGCGVIGPCIATALARKGKKV
                     LIVEKEWTFPERIVGELMQPGGVRALKSLGMVQAFNNIDAYPVTGYTVIYNGEEVDIP
                     YPYKADSAPVEKLEGIVKDGNDKVLDDANIKIKDFEDDERERGIAFVHGKFLQNLRKI
                     VADEPNVTRLQGTVIEIMKDDKNEVYGAKVDIPTRGKVVFKANLTFVCDGIFSRFRTE
                     LHPDHQSRVDSSFIGMALYNADMPAPKHGHVILGNNHLPIICYQISPEEVRLLCAYNS
                     AKLPSDIKGWMTKEVQPFIPKKLRPSFDAALAEGKFKSMPNSYLPAIPNQITGLCVIG
                     DALNQRHPLTGGGMTVGLQDVVLLMKKISDLDFNDRELVLDEILDFNYEKKDYGVVIN
                     VLSIALYALFAANTPELKVLQKGCFKYFQRGGDSIAVPARFLAGVLPKPLVLTRVFFA
                     VAFYACYINIQEQGLVGFFQAFSILITAFKVFTPFLYEEMFS"
     gene            complement(<670756..>672360)
                     /gene="TPHA0E03170"
                     /locus_tag="TPHA_0E03170"
                     /db_xref="GeneID:11531147"
     mRNA            complement(<670756..>672360)
                     /gene="TPHA0E03170"
                     /locus_tag="TPHA_0E03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685793.1"
                     /db_xref="GeneID:11531147"
     CDS             complement(670756..672360)
                     /gene="TPHA0E03170"
                     /locus_tag="TPHA_0E03170"
                     /inference="similar to DNA sequence:INSDC:YGR177C"
                     /note="similar to Saccharomyces cerevisiae ATF2 (YGR177C);
                     ancestral locus Anc_5.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685841.1"
                     /db_xref="GeneID:11531147"
                     /db_xref="GOA:G8BU29"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:G8BU29"
                     /translation="MSLEALSFDEYKPYITEELIERGHARRMGHLQDYFAIIQRQKLY
                     NNFNIYCELNEKVNKVQLSHAFREMFLQYPALIEYIVPKFYPKHEAYYRSEEYLSKPC
                     PIHDYIRVLNEVNINDIIMNEQDEYKSITTKISDIFVKNDYKFSNEISEMVSTIKIAI
                     CDPKKPNWRIICLPSKTSSTEWKDFILVSNHFDSDGTSAVNFFEDLTNILSKQANVEN
                     DTIVIGNDINIINYSKDYKLISKLPIPITERISYTPTLSSIPKFIVGNICKTKLQYTS
                     DGGDTPAEFVSEDPLTYDYLINFSSEEVAKMKKTIKNCLYNSVTLTPFIQACFFVAMY
                     KYNKILNLNNWWQWGVDCALATNARRLLPDDPETRDLYRYGSNVGGTHYFNLISQFNI
                     NEFEYDKFFKLVDYYHKNYQNSYRNGDELVGFGVLFSDLIINNTNMDKTIKDDYTNHK
                     RGGLLFSNVGYRNEDLTKKVHVNNIIFSQSPGCMKFTFGLNLISTDKCGMNILMNGVR
                     GSVKSRENFEDFCRFFRKTVENFAKL"
     gene            complement(<672883..>675126)
                     /gene="TPHA0E03180"
                     /locus_tag="TPHA_0E03180"
                     /db_xref="GeneID:11531198"
     mRNA            complement(<672883..>675126)
                     /gene="TPHA0E03180"
                     /locus_tag="TPHA_0E03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685794.1"
                     /db_xref="GeneID:11531198"
     CDS             complement(672883..675126)
                     /gene="TPHA0E03180"
                     /locus_tag="TPHA_0E03180"
                     /inference="similar to DNA sequence:INSDC:YGR178C"
                     /note="similar to Saccharomyces cerevisiae PBP1 (YGR178C);
                     ancestral locus Anc_5.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685842.1"
                     /db_xref="GeneID:11531198"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:G8BU30"
                     /translation="MKGGNFSNKKQSGGSSYHNSNRSHATSQAMFAESPETLASFTDR
                     QDYLFVNSIGSEVTATLFSGTKFSGILSAYNPESKEGIEIVLKFPKLVDVGFSDIDTK
                     DSETKLGETLLFHGKDVAELELNNISFSLDEKYEQANKKREIISQQPIKQQNTTSHTE
                     QSSKFKTDVDISKSAPKIKERELQKWAPEADDSSALNQGLDDGSSNWDQFAVNEKKFG
                     VTSSYDEHFYTTKIDKSHPEYRKRLQEAEKLAKEIESQGSSNIHVAEDRGLIIDDSGM
                     DEEDKYSGVDRRGDELLAALKSNTKPIENKPSKYVPPTLRHQPHHIDPAIISSVTEQS
                     TVGAPASTMKAGPTLNTKNIEGKSDSTKISYSNVVKNGIQKTIYSVGTSTKENFNSKE
                     TQIEDLKKFSQKFKVPFKVPEDMKEVVKKSEEPKDSNSTKGSSKASSSGKGTDGKRPS
                     ISSRRRHATIFFGSQGLPHSNNRKKEIFNNNFNMFESAKASYDKNIEKAESEMGKEEK
                     IMQPFIIEKPYFTAPTWESTIEKSHKALFPDERVLVQKAQMRLQQRQMRSYDPNMGNH
                     QMQMAMGGMIGYPMSTAGINPLMNGGMSMYVPMQQPMMYPGMVPQMVGVMGSSGKEGA
                     KGMSPQQQYQSLGYGGPAPVHLGNPYMYQGGMTFNQGMAGHSQPQNSHYKPNSHHNSN
                     FNRHNNNNNIYYYNNNNYKNNNNSHYNNHYRNNNANGHPTKNQGNGSESNKNSNTQEP
                     TSKNVNE"
     gene            complement(<675675..>676844)
                     /gene="TPHA0E03190"
                     /locus_tag="TPHA_0E03190"
                     /db_xref="GeneID:11531479"
     mRNA            complement(<675675..>676844)
                     /gene="TPHA0E03190"
                     /locus_tag="TPHA_0E03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685795.1"
                     /db_xref="GeneID:11531479"
     CDS             complement(675675..676844)
                     /gene="TPHA0E03190"
                     /locus_tag="TPHA_0E03190"
                     /inference="similar to DNA sequence:INSDC:YGR179C"
                     /note="similar to Saccharomyces cerevisiae OKP1 (YGR179C);
                     ancestral locus Anc_5.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685843.1"
                     /db_xref="GeneID:11531479"
                     /db_xref="UniProtKB/TrEMBL:G8BU31"
                     /translation="MSSSPENRFLDEIENDSANSSILMDVNNSKHLRLDELEEADEHT
                     KMSKKLFYSSPHREKPIRNRPVHDEPLSKNNENERGVQAPVREIIINKDTLYDKEEIQ
                     PWEFNKVIRKGYKEKLPTNYDLKKWRRPSKTMVNSVIQLLENNIEYGIEGVMNKYKDE
                     LEAVTNYNQREIKKVYKQKQSIMDDIVSKIKQRLAKSKFPSRLADKDLDIEYIFAKRK
                     FIQSRYIQELENAERVETELIKSQAELIKLRDTSKKLMKNNRKRLVEKLIDNNLHSSL
                     SKSISNSFNFETNTDSTVLNDTDNNNHSSKFSTDLYELNLEIDLSDDAEEPQMFDTIT
                     MQKDRDTNASLYLPSLESYEQTSNKLSKTINSILELNHNKEFKKLNNRNVDNEDD"
     gene            complement(<677352..>679232)
                     /gene="TPHA0E03200"
                     /locus_tag="TPHA_0E03200"
                     /db_xref="GeneID:11531205"
     mRNA            complement(<677352..>679232)
                     /gene="TPHA0E03200"
                     /locus_tag="TPHA_0E03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685796.1"
                     /db_xref="GeneID:11531205"
     CDS             complement(677352..679232)
                     /gene="TPHA0E03200"
                     /locus_tag="TPHA_0E03200"
                     /note="ancestral locus Anc_5.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685844.1"
                     /db_xref="GeneID:11531205"
                     /db_xref="GOA:G8BU32"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BU32"
                     /translation="MSYPHLVTSESTSNDHNEDDLESIKSYIPEINETDNQNDGIVNT
                     LSQTISNLSKKSISLGVNEREEILSIVNSHREGVQRVLSDYESLTHGIGPVEEMIDKE
                     APHKIIPSTTNFYHEEDKWQYPIDSETGFRIVEFVDDDRDDPRTWDARIKWNITVLLG
                     IICFVVAMMSAVVTGDINAPAAHFGVSEEVIILTVSLMVWGFGLGPLVFAPLSEELGR
                     NWIYCTTLFVAVIFIIPCAVAQNIGTLLAFRFLDGLAFSAPMCIIGGSLSDIWRTEER
                     GIAMSIFSAAPFLGPVMGPIVGSLLTVYCGWRWVYIFMIILSGCLYAVLFVFLPETHH
                     QTILKRRAKKLRKLTGDQSYRAVSEIKVRTLKEIANDSLLRPLILLSELIVFLVTMYM
                     AILYGLLYMFFFAYPVVYSEGKGWSDIKTSIMFIPIGVGVLIGTAVSPLFNMDYNRRA
                     QRFIDKGEIPPAELRLIPMMYGCAFVPIGLFCYAWTSFPHVSWAGPCFSGFACGLGFV
                     LLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGSVPLFTIQMYHRLGYEWASTLMAF
                     IGLACCAIPFLFYRYGATIRKRSKYAYSPSVDVVKVTAEDVENNSNKETTNNTESSSD
                     SY"
     gene            682253..682361
                     /gene="TPHA0Etrna5P"
                     /locus_tag="TPHA_0Etrna5P"
                     /db_xref="GeneID:11531316"
     tRNA            join(682253..682289,682325..682361)
                     /gene="TPHA0Etrna5P"
                     /locus_tag="TPHA_0Etrna5P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11531316"
     gene            complement(<682696..>683901)
                     /gene="TPHA0E03210"
                     /locus_tag="TPHA_0E03210"
                     /db_xref="GeneID:11531443"
     mRNA            complement(<682696..>683901)
                     /gene="TPHA0E03210"
                     /locus_tag="TPHA_0E03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685797.1"
                     /db_xref="GeneID:11531443"
     CDS             complement(682696..683901)
                     /gene="TPHA0E03210"
                     /locus_tag="TPHA_0E03210"
                     /inference="similar to DNA sequence:INSDC:YGR180C,YJL026W"
                     /note="similar to Saccharomyces cerevisiae RNR4 (YGR180C)
                     and RNR2 (YJL026W); ancestral locus Anc_5.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685845.1"
                     /db_xref="GeneID:11531443"
                     /db_xref="GOA:G8BU33"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:G8BU33"
                     /translation="MAPPKETPSKVAASALSDLELKDSKANLGKTLDALKENKFDEEA
                     LQLRLSKAAEEHKQFMAKHRVQRHKLKELEKSEPLLVEDDSRKVLYPIKYPDVYEAYK
                     RAEASFWTAEEIDLGKDLHDWNNRMNENEKFFISRVLAFFAASDGIVNENLTENFSVE
                     AKIPEAKLFYGFQIMIENIHSETYSLLIDTYVKDPKESQFLFNAIETIPQIKEKAEWA
                     LRWINDSEALFAERLVAFAAIEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGL
                     HTDFACILFSHIKNKPSPEIVEKIVTEAVEIEKRYFLDALPVSLLGMNADLMNQYVEF
                     VADRLLVAFGNKKYFKVENPFDFMENISLAGKTNFFEKRVSDYQFAGVISKSSNTESE
                     NPFSLEEDF"
     gene            complement(<684857..>685915)
                     /gene="TPHA0E03220"
                     /locus_tag="TPHA_0E03220"
                     /db_xref="GeneID:11531348"
     mRNA            complement(<684857..>685915)
                     /gene="TPHA0E03220"
                     /locus_tag="TPHA_0E03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685798.1"
                     /db_xref="GeneID:11531348"
     CDS             complement(684857..685915)
                     /gene="TPHA0E03220"
                     /locus_tag="TPHA_0E03220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685846.1"
                     /db_xref="GeneID:11531348"
                     /db_xref="GOA:G8BU34"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:G8BU34"
                     /translation="MSSITEFFAEHKAKRHLLKESQKDEVILIENHRRFVLFPIKYHE
                     VYDAYKQREALFWTAEELDFTKDIENFNGEEISEDEKEYITRLLALFASNDMDKLNLT
                     ENLSAEVQIPEAKCFYGFQIMLDNIHQEVYSLIIDAIIKDNGKRVSMFDDLKKLSNIN
                     DKLEYAKTWFENEDHLFGEKLIAFAAVQGIFSLAAYASIFSPKGGKLFPGLQKGVQNM
                     FRDRALHTDFQSLMYAHLKHDVDPVVVNRIITDAVKIEKASLKDTLPIEKFGLKIAEM
                     EQLIEHVADFLLVSFGAEKEYNVANPFPFMEKVAIPGNTNSFAKKVADYHKASDIAQT
                     STNEKKDGEANFSMTEDF"
     gene            complement(<687151..>688761)
                     /gene="TPHA0E03230"
                     /locus_tag="TPHA_0E03230"
                     /db_xref="GeneID:11531186"
     mRNA            complement(<687151..>688761)
                     /gene="TPHA0E03230"
                     /locus_tag="TPHA_0E03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685799.1"
                     /db_xref="GeneID:11531186"
     CDS             complement(687151..688761)
                     /gene="TPHA0E03230"
                     /locus_tag="TPHA_0E03230"
                     /inference="similar to DNA sequence:INSDC:YJL149W"
                     /note="similar to Saccharomyces cerevisiae YJL149W;
                     ancestral locus Anc_1.198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685847.1"
                     /db_xref="GeneID:11531186"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8BU35"
                     /translation="MSQFPLHLLPDELVKEVFSHLPQADRLNLCLLNKYYHKIATQLL
                     YNRIYLNDSNVVKSDYINLAINWSLINIPSSLSEKDSREIANKRLEQLIETLENVSLC
                     RNSITWIRINWDLDSQLQKRILNILCDKGESVTRLENITDPNCNDIIMHGKIAKRQVI
                     SFDLAPPNALPEVPVSPDYIPNAKLFLKNRISSRLSHMTLFIDPVKLFNYLYPLKNKL
                     QIVDLKLHWRSEFYQNEYFTKPLSKYEFTKLSEIFDVRTLKVLTVISWNQTLLDREIE
                     MVNDFKEFTNIEDLSLISIKQKTRLIVSLFKRLKNLKRLKMDFLEDFVPESTNPEIFI
                     AITTYCRYLQFMDLRFQGLDPSIISLGKVSSGIDDTFDINSENRFILTQTCNCDKCDY
                     VFKEILKKKIFLFEEDYIFEDISDIASKDIYKMMRCLSLLPYSKACDYYPSVRTQPMN
                     LKEFVKRINTNLWAYRQSRDQLILKKEKKVVLDDQNESGNSEEEIEEITYELPHDPLS
                     EKDVIDCYHALIHQYKSTYITFLSRFKN"
     gene            complement(<689543..>690109)
                     /gene="TPHA0E03240"
                     /locus_tag="TPHA_0E03240"
                     /db_xref="GeneID:11531412"
     mRNA            complement(<689543..>690109)
                     /gene="TPHA0E03240"
                     /locus_tag="TPHA_0E03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685800.1"
                     /db_xref="GeneID:11531412"
     CDS             complement(689543..690109)
                     /gene="TPHA0E03240"
                     /locus_tag="TPHA_0E03240"
                     /inference="similar to DNA sequence:INSDC:YKR065C"
                     /note="similar to Saccharomyces cerevisiae PAM17
                     (YKR065C); ancestral locus Anc_1.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685848.1"
                     /db_xref="GeneID:11531412"
                     /db_xref="InterPro:IPR013875"
                     /db_xref="UniProtKB/TrEMBL:G8BU36"
                     /translation="MLSSTVRKSTLQLTKPIWSIRSLSAKAPVTSQTSEDAKGLTWAD
                     FFALRRTERKINVGSSIFTALVGSNLSWAYLSTMQIDPTQTLLGFDPLVAISAGLIAS
                     GTLGYLFGPLLGSQIFNVGHSKKLKSYTAKNKEFLKKIISNRVDASSQSFSNPVPDYY
                     GEKIGSIKEYRQWLRDCHAYRRKAKEFL"
     gene            complement(<690693..>691775)
                     /gene="TPHA0E03250"
                     /locus_tag="TPHA_0E03250"
                     /db_xref="GeneID:11531397"
     mRNA            complement(<690693..>691775)
                     /gene="TPHA0E03250"
                     /locus_tag="TPHA_0E03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685801.1"
                     /db_xref="GeneID:11531397"
     CDS             complement(690693..691775)
                     /gene="TPHA0E03250"
                     /locus_tag="TPHA_0E03250"
                     /inference="similar to DNA sequence:INSDC:YKR066C"
                     /note="similar to Saccharomyces cerevisiae CCP1 (YKR066C);
                     ancestral locus Anc_1.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685849.1"
                     /db_xref="GeneID:11531397"
                     /db_xref="GOA:G8BU37"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="UniProtKB/TrEMBL:G8BU37"
                     /translation="MSFARTLNKRSVYLFGAVAGAAAAASMASQSEFSKFSYNNSNNN
                     NNNNRHNNFSRFTKAGLFGIGAASASHPNVANPDKTKTIEDYQKIYNVIAKKIQDEDE
                     HDGYIGYIPILVRIAWHSSGTYDKESGTGGSHGGTMRHAKELNDPSNAGLHTAKAFLD
                     PIQTQFPWISHGDLYTLAGVAAIQEAQGPKIPWRNGRVNKDEDEGPENGRLPDANGDA
                     TYVRSYYGRLNFLNDRDIVALMGCHCLGRTHLANSGFDGPWGAASNVFSNEFFVNLLT
                     ENWKWEKNAAGNYQWNSPKGYMMLPADHSLIEDGTFKKIVEEYAANQDVFFKDFSNVF
                     ARLLENGITFPKDQKPFIFKTLDEQE"
     gene            <693073..>695907
                     /gene="TPHA0E03260"
                     /locus_tag="TPHA_0E03260"
                     /db_xref="GeneID:11531243"
     mRNA            <693073..>695907
                     /gene="TPHA0E03260"
                     /locus_tag="TPHA_0E03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685802.1"
                     /db_xref="GeneID:11531243"
     CDS             693073..695907
                     /gene="TPHA0E03260"
                     /locus_tag="TPHA_0E03260"
                     /inference="similar to DNA sequence:INSDC:YJL154C"
                     /note="similar to Saccharomyces cerevisiae VPS35
                     (YJL154C); ancestral locus Anc_1.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685850.1"
                     /db_xref="GeneID:11531243"
                     /db_xref="GOA:G8BU38"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="UniProtKB/TrEMBL:G8BU38"
                     /translation="MLSNESMELLLNDIKRQSLIIKKCLDNNELMNSLKNYSILLNNL
                     RNDKLSPKQYYEVYIIIFDSLSRLTVFLKESNASHYCNSKTLVDLYELVQYSGNILPR
                     LYLMITIGSLYLSIEDAPSIELLKDMIEMCRGVQNPMRGLFLRYYLSQRTKDYFLDVD
                     AAEYDKNFNCSFIITNFIEMNKLWVRMQHQGSSKDKDKRLTERTELKILIGSQLVRLS
                     QIIDTDFETYNDFFLPKVLEQIIQCNDLLSQEYLFDVIIQIFPVDFNLKMLQLTILPN
                     LLKLNNTDTIKKILELLIIRLLNVELESVLQEASLDNATLFDVLWHFLNDLIEKRPDL
                     PFLTFIAIIENYLSLSITLDPRNFDHLTSIFKTVIKKFKEFGESNLSKTEFLSIKNIL
                     LFKNYQDKIKELPHLFFFNLLISCSEYNNLLLLQPLKNQKVIISSILDNLLSVTISKE
                     QKLIDVFHINSKSELESILLFVEPIIKKYDSETDDVRVLSYDPLQDRLAKLIHLVIAR
                     QNVFNNEKSIKNKIEWMIKYYLIIKNWFYKGGSNTYYTFPVIITYFWKLIRYVNLVKL
                     KYIANQDNEVDEKLVDYFDLQLKQLFKLTSRCIADLYQLSAMENERITMPGYKQEEAI
                     YDTIFKLNIQCASLADQLSFSEISYDFFSQAFTIYEEKLNDSKTQFQSLIYLAQTLQK
                     TRSLYHGEDNNYENLIVRCTLHSSKLLKKQDQCRSVYLCSHLWWATEVSSLGEEEDQT
                     DTFYRDGKRVLECLQRSLRVADSIMDNVQSCQLMVEILSRCIYYFVHSTSEYDSHVTA
                     KYINGLLELIQTNLNSLNIERNTLPNVALSDSDNDNDNNNNANANRSSAANNNFHKIT
                     SSVVETKKHVVTGNVSVGLNGSYLRVDNLNERSLVSSSNNNNGTKSLTGHDSVTLQEK
                     IDSLFQYFNRVCKYISEQRQVDPRFTAITV"
     gene            <697207..>698124
                     /gene="TPHA0E03270"
                     /locus_tag="TPHA_0E03270"
                     /db_xref="GeneID:11531244"
     mRNA            <697207..>698124
                     /gene="TPHA0E03270"
                     /locus_tag="TPHA_0E03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685803.1"
                     /db_xref="GeneID:11531244"
     CDS             697207..698124
                     /gene="TPHA0E03270"
                     /locus_tag="TPHA_0E03270"
                     /inference="similar to DNA sequence:INSDC:YJL158C"
                     /note="similar to Saccharomyces cerevisiae CIS3 (YJL158C);
                     ancestral locus Anc_1.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685851.1"
                     /db_xref="GeneID:11531244"
                     /db_xref="GOA:G8BU39"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8BU39"
                     /translation="MQLKQTLATTALASTALAAYNPSEPWTTLTPSATYAGGYTDYSA
                     SFGIAVQPIASSVAKRAEAISQIGDGQIQATTKTTTSAAKSTAAAVSQIGDGQIQATT
                     KTTTSAAKSTAAAVSQIGDGQIQATTSTKATAAAVSQIGDGQVQATTSSAKSSAAAAS
                     QINDGQVQASTTKATTTLEGSSSSSSAATSTSTSAATTGALVINSVSCSGSGTLALSL
                     KGGELTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGNLAIGDNDIFYQCL
                     SGNFYNLYDETLGAQCNPVHLEIVDLVDC"
     gene            complement(<698537..>699625)
                     /gene="TPHA0E03280"
                     /locus_tag="TPHA_0E03280"
                     /db_xref="GeneID:11531202"
     mRNA            complement(<698537..>699625)
                     /gene="TPHA0E03280"
                     /locus_tag="TPHA_0E03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685804.1"
                     /db_xref="GeneID:11531202"
     CDS             complement(698537..699625)
                     /gene="TPHA0E03280"
                     /locus_tag="TPHA_0E03280"
                     /inference="similar to DNA sequence:INSDC:YJL159W,YKL163W"
                     /note="similar to Saccharomyces cerevisiae HSP150
                     (YJL159W) and PIR3 (YKL163W); ancestral locus Anc_1.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685852.1"
                     /db_xref="GeneID:11531202"
                     /db_xref="GOA:G8BU40"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8BU40"
                     /translation="MQLKQTLATAALASTAMAAYNPAEPWTTLTPSATYAGGLTDYTT
                     SFGIAVQPITTSVSAASSVAKRAEAISQIGDGQIQATTSTKTTAAAVSQIGDGQIQAT
                     TKTTTAKTTAAAVSQIGDGQIQATTKTTTAKTTAAAVSQIGDGQIQATTKTTTAKTTA
                     AAVSQIGDGQIQATTKTTTAKTTAAAVSQIGDGQIQATTSTKTAAAAVSQIGDGQIQA
                     TTKTTSGKSTSSNTTTTLVGSKSSTSAAASTASAAADSNDPITAQTCMTDSTLAMVIK
                     KGELTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGNLAIGDNDIFYQCLS
                     GNFYNLYDETLGAQCTPVHLQAIDLVQC"
     gene            <701131..>702075
                     /gene="TPHA0E03290"
                     /locus_tag="TPHA_0E03290"
                     /db_xref="GeneID:11531145"
     mRNA            <701131..>702075
                     /gene="TPHA0E03290"
                     /locus_tag="TPHA_0E03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685805.1"
                     /db_xref="GeneID:11531145"
     CDS             701131..702075
                     /gene="TPHA0E03290"
                     /locus_tag="TPHA_0E03290"
                     /inference="similar to DNA sequence:INSDC:YJL160C,YKL164C"
                     /note="similar to Saccharomyces cerevisiae YJL160C and
                     PIR1 (YKL164C); ancestral locus Anc_1.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685853.1"
                     /db_xref="GeneID:11531145"
                     /db_xref="GOA:G8BU41"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:G8BU41"
                     /translation="MQLKQTLATAALASTAMAAYNPAEPWTTLTPSATYAGGLTDYTT
                     SFGIAVQPITTSVSAASSVAKRAEAISQIGDGQIQATTSTKTTAAAVSQIGDGQIQAT
                     TKTTTAKTTAAAVSQIGDGQIQATTKTTTAKTTAAAVSQIGDGQIQATTSTKTAAAAV
                     SQIGDGQIQATTKTTSGKSTSSNTTTTLVGSKSSTSAAASTASAAADSNDPITAQTCM
                     TDSTLAMVIKKGELTDAKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGNLAIG
                     DNDIFYQCLSGNFYNLYDETLGAQCTPVHLQAIDLVQC"
     gene            <703575..>704912
                     /gene="TPHA0E03300"
                     /locus_tag="TPHA_0E03300"
                     /db_xref="GeneID:11531307"
     mRNA            <703575..>704912
                     /gene="TPHA0E03300"
                     /locus_tag="TPHA_0E03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685806.1"
                     /db_xref="GeneID:11531307"
     CDS             703575..704912
                     /gene="TPHA0E03300"
                     /locus_tag="TPHA_0E03300"
                     /inference="similar to DNA sequence:INSDC:YJL164C,YKL166C"
                     /note="similar to Saccharomyces cerevisiae TPK1 (YJL164C)
                     and TPK3 (YKL166C); ancestral locus Anc_1.182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685854.1"
                     /db_xref="GeneID:11531307"
                     /db_xref="GOA:G8BU42"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BU42"
                     /translation="MYIDPQNKNEVRRLSVSPRLEESEQPLYRSKNSQLDLDNNRPGQ
                     QQDKNNSEEDVRKQQGNIEDSIDKLNKKMSNAKLDDIEQRIRNGPDGGEVGDQLKLAG
                     ISKQRTVANEENDLKKLAVHGKKTDCKYTLRDFQILRTLGTGSFGRVHLVRSNHNDRF
                     YALKVLKKYTVVKLKQVEHTNDERKMLSVVAHPFLIRMWGTFQDCEQVFMVMDYIEGG
                     ELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILLDKNGHIKITD
                     FGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTAFYDST
                     TMKTYENILNAPLKFPPFFHPDVQDLLSKLINRDLSKRLGNLQGGSEDVKNHPWFSEV
                     IWEKLLSRNIETPYEPPIQQGKGDTSQFERYPEEEINYGIQGEDPYNVLFEGF"
     gene            <705440..>705835
                     /gene="TPHA0E03310"
                     /locus_tag="TPHA_0E03310"
                     /db_xref="GeneID:11531381"
     mRNA            <705440..>705835
                     /gene="TPHA0E03310"
                     /locus_tag="TPHA_0E03310"
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /transcript_id="XM_003685807.1"
                     /db_xref="GeneID:11531381"
     CDS             705440..705835
                     /gene="TPHA0E03310"
                     /locus_tag="TPHA_0E03310"
                     /inference="similar to DNA sequence:INSDC:YKL167C"
                     /note="similar to Saccharomyces cerevisiae MRP49
                     (YKL167C); ancestral locus Anc_1.181"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /protein_id="XP_003685855.1"
                     /db_xref="GeneID:11531381"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BU43"
                     /translation="MSSIGKQLKFLNKISLTTKPTQILINPDKYHGLKLTFQFQNHNG
                     HMGARKFWREYLPTLKFYNPELNIDVVRIKNEDRNNVSVPCVMEITSKTGTPLATIDM
                     RNKRDSEIVTEFLGKIQHTVIPEEDLIKV"
     gene            complement(<706041..>706556)
                     /gene="TPHA0E03320"
                     /locus_tag="TPHA_0E03320"
                     /db_xref="GeneID:11531158"
     mRNA            complement(<706041..>706556)
                     /gene="TPHA0E03320"
                     /locus_tag="TPHA_0E03320"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="XM_003685808.1"
                     /db_xref="GeneID:11531158"
     CDS             complement(706041..706556)
                     /gene="TPHA0E03320"
                     /locus_tag="TPHA_0E03320"
                     /inference="similar to DNA sequence:INSDC:YKL170W"
                     /note="similar to Saccharomyces cerevisiae MRPL38
                     (YKL170W); ancestral locus Anc_1.179"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="XP_003685856.1"
                     /db_xref="GeneID:11531158"
                     /db_xref="GOA:G8BU44"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:G8BU44"
                     /translation="MIVDVSFIYREISRVLYQSVDIDIPQGLLCIVIMIYLKSIIKVI
                     DNSGAQLVECIKVMRKGSPQTPAKIGDQIVAVVQKAKPLSQNIVGANLANRVKKGDIV
                     RAIVVRTKQRNMTRPNGMTVAFGDNACVLINKTTGEPLGTRIMANEGVVGRELKELGY
                     NKICSLARRVI"
     gene            complement(<706990..>707274)
                     /gene="TPHA0E03330"
                     /locus_tag="TPHA_0E03330"
                     /db_xref="GeneID:11531159"
     mRNA            complement(<706990..>707274)
                     /gene="TPHA0E03330"
                     /locus_tag="TPHA_0E03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685809.1"
                     /db_xref="GeneID:11531159"
     CDS             complement(706990..707274)
                     /gene="TPHA0E03330"
                     /locus_tag="TPHA_0E03330"
                     /inference="similar to DNA sequence:INSDC:YJL166W"
                     /note="similar to Saccharomyces cerevisiae QCR8 (YJL166W);
                     ancestral locus Anc_1.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685857.1"
                     /db_xref="GeneID:11531159"
                     /db_xref="GOA:G8BU45"
                     /db_xref="InterPro:IPR004205"
                     /db_xref="UniProtKB/TrEMBL:G8BU45"
                     /translation="MSPPGAKTYMGWWGHIGSPKQKGITSYAISPYAQKPLNGAFKNA
                     FFNSFRRFKSQVLFVAIPAGIYWYWWTNSREYNEYLYTKAGREELERINV"
     gene            complement(<707798..>708856)
                     /gene="TPHA0E03340"
                     /locus_tag="TPHA_0E03340"
                     /db_xref="GeneID:11531157"
     mRNA            complement(<707798..>708856)
                     /gene="TPHA0E03340"
                     /locus_tag="TPHA_0E03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685810.1"
                     /db_xref="GeneID:11531157"
     CDS             complement(707798..708856)
                     /gene="TPHA0E03340"
                     /locus_tag="TPHA_0E03340"
                     /inference="similar to DNA sequence:INSDC:YJL167W"
                     /note="similar to Saccharomyces cerevisiae ERG20
                     (YJL167W); ancestral locus Anc_1.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685858.1"
                     /db_xref="GeneID:11531157"
                     /db_xref="GOA:G8BU46"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:G8BU46"
                     /translation="MSSKEEVRGKFVDEFPELVEELKDVLRKYGMPAEAITWFEKNLN
                     YNTPGGKLNRGLSVVDTYAILKNYKSVNDLSKDEYRKVAVLGWCIELLQAYFLVADDM
                     MDKSITRRGQPCWYKVKDVGEIAINDAFMLEAAIYELLKKYFKGQSYYIDLIELFHEV
                     TFQTEMGQLLDLITAPEDKVDLSKFSLAKHSFIVIFKTAYYSFYLPVALAMYMAGITD
                     AKDLKQAQDVLIPLGEYFQIQDDYLDCFGTPEQIGKIGTDIQDNKCSWIINKALELAT
                     PEQRKVLDENYGRKDSVMEARCKKIFVDMKLDEHYHEYEEKVATELKAKIAKIDESRG
                     FKGEVLTAFLNKVYKRSK"
     gene            <709592..>711535
                     /gene="TPHA0E03350"
                     /locus_tag="TPHA_0E03350"
                     /db_xref="GeneID:11531390"
     mRNA            <709592..>711535
                     /gene="TPHA0E03350"
                     /locus_tag="TPHA_0E03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685811.1"
                     /db_xref="GeneID:11531390"
     CDS             709592..711535
                     /gene="TPHA0E03350"
                     /locus_tag="TPHA_0E03350"
                     /inference="similar to DNA sequence:INSDC:YKL174C"
                     /note="similar to Saccharomyces cerevisiae TPO5 (YKL174C);
                     ancestral locus Anc_1.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685859.1"
                     /db_xref="GeneID:11531390"
                     /db_xref="GOA:G8BU47"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BU47"
                     /translation="MPEYRLVPDSIRENFNNFHPNELFENLHDIVLEGEVNADESDLS
                     SSPEVNDALYEQQLDKSLLSKSSIVGLGFGLMSPVLGMCTSMSIGLKDGGPLTILIGF
                     MVSGIFTWFCSLSLGEVVSKYPNELHISSAMLSSYLTDNTLDSKLRYIASWYTGWLML
                     IGNWTMSTSITFAGAQLTISLLLLMKSDLISETHLILFTVIVFYLVVTIVGFINLKFS
                     RFIETINKICVIWIFYAIIFIDVLLLVFQAGKFRSLKYALFHFDNSLSGYTSAFLSFI
                     IGFQQSNFTLQGFSMLPALADEVKRPERDIPRGMSTAVLLSTFSGVVFLLPIMLILPD
                     LDNIFNNKNSNLLPIVSIFTQSTHSKFVSVFLVFCILGNLLFSGIGSITTSSRAVYSF
                     SRDHALPYHELWTFVDSDSVSKVPKYSIWLSMGVSYTLGLLALFSTAAFNAFVGAAVL
                     CLCTATVIPLILVLISGRRSIRNAPVKMKYKLGWIVNILSVAWLLLAMVSVCFPPQIP
                     VTFSTMNYALMVYIFCLIIITVLYFQWGKNNFVLPHPMKTSLTSNPSTYAMSKSLVDL
                     SRETDMEEFNSTNKSSTEENKYNNEPDAFQDLGRNPFDDENNIELQYTTANHHHEEKD
                     FTKKHHSPLSSLLKTSEIDLSER"
     gene            <712540..>715467
                     /gene="TPHA0E03360"
                     /locus_tag="TPHA_0E03360"
                     /db_xref="GeneID:11531351"
     mRNA            <712540..>715467
                     /gene="TPHA0E03360"
                     /locus_tag="TPHA_0E03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685812.1"
                     /db_xref="GeneID:11531351"
     CDS             712540..715467
                     /gene="TPHA0E03360"
                     /locus_tag="TPHA_0E03360"
                     /inference="similar to DNA sequence:INSDC:YKL176C"
                     /note="similar to Saccharomyces cerevisiae LST4 (YKL176C);
                     ancestral locus Anc_1.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685860.1"
                     /db_xref="GeneID:11531351"
                     /db_xref="UniProtKB/TrEMBL:G8BU48"
                     /translation="MLAGLLRKGQPNKNGYDQDAYMNGSNNNPTQIINNRLNGVLDPH
                     GISALHLNSNGNGIGNGNSYSINGSTVNSNPNSNPLDNISDSMLLKLFGTTSFETKYR
                     NSGVLPNSFKNIEHTRNSIHGLSNTNKFVSDSFRLIVAEETGQMASINNHRFIIDTTF
                     PKNSSMSHIRNSELKEYIFGSPLRLSESTKSDKFRTIPNSNMTLIIRSFTYSSKLSNK
                     LAICLCVPTNYFPVITEGWSAISQWLDYTQKIILVMTKKGIHQKHSPCPVTIKNGAIN
                     NPETRATTGYTFYNNMSQELLVNKSVNSPFKNNDASSSSLLSIDARFKNTPDVDKIIQ
                     KLQKVVMPCLQSLYSIPRLFIFPENSIAYIDCWLQEIFSWLEIKDGPNSSFLPSLLAK
                     IIIDYKESMSGDTSDRIVVMTGSTVVADKLTFIIAGLLEPKNLKLNLKSSHSNISIYQ
                     PSSNSTFPDATTLNEKTELLSLNVNSSGQIPSFENINNTKDKHEACKSHSSSSNDLMK
                     ISPNSPAASDKIHSSRRGWEIPKKNVTQNVTTLSPGESFAHVIQPSSINSGGSLNQLH
                     ASLSSSQSGSYGSWFKQMPSLSHFMQHSNSLKSNDSWDRPASSNMGLQRTTSNTSVQQ
                     ARLNFGITPQPSPSISTYDEYPWFDTPSSSQIDTNVLSTTHATAQPIVGANGFLYANS
                     PAKSYTSNLSIPSTLTATEAIGQFGSSLTNSHKQMDRNTGASVSWPIKDISDVSDIKK
                     ENINLERSRRHVVQDGRLDDAFDKICNFDRVEDLKYTLTPSNAQHAGTLELDMAELAT
                     EESMVENQHHYTELLPRYTSYLSMYNSWFKLQAIQLNSDSKFRIVDSMKKDLENKDGV
                     SIEKTLMIVLGSREIHEVSVRKENNKLMQKNKNVFSNGKITKSSATSNHKYKDDGTFD
                     IAEDDTLKQSTDEYRNELSNCLLFIEYTIKSAKELYSDTEISDEKRDKEIMKLYLGLF
                     HYK"
     gene            <716679..>717857
                     /gene="TPHA0E03370"
                     /locus_tag="TPHA_0E03370"
                     /db_xref="GeneID:11531481"
     mRNA            <716679..>717857
                     /gene="TPHA0E03370"
                     /locus_tag="TPHA_0E03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685813.1"
                     /db_xref="GeneID:11531481"
     CDS             716679..717857
                     /gene="TPHA0E03370"
                     /locus_tag="TPHA_0E03370"
                     /inference="similar to DNA sequence:INSDC:YJL171C"
                     /note="similar to Saccharomyces cerevisiae YJL171C;
                     ancestral locus Anc_1.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685861.1"
                     /db_xref="GeneID:11531481"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:G8BU49"
                     /translation="MSTILQLVALAVYSMVVSASVDKVSFTNVGFGGSFTPVKKLSNI
                     DSDSCTCEVDSAEYFSGANSPLADYLSVHFRGPLTLSKFAFYSSNSFVINNNRSSDDW
                     SRLAYYDSADQISQNVTFLTKAGDDSPCLGKALTYASANGTGAASDSTILEDNNYISS
                     DLEYAIFSNISCPSSGTGKGCGVYRDGIPAFYGFYGVTKMFLFEFELPTETQSNSTSF
                     EYYDLPAIWLLNDHIPRTSQYPNNANCSCWASGCGEYDIFEAMNGTEHNNLYSTFHTY
                     QGISDLGTGIQAYQAFARDTSNVMRGGVIFDSDGNVVSFLSSSTTFESTYSASDVIAL
                     VNGISTNETYSSQLASISAASTTSSKSKNGAGSLLPNNNTFMYYLATIVTTFLHVFVI
                     "
     gene            <718369..>718719
                     /gene="TPHA0E03380"
                     /locus_tag="TPHA_0E03380"
                     /db_xref="GeneID:11531482"
     mRNA            <718369..>718719
                     /gene="TPHA0E03380"
                     /locus_tag="TPHA_0E03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685814.1"
                     /db_xref="GeneID:11531482"
     CDS             718369..718719
                     /gene="TPHA0E03380"
                     /locus_tag="TPHA_0E03380"
                     /inference="similar to DNA sequence:INSDC:YJL173C"
                     /note="similar to Saccharomyces cerevisiae RFA3 (YJL173C);
                     ancestral locus Anc_1.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685862.1"
                     /db_xref="GeneID:11531482"
                     /db_xref="GOA:G8BU50"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="UniProtKB/TrEMBL:G8BU50"
                     /translation="MASETPRLDPTEIKDNSFPVFRLIGLVTSQPTESALTLKSPTKD
                     GEMISLTNIRVSMNKQFEVDAWYEFVCRSSDNGDIGFLILDAVKCILEENETISIDGI
                     VALQQLSKKFPEIY"
     gene            <719360..>721417
                     /gene="TPHA0E03390"
                     /locus_tag="TPHA_0E03390"
                     /db_xref="GeneID:11531252"
     mRNA            <719360..>721417
                     /gene="TPHA0E03390"
                     /locus_tag="TPHA_0E03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685815.1"
                     /db_xref="GeneID:11531252"
     CDS             719360..721417
                     /gene="TPHA0E03390"
                     /locus_tag="TPHA_0E03390"
                     /inference="similar to DNA sequence:INSDC:YKL179C"
                     /note="similar to Saccharomyces cerevisiae COY1 (YKL179C);
                     ancestral locus Anc_1.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685863.1"
                     /db_xref="GeneID:11531252"
                     /db_xref="GOA:G8BU51"
                     /db_xref="InterPro:IPR012955"
                     /db_xref="UniProtKB/TrEMBL:G8BU51"
                     /translation="METSVYSHALKLWENADLTSLQKNLDSDVLDIKETESVFLDSRK
                     SLATETKKFKKLENDEKLSQMNKLIKQYQQEIDSLTKRSKRSESILFNVYARLSETPD
                     PKPLLQNSIEKFSNVEDSKELKEQVESLQDKLAKYADYESIKSRLLDLEQSSAVVLTK
                     RLTAQEKELTSVWEAKKKNWEEKESEYTKQLQTLKQNNKVLELKVSKQVDIDGADDNE
                     EADGEENNKFVNITENNFLVEELNSAQSRIFQLEKRNEELTASLAEVTNEAKKESDLI
                     EKQRKISQLESENALLSASFERERIAQEKIKTTLSDQLSTSKVELASYKTELENVRRK
                     LNNYSDYAKLKDELTALKKIEFGVDDVNSDEDDMDSNSSVDNKMETTLITANKKLQSN
                     LAILRSKDTEQKEEIARLQKELQSLTLKVEELDKTNQKLERDLEAVEDIDQKFNDTAS
                     MMSGVTRQMNNRGGATGRLSPTSSIIGIPEESELPSSLMTNSSSILPIVTKQRDRFRI
                     KNIELEKQIRQVNNEKGKLQSDINKLHGDYQKLTERLRHISSLDSSSSKINSLSEFDA
                     EAQFSRSYDKSYNPLIDYKKKDSGYYKINRLPFTERIFMKFAEVVGSSKASRMVFVFY
                     SLGVHGILLLLLIAIGNSGGYSNTSSASIAHSEALAATSQLGAIAEKLNDVSSSGVKV
                     GNN"
     gene            complement(<721781..>722760)
                     /gene="TPHA0E03400"
                     /locus_tag="TPHA_0E03400"
                     /db_xref="GeneID:11531286"
     mRNA            complement(join(<721781..722026,722452..>722760))
                     /gene="TPHA0E03400"
                     /locus_tag="TPHA_0E03400"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_003685816.1"
                     /db_xref="GeneID:11531286"
     CDS             complement(join(721781..722026,722452..722760))
                     /gene="TPHA0E03400"
                     /locus_tag="TPHA_0E03400"
                     /inference="similar to DNA sequence:INSDC:YJL177W,YKL180W"
                     /note="similar to Saccharomyces cerevisiae RPL17B
                     (YJL177W) and RPL17A (YKL180W); ancestral locus Anc_1.161"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_003685864.1"
                     /db_xref="GeneID:11531286"
                     /db_xref="GOA:G8BU52"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:G8BU52"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAVSGWELQKA
                     QKYLDQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQQLLQNAAANA
                     EAKGLDATKLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVLTEREEAVEKA
                     TEKKAVRLSSRQRGRIAFQKRISA"
     gene            <724109..>724927
                     /gene="TPHA0E03410"
                     /locus_tag="TPHA_0E03410"
                     /db_xref="GeneID:11531171"
     mRNA            <724109..>724927
                     /gene="TPHA0E03410"
                     /locus_tag="TPHA_0E03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685817.1"
                     /db_xref="GeneID:11531171"
     CDS             724109..724927
                     /gene="TPHA0E03410"
                     /locus_tag="TPHA_0E03410"
                     /inference="similar to DNA sequence:INSDC:YJL178C"
                     /note="similar to Saccharomyces cerevisiae ATG27
                     (YJL178C); ancestral locus Anc_1.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685865.1"
                     /db_xref="GeneID:11531171"
                     /db_xref="InterPro:IPR018939"
                     /db_xref="UniProtKB/TrEMBL:G8BU53"
                     /translation="MKVYQSFFALVLLSSFVLGLQCSKHEVLKLYDLDKSMSLSELEK
                     ETPPTTTVEKWYINICNEDNGKNSKELYEGCKKTDLMCGVRLIKSATNKNDSPLLAQL
                     IDIDDSSKLEVSVVDNNLSLQFKDVVWGPNKVDASVVYTCDKNMKVDEVTSVWLENNI
                     QVSIKGPSGCLKDNNKDSDNNNSGNNGENNEKQSSGFPWFMVMLMYVIVFTVVYVSVM
                     SYKNTRGGSFNEFSVEFIERFTQLITSLPDLLKEVVSKIFGSRSSTERGGYSVL"
     gene            complement(<725167..>725427)
                     /gene="TPHA0E03420"
                     /locus_tag="TPHA_0E03420"
                     /db_xref="GeneID:11531248"
     mRNA            complement(<725167..>725427)
                     /gene="TPHA0E03420"
                     /locus_tag="TPHA_0E03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685818.1"
                     /db_xref="GeneID:11531248"
     CDS             complement(725167..725427)
                     /gene="TPHA0E03420"
                     /locus_tag="TPHA_0E03420"
                     /inference="similar to DNA sequence:INSDC:YJL179W"
                     /note="similar to Saccharomyces cerevisiae PFD1 (YJL179W);
                     ancestral locus Anc_1.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685866.1"
                     /db_xref="GeneID:11531248"
                     /db_xref="GOA:G8BU54"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:G8BU54"
                     /translation="MSDMKLVQEMTTSLRNNKAQLDMVNQQISHLDRQGQIAQLTADE
                     LGSYPNNEVWRSCGKAFILQSKDKYVTDLKHDENVINEQKKR"
     gene            complement(<725830..>727092)
                     /gene="TPHA0E03430"
                     /locus_tag="TPHA_0E03430"
                     /db_xref="GeneID:11531327"
     mRNA            complement(<725830..>727092)
                     /gene="TPHA0E03430"
                     /locus_tag="TPHA_0E03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685819.1"
                     /db_xref="GeneID:11531327"
     CDS             complement(725830..727092)
                     /gene="TPHA0E03430"
                     /locus_tag="TPHA_0E03430"
                     /inference="similar to DNA sequence:INSDC:YJL183W"
                     /note="similar to Saccharomyces cerevisiae MNN11
                     (YJL183W); ancestral locus Anc_1.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685867.1"
                     /db_xref="GeneID:11531327"
                     /db_xref="GOA:G8BU55"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:G8BU55"
                     /translation="MKPKSNLKYTGKEGSSWQGEITNLLSSETITTYSGGFNKKLSVR
                     IASLITGSLFLFYILSSMFSGNGSGDSLELRKEKLPEKHGFYYHEIEASSPLIFPNVD
                     HTKVLKDIGVRGLYILRMGPNDNNHYYIKVDDKPVPEEVIKKTTDQAFLAKRSFLDHG
                     KLVYHKGNSPDVIIVTLIDFDKYDEATLVKIVQNRVDYGQKHNYGVYIRWIQEFVPVL
                     EKQDLKSQYDNIKPIMMRAAMHAFPNAKQYMYLDDEALFMDMNLSLQKHILDPSVIEM
                     SLLKGVPVTAGSNINTYQNFHASNAKVIVPQGPDGKLDLSAFIVSNTFSGKVFLEYLC
                     EPLVRNYSFESFEHAVAHILQWHAYLLSKTAVVVPKLFASIYDPENKALNDVYHYTEG
                     DLLISFKGCEARGTCAQEISLFADKAKK"
     gene            complement(<727911..>729443)
                     /gene="TPHA0E03440"
                     /locus_tag="TPHA_0E03440"
                     /db_xref="GeneID:11531215"
     mRNA            complement(<727911..>729443)
                     /gene="TPHA0E03440"
                     /locus_tag="TPHA_0E03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685820.1"
                     /db_xref="GeneID:11531215"
     CDS             complement(727911..729443)
                     /gene="TPHA0E03440"
                     /locus_tag="TPHA_0E03440"
                     /inference="similar to DNA sequence:INSDC:YCR028C"
                     /note="similar to Saccharomyces cerevisiae FEN2 (YCR028C);
                     ancestral locus Anc_1.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685868.1"
                     /db_xref="GeneID:11531215"
                     /db_xref="GOA:G8BU56"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8BU56"
                     /translation="MNEIEFVKKDDQFKVYIDKDDGRDYNENEPVLVTKPINKRKVLI
                     KIDLFVLSFVCLQYWINYVDRVGFTNAYVSGMKEDLNMEGNDITIVGVCFTVGYVIGM
                     LPNNLILLVVSPRIWLSFCTFAWGVLTLSMYKVTSYKQCCAIRFFQAIFESCTFSGTH
                     LILGMWYKEKELPIRTAIFTSSGLVGSIFSGFIQTGIHDSLNGAHGLEGWRWLFIIDF
                     CITIPIALYGLVFFPGIPDHNSISGRFSMTKYIFNQEELDYARRRLPKRDESTSLDWS
                     VIPRVLGRWHWWLFSFVWILGGENISFSSNSLFALWLLDQNYSLSQKNNYPSGIYAVG
                     ILSTMAAAAYLSYIKRAKHWHVALVIATLLCVVAIMIRANPLNAAIMFTAQYLAGVAY
                     AGQAVFFTWANIICHNDLQERAIVLASMNMFSGAVNAWWSILFYSATTVPHFRKGCYA
                     LIATSVASGIVSIVIRKLQIKELNERQELPFVNPNDAIAEEYEGEDITDSLDDHSLDN
                     TC"
     gene            complement(<729975..>730358)
                     /gene="TPHA0E03450"
                     /locus_tag="TPHA_0E03450"
                     /db_xref="GeneID:11531216"
     mRNA            complement(<729975..>730358)
                     /gene="TPHA0E03450"
                     /locus_tag="TPHA_0E03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685821.1"
                     /db_xref="GeneID:11531216"
     CDS             complement(729975..730358)
                     /gene="TPHA0E03450"
                     /locus_tag="TPHA_0E03450"
                     /inference="similar to DNA sequence:INSDC:YCR028C-A"
                     /note="similar to Saccharomyces cerevisiae RIM1
                     (YCR028C-A); ancestral locus Anc_1.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685869.1"
                     /db_xref="GeneID:11531216"
                     /db_xref="GOA:G8BU57"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR011344"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BU57"
                     /translation="MFLRAQTRSFHATAKKMDFSKMSIIGRVGTEFTESTSANNTTYM
                     RYSIASQPRKDGPTNWYQVTVFSQPQMNFLKEYVKKGALVYVEADAANYSYEREDGTK
                     NTSLSLIQRDFNLLRNPKPVEDQGE"
     gene            <731135..>732067
                     /gene="TPHA0E03460"
                     /locus_tag="TPHA_0E03460"
                     /db_xref="GeneID:11531518"
     mRNA            <731135..>732067
                     /gene="TPHA0E03460"
                     /locus_tag="TPHA_0E03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685822.1"
                     /db_xref="GeneID:11531518"
     CDS             731135..732067
                     /gene="TPHA0E03460"
                     /locus_tag="TPHA_0E03460"
                     /inference="similar to DNA sequence:INSDC:YJL185C"
                     /note="similar to Saccharomyces cerevisiae YJL185C;
                     ancestral locus Anc_1.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685870.1"
                     /db_xref="GeneID:11531518"
                     /db_xref="UniProtKB/TrEMBL:G8BU58"
                     /translation="MSYGALRKYSGSRPAVQATFESSNEKSLIWDSEDNIYVHSGCED
                     ADLASLQVTRVLNNPGSPNGMESPTLSVSVSARGTTESSQNICLSSNNYDLINDNGRS
                     SFDQYSILSLSSSFGLHTTSRGQNSDSDKESSAAGLISIPKIEEKSSFTKKYKIIDDW
                     CLNNELKFSHSNNNDHLVNINSNCTSEGNNRKKQEYTVSIFPSNSHHLHDSDLYTQLR
                     EIQILHIKNFIKGMVPILRNFNSEINNGSINSVQYPIKYSSIPSVFSERDLLLFYSFK
                     YDELNRKADNILQFREELFESRSNMSNINSDRSI"
     gene            complement(<732624..>735074)
                     /gene="TPHA0E03470"
                     /locus_tag="TPHA_0E03470"
                     /db_xref="GeneID:11531405"
     mRNA            complement(<732624..>735074)
                     /gene="TPHA0E03470"
                     /locus_tag="TPHA_0E03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685823.1"
                     /db_xref="GeneID:11531405"
     CDS             complement(732624..735074)
                     /gene="TPHA0E03470"
                     /locus_tag="TPHA_0E03470"
                     /inference="similar to DNA sequence:INSDC:YCR030C"
                     /note="similar to Saccharomyces cerevisiae SYP1 (YCR030C);
                     ancestral locus Anc_1.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685871.1"
                     /db_xref="GeneID:11531405"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8BU59"
                     /translation="MTERAVYSSTLLVGKDPYESTEAVRIRLSEAKLINKNFFVALKE
                     ISDLQTSYNQRLRKIITQNENLGNILSKQLLTSQILTEEESRKYTFNSIGEVQQLWDV
                     LIQGLKDNLDAHTQLQLVLQHDVISVLKNNTETDSNWAETRKLHSRLSQAASVIDYYN
                     NTPNASGNPQEAMDQWGSESPYLFDTFEKVDFDRLQTLKNCLLKYQTSYSDYFLSSTK
                     NCENGMATLLSFDPETEINRFADEAMKFNFKMSDPKALNSTKQKAYAQEASPSKKEKR
                     RSTFGNISHRLTSNSTVLHHDLMNDEFSDSNNNVSLKSKKSGSLKSKVGSIFGRNKLK
                     NKKSQNLGGLKEASIPEQASSGSSIRTPSRTSTRNPVPRPSDTQPPLPREQYEKYQAA
                     ENSTPSNNYTPPANTYEAPTNNYTAVSNSSDWQQEHLPSNQQVNTPPTSPAEVPSHTQ
                     EKETQNFNEKPLPEEPTPQNSPSVSSRPLHIQAPSIPPSRKQNRDSVLGNDPFASEVL
                     PHEEVSAPNVADSNRVSVLLSQVTPGLQALDPQTTGTSTTISGQSIFQHESAGEIKSG
                     LNASVAEVINARFRDGILESSQLVGELALVYAKDPAQELPIGVNLKIENGDKFEKVIL
                     NQAFMEKVSPEEYKVNPIFINSRTLGAIKYSISNPVVPIIIQPVWKFEAHQASVILTV
                     KMSPTISNTIQSVTLNDFSVHVTIDGAETTNALSKPQGSFNKDKKRISWKFKQPLVLT
                     RQNEERLIARFMTEGTAYQTSKSVLTKFTILKSGEFGGSLNLFSQESNEENPFGGAWE
                     VIEATKTLTAGNYIGLST"
     gene            complement(<735664..>737793)
                     /gene="TPHA0E03480"
                     /locus_tag="TPHA_0E03480"
                     /db_xref="GeneID:11531461"
     mRNA            complement(<735664..>737793)
                     /gene="TPHA0E03480"
                     /locus_tag="TPHA_0E03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685824.1"
                     /db_xref="GeneID:11531461"
     CDS             complement(735664..737793)
                     /gene="TPHA0E03480"
                     /locus_tag="TPHA_0E03480"
                     /inference="similar to DNA sequence:INSDC:YJL186W"
                     /note="similar to Saccharomyces cerevisiae MNN5 (YJL186W);
                     ancestral locus Anc_1.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685872.1"
                     /db_xref="GeneID:11531461"
                     /db_xref="GOA:G8BU60"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BU60"
                     /translation="MAGFQLTKFRIPLSLKSRTNRRLNVILGLLSLCFFSLFWFPTLT
                     SINGDFSTQSEFGTPVVSEYSAKHGGLSYAPKTFNNIGNMNGYFANAKIKNVHDFYYK
                     LFNAISKARPVTPPKDKMAAYRKEGCKIKDVASYDKKENFSLLSYSNLDECFKLSDSQ
                     TKDLQVNHERFVNFIDTDIAEMDPAIKEQLWPNEKGIVIVGGGKFSIISINTIKAIRE
                     RGSTLPIEVIIPRSSVPEEEYCNRFLPSFNAKCVYLDDTLPNEFKERLTLKKYQYKSF
                     ALLVSSFKNVLYIDADNIPLVNLDNIFDSKAYKDNGLITWPDIWRRVTAPAYYKIANI
                     NYNLDNRVRYMADDVTPTSYYDNIVNPGNNYKLRRTPFHDFEGTLPDLTSESGQLMVN
                     KETHFRTLLLAFYYNYYGPRWYYTIFSQGTSGEGDKETFLAAAHALGEPYYQVKSTIE
                     FDGYFDHKDGFQGIGLYQKDFNKDYENYLAAKAKVEKDKKYGEYNPNYDFDADFEKAL
                     MNPPGNEVEAMFIHVSFHKFDPHNLAKNKRYILQGKQYRVFSKFKNLRNWDLELEANR
                     NMHFYLCTDNAVEFIFYKDLQGKDSWKDMCNYLSERVEYLASTHDAALSGELKIGQPP
                     YVEEPKEEPKEEEKPVAEGETKNQEAKNEEAKNEETKKDETKKDETKKDETKKDETKK
                     EEEVKKEEPKKEEPKKEEPKKEEANKK"
     gene            complement(<738659..>739063)
                     /gene="TPHA0E03490"
                     /locus_tag="TPHA_0E03490"
                     /db_xref="GeneID:11531425"
     mRNA            complement(<738659..>739063)
                     /gene="TPHA0E03490"
                     /locus_tag="TPHA_0E03490"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_003685825.1"
                     /db_xref="GeneID:11531425"
     CDS             complement(738659..739063)
                     /gene="TPHA0E03490"
                     /locus_tag="TPHA_0E03490"
                     /inference="similar to DNA sequence:INSDC:YCR031C,YJL191W"
                     /note="similar to Saccharomyces cerevisiae RPS14A
                     (YCR031C) and RPS14B (YJL191W); ancestral locus Anc_1.146"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_003685873.1"
                     /db_xref="GeneID:11531425"
                     /db_xref="GOA:G8BU61"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:G8BU61"
                     /translation="MAQARDNSQVFGVARIFASFNDTFVHVTDLSGKETIARVTGGMK
                     VKADRDESSPYAAMLAAQDVAVKCKEVGITAVHIKIRATGGTRSKTPGPGGQAALRAL
                     ARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            <740614..>741360
                     /gene="TPHA0E03500"
                     /locus_tag="TPHA_0E03500"
                     /db_xref="GeneID:11531426"
     mRNA            <740614..>741360
                     /gene="TPHA0E03500"
                     /locus_tag="TPHA_0E03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685826.1"
                     /db_xref="GeneID:11531426"
     CDS             740614..741360
                     /gene="TPHA0E03500"
                     /locus_tag="TPHA_0E03500"
                     /inference="similar to DNA sequence:INSDC:YJL192C"
                     /note="similar to Saccharomyces cerevisiae SOP4 (YJL192C);
                     ancestral locus Anc_1.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685874.1"
                     /db_xref="GeneID:11531426"
                     /db_xref="UniProtKB/TrEMBL:G8BU62"
                     /translation="MKVKSSTDKSMIIINCFIYFILNVSYVFASASIKGKVDLRPKSL
                     TISDISRITLTLHQIYNYKNDNITISDTKDSYYASTKIINTSGDFKFDNLPLIKGFNK
                     TTYFVLHSNSLDYNLRPNRVLYKFVSLDEDANKFNVTAYQNLLGREYFPSPEIAYPEN
                     LLEINADPYLNITYVRNAPMRLYYQHRKPSFLETGIIGNILSSRWKTAAVVTALCLAI
                     FPLVAEKLDPETTRLIKEEALKKQREKYQS"
     gene            <741718..>748116
                     /gene="TPHA0E03510"
                     /locus_tag="TPHA_0E03510"
                     /db_xref="GeneID:11531218"
     mRNA            <741718..>748116
                     /gene="TPHA0E03510"
                     /locus_tag="TPHA_0E03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685827.1"
                     /db_xref="GeneID:11531218"
     CDS             741718..748116
                     /gene="TPHA0E03510"
                     /locus_tag="TPHA_0E03510"
                     /inference="similar to DNA sequence:INSDC:YCR032W"
                     /note="similar to Saccharomyces cerevisiae BPH1 (YCR032W);
                     ancestral locus Anc_1.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685875.1"
                     /db_xref="GeneID:11531218"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR023362"
                     /db_xref="UniProtKB/TrEMBL:G8BU63"
                     /translation="MVSKLLDCFNKLLRLSPVEDSSQPLESSQVISRIIVEYQVKLEN
                     DNESIKSGEDLEDYIDWALPKYFNIDIIDDNFIVKENEDNWTLFLQLIITNNEKELII
                     KKCLLQIIIALIRVSFINKQKIGKCLKFQNSLKDTLFTKDSEFALEESLRQILNTLYT
                     ETLSVSSTIDDLLNLYDNFTRSKDIINTLALQTTETLSQSYFLFQNSYKIFSIKDALP
                     PKSKSIAIRLYLQLNNVTSNRIMTIGCNLFFEIKEGQLFLSDDESIIGLFDSFEFKPL
                     QIYSLLINIEGTDITLYNDGILINKLQLFDGAISNLAIVELGSMMSSFKVFRFQIFSG
                     IIDDTVATLLHQAGSTYYKSSCYEQQLYGLDYALRKATIVKAMQSTPNGNLESSFLNF
                     SDDSLIIDLNPNFELANINEDNYIFIEKRASTNNENNVLDSRPIYYYKSSNLVSNFEA
                     VDCFSQIIKILGECSNFEEVYELLNHLIKLLNDYRLRYIFEKDFGFPIIKHILLNITI
                     PTLKKTLPLPILNLFLEFCGWDISDVENSIIKNESAYDNIILDLKLWYAYSDDNEQTL
                     IGQEILRFILFQITTQVDASIFSSYNLKVMQKLYFIQKLSNSQHLIGELFPTSNVLFE
                     LKQDLVNIYYTLIKRDISRFKLKYIFNFAFYEIKQGFFVSGDILLKSLEIAINDTIEN
                     NDIKGLVLIYESLPTKDILLVLQEIIEKKENPIIPLRIILKLLASNSSNLENFGKRSG
                     FKVLLEVLKGTEFLYYEEIILLLFFQSFEDFDYIKNSPSVESFVNCTISFKKSIALKD
                     ILELSIRLLEWAVINDIEEKFEVELPDFIYSFISQLDTLMLDTKNVDILDVRTSNILN
                     SLSDLLLTMTKPQNGNVYEKSSNLLQNLISKTLKYNIISMNTKNFEQYIQEFFYLDVA
                     FTQKFAIFSGNKHPYYLYINIEKYFIEVVYELLAMDVKFSLKLMSSPFMFPNIITIFS
                     AMIKNYVELDFSTEFYLASLSILLICLRICLTDDKYDQKTISNSELVKLVVHLVVKLQ
                     ALVINKRLEWDDDFFNQYLKLLLKYNDILFENTNEILSSNIIWLIFIFIGYNINAQQI
                     NTESLDVIGSILTSCEQNQEYILNELEFKGRKDLLSIINLFKSAKNEEAISLLKKNKD
                     RLLTEKQCNKFLGISFQILNVTDFSRNISTTELNNIVFKSKQEDMDRNFIATEKLYKI
                     FLNSLVEKRKLIIREGDKEVKGFLTDCEEEYMINRNEYKEIIFKNSLILDAYNSKYLP
                     FDWSLDDIEDFQKSKRKLVRVPNNKKLHEDDQSREQYSLRKGKENREDNLFSDSLNSY
                     EVISNISFENENDYDSTEENHKILKVLKPKDSIKGIWNCSRIIGLEVKEGILIYGLTH
                     MYFIQNYFFSKSHKNIVNISKAPIEERDINIELIGNSPKSSVFQEHEVVIWENSSLIH
                     VTQRPFLLRDVAFELFYSEGKSNLFSFNNKDTRDEVYSRINKNCKSFGMDPMLRMVLD
                     EINKRNSGVGLKNGISQTNLRNKVFNVLNTSTFDGFEATQLWVKGEISNFYYLMILNT
                     LAGRSFNDLTQYPVFPWIISDCVSDTISLKDKNIYRDLSKPMGAQTEKRAAQFKERYE
                     SLESLKDPLSPPFHYGTHYSSSMIVSSYLIRLRPFVDSYLLLQSGKFGPADRLFNSIE
                     RAWCSASSESTTDVRELIPEFFCLPEFLINVNKLNFGKDQKNTQIDNVSLPKWANGDP
                     TVFIWKNREALESEYVSENLHHWIDLIFGYKQKGPAAISSINVFNKVSYPGAVNLDNI
                     DDPNEKRAITGMIHNFGQTPLQIFSEPHPKRSGLKPFQLTKSILALNGTCSVIKNIEP
                     KSQSNVTRFIKLSNNSSNNSKWQSFPKTHLPAIGGFDVILDNKFRTSLTIGNKVFSYL
                     HDAPITEINGEGNSLIFTGDDSGLIKIWKLDTENSPSIKNISIFRGHRSTIKQIEFYY
                     EYRVIISLDISGMIILWDVKNLRLIRYIKNSSSILAISQGNGDIAVVSKNNTVSFQNI
                     NGSNFCNIDFKNHIITSIEFFNISSLATGQLRHVFWQEKDVILIGFEDGIIEIYVLYL
                     LDSGEWSLKLLKVIKSTISTPITSIKPHLNSLFVDDYEKNNFVEIIAGDSNGDLYIWS
                     "
     gene            complement(<748237..>749406)
                     /gene="TPHA0E03520"
                     /locus_tag="TPHA_0E03520"
                     /db_xref="GeneID:11531514"
     mRNA            complement(<748237..>749406)
                     /gene="TPHA0E03520"
                     /locus_tag="TPHA_0E03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685828.1"
                     /db_xref="GeneID:11531514"
     CDS             complement(748237..749406)
                     /gene="TPHA0E03520"
                     /locus_tag="TPHA_0E03520"
                     /inference="similar to DNA sequence:INSDC:YJL193W"
                     /note="similar to Saccharomyces cerevisiae YJL193W;
                     ancestral locus Anc_1.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685876.1"
                     /db_xref="GeneID:11531514"
                     /db_xref="GOA:G8BU64"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G8BU64"
                     /translation="MPHNTIKTLYNYIHIVILCVCWYMLSSVGSQVTKRILTVCPLPL
                     FLGEFQFLYTAQLAVLCCGIAYSSERFYNTFPNGTFPVYDRKNIRDNWAWSVITKPSK
                     SIFQTVLPLSIFQFVGKFFGHKATSLVPVSTVASIKTLSPVFILIFQKIIGISTIQTN
                     INVGFSLAALITGVWIIVSEDNKLKSSSNVSDFSLFGIICAVISMFIFVFQNIYGKKV
                     FTFKKDDDNICILPKVNSTEQLMDEKYAFGSHHKISNKCYDKLTLMLYISSVGFILSF
                     FWFITFELPTILRYLSGDTTTVIQSIPWQLFIINGTFHFLQAMITFHLLGELSTLTYS
                     IANLMKRIAIISVSWVFIGKSVTLMQIFGLFLNVVGLFVYERIVNKNKKPRIHEK"
     gene            complement(<749999..>751735)
                     /gene="TPHA0E03530"
                     /locus_tag="TPHA_0E03530"
                     /db_xref="GeneID:11531521"
     mRNA            complement(<749999..>751735)
                     /gene="TPHA0E03530"
                     /locus_tag="TPHA_0E03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685829.1"
                     /db_xref="GeneID:11531521"
     CDS             complement(749999..751735)
                     /gene="TPHA0E03530"
                     /locus_tag="TPHA_0E03530"
                     /inference="similar to DNA sequence:INSDC:YJL194W"
                     /note="similar to Saccharomyces cerevisiae CDC6 (YJL194W);
                     ancestral locus Anc_1.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685877.1"
                     /db_xref="GeneID:11531521"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016314"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BU65"
                     /translation="MITTAGGRVLRGRKRPTVHYGSDDESSDLEVVEEVAVPTTPKKS
                     PLKKRLKRNNTNELRTPPRSVSKKSKNVFMDPNNIFITPVKMKLPVNESKPSLMVTPR
                     ASPQKLVFGKNNLYSRTKALLQRSSGMLTQADGSLPTREKEYAQLREFLDENISAGKS
                     NSLYITGPPGTGKTAQIESILRDNFHKIVLPQLNVMGERPVAPEINEDLENLSYYTLP
                     NGDIKAVATISINCIALANPSVIFNRIYNSFVKKHPNDKKEVRTSLDLQTFFEKYSSE
                     VTFMVVLDEMDKLVNSAISNDVTSTKIIFELFLLAKLPKTNFLLLGIANSLDMQDRFL
                     TRLTSEQDLLPKTILFHPYTADEMYQIIMNRLKTLKNDLQEQEEYCVFNEMAIKFAAK
                     KCSGNTGDLRKLFDILRSSVEILELEMIAAAKSESPFLKSHTNNTTVGGNTLKKVGLP
                     HIAKVFTSSMNNSSTKSKISKLNMQQKILLCTLMHREKSDIFQTHCTLDDAYDYYTKM
                     LKAKNSLAPLKRNEFLESCNALETCGVVNIFEFKKHGKTKYFGKMVKTSVDIEEFETE
                     ITKVDLLKSFLN"
     gene            <751828..>752355
                     /gene="TPHA0E03540"
                     /locus_tag="TPHA_0E03540"
                     /db_xref="GeneID:11531154"
     mRNA            <751828..>752355
                     /gene="TPHA0E03540"
                     /locus_tag="TPHA_0E03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685830.1"
                     /db_xref="GeneID:11531154"
     CDS             751828..752355
                     /gene="TPHA0E03540"
                     /locus_tag="TPHA_0E03540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685878.1"
                     /db_xref="GeneID:11531154"
                     /db_xref="UniProtKB/TrEMBL:G8BU66"
                     /translation="MHLYVVIYSILESSSLGFGVPDLICPLSSPAISILFLETAQTNP
                     QDRCARSRHFGNTSISYPNREICHVISQTGQTSGLAAWTSKDDGRRRTASQSGVPGRM
                     HSSHVRCPMHSWRSVGTLNWWSKRAGTVVGCRCPHCSLLASRPAVHDPQTTVTVAQCS
                     FEHIHSSQTVSGPMR"
     gene            <752628..>753584
                     /gene="TPHA0E03550"
                     /locus_tag="TPHA_0E03550"
                     /db_xref="GeneID:11531155"
     mRNA            <752628..>753584
                     /gene="TPHA0E03550"
                     /locus_tag="TPHA_0E03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685831.1"
                     /db_xref="GeneID:11531155"
     CDS             752628..753584
                     /gene="TPHA0E03550"
                     /locus_tag="TPHA_0E03550"
                     /inference="similar to DNA sequence:INSDC:YCR034W,YJL196C"
                     /note="similar to Saccharomyces cerevisiae FEN1 (YCR034W)
                     and ELO1 (YJL196C); ancestral locus Anc_1.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685879.1"
                     /db_xref="GeneID:11531155"
                     /db_xref="GOA:G8BU67"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:G8BU67"
                     /translation="MNSTNVTESGRPIVENTVANVFEAYYPTVDLPFFNISLWNIFNK
                     TMTVLSGGKFVPDEFKFVQGQLPLSELNHVLVGIATYYVVIFGGKFLLRNREPYKLNA
                     IFQLHNIFLTFVSFSLLVLMIEQLFPIIYRNGIFFGICDISAWKPELVTLYYLNYLVK
                     FVEFIDTLFLVLKKKNLTFLHTYHHGATALLCYTQLVGNTSVSWVPITLNLGVHCLMY
                     FYYFLAARGIRVWWKEWVTRFQIVQFIFDVTFIFLVAYHRAAFLYMKSLPHSQCAGST
                     TAIFSGFCILASYLFLFTAFYIELYKRAGSKKAKEANSKKNR"
     gene            complement(<753804..>754946)
                     /gene="TPHA0E03560"
                     /locus_tag="TPHA_0E03560"
                     /db_xref="GeneID:11531168"
     mRNA            complement(<753804..>754946)
                     /gene="TPHA0E03560"
                     /locus_tag="TPHA_0E03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685832.1"
                     /db_xref="GeneID:11531168"
     CDS             complement(753804..754946)
                     /gene="TPHA0E03560"
                     /locus_tag="TPHA_0E03560"
                     /inference="similar to DNA sequence:INSDC:YCR035C"
                     /note="similar to Saccharomyces cerevisiae RRP43
                     (YCR035C); ancestral locus Anc_1.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685880.1"
                     /db_xref="GeneID:11531168"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8BU68"
                     /translation="MNSIENSVIDVKPLVFPKDVLARISPDLILQRYLSLNLRPSIRS
                     FDEFRDISVSNIDDIENEFADNVLGTNILKCGKTIIITTITASIIKEENQDETFERYY
                     EDISGVERRRNKVSEYGSVYPVVEIERGRGNAPPSDEEMNIGQKLHDNILHSGLISKK
                     SLKVDYGVRITDLETNKSKIIYPEEDEINDVPILQLNHYQKNLKYVLHAKITVFSRTG
                     PLFDLCWNSLTYALQNTKLPKAFIDEKAVSLKTIIRSRGKTTELRENFNIICDTNTRV
                     PLQLNKENIAYASNYGIVDLDYDLIDTEYEEKNNDNDKKTVLLADINTESEEEYINSS
                     ISIITNKYGNLKNIIVLGGTSKISMEILKKSISLSKIRAHDLESKA"
     gene            complement(<755243..>757927)
                     /gene="TPHA0E03570"
                     /locus_tag="TPHA_0E03570"
                     /db_xref="GeneID:11531446"
     mRNA            complement(<755243..>757927)
                     /gene="TPHA0E03570"
                     /locus_tag="TPHA_0E03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685833.1"
                     /db_xref="GeneID:11531446"
     CDS             complement(755243..757927)
                     /gene="TPHA0E03570"
                     /locus_tag="TPHA_0E03570"
                     /inference="similar to DNA sequence:INSDC:YCR037C,YJL198W"
                     /note="similar to Saccharomyces cerevisiae PHO87 (YCR037C)
                     and PHO90 (YJL198W); ancestral locus Anc_1.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685881.1"
                     /db_xref="GeneID:11531446"
                     /db_xref="GOA:G8BU69"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:G8BU69"
                     /translation="MKFSYFLKYNAVPEWQSHYMDYNKLKDLIYSLQTEELHNQDENF
                     KSNEIEKLPSKTNPIKDDVIREETFELSELRSSSSNGKTGSSRKEKINNTLKKYKPSI
                     FDKTDKNDRKNSLTNSSINSLESNSIGSNSHDIFIKALLEDKVKVDDFYKRTETKFYD
                     KLSHLIKDLEKEGIHNLRSVNEQNEEIQTLHSRPNSLTNELRSRFTDTGESAPDINSV
                     DFEEDEDEDDYAEDNNDHTALLNYSQFNVKSQRKSLLKQSIVNLYIDLCQIKSFIELN
                     RIGFSKISKKFDKVLKMNIRAELIESGEFFKDTYVFQDAVLNILNDRIFSLIEFYSII
                     TGQTFDIESCEKELKQSLHDHIVWVRSTTWKDMLGLASQQNIFTGLVAAPDATAKAQK
                     NKLKLEYYSYELKSPINIYKWELSSLKIPKLFFTWKAFKLAFIFTFTAILLGVKTFND
                     PVEHRCMALLECVALLWATEAIPLYATALLVPFLTVLFKVLKNDDGTVKSAAESSSTI
                     LGAMWSSTIVILLAGFTLGEVLAQYDIAKILASWLLAFAGTKPRNVLLMAMSVVFFLS
                     MWISNVAAPVLTYSLLTPLLDDLDSTSPFGKALVLGIALAANLGGMASPISSPQNIIS
                     MEYLAEYGIGWGQFFAISIPTGIISLLLAWGLMCLTFKINTSKIEKFIPIRSKFTLKQ
                     YFIVGMTLATILLWCVESQIESAFGSSGIIALLPIVVFFGSGLLNTNDLNTFPWSIVV
                     LAMGGIALGSAVSSSGLLSTVALALQRKIQNDGTYAILCIFGILMLVIGTFVSHTVSA
                     IIIIPLVQEVGDALSDPKSAPILIFGCCLLSSCGMGLASSGFPNVTAISMVDKKGNRY
                     LSMNTFITRGVPCSLLAFLCVITIGYGIMSTVLKGKTS"
     gene            760849..760921
                     /gene="TPHA0Etrna4T"
                     /locus_tag="TPHA_0Etrna4T"
                     /db_xref="GeneID:11531455"
     tRNA            760849..760921
                     /gene="TPHA0Etrna4T"
                     /locus_tag="TPHA_0Etrna4T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11531455"
     gene            complement(761451..761546)
                     /gene="TPHA0Etrna6K"
                     /locus_tag="TPHA_0Etrna6K"
                     /db_xref="GeneID:11531347"
     tRNA            complement(join(761451..761487,761509..761546))
                     /gene="TPHA0Etrna6K"
                     /locus_tag="TPHA_0Etrna6K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11531347"
     gene            <762426..>764519
                     /gene="TPHA0E03590"
                     /locus_tag="TPHA_0E03590"
                     /db_xref="GeneID:11531456"
     mRNA            <762426..>764519
                     /gene="TPHA0E03590"
                     /locus_tag="TPHA_0E03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685834.1"
                     /db_xref="GeneID:11531456"
     CDS             762426..764519
                     /gene="TPHA0E03590"
                     /locus_tag="TPHA_0E03590"
                     /inference="similar to DNA sequence:INSDC:YJL204C"
                     /note="similar to Saccharomyces cerevisiae RCY1 (YJL204C);
                     ancestral locus Anc_1.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685882.1"
                     /db_xref="GeneID:11531456"
                     /db_xref="GOA:G8BU70"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:G8BU70"
                     /translation="MEGILKVRNIVVEIASDLNPTDYLNFKAVNKNVYNEILSDEVDQ
                     TYWSKRLQLLDLKETQENITDDQFANLTAVDIFDKIVNFNKKQSKHIYIKFYGCFKDY
                     CDKLSNSDLGTLFSAEEENDPVLEAKVLMNIYRFNASNDVEDSYYGKVKEQLDIVKEL
                     FVNSVLKELEKNYKLKNYEEVSKFMGVLFLVKESTVAVDFFNSEFDTEYTISLPDNIF
                     KEINTLIIDNQSLSNLIEDESSADHSMKFKRMKVLNKSLVKESLGKIFEYIFNVVDVV
                     YQVFGDNYDNGRFVVEKYIGYFMDLVDIHFEEKENLMELPKFYKLTNEAIDAVFGEEE
                     YFKKLIKDDIDVHLKSKKEYYLETIPSFFNQQLKDLRTNPVKKEDDKVKKSKDDSLRL
                     ATLFKKKPNDKDEITEQEMPKVDVKSLVNVEYYENVLKLSEQVLDDIDQFGGDKKKIY
                     DIIVKRISVDGIRHEYKGVVGELGRGEIGLVMFTEVVNIWDMIVHKVVVFEGRSEEGR
                     LEMLLDEIVGEGLNIGISKMMREVENILLGVAYNQQQVIDVEATEAAHKVIDLLKQNC
                     FLLKGEAIAEVFQQEIGERLFNELVKLIKRSTISTQGALYLISDLNLYYDFITYKLKQ
                     KNIVPLFAGLKSIGQLFLISTNDSKELGKMIAAGSQGIFSQEEIYEFVQRRSDWFKVK
                     RDVEKAIYGLDCILI"
     gene            <764541..>764948
                     /gene="TPHA0E03595"
                     /locus_tag="TPHA_0E03595"
                     /db_xref="GeneID:11531422"
     mRNA            join(<764541..764603,764659..764820,764919..>764948)
                     /gene="TPHA0E03595"
                     /locus_tag="TPHA_0E03595"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685835.1"
                     /db_xref="GeneID:11531422"
     CDS             join(764541..764603,764659..764820,764919..764948)
                     /gene="TPHA0E03595"
                     /locus_tag="TPHA_0E03595"
                     /note="ancestral locus Anc_1.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685883.1"
                     /db_xref="GeneID:11531422"
                     /db_xref="GOA:G8BUB5"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G8BUB5"
                     /translation="MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLE
                     RVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK"
     misc_feature    764556..765006
                     /note="X region"
     gene            complement(<765003..>765754)
                     /gene="TPHA0E03610"
                     /locus_tag="TPHA_0E03610"
                     /db_xref="GeneID:11531266"
     mRNA            complement(join(<765003..765636,765693..>765754))
                     /gene="TPHA0E03610"
                     /locus_tag="TPHA_0E03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685836.1"
                     /db_xref="GeneID:11531266"
     CDS             complement(join(765003..765636,765693..765754))
                     /gene="TPHA0E03610"
                     /locus_tag="TPHA_0E03610"
                     /inference="similar to DNA sequence:INSDC:YCR039C"
                     /note="similar to Saccharomyces cerevisiae MATALPHA2
                     (YCR039C); ancestral locus Anc_1.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685884.1"
                     /db_xref="GeneID:11531266"
                     /db_xref="GOA:G8BUB6"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8BUB6"
                     /translation="MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLT
                     EADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKE
                     NEIIKYESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLP
                     KKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPE
                     VSALLRDNKTITS"
     misc_feature    765007..766578
                     /note="Yalpha region"
     gene            <766068..>766655
                     /gene="TPHA0E03620"
                     /locus_tag="TPHA_0E03620"
                     /db_xref="GeneID:11531208"
     mRNA            <766068..>766655
                     /gene="TPHA0E03620"
                     /locus_tag="TPHA_0E03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685837.1"
                     /db_xref="GeneID:11531208"
     CDS             766068..766655
                     /gene="TPHA0E03620"
                     /locus_tag="TPHA_0E03620"
                     /inference="similar to DNA sequence:INSDC:YCR040W"
                     /note="similar to Saccharomyces cerevisiae MATALPHA1
                     (YCR040W); ancestral locus Anc_1.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685885.1"
                     /db_xref="GeneID:11531208"
                     /db_xref="GOA:G8BUB7"
                     /db_xref="InterPro:IPR006856"
                     /db_xref="InterPro:IPR017931"
                     /db_xref="UniProtKB/TrEMBL:G8BUB7"
                     /translation="MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQF
                     IAENFKLKIPYPPTCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDD
                     INDDIAYINYSSEEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQ
                     HHVWDVFAQQFNFVKPKCGFVEWVGQTYEREWCTE"
     misc_feature    766579..766790
                     /note="Z region"
     gene            complement(<766656..>768371)
                     /gene="TPHA0E03630"
                     /locus_tag="TPHA_0E03630"
                     /db_xref="GeneID:11531249"
     mRNA            complement(<766656..>768371)
                     /gene="TPHA0E03630"
                     /locus_tag="TPHA_0E03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685838.1"
                     /db_xref="GeneID:11531249"
     CDS             complement(766656..768371)
                     /gene="TPHA0E03630"
                     /locus_tag="TPHA_0E03630"
                     /inference="similar to DNA sequence:INSDC:YLR182W"
                     /note="similar to Saccharomyces cerevisiae SWI6 (YLR182W);
                     ancestral locus Anc_1.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685886.1"
                     /db_xref="GeneID:11531249"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BU74"
                     /translation="MSIVSVSGQFKLHDFTLQRNVDNGYFLLEPVLRLLKTFTYQNVS
                     DDYLLSHYNILVATSADGSKWIPEEKAAQLLEVCDEDGKLKVFFDGLVSKKHDSEIKL
                     DEEFVSEPLKLHQAKEVSFAASEEEQLKLEMFLQKVVGEDQDEKREFYSVLKELDEMY
                     PNVELNFNLKVDEFGNTPLHWLASVGKVDLVESLVKNGANVFIGDDNGQTAIVKAVKC
                     INNYERGTFEKLLHYLFPCLLVVDREGRTIFHHIALASGQPGYSVVSKYYLDVLMGYV
                     VNNQNHVLKELNLKWIIANMLNVCDNNGDTSLNIAAKIGSSSLVETLMDYGTDPSIKN
                     NSGLNALDFKDNKYKECDLVDNISNNMASLGNREPNPETHTKEAQDILNNITSLLGNI
                     KSDYEEEVKKNNKVLALLHEELNEKRTVLAASRESLVEARQGFDQSIILLEQINNLNK
                     YIDMELDKDEVEIEMDDDLNIESLESQEPSSLSIAQLNALNIHNEAQKRYNEQLSRIL
                     EGIEEKQSDLEGKFRRVLSLCLKIEEHKVDAMLDGLLQAISSEDPQDVDTDEMQHFLK
                     KHARI"
     gene            complement(<769962..>773375)
                     /gene="TPHA0E03640"
                     /locus_tag="TPHA_0E03640"
                     /db_xref="GeneID:11531427"
     mRNA            complement(<769962..>773375)
                     /gene="TPHA0E03640"
                     /locus_tag="TPHA_0E03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685839.1"
                     /db_xref="GeneID:11531427"
     CDS             complement(769962..773375)
                     /gene="TPHA0E03640"
                     /locus_tag="TPHA_0E03640"
                     /inference="similar to DNA sequence:INSDC:YCL024W,YDR507C"
                     /note="similar to Saccharomyces cerevisiae KCC4 (YCL024W)
                     and GIN4 (YDR507C); ancestral locus Anc_1.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685887.1"
                     /db_xref="GeneID:11531427"
                     /db_xref="GOA:G8BU75"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BU75"
                     /translation="MLKANISDVTVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQ
                     AAIKIISKSVFDHLVNSNNNNNSALAASDVNNGSVQHNQEALPYGIEREIIIMKLLNH
                     TNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCH
                     ALGIVHRDLKPENILLDHKSNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLP
                     YNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQD
                     LIGKILTVNPKQRIKTREILKHPLLQKYPNIKDSKTIRDLPREDTYLNPLADNNGVDT
                     EIDESILQNLTVLWHGKDKNEIIKKLKEPGANAEKTLYVLLHRFKEDTERENHKNSQL
                     RKRQSLMKASSSSSSNQGNVPRRRKNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVIS
                     LPSSSNTTPASSKRISLSLSSSNKRNSRLYTQSNSSSPTPAPRSRRSSNQNLINKESE
                     APPIPVDVLKDYNKISNQNKRGSRLSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWE
                     FIEKETKRVSSDFATLIDEIFEHEKFEKIRKEKEELERKVIEAKQKEERERKEAEAAA
                     KEEARVRREKELARMNKEEEQLQNDIDEEARLLKDEFNFVNDETQENPINSRSVSEPV
                     KNGGTDEKGQRNFSLQTRPISRLDPGLMFSKLGDVDNNSSVDENLTMNNQKTILETIR
                     RSKFLGSSFDINKELNNANEERKRLRQLQLQKQKELEEKERIASTSYVSNENQVLSKN
                     AIGVVDLKDFSSDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVD
                     MIKENPVEDEDVTEDPGFNFEDSQYDYLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSV
                     SMKLNFADRFSNVNSNTKQESSFEDKFPNILSKSGTEGLGLYSKNEKTEPKPVKSMIP
                     EEDKVNSSPVVEAPLNKVVNKTRAENKSTSKGPSGSQKVSNTSSFLRKISGKSSNSTV
                     AKGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSL
                     RSTIVELCVFTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVLQK"
     gene            complement(<773947..>774264)
                     /gene="TPHA0E03650"
                     /locus_tag="TPHA_0E03650"
                     /db_xref="GeneID:11531164"
     mRNA            complement(<773947..>774264)
                     /gene="TPHA0E03650"
                     /locus_tag="TPHA_0E03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685840.1"
                     /db_xref="GeneID:11531164"
     CDS             complement(773947..774264)
                     /gene="TPHA0E03650"
                     /locus_tag="TPHA_0E03650"
                     /inference="similar to DNA sequence:INSDC:YDR510W"
                     /note="similar to Saccharomyces cerevisiae SMT3 (YDR510W);
                     ancestral locus Anc_1.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685888.1"
                     /db_xref="GeneID:11531164"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BU76"
                     /translation="MSDTGSPVEKKPDINANEGAASATAETHINLKVSDGSSEIFFKI
                     KRTTPLKRLMEAFAKRQGKEMDSLRFLYDGIRLQADQTPEDLDMEDNDIIEAHREQIG
                     GAI"
     gene            <775232..>777175
                     /gene="TPHA0E03660"
                     /locus_tag="TPHA_0E03660"
                     /db_xref="GeneID:11531241"
     mRNA            <775232..>777175
                     /gene="TPHA0E03660"
                     /locus_tag="TPHA_0E03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685841.1"
                     /db_xref="GeneID:11531241"
     CDS             775232..777175
                     /gene="TPHA0E03660"
                     /locus_tag="TPHA_0E03660"
                     /inference="similar to DNA sequence:INSDC:YCL025C,YDR508C"
                     /note="similar to Saccharomyces cerevisiae AGP1 (YCL025C)
                     and GNP1 (YDR508C); ancestral locus Anc_1.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685889.1"
                     /db_xref="GeneID:11531241"
                     /db_xref="GOA:G8BU77"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BU77"
                     /translation="MSNSRNGSSNEHIELQDYKGNSEKNSTTVYIDSNENEVEYLSDK
                     DASTSADYTYKDLNPSDKKKKSNIKRFIDSFKQPIRPNSDYIDAAELDYEQALENGIT
                     TSVSPSAPNLRKLNQLRTPTDANDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTAL
                     KNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAW
                     VYCIQWLTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFF
                     CNCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLV
                     TAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTR
                     LLGSDGSATSASPYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLAR
                     QGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTW
                     CAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIG
                     SGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFDEDLLKE
                     EDFEYRQRLKNGPFWRRVVDFWC"
     gene            complement(<777361..>778851)
                     /gene="TPHA0E03670"
                     /locus_tag="TPHA_0E03670"
                     /db_xref="GeneID:11531277"
     mRNA            complement(<777361..>778851)
                     /gene="TPHA0E03670"
                     /locus_tag="TPHA_0E03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685842.1"
                     /db_xref="GeneID:11531277"
     CDS             complement(777361..778851)
                     /gene="TPHA0E03670"
                     /locus_tag="TPHA_0E03670"
                     /inference="similar to DNA sequence:INSDC:YCL028W"
                     /note="similar to Saccharomyces cerevisiae RNQ1 (YCL028W);
                     ancestral locus Anc_1.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685890.1"
                     /db_xref="GeneID:11531277"
                     /db_xref="UniProtKB/TrEMBL:G8BU78"
                     /translation="MSNQGVDNLISDAENQFNQGNHQEAVASLTNAAGMNPNSDQMSQ
                     IENIIRKIAKYVMGNTDNQHDRGVGDSFLSTLMGNSNGNSQAQLGKLALLTSVMSSGG
                     GPRNNGSNGFNLGSIASMMMSGNNNGNNNSMNTSALSGLASQFFGSSNNNQSQGQGHS
                     YSKLASMASSYFSGSSNNSNNSNMGGNGGYNGNNSHSNNNNANANGYGNNDNKFGNNS
                     NRYGNEDNKYSSSNNNDSYGNNSNSYDDNSNSYGNNSNRYGNDHNKYSGSNNNNSYGD
                     DDNKYSNNNNNNSYGSNSNSYGNNGSSYGNNNNSYGNDDNKYSNSNNGNSYGSNSNSY
                     GNNSNSYGNDDNKYSNSNNGNSYGNNSTNYGNNSNSYGNNENKYSSNDNYDSNTNKYG
                     NNNSNNSQNGNEDGFSKLASMATSYLTQSTSHSSNNSQNNYNGGNSSQSNTFGKLASM
                     ASSYLSGGSQNNNQGQNSNYNNSNNQGNNQNNQNSNNGFSFNGNFA"
     gene            <779557..>780873
                     /gene="TPHA0E03680"
                     /locus_tag="TPHA_0E03680"
                     /db_xref="GeneID:11531278"
     mRNA            <779557..>780873
                     /gene="TPHA0E03680"
                     /locus_tag="TPHA_0E03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685843.1"
                     /db_xref="GeneID:11531278"
     CDS             779557..780873
                     /gene="TPHA0E03680"
                     /locus_tag="TPHA_0E03680"
                     /inference="similar to DNA sequence:INSDC:YCL029C"
                     /note="similar to Saccharomyces cerevisiae BIK1 (YCL029C);
                     ancestral locus Anc_1.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685891.1"
                     /db_xref="GeneID:11531278"
                     /db_xref="GOA:G8BU79"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G8BU79"
                     /translation="MSVNQIQKYQKKIGCFIQIPNVGRGKLKYVGVVDNKPGYYAGID
                     LLANIGKNNGSFQGKKYFETEYPQSGLFIQLQKVSHLIENASLSRRTTLVTDNNHSNT
                     NVMSSGDRSSSVTSDGRINSTGSTIVRSIHNDITVDPTSPTPIGSYHGDSRRGTARLD
                     DLDKMEIDTPVPASAGRRDVVTDKLIKEYEQKIEKQFNQLVQYKKLLDEQRVVLEEMK
                     PTIDIYENNLVSSENEIASLKEQLNKEREENDKQKKYFENEHEQLLRVVDQLHDEIKE
                     NERRVIASKQNMKMSSGHTDETVLRELEELREYKQTNETNKLKWEKERDQLKMHNSSL
                     NKEYQELYKDFSRMESIQRENETLRNKLSELETHTSTQPKTDASENPATQPDDIASLP
                     IYRPAKEVDVTAGRDLWCALCDKQGHTSIDCPYLPVNENAEDDIMY"
     gene            <781473..>783926
                     /gene="TPHA0E03690"
                     /locus_tag="TPHA_0E03690"
                     /db_xref="GeneID:11531177"
     mRNA            <781473..>783926
                     /gene="TPHA0E03690"
                     /locus_tag="TPHA_0E03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685844.1"
                     /db_xref="GeneID:11531177"
     CDS             781473..783926
                     /gene="TPHA0E03690"
                     /locus_tag="TPHA_0E03690"
                     /inference="similar to DNA sequence:INSDC:YCL030C"
                     /note="similar to Saccharomyces cerevisiae HIS4 (YCL030C);
                     ancestral locus Anc_1.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685892.1"
                     /db_xref="GeneID:11531177"
                     /db_xref="GOA:G8BU80"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR002496"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR021130"
                     /db_xref="UniProtKB/TrEMBL:G8BU80"
                     /translation="MVFPILPLYGSNSIDIVNKNRFLLLAGQSLLDCVSFNGQAQIID
                     FVQKFKELKLVSIYLNDLNEFSGDDVVNLLNNGISTVFTKQAVLKESLINEFNVPAER
                     IVLFDSKTSSYPNKFVVVDDFKESRIINAQDISLGLFQDSIINAIRTDRDDKLYTTLV
                     VDEYEKCLGLVYSSLESIKIATEKKIGCYYSRSRNEIWIKGLTSGNTQDLVSIEIDCD
                     GDSLKFVVIQNGNNESAKPSFCHLNTESCFGELNYGLQSLEKTLKDRLINAPEDSYTK
                     RLFNDDDLLNAKIKEEAEELTEAVTSKELSWEAADLFYFAMAKLVKNGVSLRHVENNL
                     KMKHLKITRRRGDAKPKFIQNKKQKVEAKVEGERDLTNKKIYLNVIKSSNKDDVEKAI
                     SRPIQKTSEIMHLVNPIVQNVKEKGDKALLEYTEKFDGIKLSTPVLCAPFPKEYFEGL
                     TQEMKESLDLSMENVRKFHAAQLQTETMVVETQPGVVCSRFSRPIERVGLYIPGGTAI
                     LPSTALMLGVPAKVAKCKEIIFASPPRKSDGKVSPEVVYVASKVGASKIVLAGGAQAV
                     AAMAYGTESVPKVDKILGPGNQFVTAAKMYIQNDTQALCSIDMPAGPSEVLVVCDENA
                     DADFVASDLLSQAEHGVDSQVILVGVNLSEKKILEVQDAVDRQANELPRVDIVRKCIA
                     HSTIILCESYEEAFGMSNKYAPEHLILQIENAQKYVSLVDNAGSIFVGQYTPESCGDY
                     SSGTNHTLPTYGYARQYSGVNTSTFQKFITSQQISPEGLQNIGKAVMCVAKVEGLDGH
                     RNAVKIRMQKLGQLPTDFE"
     gene            <784357..>784755
                     /gene="TPHA0E03700"
                     /locus_tag="TPHA_0E03700"
                     /db_xref="GeneID:11531346"
     mRNA            <784357..>784755
                     /gene="TPHA0E03700"
                     /locus_tag="TPHA_0E03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685845.1"
                     /db_xref="GeneID:11531346"
     CDS             784357..784755
                     /gene="TPHA0E03700"
                     /locus_tag="TPHA_0E03700"
                     /inference="similar to DNA sequence:INSDC:YDR511W"
                     /note="similar to Saccharomyces cerevisiae ACN9 (YDR511W);
                     ancestral locus Anc_1.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685893.1"
                     /db_xref="GeneID:11531346"
                     /db_xref="GOA:G8BU81"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="InterPro:IPR008381"
                     /db_xref="UniProtKB/TrEMBL:G8BU81"
                     /translation="MRATTRLLISNNAILLQAARKAKTAVQPLLPPLQLYRRILREHR
                     HLPPLQRELGDQYVKNEFKLHKNTDNPLHIVGFLTSWQDYLHTITKGEWEEERVSAQV
                     LEKLSSDQVVQLYELMKEADALSKGTSTTE"
     gene            <785265..>786221
                     /gene="TPHA0E03710"
                     /locus_tag="TPHA_0E03710"
                     /db_xref="GeneID:11531407"
     mRNA            <785265..>786221
                     /gene="TPHA0E03710"
                     /locus_tag="TPHA_0E03710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685846.1"
                     /db_xref="GeneID:11531407"
     CDS             785265..786221
                     /gene="TPHA0E03710"
                     /locus_tag="TPHA_0E03710"
                     /inference="similar to DNA sequence:INSDC:YCL031C"
                     /note="similar to Saccharomyces cerevisiae RRP7 (YCL031C);
                     ancestral locus Anc_1.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685894.1"
                     /db_xref="GeneID:11531407"
                     /db_xref="InterPro:IPR024326"
                     /db_xref="UniProtKB/TrEMBL:G8BU82"
                     /translation="MSESAKFHYVKTMKSGFLVVPFKLPKHRALKKDAGLNNNSFHYV
                     YIKKHVNKDNEEEKNCLFAINLPILSNTEFIKKVFNDICSKNDTIAYIEKLLQYDEFG
                     LEEIDLSSLTSDLMSNKSSEDEQAKMNENRYTPRNTCLIKFVDESSLENCYSSIKKYC
                     DLIQKKKEKANFIEWEYVSPSITTFINFYKPIDIDYLKEDISLHMKIFEERENTAREE
                     AQSSIVDEDGFTLVVGKNTKSLNSIKKKILNKNPLLKHKTKAKQGNSMVDKKVKQDFY
                     RFQVRERKKQEINELLSKFKDDQERIKVMKAKKKFNPYNNSL"
     gene            complement(<786291..>787241)
                     /gene="TPHA0E03720"
                     /locus_tag="TPHA_0E03720"
                     /db_xref="GeneID:11531182"
     mRNA            complement(<786291..>787241)
                     /gene="TPHA0E03720"
                     /locus_tag="TPHA_0E03720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685847.1"
                     /db_xref="GeneID:11531182"
     CDS             complement(786291..787241)
                     /gene="TPHA0E03720"
                     /locus_tag="TPHA_0E03720"
                     /inference="similar to DNA sequence:INSDC:YCL034W"
                     /note="similar to Saccharomyces cerevisiae LSB5 (YCL034W);
                     ancestral locus Anc_1.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685895.1"
                     /db_xref="GeneID:11531182"
                     /db_xref="GOA:G8BU83"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="UniProtKB/TrEMBL:G8BU83"
                     /translation="MGFLSDHQHTEISDYLEDLVSQDDNSTVFARKTVKLIRLIDDTR
                     DDGLYLENQKEAARKIRKLLKYNDNVSVKKRCFNLLSEFIIYNNCKFRELYNDQKLLL
                     AIQTTISANSKKIKFFTNCFLEWIKFINDGKNSSSSTYRGLVELYRQFKSKSSGNRRV
                     FDLQKESPKIRLLVGDSLSTSIALKNRLLQLRPGQTSVDDKDSTDLFVKCRELRRAVL
                     KYIQFVQEGELLGSLVHANDELVNSLKKYDELSGLDEVNNYDSATSESSYYETDEEDY
                     DDIQPLSSRETSNASRAAPQNVNKQNSRDYDPFGDHNGIF"
     gene            <787911..>788231
                     /gene="TPHA0E03730"
                     /locus_tag="TPHA_0E03730"
                     /db_xref="GeneID:11531183"
     mRNA            <787911..>788231
                     /gene="TPHA0E03730"
                     /locus_tag="TPHA_0E03730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685848.1"
                     /db_xref="GeneID:11531183"
     CDS             787911..788231
                     /gene="TPHA0E03730"
                     /locus_tag="TPHA_0E03730"
                     /inference="similar to DNA sequence:INSDC:YCL035C,YDR513W"
                     /note="similar to Saccharomyces cerevisiae GRX1 (YCL035C)
                     and GRX2 (YDR513W); ancestral locus Anc_1.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685896.1"
                     /db_xref="GeneID:11531183"
                     /db_xref="GOA:G8BU84"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:G8BU84"
                     /translation="MSEKTILEVQKMIDEKPVFIATKSYCNESNAAKGTLFDEYSILD
                     DEATVLELDKMSDGEAVLFALSKISQQSTLPNIFIKGKHIGGYQDLKEMNESGELEKL
                     LDSI"
     gene            complement(<788354..>789853)
                     /gene="TPHA0E03740"
                     /locus_tag="TPHA_0E03740"
                     /db_xref="GeneID:11531139"
     mRNA            complement(<788354..>789853)
                     /gene="TPHA0E03740"
                     /locus_tag="TPHA_0E03740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685849.1"
                     /db_xref="GeneID:11531139"
     CDS             complement(788354..789853)
                     /gene="TPHA0E03740"
                     /locus_tag="TPHA_0E03740"
                     /inference="similar to DNA sequence:INSDC:YCL036W,YDR514C"
                     /note="similar to Saccharomyces cerevisiae GFD2 (YCL036W)
                     and YDR514C; ancestral locus Anc_1.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685897.1"
                     /db_xref="GeneID:11531139"
                     /db_xref="GOA:G8BU85"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G8BU85"
                     /translation="MVAIRIARAHRVTMKRSFDKIESFGSHINSRSYVDGRNSPHRDR
                     NVKEVSSVVVRNLPARLKTGINFYKKSLSSLLNSNASSSDVNWADSIEYYQGIKNIVY
                     VPNERDIQQVKEYINEISKKYAASNKDSSQALYSKLNALSEKYINENPNLDAGYFSIV
                     PGSSSASIDNAVKKEFDFKVKDIKNSHFPTIFCPPKSTNFEYISNSLQLVNEKKTILF
                     SIDIEAYEFDSNVITEIGITIYDPRENYQQPTIFPVFQKYHIIIEESLFLKNKKFVCD
                     FKDCYLHGESYVLKLVEAKNFIQNLINFYLKSSNEADRTWERALVGHNVKGDLNWLKN
                     IGIKLPELDFTLTEKDNSDAVHVLDTQIFYQHNFYDKYSSLGKILKLFNISHSFLHNA
                     GNDSYYTLKALIYMNDINFRRNQRLDDIESVQKNIIQLMERDKTEKRIIPMSYNVLIK
                     EVQEEKNTVSHKHQHKKQNAKRLIHQTEFNGIVWFNKGIDAFKYSIGQR"
     gene            <790322..>791563
                     /gene="TPHA0E03750"
                     /locus_tag="TPHA_0E03750"
                     /db_xref="GeneID:11531437"
     mRNA            <790322..>791563
                     /gene="TPHA0E03750"
                     /locus_tag="TPHA_0E03750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685850.1"
                     /db_xref="GeneID:11531437"
     CDS             790322..791563
                     /gene="TPHA0E03750"
                     /locus_tag="TPHA_0E03750"
                     /inference="similar to DNA sequence:INSDC:YCL037C,YDR515W"
                     /note="similar to Saccharomyces cerevisiae SRO9 (YCL037C)
                     and SLF1 (YDR515W); ancestral locus Anc_1.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685898.1"
                     /db_xref="GeneID:11531437"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:G8BU86"
                     /translation="MSDSKEDIENVVKSEVEKEDSQIPIQESKSFILAPKPSQSPWKN
                     GEVDGTNIPEQVISIEHTQSKSVGKYKKKHRGKKSNSVIKINSNTKWEAIQPVIVVAD
                     EVGNKTSNSNNSNSNNGKKSSRRRSKKKKPSTTDEGKDKESSKQNEDQQHSANGNKSN
                     ANMKQTSSKKNNNRKKTNKKKHQDSSNVNKKSEPDSKSYKDTESKKHNNNHNRNLYHG
                     DHQNTDQRTYYSLKPIIDSVNAVAHQIEYYLSKENLEKDTYLMPKLSKDGYISMYPLS
                     KFFRLVNLSFGGNISILLAALREIVVNENATITVSSGAFLDLNIEDSENILRQFFLRG
                     KDWESYKGDIVNNKEESSYIIEKELSGNDLDQYMIFNVKGSNHRRSVDANHEGKENAN
                     ATNTEEPKAEPEMETEKEDVN"
     gene            complement(<791726..>794116)
                     /gene="TPHA0E03760"
                     /locus_tag="TPHA_0E03760"
                     /db_xref="GeneID:11531480"
     mRNA            complement(<791726..>794116)
                     /gene="TPHA0E03760"
                     /locus_tag="TPHA_0E03760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685851.1"
                     /db_xref="GeneID:11531480"
     CDS             complement(791726..794116)
                     /gene="TPHA0E03760"
                     /locus_tag="TPHA_0E03760"
                     /inference="similar to DNA sequence:INSDC:YCL039W"
                     /note="similar to Saccharomyces cerevisiae GID7 (YCL039W);
                     ancestral locus Anc_1.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685899.1"
                     /db_xref="GeneID:11531480"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BU87"
                     /translation="MSISFEGDADGVDDKIFMPTYNSKRRRSKVSSKPPLKTLTDESV
                     NPVMNETVGNVFDKVQLTKLLINTLNEMGFSDTAIALEKESGGVRVESSNVHQLIRLL
                     ESGKYEYIDLEILSRLPLNNKTSILNQYVKDKPQELSDRDEVIDMENVNYSQTLKVMN
                     DNTDQLKIIVDDLVKDYNLNTSDSFWSDLIYLRGIVEILVLLSRQIFLELVLDIEDIS
                     TAVTFLRTIVRNLIKIWETLLLVKDKAIIMIEEGDTSEFTPDNILKEMTITLTSSNIV
                     KGDPRSAWRGSKENSRKNTVELISCYIDPEDLVPKDRLITLLKQAIKFQRSQDVLNII
                     DEEYDEKNIGNRRIINLLQDSSESYNNLKFEEYKTLKYSVDEIWYLQFSPDGKYLASS
                     SANSLYDRKIILYDVENDFKTFKVLGGNDQCILYLSFSPDSRYIVSCPFSEKANVYDL
                     HKKGSSIEIEDEVHTLMTTTLLQPIHSFQITAPATVSTSPLNATIPSHLVDNGNDSGS
                     NNHASNNSTPRSSNSENSIANVNANPPRIWCCDWFHTPSQQGRFVIGSPDREVVFYDI
                     NEGRILFRMSGTSSIRVKDVANYIIQPQLEKFPRVHDIKITEDDKNLILMTHQGHLEV
                     YDLSKFPKKSSFSSMDSVSLFETFSLTRINRVNIEKKMTCISLPQITGSYDQVSSLVL
                     VSLQCNELQLWDFKESILIQKFYGQKQEQFIIRSCFGYNNNLVASGSEDGKVYVWDRI
                     NGNIVGVLSGHVEHSEYGSKKIEKNCNVVSWNPTNKTQFASGGDDGYIKIWRVIKD"
     gene            complement(<794493..>796118)
                     /gene="TPHA0E03770"
                     /locus_tag="TPHA_0E03770"
                     /db_xref="GeneID:11531240"
     mRNA            complement(<794493..>796118)
                     /gene="TPHA0E03770"
                     /locus_tag="TPHA_0E03770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685852.1"
                     /db_xref="GeneID:11531240"
     CDS             complement(794493..796118)
                     /gene="TPHA0E03770"
                     /locus_tag="TPHA_0E03770"
                     /inference="similar to DNA sequence:INSDC:YCL040W,YDR516C"
                     /note="similar to Saccharomyces cerevisiae GLK1 (YCL040W)
                     and EMI2 (YDR516C); ancestral locus Anc_1.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685900.1"
                     /db_xref="GeneID:11531240"
                     /db_xref="GOA:G8BU88"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:G8BU88"
                     /translation="MYGYISIYICISNATMVDQYCRSGWLVISLKIDGHWDVMTDNMI
                     FKDENEGDDLLAAAVKGICDQFVVTQGQLIAMTNYFIDQMNSGLNEEIGSGLPMIPSF
                     VTALPTGEEQGIVLTAELGGTNFTVSKVTLKGRNQYSIDQMKTRIPDYLFQNYSATSR
                     DLFTFLVKQVDEFMRSHLGDVFTADRKHDQSFKMGFIFSYPVKQTSLDTAELIRWTKR
                     LNIKDTVGKDVIQLFQDELDNQGLNMVNVMALTNDTICTFLSLCYSTRTTDLSAGRDN
                     KIQGDISGPVIGCVFGTGTNGCYKESINNIVKLPRDIKQMLLNMGNTEMLINTEWGSF
                     DNETKILPTSKYDISIDKKYSRNPGYNLFEKRVSGMFLGEILRNILIDLYSRGLMFQQ
                     YASYDVLPHQLRTPFQISCQVMASIEIDDTIGLRASEMSLLQSLRILTTPTERAHIQT
                     LTRIISRRAAYLAAVPIAAIIIKTGALEKKYNGEVDVSCEGSIIKYYPGFKTMMRQAL
                     ALTPLGTDGERRIHLKILEDSPSVGAALCALMA"
     gene            <796798..>797991
                     /gene="TPHA0E03780"
                     /locus_tag="TPHA_0E03780"
                     /db_xref="GeneID:11531501"
     mRNA            <796798..>797991
                     /gene="TPHA0E03780"
                     /locus_tag="TPHA_0E03780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685853.1"
                     /db_xref="GeneID:11531501"
     CDS             796798..797991
                     /gene="TPHA0E03780"
                     /locus_tag="TPHA_0E03780"
                     /inference="similar to DNA sequence:INSDC:YDR517W"
                     /note="similar to Saccharomyces cerevisiae GRH1 (YDR517W);
                     ancestral locus Anc_1.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685901.1"
                     /db_xref="GeneID:11531501"
                     /db_xref="InterPro:IPR007583"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="UniProtKB/TrEMBL:G8BU89"
                     /translation="MFRIAKNLVKTLEQSVQDTLALSSSTSEIDAFFHSIPPALLLPQ
                     MQEQSGYSPEDAGSASVRSNVNESLSGLRIVFVHETQLQLQSYFDFIVGINDEPVPVI
                     INQHGYSYPDYNRIVELLNEKCNNYVKLNIWSGKGGNYRDEYVSVQYKDESQLEDVSL
                     AAVEDNQAANKKFQSLGFKVQWSPLIAATFVYHILNINLPNGPAEQAGLIPDEDYIIG
                     CQDGLLATGGETLLQDIVKSRANHELILYVYNKIHDCVRPITVNIGGDGRLGCNVGYG
                     FLHRIPTVAPSHTTGTATTATTTAPPPAIEPPAIEPPAQLSEEAFTPQVALPTAGKKR
                     TKTKHTTGLVDTDYFNEGKDTAPPSSTNSKADVPPPQQASRHNNKHTHAHLQYICIHI
                     FIYII"
     gene            <798300..>800000
                     /gene="TPHA0E03790"
                     /locus_tag="TPHA_0E03790"
                     /db_xref="GeneID:11531502"
     mRNA            <798300..>800000
                     /gene="TPHA0E03790"
                     /locus_tag="TPHA_0E03790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685854.1"
                     /db_xref="GeneID:11531502"
     CDS             798300..800000
                     /gene="TPHA0E03790"
                     /locus_tag="TPHA_0E03790"
                     /inference="similar to DNA sequence:INSDC:YCL043C,YDR518W"
                     /note="similar to Saccharomyces cerevisiae PDI1 (YCL043C)
                     and EUG1 (YDR518W); ancestral locus Anc_1.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685902.1"
                     /db_xref="GeneID:11531502"
                     /db_xref="GOA:G8BU90"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8BU90"
                     /translation="MVSINSLLLVAGLSGNVFGAAAVARDAKASSSDKIEQLNATNFD
                     QIVGSKRFFVAEFYAPWCLHSKNIKERLAAAADRLLPRDIVFGQIDCTENKEVCDKYE
                     IDAYPTLKIFKDSNLTHPIAWEGSTNVDGLVAYALRKDTVPVTVVDSESVLQDILRNS
                     GKPVVVKNANGKFDEQFENIAKQRMDSITFVSFPREKDATFSLYINKGKNANGSPDIK
                     EISNLENLEYFINDEQNFVKWITQETLPAFGNLTASTHSVYASLSVPIAYYMYNRDED
                     ATDDIIPFMKELGETYRGKVNIVGVDVRQYSKPIETLGVLPQYPLFAIHDVRKNRRYV
                     LPQLAEEEFKNLEEPVKLSQIHMKQLLENFTKGEAKPMERSEEVPAKQDSDVYHLVGS
                     THDKFVFDEKRDILVRYYAPWCNISAKIEPLFNRAAQIFNEDASLKDKLALADINAFD
                     NDVLSVDIEQFPTLVLFPAGNNTKPVFFEGGKSIESIMAFVENSSTHKIPGKQMFAAY
                     RQRVLDEQNKKESAEKAKKASEEQAKKTSEEQAKKTSEEQAKKNDQQQQQQQAVHDEL
                     "
     gene            <800489..>801715
                     /gene="TPHA0E03800"
                     /locus_tag="TPHA_0E03800"
                     /db_xref="GeneID:11531195"
     mRNA            <800489..>801715
                     /gene="TPHA0E03800"
                     /locus_tag="TPHA_0E03800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685855.1"
                     /db_xref="GeneID:11531195"
     CDS             800489..801715
                     /gene="TPHA0E03800"
                     /locus_tag="TPHA_0E03800"
                     /inference="similar to DNA sequence:INSDC:YCL044C"
                     /note="similar to Saccharomyces cerevisiae MGR1 (YCL044C);
                     ancestral locus Anc_1.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685903.1"
                     /db_xref="GeneID:11531195"
                     /db_xref="InterPro:IPR013911"
                     /db_xref="UniProtKB/TrEMBL:G8BU91"
                     /translation="MTLYTPPDKNQKDKGDAAKNVDSSNEPLKLYPRPSLGLKMWGPL
                     VPASDNRVGLWSLVGAQTLIGLFFLRRGWTIRKNVNMRNLATGVSPAFKTDISNIPTL
                     NRFSNGPVATGTATTKPSIFASILTRFIKRQPTGSRFGARYGYQNQQSWQGFRSFASL
                     LYLFVGALVISQSTLEIMRLVLLKYDPWYDEAKSAREKKFFNDIVKYYHEGIDPTKIK
                     VKDASSGTALSTNSPQVRQSVALVRAQAENESILTKWFGPVYFKPMSFNDFLDKLEYN
                     LDIQDKIDDKKKSKLISKSIQRKLRHTPDELHNLKVINEENRKKTLQLLDLNRGIGES
                     DHQGQKSEHPPRGIIMDDALTSPEEVDLGEMWYLYNPWMNLALDTSLSIKFLPTVVMD
                     TDDKDSKSDGNDQKNY"
     gene            <802496..>804727
                     /gene="TPHA0E03810"
                     /locus_tag="TPHA_0E03810"
                     /db_xref="GeneID:11531210"
     mRNA            <802496..>804727
                     /gene="TPHA0E03810"
                     /locus_tag="TPHA_0E03810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685856.1"
                     /db_xref="GeneID:11531210"
     CDS             802496..804727
                     /gene="TPHA0E03810"
                     /locus_tag="TPHA_0E03810"
                     /inference="similar to DNA sequence:INSDC:YCL045C"
                     /note="similar to Saccharomyces cerevisiae YCL045C;
                     ancestral locus Anc_1.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685904.1"
                     /db_xref="GeneID:11531210"
                     /db_xref="GOA:G8BU92"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:G8BU92"
                     /translation="MSMKLFVSSVLVLINAICVQCVYMDEAYLTDWHLANIGEYRCVF
                     DSQKKDKLIILSEIDEGTVITYLNKTDGTPTVRQKLSSVVDDVLRYGDNDIYFKSGND
                     YIKFNDEAGLDYDVVTKNLTSLNSICSPNSQNIKMDKNNIRVIDTDSNLELMNVKLPN
                     NFTSFVYATTDGIENLSVLFTTGELKYMFQNYKNGNITESWERNESLTDIVAHAYVTL
                     PDLELLQTSDEILAEYTLSNPIFAYLHRIKNNINRIISFIRMNRLSPGTILTNILFSD
                     TVDGSETIKTKQNFKFGFSKLLIVGTKRGQISALDILNGKPLWNLHPLDKKIVSIEWN
                     SSSKEFIVVYETGQYFAYKLTDFYAPIQSFNGSLKSQVRSINLLDDSSTLYVNYKSGD
                     KEIVSLSKSDDLLQNKVIFITDHNERGLSGHMQNSTDKIMNTWKIDIPKNEKLVAYAK
                     RIDEPIANIGVVTGNRTVLYKYLYPNLVSYAVVDKETKSLYIDIVDSVTGSVLYTQKH
                     DDSVNDKLPINMVFGEHWIVYSYFSSNPIPEQKLVVIELYDSLSLDVRVSDPNKTYNP
                     LDGIYKPKVITKSYFFPEIIKSLQLSKTKFNIASKAILIETQDGQMSYIPKYIVGARR
                     KEEKLMTDDDKKEFMAAPYNSNIPSNDHFVITHSRQLLMGNESIISSVATNLESTSIV
                     CNLGHDIFCTKIYPSSQFDIMNPTFEKGKLLLTIVIMSLVLFFIRPRMTIKQLKTKWM
                     VRD"
     gene            <805014..>805811
                     /gene="TPHA0E03820"
                     /locus_tag="TPHA_0E03820"
                     /db_xref="GeneID:11531188"
     mRNA            <805014..>805811
                     /gene="TPHA0E03820"
                     /locus_tag="TPHA_0E03820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685857.1"
                     /db_xref="GeneID:11531188"
     CDS             805014..805811
                     /gene="TPHA0E03820"
                     /locus_tag="TPHA_0E03820"
                     /inference="similar to DNA sequence:INSDC:YCL047C"
                     /note="similar to Saccharomyces cerevisiae YCL047C;
                     ancestral locus Anc_1.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685905.1"
                     /db_xref="GeneID:11531188"
                     /db_xref="GOA:G8BU93"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BU93"
                     /translation="MDILKLQLVEKYKSFIDSNQDFKVVYGDNLLDSQNDVILVLDSS
                     FNPPHMGHYSLAKRSIEYFKEHHKNSKVSLLLLLSVKNADKVPTPASFEERLYMMCLL
                     NDFIKKDGIKVSVGLTTHAKFVDKSDAIRRACSFENQIAYLVGFDTITRIFDPRYYKP
                     DAPADALQEFMKTTQFCCLTRDNGSIPSEEQLNYASDISSGKFEPLIPSHWGSKIHIL
                     DNDSKYTKISSSDIRNKLHNISRVKELNDELPLTIMEYLEVFGKSIY"
     gene            complement(<805860..>808328)
                     /gene="TPHA0E03830"
                     /locus_tag="TPHA_0E03830"
                     /db_xref="GeneID:11531508"
     mRNA            complement(<805860..>808328)
                     /gene="TPHA0E03830"
                     /locus_tag="TPHA_0E03830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685858.1"
                     /db_xref="GeneID:11531508"
     CDS             complement(805860..808328)
                     /gene="TPHA0E03830"
                     /locus_tag="TPHA_0E03830"
                     /inference="similar to DNA sequence:INSDC:YDR520C"
                     /note="similar to Saccharomyces cerevisiae YDR520C;
                     ancestral locus Anc_1.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685906.1"
                     /db_xref="GeneID:11531508"
                     /db_xref="GOA:G8BU94"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BU94"
                     /translation="MEKGTQKVIDTDSSGKGNETTASGPKFGDENLIEVIGLSDGEKS
                     NSQVETIQAAATEEVPEKNKQLQEQNSNAKRSLSVNLEDTDNEVDTMVHNISGNENSR
                     KFRKKRRTFSCDTCRKFKTRCDFEPLVGKCHRCNMLQINCSLTTEREHEILDAIEHSS
                     KILLTSNNSSTDLLNANTFSSNGIGKPKNDTIAVANPLSQTLNNRLNRMEEKFSSLES
                     KLELILMQLQGSSNAEYTAKHMLPAKSKNDKNYYTRKDANIANSNGHEASNNTDNSNY
                     VLHISNSMKEETFNGIHLKEPPLKLINAIDERLFPSEAKSDKEKIEQQQRPYVVARVN
                     FLQFYKKNANLCHRLVRDFLVRSHFWIIPGGIKEIDEDYAHKHLFITSVFTIIAMSFD
                     DDEKYAEKQETLYPLVERLLTNTLTMFEELTDFDIEAILYCCMFHISRKSRRHRQLKF
                     NSLVLSNFAISSMLNVIDFHEIKERVLKKDKFDAKDLYHLRILNSLTVCKLEYSISYG
                     NVSPLDRMLMEFNNLTAKFPQANFGDDIKISELNLGDTVNSIYLNFKTYFKITKEKFE
                     EMHTNSDDATEPIVNIQFIFPELEDWLNNWEELLSKDGGGVLLFTYDFYHIMICRSFI
                     SEFFNEMKNSKLFLTCILSTMREHAYSLLNGFLRLPPSLIRGAPIFTMHQLVYACLTL
                     CDFLHWFMPDERQHILNICSRIYWHLNTIGEKMNDATDNVGKIIKSIIDTSRTKTNLT
                     SLTNSTIPNGNLATNLPNGQFTVNKIELGNKIQTTPARFNINERQSIPDVDQFNSFED
                     FFQDFFDNLKPTTQRIFTSNKNSK"
     gene            complement(<808740..>810215)
                     /gene="TPHA0E03840"
                     /locus_tag="TPHA_0E03840"
                     /db_xref="GeneID:11531509"
     mRNA            complement(<808740..>810215)
                     /gene="TPHA0E03840"
                     /locus_tag="TPHA_0E03840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685859.1"
                     /db_xref="GeneID:11531509"
     CDS             complement(808740..810215)
                     /gene="TPHA0E03840"
                     /locus_tag="TPHA_0E03840"
                     /inference="similar to DNA sequence:INSDC:YCL048W,YDR522C"
                     /note="similar to Saccharomyces cerevisiae SPS22 (YCL048W)
                     and SPS2 (YDR522C); ancestral locus Anc_1.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685907.1"
                     /db_xref="GeneID:11531509"
                     /db_xref="UniProtKB/TrEMBL:G8BU95"
                     /translation="MNLLILLLISFATASYIHHPDRYNMVQQGSFKSHNVKPGSIIWI
                     QKRDLLSLGDQKFQLLNNELLMQKQDPFEKVSYEKSTPVLEQCRKDSYVIESKQELYA
                     LQNACQKLMGSIHISNYDSSDVDFGNIEEIEGSIQIEENSNIVNINAPHLKKIKDTFV
                     LQSLTSLVSLNIPELVSVKVIDWKVVPILNYVQLNKEITEIESITISDTSLSYIDGFD
                     NIEKISTFNINNNRFLETIKTNLKEVTEQFTIHANSRELELEMPELQYAKNITVRDTS
                     KVSFPKLEKVTSSMEFIENIFTDLEIPTLTSVGGTVGIIDNPNLSNVDLSGITFINGG
                     LMVTKNDKLTNLSFLPKLKQIGGAIHFEGKFQETDFPDLKLVKGSAYINSNSDQLDCD
                     TWTTPVSGRSIIRGGKIECISGKKQKSLSVNEDGEVIKGSEKSTNNDEKDKSKDSGES
                     SGKKPGYFSRIKNDSTSYSNQFSYFHLAVSVIFCSSMLLHI"
     gene            complement(<810694..>812142)
                     /gene="TPHA0E03850"
                     /locus_tag="TPHA_0E03850"
                     /db_xref="GeneID:11531498"
     mRNA            complement(<810694..>812142)
                     /gene="TPHA0E03850"
                     /locus_tag="TPHA_0E03850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685860.1"
                     /db_xref="GeneID:11531498"
     CDS             complement(810694..812142)
                     /gene="TPHA0E03850"
                     /locus_tag="TPHA_0E03850"
                     /inference="similar to DNA sequence:INSDC:YDR523C"
                     /note="similar to Saccharomyces cerevisiae SPS1 (YDR523C);
                     ancestral locus Anc_1.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685908.1"
                     /db_xref="GeneID:11531498"
                     /db_xref="GOA:G8BU96"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BU96"
                     /translation="MTNSVFEKVNPLTRYTIQDCVGRGNFGDVYKAIDKNESKVVAIK
                     IVNLENTDEDIELLTQEIFFLSELKSPFITNYITTLTEDVTMWIVMEYCGGGSCADLI
                     KMVYSKGIPESKVSYILRDTVKGLKYLHDQKKIHRDIKAANILLTDCGKVKLGDFGVS
                     GQIRATMKRGTFVGTPYWMAPEVINKQCKGYNEKADIWSLGITAYELLKGVPPLSKYD
                     PFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIKDPKQRPSIEALLETDFLLPNTVLN
                     LKEDVDLIKSIKLKNNYSKTPKYQLNQKIYDGSENIMSWNFDVSENNNSIQEIYENNI
                     QTTEAATLQKMSELEKSPTTPTLDMRTSKPSSQLETPMTNISERSFRRLDKTKNNIVA
                     GKITNTNDSKTSSEKNLFDLKEFDYLKNVINYSFTRMHERAKDEETKYYVDGIMSNFT
                     KTESQVPGFSEVFIEEISLRMTSIKEYIASRQ"
     gene            <813205..>814629
                     /gene="TPHA0E03860"
                     /locus_tag="TPHA_0E03860"
                     /db_xref="GeneID:11531224"
     mRNA            <813205..>814629
                     /gene="TPHA0E03860"
                     /locus_tag="TPHA_0E03860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685861.1"
                     /db_xref="GeneID:11531224"
     CDS             813205..814629
                     /gene="TPHA0E03860"
                     /locus_tag="TPHA_0E03860"
                     /inference="similar to DNA sequence:INSDC:YDR527W"
                     /note="similar to Saccharomyces cerevisiae RBA50
                     (YDR527W); ancestral locus Anc_1.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685909.1"
                     /db_xref="GeneID:11531224"
                     /db_xref="InterPro:IPR013929"
                     /db_xref="InterPro:IPR013930"
                     /db_xref="UniProtKB/TrEMBL:G8BU97"
                     /translation="MDLLGEIVEKNLDDDHAVGDVQMSKQNANNGGFPELYKPEKISS
                     WRQRLKAKGQRAWQNAAGSPSEQKLTYAEKVAANEIKGEDKPVSEVKSIHDENINRLK
                     NMNDEEIMRERMELFESLDPKLIQKLLKNMNKRSMTEDGTPIFAEIEGAPGTWVGGTN
                     DLHNLPTLSGKSVEEALGTGHKQHSVSEIKPTKVEKQEDVQDYNEDDDNELLYEDEVD
                     DIAPLDFQLAQNIDHMTNEELMSDVHFVREVKNDSINKDNEKLFEKLDINDPEFNSKL
                     HEKYFPDLPKDISKLKWMESVTKTEDGEEIGESSSVIEDVTQLRFDFKGNLIPPSRKI
                     ENTTQSALHHHSQDPQLAGYTIPELARLTRSTFPQQRSISIQVLGRILYKLGKQSYYQ
                     LIPEIDQETYQEHGSTQGVINKIYSMIWDLCKDCQVIESLEDAADERKTSHLTVRNYA
                     IEALWLWKNGGGDFRAKHTETKTD"
     gene            <815023..>816321
                     /gene="TPHA0E03870"
                     /locus_tag="TPHA_0E03870"
                     /db_xref="GeneID:11531233"
     mRNA            <815023..>816321
                     /gene="TPHA0E03870"
                     /locus_tag="TPHA_0E03870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685862.1"
                     /db_xref="GeneID:11531233"
     CDS             815023..816321
                     /gene="TPHA0E03870"
                     /locus_tag="TPHA_0E03870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685910.1"
                     /db_xref="GeneID:11531233"
                     /db_xref="GOA:G8BU98"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:G8BU98"
                     /translation="MSSDFNGNKSSVVIETQELDVEVESNIEDSSNRSFPSFDREERS
                     VNKSVSEDDFEDDCEIEEDKSNILRKFTSESLKPNIGLVILALAFFCNSLMIVSTKVL
                     VTNPERSSEERIKPLQILLVRMVLTYIGTLIYMYLNRATIPNVPFGPPEVRKWLLLRG
                     ACGFFGVFGMYFSLMYLCLSDALIITFLSPSVTIILAWVVLRENLTKYEVTSSLISLL
                     GVVLIIRPEFIFGSRGMSSDGNDLSVVSSDPHERLIASLVGLAGVFGASIVYIVIRFI
                     GNKAHAIMSVSYFSMVTAVISLIGIIIIPSMTFQIPSSLKEWLLFANLGVCGFFFQLL
                     LTLGIQKEKAGRGTLMQYTQIIYAIFWDVLLWDVWPNIWSWGGMVLIIGSTLFMFILK
                     KSVSKSEQALNDSEGRNLQLSRGTASHPDNDELELQNLSD"
     gene            <816767..>817951
                     /gene="TPHA0E03880"
                     /locus_tag="TPHA_0E03880"
                     /db_xref="GeneID:11531383"
     mRNA            <816767..>817951
                     /gene="TPHA0E03880"
                     /locus_tag="TPHA_0E03880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685863.1"
                     /db_xref="GeneID:11531383"
     CDS             816767..817951
                     /gene="TPHA0E03880"
                     /locus_tag="TPHA_0E03880"
                     /inference="similar to DNA sequence:INSDC:YDR532C"
                     /note="similar to Saccharomyces cerevisiae YDR532C;
                     ancestral locus Anc_1.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685911.1"
                     /db_xref="GeneID:11531383"
                     /db_xref="UniProtKB/TrEMBL:G8BU99"
                     /translation="MEVRPVTTFKNELRNIEETVTQASTEVLNEQEQRYQTTINEITQ
                     SIVSVSNGQDFIKLYKGDQQLSDVIDENESLVIDPRNLKDNLLKVNKLVELLKLTYLE
                     KDTLDYFLRYTLTSTNLLALESEDDPKFLELQKQVASMEQNALIDKLQSVENAKEEIL
                     NKNKELSMKQDQINNMYLDTTGIIDDCWEMLDELETLKRLQNENTISNKDAAPDNKVE
                     KDNDAEIIKETYEEWQTLKMVKSLENKLNSELAQVQQIRDEKNLNSDMKSKGNFDTNE
                     VLTVQGETLTKLIRLWNNYFLPSSNLPNSEEKTQSKLRLEIFPQTRKFQFNLSNKYVV
                     VFELNDDVKNSVKDIRFFEKNADSMVENFKLRSEYLNKFNKPISNHEIFWVMEDILRN
                     VI"
     gene            complement(<818046..>819203)
                     /gene="TPHA0E03890"
                     /locus_tag="TPHA_0E03890"
                     /db_xref="GeneID:11531384"
     mRNA            complement(<818046..>819203)
                     /gene="TPHA0E03890"
                     /locus_tag="TPHA_0E03890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685864.1"
                     /db_xref="GeneID:11531384"
     CDS             complement(818046..819203)
                     /gene="TPHA0E03890"
                     /locus_tag="TPHA_0E03890"
                     /inference="similar to DNA sequence:INSDC:YDR531W"
                     /note="similar to Saccharomyces cerevisiae YDR531W;
                     ancestral locus Anc_1.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685912.1"
                     /db_xref="GeneID:11531384"
                     /db_xref="GOA:G8BUA0"
                     /db_xref="InterPro:IPR004567"
                     /db_xref="UniProtKB/TrEMBL:G8BUA0"
                     /translation="MTQMKNCIHFDCNYSKKLFTIAIDIGGTLAKVVYSPLCSNTLCF
                     DTIESARIDDFILLLHNLVKDHNNNDYQTTQIIATGGGAYKFYNLLTKEFSNIKSISR
                     FDEMECLIKGLNMFIHKIKDEVFTYNDIEGMKIIQHSLNSKEDANNNKNIDTLIYPYL
                     LVNIGSGVSILKVESPNEFSRVGGSSLGGGTLWGLLSLITGAKTYDEMLSWAQEGDNT
                     NVDMLVGDIYGSGYSNIGLKSTHIASSFAKVFENRSSSTSTETKKDMSNELENLSIDD
                     NENPNESSRITSTEIINRRKTEKSFRNEDISKSLLYAISNNIGQIAYLQAKIHNVHNI
                     YFGGSYIRGHLTTMNTLSYAINFWSDGTKQAFFLKHEGYLGAMGAFLSEVE"
     gene            <819864..>820826
                     /gene="TPHA0E03900"
                     /locus_tag="TPHA_0E03900"
                     /db_xref="GeneID:11531170"
     mRNA            <819864..>820826
                     /gene="TPHA0E03900"
                     /locus_tag="TPHA_0E03900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685865.1"
                     /db_xref="GeneID:11531170"
     CDS             819864..820826
                     /gene="TPHA0E03900"
                     /locus_tag="TPHA_0E03900"
                     /inference="similar to DNA sequence:INSDC:YCL050C,YDR530C"
                     /note="similar to Saccharomyces cerevisiae APA1 (YCL050C)
                     and APA2 (YDR530C); ancestral locus Anc_1.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685913.1"
                     /db_xref="GeneID:11531170"
                     /db_xref="GOA:G8BUA1"
                     /db_xref="InterPro:IPR009163"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019200"
                     /db_xref="UniProtKB/TrEMBL:G8BUA1"
                     /translation="MLAKEIAQSVKEKYEAAVKSGSLVFTETTQEKVKDSKSGIEYLV
                     SYAPSLKGKPTKEGNGASDPFENPEAELLISEDVNGDDQFKLLLNKYPIVENHTILAT
                     KTFQKQNLALSPKELFTSYKYLSKLDDSTNDEVKYMMFYNCGDLSGSSVDHKHLQFIP
                     LPKNFNTIQDNLVSGKTHFLPTVREEPLQHEKTSFAHFAIPLPDNSDDVDEDLLAMAY
                     FSLLQRALTFFQDWLNERPEFTGKTSYNVMMTKKWLSVVPRSSPVSKTLGLNLNATAY
                     VGLLLIKDEETLNKVKENASLIDEALLECGFPNTAGEKTNEYNY"
     gene            complement(<821156..>822910)
                     /gene="TPHA0E03910"
                     /locus_tag="TPHA_0E03910"
                     /db_xref="GeneID:11531376"
     mRNA            complement(<821156..>822910)
                     /gene="TPHA0E03910"
                     /locus_tag="TPHA_0E03910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685866.1"
                     /db_xref="GeneID:11531376"
     CDS             complement(821156..822910)
                     /gene="TPHA0E03910"
                     /locus_tag="TPHA_0E03910"
                     /inference="similar to DNA sequence:INSDC:YCL051W,YDR528W"
                     /note="similar to Saccharomyces cerevisiae LRE1 (YCL051W)
                     and HLR1 (YDR528W); ancestral locus Anc_1.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685914.1"
                     /db_xref="GeneID:11531376"
                     /db_xref="UniProtKB/TrEMBL:G8BUA2"
                     /translation="MLDTQNLTVSAPKFASQDTAMTPSRRGHRHKRSFAISGDFEFLK
                     QPQQLQGQDSPELLQPPLSAQSLQYSKVSSHEPPKLYISEQHSALQNSGGSSENNMLS
                     SGQNPFQSPRFFASEEPTFSSPFEGVPDAIINLDDALRAKPGSFQAHRRTESAPADLE
                     FLLDAKTLQLHTPRIEEEEMSDIAESDISNSPKSNKNRNDKQQNNPGLLSPLRPYTEL
                     KFKKHPDNDEEESPSHSRLITPSNLLFSGYQHSNNSNNGDYSLNSEAGTNLFNNQFSE
                     KNPNPNLTFTHTLSRSPYNSLKINKQKQRSYNRQLPLSSAATVQPQTVKEKSSANSLS
                     STFLLSPASQLHSPSKPISTPGTPISYHYKQKLNGLPFPSQPASKPNNATPLHSFQQR
                     SSVLRPSSASNAHNSRFNFESKEYDLDYNKLDDFYGSKYENYDNKDLMNNNSRFESQK
                     EAVKSNKNEDIYLSEDLLLGEPGAMVDLSSTTSPVKGITKAFDSLKIDSAHINSNDMY
                     INSGDSSKISLSSSLYDSDKIPTTIANKTINKSNPPKNRDTQKSSSDKIETDFTKDDH
                     RSVSDTALLMKKINLSQD"
     gene            <823754..>825082
                     /gene="TPHA0E03920"
                     /locus_tag="TPHA_0E03920"
                     /db_xref="GeneID:11531375"
     mRNA            <823754..>825082
                     /gene="TPHA0E03920"
                     /locus_tag="TPHA_0E03920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685867.1"
                     /db_xref="GeneID:11531375"
     CDS             823754..825082
                     /gene="TPHA0E03920"
                     /locus_tag="TPHA_0E03920"
                     /inference="similar to DNA sequence:INSDC:YCL052C"
                     /note="similar to Saccharomyces cerevisiae PBN1 (YCL052C);
                     ancestral locus Anc_1.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685915.1"
                     /db_xref="GeneID:11531375"
                     /db_xref="GOA:G8BUA3"
                     /db_xref="InterPro:IPR013233"
                     /db_xref="UniProtKB/TrEMBL:G8BUA3"
                     /translation="MSFKNRLTVLLNEKDTFDEYISTNDTHVKVKGKTDGIHLQQRYT
                     IERSDASTKLPDEILRLTWRSIDGMKRPSVIEPFLTFGFNAYTNVNSELLGDYSNSVD
                     SKVYHVFHGDSLLEMEKILLKYEDIPTKLIDFDMGNDYDIIIDNKSVQINEYKILHEN
                     DIFEYGKSEFFDFDKMEAGIFNLESQDDIDTNLGGISCIWRAEDNNIEKCQKTMLLFK
                     SGHIEKDQRNEKNIIEIEQPVGLHPKLLVNLTDIRVSDDQCNIYMFLQLPLEIFVDQY
                     QSDPFFLFGEHDLELPSYKLKDKAWGSETLFELEPGMVNEITLHSRYVEPFSNLSENL
                     NMDDHFISHIEPIVFEECATGALNLKSNPFYSKNLGLEAFFTEDTIFKHIETKSFNIP
                     IPRPNSSEYEATVYITVFCLVTSIIYLLYKMFGKLSSKPTTIDNSSTEIK"
     gene            complement(<825235..>827763)
                     /gene="TPHA0E03930"
                     /locus_tag="TPHA_0E03930"
                     /db_xref="GeneID:11531519"
     mRNA            complement(<825235..>827763)
                     /gene="TPHA0E03930"
                     /locus_tag="TPHA_0E03930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685868.1"
                     /db_xref="GeneID:11531519"
     CDS             complement(825235..827763)
                     /gene="TPHA0E03930"
                     /locus_tag="TPHA_0E03930"
                     /inference="similar to DNA sequence:INSDC:YCL054W"
                     /note="similar to Saccharomyces cerevisiae SPB1 (YCL054W);
                     ancestral locus Anc_1.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685916.1"
                     /db_xref="GeneID:11531519"
                     /db_xref="GOA:G8BUA4"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BUA4"
                     /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFL
                     EKSKVVIDLCAAPGSWCQVASKLCPVNSLIIGVDIVPMKSMPNVITFQSDITTEDCRS
                     KLRGHMKTWKADTVLHDGAPNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKI
                     FRSKDYNKLIWVFQQLFDKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRILDPREV
                     FEELPDGPANMESKIYNPEKKVRKRQGYEEGDYLLYHELPIMDFVNTEDPITLLGENN
                     KFTYDKEDHQWKILKKMKQTSTEFLACIEDLKVLGKKDFKMILKWRKAARDLLGIDKE
                     EEVEVEVNPLTEEEQIDKELSAMQERQRLNLRREKRKKNESKQKELIRMQMNMLTPAD
                     IGIEAASIGRESLFNLKSAEKTGILDKLARGKKRMVFTEEELAHDNDIHIDESIVLKD
                     KDAAGEADDLESQLNSMYADFKQRKSERDARFKAKQARGGDNEDEWTGFTDSKNGEDE
                     EDAKEEKDYIEEEDDDILSDSDDDEGINNLISKIKSESDGSKLSSQAKMLFSDPIFKN
                     VTPDLPSKPSTDISSESVGDFTKLSKKRKHDQVEKEEKEEKEVDSSDDDSSDDSDFEV
                     VSNTYNHEDEIDSDYDSDEEKKQTEKEKHSKDIDIATVEAMTLAHQLALGQKTKHDLV
                     NEGFNRYAFRDVDNLPDWFLEDEKEHSKINRPITKEAAMAIKEKIKALNARPIKKVLE
                     AKARKKMRSVARLERIKKKAGLINDNTDKSEKDKADEITKLMRKVSKKPVRKPKVTLV
                     VASGKNRGLAGRPKGVKGKYKMVDGVLKNEHRALKRIAKKHHKK"
     gene            complement(<828918..>829880)
                     /gene="TPHA0E03940"
                     /locus_tag="TPHA_0E03940"
                     /db_xref="GeneID:11531439"
     mRNA            complement(<828918..>829880)
                     /gene="TPHA0E03940"
                     /locus_tag="TPHA_0E03940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685869.1"
                     /db_xref="GeneID:11531439"
     CDS             complement(828918..829880)
                     /gene="TPHA0E03940"
                     /locus_tag="TPHA_0E03940"
                     /inference="similar to DNA sequence:INSDC:YCL055W"
                     /note="similar to Saccharomyces cerevisiae KAR4 (YCL055W);
                     ancestral locus Anc_1.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685917.1"
                     /db_xref="GeneID:11531439"
                     /db_xref="GOA:G8BUA5"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="UniProtKB/TrEMBL:G8BUA5"
                     /translation="MFTDDLYLDSKAGTPPKTKHVSFKPAKKFHSNDYSNNYVHRKSF
                     PQKYVANIENTVEGYPKLKRLLEIKEKQILEYSSKPYGCKIGLDQMVPKLNQWIHKDK
                     INFDIVMIGCLSDNQFIYPLLTQLPLDKLVSKPGFLFIWASVHKINELTRLMNTELWA
                     KKFRRSEELVFIPVDKNSPFYPGLDNDDKALFEKMQWHCWMCITGTVRRSTDGHLIHC
                     NVDTDLCIEKENNRDGAVPSDLYRVAENFSTATRRLHIIPTRTGFEKPVRLRPGWVIM
                     SPDVMLDNFDASDYKKEISKIGTNIPIKAEIENLRPKSPIQKAQ"
     gene            complement(<830750..>831865)
                     /gene="TPHA0E03950"
                     /locus_tag="TPHA_0E03950"
                     /db_xref="GeneID:11531440"
     mRNA            complement(<830750..>831865)
                     /gene="TPHA0E03950"
                     /locus_tag="TPHA_0E03950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685870.1"
                     /db_xref="GeneID:11531440"
     CDS             complement(830750..831865)
                     /gene="TPHA0E03950"
                     /locus_tag="TPHA_0E03950"
                     /note="ancestral locus Anc_1.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685918.1"
                     /db_xref="GeneID:11531440"
                     /db_xref="UniProtKB/TrEMBL:G8BUA6"
                     /translation="MAVSFKRICSDVNISGPDYKKKELVFKLTDNNTSSKVSSNASSS
                     SSKNGSADVGLQNYKNFIKQYSCSDQNTTSMDSDENLGVFTKSSSNYRYNTDSNDFND
                     TNTITNTNNNDNNNDNSIKDETIRRSSINSRSGSFSVSQRKHSQLFRDDLVARERCFD
                     YITQCIDEVWGRYCNTTANAEALVYGDSSNKNNYPISPASLSSNSPVSYNTTTIGTNS
                     DRTTSNDDFLSMKPKVTNKQIKSFNSNTCKPLVLTDNELEEGSDYSCESDYEDYKSEV
                     TNITEYETDSGSDVRTVSNLPDSVKLQSLKCRLARAKEDLEDIYDSNEYQDCVDFWRR
                     WDMLKYNAVEMMEDDDDDDVIESAIEELEMGRFYREV"
     gene            <833382..>833915
                     /gene="TPHA0E03960"
                     /locus_tag="TPHA_0E03960"
                     /db_xref="GeneID:11531306"
     mRNA            <833382..>833915
                     /gene="TPHA0E03960"
                     /locus_tag="TPHA_0E03960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685871.1"
                     /db_xref="GeneID:11531306"
     CDS             833382..833915
                     /gene="TPHA0E03960"
                     /locus_tag="TPHA_0E03960"
                     /inference="similar to DNA sequence:INSDC:YCL056C"
                     /note="similar to Saccharomyces cerevisiae YCL056C;
                     ancestral locus Anc_1.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685919.1"
                     /db_xref="GeneID:11531306"
                     /db_xref="UniProtKB/TrEMBL:G8BUA7"
                     /translation="MDSSDVFSDENGNEEGFESTLLNYLESITNIFDLVFFLRSTGLI
                     KENNFFYRNLNRSNIGSKIWFVTLILSIRKLYKNILKSTKLLSLLKTELTKIEKNNDL
                     TSDIILQKIQNNNTILKKKIKNFIIELIQDFIYLIIVSLEIFKISISKKLNHRLEILS
                     NSVSMLKFFTLEITPTK"
     gene            complement(<834023..>836266)
                     /gene="TPHA0E03970"
                     /locus_tag="TPHA_0E03970"
                     /db_xref="GeneID:11531176"
     mRNA            complement(<834023..>836266)
                     /gene="TPHA0E03970"
                     /locus_tag="TPHA_0E03970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685872.1"
                     /db_xref="GeneID:11531176"
     CDS             complement(834023..836266)
                     /gene="TPHA0E03970"
                     /locus_tag="TPHA_0E03970"
                     /inference="similar to DNA sequence:INSDC:YCL057W"
                     /note="similar to Saccharomyces cerevisiae PRD1 (YCL057W);
                     ancestral locus Anc_1.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685920.1"
                     /db_xref="GeneID:11531176"
                     /db_xref="GOA:G8BUA8"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:G8BUA8"
                     /translation="MIQFLSPIIKSGIGKSFKNKSILLSLVAIPAVAIGIYHQNNQGL
                     RFYTASQVKMNEAAFIAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIE
                     NFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFK
                     QFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIK
                     KRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKY
                     PDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNL
                     DIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHR
                     YYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGD
                     DVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTA
                     LVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAP
                     SQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDM
                     KVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGY
                     MWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAF
                     LKELGLQ"
     gene            <837161..>837421
                     /gene="TPHA0E03980"
                     /locus_tag="TPHA_0E03980"
                     /db_xref="GeneID:11531169"
     mRNA            <837161..>837421
                     /gene="TPHA0E03980"
                     /locus_tag="TPHA_0E03980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685873.1"
                     /db_xref="GeneID:11531169"
     CDS             837161..837421
                     /gene="TPHA0E03980"
                     /locus_tag="TPHA_0E03980"
                     /inference="similar to DNA sequence:INSDC:YCL057C-A"
                     /note="similar to Saccharomyces cerevisiae YCL057C-A;
                     ancestral locus Anc_1.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685921.1"
                     /db_xref="GeneID:11531169"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:G8BUA9"
                     /translation="MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVT
                     SILLFKRRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI"
     gene            complement(<837690..>838040)
                     /gene="TPHA0E03990"
                     /locus_tag="TPHA_0E03990"
                     /db_xref="GeneID:11531264"
     mRNA            complement(<837690..>838040)
                     /gene="TPHA0E03990"
                     /locus_tag="TPHA_0E03990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685874.1"
                     /db_xref="GeneID:11531264"
     CDS             complement(837690..838040)
                     /gene="TPHA0E03990"
                     /locus_tag="TPHA_0E03990"
                     /inference="similar to DNA sequence:INSDC:YCL058W-A"
                     /note="similar to Saccharomyces cerevisiae YCL058W-A;
                     ancestral locus Anc_1.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685922.1"
                     /db_xref="GeneID:11531264"
                     /db_xref="UniProtKB/TrEMBL:G8BUB0"
                     /translation="MAKGKSNNIKKSFRNNGKNVKDRKNIKGKLSSQVRKSTKHKVEK
                     LNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDRQLIEKIESKKKETNA
                     SLLQQIEMMSGFSL"
     gene            <838446..>839396
                     /gene="TPHA0E04000"
                     /locus_tag="TPHA_0E04000"
                     /db_xref="GeneID:11531265"
     mRNA            <838446..>839396
                     /gene="TPHA0E04000"
                     /locus_tag="TPHA_0E04000"
                     /product="90S preribosome/SSU processome component KRR1"
                     /transcript_id="XM_003685875.1"
                     /db_xref="GeneID:11531265"
     CDS             838446..839396
                     /gene="TPHA0E04000"
                     /locus_tag="TPHA_0E04000"
                     /inference="similar to DNA sequence:INSDC:YCL059C"
                     /note="similar to Saccharomyces cerevisiae KRR1 (YCL059C);
                     ancestral locus Anc_1.6"
                     /codon_start=1
                     /product="90S preribosome/SSU processome component KRR1"
                     /protein_id="XP_003685923.1"
                     /db_xref="GeneID:11531265"
                     /db_xref="GOA:G8BUB1"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR024166"
                     /db_xref="UniProtKB/TrEMBL:G8BUB1"
                     /translation="MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTL
                     FPKYREVYLKSVWKDVTKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIK
                     LLARSVPFPQAVKILDDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLT
                     KCYILVQGNTVSVMGPFKGLKEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANE
                     DWSRFLPMFKKRNVARKKSKKPKREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKE
                     VKRLHERRDQQAEKQAEKDIERSKNYIAPKEEKYVSSIEK"
     gene            <839903..>842800
                     /gene="TPHA0E04010"
                     /locus_tag="TPHA_0E04010"
                     /db_xref="GeneID:11531465"
     mRNA            <839903..>842800
                     /gene="TPHA0E04010"
                     /locus_tag="TPHA_0E04010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685876.1"
                     /db_xref="GeneID:11531465"
     CDS             839903..842800
                     /gene="TPHA0E04010"
                     /locus_tag="TPHA_0E04010"
                     /inference="similar to DNA sequence:INSDC:YCL061C"
                     /note="similar to Saccharomyces cerevisiae MRC1 (YCL061C);
                     ancestral locus Anc_1.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685924.1"
                     /db_xref="GeneID:11531465"
                     /db_xref="InterPro:IPR018564"
                     /db_xref="UniProtKB/TrEMBL:G8BUB2"
                     /translation="MDSLFDQLNHFKKKRTTYDKIPHDLLEEEQESEDILKNKTAKEI
                     SQLDGGILFGNSILGQIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQII
                     NNLYDGGEDLENEIFHNSFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKP
                     LDVVNNTQTVLVIENTQPLPSEIKTQVVNEVNSALPVTQPTQTIVATQANEVTYDTQE
                     LMPTVDDVAMRSTGLKITDIEKELEEEQRLAKETEFGTEFKFKESESKISKKFSKEDF
                     LNHFDDSSSSEDETSKNEKGPNVDKSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKA
                     NNEQIIEFSESDEDSDTNISPSYASKAVILNIRANKSKQQPKVSQKSDQTTLLMLYNN
                     LKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQKIRQREKQKQKK
                     ENQDDLNSNPEEFDLSANELEDSDIPGSDFAESNNNSEKDDEEEENDEEEEDEQEDAP
                     KSTVDEEDEGFAIGKRKHKKTEIVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNIIQ
                     QSRETLNETEESDEEDEERYNAIISEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEA
                     EESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALV
                     NKILYDIKNGGFRTRKRRDRDLEFSDDDDDDLKAYRAKRRALMREKRLDIEGDKKIVK
                     NPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDNDEKLATNVTKKKKK
                     IVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTLQSVT
                     SSRSSSIASNLNEQPSQSSGSLFNDLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAY
                     KTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSRTTPSRLFDNQEGSFE"
     gene            complement(<842960..>844582)
                     /gene="TPHA0E04020"
                     /locus_tag="TPHA_0E04020"
                     /db_xref="GeneID:11531247"
     mRNA            complement(<842960..>844582)
                     /gene="TPHA0E04020"
                     /locus_tag="TPHA_0E04020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685877.1"
                     /db_xref="GeneID:11531247"
     CDS             complement(842960..844582)
                     /gene="TPHA0E04020"
                     /locus_tag="TPHA_0E04020"
                     /inference="similar to DNA sequence:INSDC:YCL063W"
                     /note="similar to Saccharomyces cerevisiae VAC17
                     (YCL063W); ancestral locus Anc_1.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685925.1"
                     /db_xref="GeneID:11531247"
                     /db_xref="UniProtKB/TrEMBL:G8BUB3"
                     /translation="MHSLNSNLEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGT
                     ATDTGNKTKDSNEALNALRSTYDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKFNLDHR
                     NIEELVFEFQNIREKLNQLAASSKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRM
                     SKELELKNKEKSVTFGKETRISLTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISY
                     DTGLNSKSKSNKRSNREYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNP
                     TVDASINTELIENNSDQETVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKK
                     SHLRRCNSHESILSTKLENTFYKNVGSNFYDRFIFSSFYRPTVASVSTTSTNIEPFLS
                     DGKNESPNKNLQLPLTSSTRGVTSRELLSKFADKPEQLKAPTTSNSNSSKYFFENWGL
                     FSSMSSSSTFHRKNTSGSNIISSEVGKKLCDRSTGIKVTSINTQNAYTFPFIRSNSHD
                     ITKQNITNPIIKERVSYNELHDALNTEIKLLF"
     gene            <846219..>847292
                     /gene="TPHA0E04040"
                     /locus_tag="TPHA_0E04040"
                     /db_xref="GeneID:11531143"
     mRNA            <846219..>847292
                     /gene="TPHA0E04040"
                     /locus_tag="TPHA_0E04040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685878.1"
                     /db_xref="GeneID:11531143"
     CDS             846219..847292
                     /gene="TPHA0E04040"
                     /locus_tag="TPHA_0E04040"
                     /inference="similar to DNA sequence:INSDC:YCL064C"
                     /note="similar to Saccharomyces cerevisiae CHA1 (YCL064C);
                     ancestral locus Anc_1.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685926.1"
                     /db_xref="GeneID:11531143"
                     /db_xref="GOA:G8BUB4"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:G8BUB4"
                     /translation="MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNL
                     IQSTSLEIQKNSKKSPEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIK
                     ATGANVIVKGNHWKEADTYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIV
                     ETFGQQHIPIEKVKAIVCSVGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTS
                     LKMGKVIQFEKINTIATSLGTANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDS
                     NMVAEPACGAALHMGYNMDILEKSLGKKLATDDIVLIIACGGSSNTVQELEASLTELK
                     NKSNEKENYSIFHSLRFQLTLNN"
     gene            <848518..>848925
                     /gene="TPHA0E04055"
                     /locus_tag="TPHA_0E04055"
                     /db_xref="GeneID:11531369"
     mRNA            join(<848518..848580,848636..848797,848896..>848925)
                     /gene="TPHA0E04055"
                     /locus_tag="TPHA_0E04055"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685879.1"
                     /db_xref="GeneID:11531369"
     CDS             join(848518..848580,848636..848797,848896..848925)
                     /gene="TPHA0E04055"
                     /locus_tag="TPHA_0E04055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685927.1"
                     /db_xref="GeneID:11531369"
                     /db_xref="GOA:G8BUB5"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:G8BUB5"
                     /translation="MSMSIELTLESLQNACKDILSIYNESSSDHRKKFLPKEARLFLE
                     RVFEKKQSLNSKERDAIAKKCGLTPLQVRVWFINKRMRTK"
     gene            complement(<848980..>849731)
                     /gene="TPHA0E04070"
                     /locus_tag="TPHA_0E04070"
                     /db_xref="GeneID:11531370"
     mRNA            complement(join(<848980..849613,849670..>849731))
                     /gene="TPHA0E04070"
                     /locus_tag="TPHA_0E04070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685880.1"
                     /db_xref="GeneID:11531370"
     CDS             complement(join(848980..849613,849670..849731))
                     /gene="TPHA0E04070"
                     /locus_tag="TPHA_0E04070"
                     /inference="similar to DNA sequence:INSDC:YCL067C"
                     /note="similar to Saccharomyces cerevisiae HMLALPHA2
                     (YCL067C); ancestral locus Anc_1.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685928.1"
                     /db_xref="GeneID:11531370"
                     /db_xref="GOA:G8BUB6"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8BUB6"
                     /translation="MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLT
                     EADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKE
                     NEIIKYESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLP
                     KKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPE
                     VSALLRDNKTITS"
     gene            <850045..>850632
                     /gene="TPHA0E04080"
                     /locus_tag="TPHA_0E04080"
                     /db_xref="GeneID:11531382"
     mRNA            <850045..>850632
                     /gene="TPHA0E04080"
                     /locus_tag="TPHA_0E04080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685881.1"
                     /db_xref="GeneID:11531382"
     CDS             850045..850632
                     /gene="TPHA0E04080"
                     /locus_tag="TPHA_0E04080"
                     /inference="similar to DNA sequence:INSDC:YCL066W"
                     /note="similar to Saccharomyces cerevisiae HMLALPHA1
                     (YCL066W); ancestral locus Anc_1.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685929.1"
                     /db_xref="GeneID:11531382"
                     /db_xref="GOA:G8BUB7"
                     /db_xref="InterPro:IPR006856"
                     /db_xref="InterPro:IPR017931"
                     /db_xref="UniProtKB/TrEMBL:G8BUB7"
                     /translation="MSSVSTWSKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQF
                     IAENFKLKIPYPPTCLLRSIDAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDD
                     INDDIAYINYSSEEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQ
                     HHVWDVFAQQFNFVKPKCGFVEWVGQTYEREWCTE"
     gene            <853540..>854007
                     /gene="TPHA0E04090"
                     /locus_tag="TPHA_0E04090"
                     /db_xref="GeneID:11531385"
     mRNA            <853540..>854007
                     /gene="TPHA0E04090"
                     /locus_tag="TPHA_0E04090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685882.1"
                     /db_xref="GeneID:11531385"
     CDS             853540..854007
                     /gene="TPHA0E04090"
                     /locus_tag="TPHA_0E04090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685930.1"
                     /db_xref="GeneID:11531385"
                     /db_xref="UniProtKB/TrEMBL:G8BUB8"
                     /translation="MALANTAHSSTNIMNKLKNINYIGSEPAFIFISMIRELINPIRP
                     EEYFHLELIIINYILNSLNGDYASIRDHFSQPPQYTIEDIFASIRSKYEYMKMNKSIN
                     TTSTSQTDTCHTCSRPLHKRIICQLGNKSGHSAKNCYHHNFQTIMCHLSKTNF"
CONTIG      join(HE612860.1:1..854350)
//
DBGET integrated database retrieval system