GenomeNet

Database: RefSeq
Entry: NC_016525
LinkDB: NC_016525
Original site: NC_016525 
LOCUS       NC_016525             815984 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 6, complete genome.
ACCESSION   NC_016525
VERSION     NC_016525.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 815984)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 815984)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612861.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..815984
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="6"
     gene            complement(<1418..>2608)
                     /gene="TPHA0F00100"
                     /locus_tag="TPHA_0F00100"
                     /db_xref="GeneID:11535373"
     mRNA            complement(<1418..>2608)
                     /gene="TPHA0F00100"
                     /locus_tag="TPHA_0F00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685883.1"
                     /db_xref="GeneID:11535373"
     CDS             complement(1418..2608)
                     /gene="TPHA0F00100"
                     /locus_tag="TPHA_0F00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685931.1"
                     /db_xref="GeneID:11535373"
                     /db_xref="UniProtKB/TrEMBL:G8BUR5"
                     /translation="MLRRQKIIIFVCISIILVSLFTTKAVDINSIDATNTAFSITPNL
                     FNFKTVHEEPELRYNEKRVTFVSRHPGTKKDFGFLVDFLELKNVTYYTKLIEPKGESP
                     YILTNEEADEICETSDYIFVTDCLTDGWNFIRDRKSKCKNLHFIVSQRADFCAKKEDK
                     NKFLKDLDFSLNREDEFRTNLIPNNIFEVPYAKFKGVNITAEYPVIRPFGYTDMEAKT
                     IDNEEKNPPCLIAGRVKQDTDYLFKSVQEHTGYTCKKLPELYGGPKTLSQYNSIIVHL
                     PHQVSVMKMWENIAHGVLIAIPSPSFLDVVCEGRLCNDIGDLNFSKKLDKKNWAKYCD
                     FYNDPKFSNCFIQYESWEELKQLLESRSYLEHINECRDIMQDRRLESLRSWRKIFEKG
                     SLTA"
     gene            complement(<4331..>5296)
                     /gene="TPHA0F00110"
                     /locus_tag="TPHA_0F00110"
                     /db_xref="GeneID:11535502"
     mRNA            complement(<4331..>5296)
                     /gene="TPHA0F00110"
                     /locus_tag="TPHA_0F00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685884.1"
                     /db_xref="GeneID:11535502"
     CDS             complement(4331..5296)
                     /gene="TPHA0F00110"
                     /locus_tag="TPHA_0F00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685932.1"
                     /db_xref="GeneID:11535502"
                     /db_xref="UniProtKB/TrEMBL:G8BUR6"
                     /translation="MVEVKKKKLVLILFAVAQILIFVKIFRSSDSVYNSVTSAVGYYS
                     IRPVANTGEYIGKKIAYVSRHPGTTQDFKYMEENLQLQNVDYFLYYGIKIDARAVNET
                     QARYICSNYDTVVISDCMTDGWEFFRHDDLHCKNIVFLISNRYDVCAGGNSEAFKQNF
                     THALNRDDGYEATIVANNAFEIPYLKYNNVDLKKDYPIIRPFGNTVLEPQDIAKEEPD
                     IPCLIIDRIIAHQNILKNNIQNELNYDCKILKEHYGGPKTLSKYNSIVIHLPYQVSIM
                     KMWENIAYGVLMAVPTPEFYDKICSENACSGSEHFRLAKEIDKDR"
     gene            <6278..>7231
                     /gene="TPHA0F00120"
                     /locus_tag="TPHA_0F00120"
                     /db_xref="GeneID:11535641"
     mRNA            <6278..>7231
                     /gene="TPHA0F00120"
                     /locus_tag="TPHA_0F00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685885.1"
                     /db_xref="GeneID:11535641"
     CDS             6278..7231
                     /gene="TPHA0F00120"
                     /locus_tag="TPHA_0F00120"
                     /inference="similar to DNA sequence:INSDC:YNR054C"
                     /note="similar to Saccharomyces cerevisiae ESF2 (YNR054C);
                     ancestral locus Anc_6.381"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685933.1"
                     /db_xref="GeneID:11535641"
                     /db_xref="GOA:G8BUR7"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BUR7"
                     /translation="MSNQVEEFDDFSSDGEDNGLLIQSKKNFSSKQHIEEDVESSDDR
                     DSNDDKESGTIKQNDDVANEKSDDDASIDDKLDEGKVEINSGTTENERKEALKKKMDA
                     FNTLKAQRKARHKTGVIYLSAIPPYMKPAKMRQILSRFGELDRLFLKRESDQKYKSRV
                     KGGGNKKTKYEEGWAEFVRKRDAKICAGALNGNTIGGSKGSFYHDDILNVKYLPGFKW
                     ADLTDQIARENDVRQSKLDLEISQANKMNAEFIRNVEKSKMLENIKKSNKRKNNGIAD
                     KEDNTIVRNFKQYKVSTRRADASDDIKAKQANMDQIINNLL"
     gene            <14360..>16636
                     /gene="TPHA0F00130"
                     /locus_tag="TPHA_0F00130"
                     /db_xref="GeneID:11535372"
     mRNA            <14360..>16636
                     /gene="TPHA0F00130"
                     /locus_tag="TPHA_0F00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685886.1"
                     /db_xref="GeneID:11535372"
     CDS             14360..16636
                     /gene="TPHA0F00130"
                     /locus_tag="TPHA_0F00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685934.1"
                     /db_xref="GeneID:11535372"
                     /db_xref="GOA:G8BUR8"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BUR8"
                     /translation="MANYSEIKRIIINRRSCKFYIYVVSVLSTIFITLHLSNNYLTDA
                     TNTPSYRQNLNNLDNFKLQLSYFNQHEVKEEPVSPIDLIPKYNTINKSSYNGRSFVQR
                     VIDTIKGNSYKDFSQLDLQTKCLLYYRNLYAMNENWSNSLEQFSLNINDINDKTLKAM
                     KEKFGDDYDNVEVVKSHKKKNDLALGFERIRLYDKCFLGPESVIKAQDVFNKNIDTKN
                     YIVPPRNLAETKSTDEQKEKENDPFYTYLKYDQYDLDHRMFPFIKKFNAETFKDLLPR
                     ITNGKVKDKYLDLGVLPVLDKHGKLSKYVTYHYDPEKTFWGNWNAMSSIVSKRGIVLS
                     FSDKHVDTFLRLLTTLRFQQNDLPIQVIHVGDDLSEESKHMIYRVATSQYVSVPVVDS
                     KSKKIKQVSNLPAQQIWFVNVSNVLDPAFMKKFDRFKNKWLAEMLNLFEEFIFLDTDA
                     ISYIHMSEYFEFPEYKDTGTLFFKDRTLEDYNKKSCTAAFRTLPPKMLETINFGNFPV
                     IDDSYVAEECNKYLTVEEKIYKHYFFDNWLHQMESGLIVINKSRHIMPIVISTMLHMT
                     GQLNSCSYGDKEFLWLGFLISGTPYRFHDVNAGAMGDVLTEKDNLEHIEQRICVIQIS
                     HFNKDNHLLWVNGGARNCKFEDDAKKIGRMINLNFLREGHKSFEEFKEYYVNSPISAQ
                     HGIIPGDNPGTWNKLGEHCRGYNHCAKFESKLTPFSFDDRKNIGKIFKFSPSHSNHIN
                     VINTIWTNFNYSPDMEKS"
     gene            <17028..>18758
                     /gene="TPHA0F00140"
                     /locus_tag="TPHA_0F00140"
                     /db_xref="GeneID:11535436"
     mRNA            <17028..>18758
                     /gene="TPHA0F00140"
                     /locus_tag="TPHA_0F00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685887.1"
                     /db_xref="GeneID:11535436"
     CDS             17028..18758
                     /gene="TPHA0F00140"
                     /locus_tag="TPHA_0F00140"
                     /inference="similar to DNA sequence:INSDC:YHL039W"
                     /note="similar to Saccharomyces cerevisiae YHL039W;
                     ancestral locus Anc_4.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685935.1"
                     /db_xref="GeneID:11535436"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G8BUR9"
                     /translation="MNDEKLSSLLNWAKENGAIIDDRIGFKYNTNSGFSCFAKNDIKS
                     EEKPLIEIPKNLLITHSLAESHFNTKITEIKLTSKNSNALTQLYLSKLKFSNSNDEEV
                     LHLKPYLDILPSDLEQPYFWGSKLLQLVHQTDLYLILKEIIVKIYNEWIELKEQLNVE
                     QREDEDKNLKGSSADQLLEYLRTYNSNEIKWESFYAYTWATCIFKSRAFPNLVIDDKN
                     VIDINLAFLYPVVDLLNHKNDTRVKWSYNENKVQFVSEEKINVDMELFNNYGNKSNEE
                     LLLNYGFIEENNVHDNTRLTLRLETAALVGAQNSGVKFSKEELVKSDCVQFLIDNNGE
                     VPKSLINLFGYLCKLKSEEFTNIRSVLEGIDQLNTILTQKIELFKSISKARSEGFGSS
                     EVKTVQSIKKFANSQKMIYNRAFDNLLKLQKTILKSAKETLSFRSAYKSDQLFSNSLL
                     LTWGITNYEDLKKNDNFREAVLMWMVRISNQNNYKNKFKFNPPKFIFDCFKEKSKSIV
                     IEKEDVAEFLPFHKKLFPALSQKIPEVYGQGDWGIKQFIIASSVYDMLVWTKDITQEP
                     LFIKNEKYLL"
     gene            complement(<18995..>19499)
                     /gene="TPHA0F00150"
                     /locus_tag="TPHA_0F00150"
                     /db_xref="GeneID:11535413"
     mRNA            complement(join(<18995..19406,19486..>19499))
                     /gene="TPHA0F00150"
                     /locus_tag="TPHA_0F00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685888.1"
                     /db_xref="GeneID:11535413"
     CDS             complement(join(18995..19406,19486..19499))
                     /gene="TPHA0F00150"
                     /locus_tag="TPHA_0F00150"
                     /inference="similar to DNA sequence:INSDC:YLL050C"
                     /note="similar to Saccharomyces cerevisiae COF1 (YLL050C);
                     ancestral locus Anc_4.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685936.1"
                     /db_xref="GeneID:11535413"
                     /db_xref="GOA:G8BUS0"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BUS0"
                     /translation="MSRSGVAVADESLSAFNDLKLGKKHKFILFGLNDNKTEIVVKET
                     SNDDSYDTFLEKLPENDCLYAVYDFEYEISGNEGKRSKIIFFTWSPDTAPVRSKMVYA
                     SSKDALRRSLNGVAADIQGTDFSEVAYETVLDRVRSGTH"
     gene            <20150..>20743
                     /gene="TPHA0F00160"
                     /locus_tag="TPHA_0F00160"
                     /db_xref="GeneID:11535504"
     mRNA            <20150..>20743
                     /gene="TPHA0F00160"
                     /locus_tag="TPHA_0F00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685889.1"
                     /db_xref="GeneID:11535504"
     CDS             20150..20743
                     /gene="TPHA0F00160"
                     /locus_tag="TPHA_0F00160"
                     /inference="similar to DNA sequence:INSDC:YLL049W"
                     /note="similar to Saccharomyces cerevisiae LDB18
                     (YLL049W); ancestral locus Anc_4.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685937.1"
                     /db_xref="GeneID:11535504"
                     /db_xref="UniProtKB/TrEMBL:G8BUS1"
                     /translation="MYTNRMVNHDGASLVRSLGRRLDSLEETVGVGENNNFIIDTVRE
                     LETQLNAIYRAGCDYSMNFLELLSVWYEHKWDNEDEEVSLHARVVAVKYKEIKQLIQA
                     LQALNATFEDVLLSRKPLISSATQGQKMVETTMLPQLEGLFKKCDGLLTRSMLLLNHF
                     YSFNRKVNIRMHDYDQRLHVAANQIMELQQEKHKNIP"
     gene            <21183..>22853
                     /gene="TPHA0F00170"
                     /locus_tag="TPHA_0F00170"
                     /db_xref="GeneID:11535411"
     mRNA            <21183..>22853
                     /gene="TPHA0F00170"
                     /locus_tag="TPHA_0F00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685890.1"
                     /db_xref="GeneID:11535411"
     CDS             21183..22853
                     /gene="TPHA0F00170"
                     /locus_tag="TPHA_0F00170"
                     /inference="similar to DNA sequence:INSDC:YHL036W"
                     /note="similar to Saccharomyces cerevisiae MUP3 (YHL036W);
                     ancestral locus Anc_4.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685938.1"
                     /db_xref="GeneID:11535411"
                     /db_xref="GOA:G8BUS2"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:G8BUS2"
                     /translation="MEDTRLLFSSQAIADEDDYDINLSKVEIPVKYGSFSSLESGTLL
                     DIEPNLNNYDDYDNNNENEQIKELSTEVPQGRHLGVFSTMVLFICRMVGSGIFATPSS
                     ILVNCGGNATLFLGVWIIAALVALSGLYLFLEFGSWLPRSGGKKNFLEQAYNKPKLMM
                     SVSFGLFSVLTGLAMSNSIIFGKYVSSILDIQNLLYSRYISISLIVTVIIIHGFSVKT
                     GVRIQNFLGGLKFILIFLICATGFYSMFFYDNSNENNLILWKDFQYDSELSLSSLASA
                     FINAFFCFSGWDSVHAVSSEIKNPNRTLKLAGPMSLFICFICYLMMNLAYLKVLTYEE
                     IKEAGPLVGSVLFIKLFGDTIGGKLMSLSIILSSISNVFIVLYGISRMNQEIFREGYL
                     PFSKYLVKNWPTGAPFPSLLIGGLLSISWLVFLPPAGKSFDYLVNMEGYGNQFFLLLI
                     SIGIFIFRREQQYATASIRCPNMCVWTIILVSMYLLIAPFIGNQDINSVGHFPPYQVT
                     ALLLVYTGFLYWFITFYLTPKIFCYKLIRKVVIQKDGLSTTEWIHNYN"
     gene            complement(<23050..>27990)
                     /gene="TPHA0F00180"
                     /locus_tag="TPHA_0F00180"
                     /db_xref="GeneID:11535412"
     mRNA            complement(<23050..>27990)
                     /gene="TPHA0F00180"
                     /locus_tag="TPHA_0F00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685891.1"
                     /db_xref="GeneID:11535412"
     CDS             complement(23050..27990)
                     /gene="TPHA0F00180"
                     /locus_tag="TPHA_0F00180"
                     /inference="similar to DNA sequence:INSDC:YHL035C,YLL048C"
                     /note="similar to Saccharomyces cerevisiae VMR1 (YHL035C)
                     and YBT1 (YLL048C); ancestral locus Anc_4.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685939.1"
                     /db_xref="GeneID:11535412"
                     /db_xref="GOA:G8BUS3"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUS3"
                     /translation="MLQLASNQTQNCPFWDYDDLSMCSRSRYINLYLPSLLLLSSVCY
                     FSVHISFAYYKYNILRVKQTDVFSQLCFGSASEESEPLLNNSTADSSNHGSVDKNSKG
                     SIEERHFTIQNLDLLKLNGDSGTQLELVKRNYMEKLRVIIEFILVLSQTLIQFTSLKY
                     SYYNEISTELTFTASMILSMLWTLLLVNVCLRLTNLEQNKPYIIYYMGNLWTISFISY
                     FILTLFNSLIFRSVLLGHIEDNTISHYYVLTFSITALLTLMLFFAPIRNSLPIDYKTH
                     SWITASPESTASLAKFITWGWLDKFLLHAYLTPIEAKDIMGLILEDYSIFSIKLFKTY
                     AKTFEHTDRKFSYILMKFFINFVLFQTFWATISAFVSFVPTILLQRILLYVEDSSSAP
                     ANLAWFYVFCMFLARATVAVSDGLALFFGRRICIRMRSIIISEIYSKALRRQVSNSSD
                     AEKSKDDFEIDPQEENDKKNVNGDEKSKTANLGAIINLMAVDTFKIADIGAYMHFFAG
                     SFIMTIIALVLLYKLLGVAAIVGTILLLCMIPVSFKLATLLGEYQKKTLAVTDQRIQK
                     LNEVLQAIRIIKFFSWEGNFEEEILTIREKELKILLIRSAVWALGGFVWYLTPTIVTA
                     GSFAYYIFIQGEQLTTPVAFTALSLFSLLRGPLDQISDMASFVIQSKVSLDRIQKFLD
                     EDDTKKYEQLSLGNKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKT
                     SLLMALLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNIL
                     FNAEYNEERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSS
                     SKHILLDDCLSAVDSHTAAWIYDNCIIGPLMENRTCILVSHNVALTLKNAEQVIMIDN
                     GKISHIGDPLTLLNNGVLGEDEMVKSSILSRHNSSTNLASKSATNISELAAMTRSSKI
                     LTDKLLSESERAKTGKLIKDEAKAEGHVDFAVYRWFLDIFGGVPMLVFLLSIFLLAQF
                     IYVTQSWWVRYWVTIQSSDVVSTIFSKSSLMASSVKIINPFNILLNSCDSKSASEYVT
                     QKVNNHTTKYYLIIYFAIGLAHSILGSIKTMLSFYVGINASRKIFKLLLSKVLHSKLR
                     FFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLIATVLLITYITNGFIVVAL
                     LVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRAYGDEIRFMKEN
                     LTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVLMNINKIDSGLAGISLTY
                     AITFTESALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSAGIVNVDKSWPSEGKIEV
                     NDLSLRYAPSLPKVIKNVSFTVEPKMKVGVVGRTGAGKSTIITALFRFLDPETGYIKI
                     DNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDDQIFKALRRVNLIVD
                     GNLNSDVTSVSSENVNKFLNLQSEISEGGSNLSQGQRQLMCLARSLLRAPNIMLLDEA
                     TASIDYASDAKIQGTIRNEFKDSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHPYSL
                     LLNKNSIFYSMCEQSGELDTLIDLSKEAFVNKLNSK"
     gene            <29177..>30985
                     /gene="TPHA0F00190"
                     /locus_tag="TPHA_0F00190"
                     /db_xref="GeneID:11535341"
     mRNA            <29177..>30985
                     /gene="TPHA0F00190"
                     /locus_tag="TPHA_0F00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685892.1"
                     /db_xref="GeneID:11535341"
     CDS             29177..30985
                     /gene="TPHA0F00190"
                     /locus_tag="TPHA_0F00190"
                     /inference="similar to DNA sequence:INSDC:YLL043W"
                     /note="similar to Saccharomyces cerevisiae FPS1 (YLL043W);
                     ancestral locus Anc_4.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685940.1"
                     /db_xref="GeneID:11535341"
                     /db_xref="GOA:G8BUS4"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:G8BUS4"
                     /translation="MSGNAQSVNDFLTGDNGRQQDGEQDFDYERQGYAGNDNHEQQPT
                     PQYIPQYSMQHAFPMHEVVPNTFSVGQKTGDPTVEMNKKRNSEQQNMPLAPEMCAVTA
                     NVLNVDDLVNQENVAGKMSHNDMPDAAGNGGDDIGMPQSVPMMVKPKAMYQNPQTPTV
                     LPSTYHPINKWSEVKHSYLREFLAEFMGTMVLIIFGDAVGVQVGIGAVQQQNAFNSAI
                     QALISDGSMTENEGKQFKTLENLVSSTGAGTFDDIPLAWAAAVVMGYFAAGGSAISGA
                     HLNPSVTVANWFFRGFPKEKVFIYIAGQVLGGFIGALIVYAYYKKVISVNIPNYFEEQ
                     SVANYFCTFPKEYLSSSRQFVSEFITTAMFIAGIFSLTDPYTCLSSDLFPLMLFILIF
                     VLNAAMSFQTGAAINLARDLGPRLALYAVGFSREVLWINNHHYFWVPMVAPLIGSLMG
                     GVVYDVCVYQGHESPVNWPLSVYKEMFFRAWHRRPGWKKRSRGRATSDLSDFSYKSDD
                     DLASNEEKKPEKKEKLGRTRTASNGSSIDGEPKQKSVQFKSVQRGRGTANGVPTILEE
                     EDSIETASLGDSHSSMQLSDSNSLNTVKEDSLDEKY"
     gene            complement(<31227..>31889)
                     /gene="TPHA0F00200"
                     /locus_tag="TPHA_0F00200"
                     /db_xref="GeneID:11535334"
     mRNA            complement(<31227..>31889)
                     /gene="TPHA0F00200"
                     /locus_tag="TPHA_0F00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685893.1"
                     /db_xref="GeneID:11535334"
     CDS             complement(31227..31889)
                     /gene="TPHA0F00200"
                     /locus_tag="TPHA_0F00200"
                     /inference="similar to DNA sequence:INSDC:YHL031C"
                     /note="similar to Saccharomyces cerevisiae GOS1 (YHL031C);
                     ancestral locus Anc_4.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685941.1"
                     /db_xref="GeneID:11535334"
                     /db_xref="GOA:G8BUS5"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:G8BUS5"
                     /translation="MASKGSSFVTVRSEIISLESKTDSLLSKYSTFAQTSSADQSTEE
                     KKLDTQIETLLGKTHDIIASLGNIVDENKNISTSKISQLQRHKEVYQEHQKNFRNIRS
                     SIQQERNRLNLLFSVKNDIEQQRNFDTNEDEYIQNEAARIDQSHNVVDDLISQAWETR
                     DQIVSQSHLLNNTNNKIMQTLQRIPGLNVLIGKISTRRRKNAVILASVITFCFLFLFL
                     TW"
     gene            complement(<32290..>33087)
                     /gene="TPHA0F00210"
                     /locus_tag="TPHA_0F00210"
                     /db_xref="GeneID:11535335"
     mRNA            complement(<32290..>33087)
                     /gene="TPHA0F00210"
                     /locus_tag="TPHA_0F00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685894.1"
                     /db_xref="GeneID:11535335"
     CDS             complement(32290..33087)
                     /gene="TPHA0F00210"
                     /locus_tag="TPHA_0F00210"
                     /inference="similar to DNA sequence:INSDC:YLL041C"
                     /note="similar to Saccharomyces cerevisiae SDH2 (YLL041C);
                     ancestral locus Anc_4.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685942.1"
                     /db_xref="GeneID:11535335"
                     /db_xref="GOA:G8BUS6"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="UniProtKB/TrEMBL:G8BUS6"
                     /translation="MFLNLQKNLLSTGRRAFSTTAKMATKQHEPRFKTFKIYRWNPDK
                     PTEKPRLQSYKVDLDDCGPMVLDALLKIKNEQDSTLTLRRSCREGICGSCAMNIGGRN
                     TLACICKIDQDNSKELKVYPLPHMYVVKDLVPDLTHFYKQYKSIQPFLQRKTFPADGK
                     ENLQSIADRKKLDGLYECILCACCSTSCPSYWWNQEEYLGPAVLMQAYRWLIDSRDQA
                     SHKRKEMLQNSMSLYRCHTIMNCTKTCPKGLNPGKAIAEIKKSLAFD"
     gene            complement(<33615..>42941)
                     /gene="TPHA0F00220"
                     /locus_tag="TPHA_0F00220"
                     /db_xref="GeneID:11535340"
     mRNA            complement(<33615..>42941)
                     /gene="TPHA0F00220"
                     /locus_tag="TPHA_0F00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685895.1"
                     /db_xref="GeneID:11535340"
     CDS             complement(33615..42941)
                     /gene="TPHA0F00220"
                     /locus_tag="TPHA_0F00220"
                     /inference="similar to DNA sequence:INSDC:YLL040C"
                     /note="similar to Saccharomyces cerevisiae VPS13
                     (YLL040C); ancestral locus Anc_4.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685943.1"
                     /db_xref="GeneID:11535340"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:G8BUS7"
                     /translation="MLESLAANVLNRLLGAYIENFDPAQLNVGIWSGDVVLKNMKLRK
                     DCLDSLDLPIDVKFGVLGNLVLTVPWSSLKNKPVKIIIEDCFLLCAARDPLNCDTQDI
                     IARELSLKLKKLAEWELRNQHIDSIDTNNENNETFMQSLLTKIVDNLQITIKNIHIRY
                     EDTKCVLSKEPYSLGITLREISAVSTDEGWVPNFISISRPITHKLLTLNSLCLYWNVD
                     STNIENYNENEDFDTTVEKFKRAILSSETEVDNYRYLLKPINGIGKLSVNKLGSTEVQ
                     PHILLEMEYDEFSVDLGDVEYANLMHTLSSLQINKDIEKYKGRRPLCSVTDDPKAWLK
                     YTIQTIAEKIKSENQKWTWENIKKSCDQRREYIALWLDKLQLPTIDDELADSKKQQRL
                     SELESELSFEAIILYRSMAKKMNAQLQKENDNQIKDNELNRASQNSTGTWLSSIWTGK
                     PLAETQKELELSEEQRKELYEAIEFTEDDDAILPIPSDRVKLKVTSVLKKGSFSIIKR
                     ENVRKLGEIIFEGCSFHFCQRPHSYLASFQIHQFRLEDGSPNTLYKHIISVNALKTLL
                     QDETTSQDPETEPLLDISYDSNPLNNEADTKLSIRLRGMTVFYHVHFINEIINFFNQQ
                     NDNQDTIGAIINAAETTMEGWTSQTRMGLEALLEEHKTIDLNLDLQAPLILLPLDPHK
                     WDTPCAVIDAGHIKVTSELISKEKIKSVKEMSVEDYDKIDGSEINRLMFDRFHVSAQD
                     TQILIGPDVRRTISSLAESNVTNNFSILEKIYLNLIVDVSILPKAHNLPKIRSFVSLP
                     ELSVSLNDEQYKYMMLIINNIMPTPIELNSDEFLNSDKGNAYIESKKMEIKLAQTANM
                     LKNKSESELNQKLLDINFDINNINLTVYHCKDTQTMKSTKLISIVGNSLKFNFIQRVK
                     EMKVNILINSLDVDDYIVMDNLGSLPTKLISSKSNLNETSTDLFQVDYLRQQRIVNHE
                     GTLIEVFDQNVELDMEQLHLSLNAKSVLTLINYSLTTFIDPTGAEAPADVLRHNDEDR
                     EDAPQKTLMKIRMAGLTMDFNEDNINIASWILTAGEFSLILLPERMKISMKLGNMEVL
                     DGNSSKTFNNEFKKLITLEGEEEVELIYETFDPADNDKDYDSIFTYKAASLHINFVEE
                     SLNRIISYFNKFMRMKSLFEKAREVTYNQTPSIDSVNNMKLDVNIRSPIIIFPKLSEW
                     SDEHFDKLEFHSGDFIVSNVFIMANEGHKINDILINIKECMLSSVINLESNSIQDFNI
                     IKDLGLDLQVKHNPHSKIDEPTFNVNGVFNTPPTSLTELQLSFLFSLSDRIMQAFSID
                     DVQSDELDKELHYVNHVVDTASDDNLSSSGLIDSINPSPQLKKADEEGVYVDFSFEIP
                     EIIISLFNNTVECTNLDKYGLTKFKFEKLGVKLITNYNGTLSGESFIGSFTIDDIRDI
                     KDNKHTELIPKLSAVENSFISKVSRILVNGSLTTTLSITIDNPMVILAMDYLFELKSF
                     YDNSIGLASKVAVSGTVNLPSEAELKPTEDDIQSNPFQYTFSIINPQVILLADVSDIK
                     SEAVVFKVGEIQFSSQNIQSLLVNNVGVFLSKLNSENDYKVRLLDDFSSSVIIDQRNS
                     TTENMLTEITSSIEPLLMRISLRDIRLAMLIFNKTVALMNKASQESSAKRKSLTDSVS
                     KEEIPTGTDLNTTSKELVKRKSNDANSTIPTILGENLHIEVGGLRLVLIGDVHEMPIL
                     DMNINAFEVFAKDWSTELDAMATLETYVNVFNYARSSWEPLIEPVPISFHLSNGLDED
                     SCMVFEIVTRKIAEITLSSRSLSMLSQIPNSLSGELILKPRGLEKPYILYNDTELNIN
                     VWKVTDTQDERINLITLAPGSSLPWEFEDWRTVREKLDIDNKRSMLGFAISGSKYSTT
                     MKINATNEGEQLFVLEPPVDHVHNRLICDLKSTEDNIKMITFRSTLILENTTEIDIQF
                     MVINENNPKQIIHTVSPSDTKSIPLEMAYSSIILVKPVSDDFLWPDQKIQWKDLLTKP
                     ISIECKSESTEEKKYYFEVNGKFDTKEPLAKIFPRMKIIVSSPIVIENLLPCDLNFSL
                     IDKRKDGNNYTFLEKRGKIFIHDVSLDTFLLLSVQPLMDNAIPSKPAIVNTPPKSSLD
                     TETDVSLTLDDGEQMLKLKLFYQSVEGTRAKIIRIYSPYIIRNSTGKEIFIQDGNGNL
                     AQSRLVLDSQNSYYTTPKMFSFLGGIYDNNRANIRFKDSDWSIPLSFDAIGQSHDVVL
                     NIPNKNQDSNLGMTVYEGEGKYSLSKIIEFAPRYMVYSDLDFAIELCEAGSTASMELE
                     AKASVPMYRMRNIVNKQLKIKFLGANTDWSSPFFIKDVGSTFLKVLKTDKTHMLLKIE
                     IVLDKATLLIRITDGKNLWPYSIRNFSDQEFIFYQRDPRVIDDYYESEEVEEITNIEY
                     KPLYYRVPARSIMPYAWDYPAARQKRMILTCRGRKREVNIAEIGNLTPMRLPGNAPND
                     PVDMVEISVIADGPTQALTITNYSQSSSLYKLNTKFNASSSSINSSREIFEGKEVKET
                     IFRKLIINFKGLGVSFINKRLQELFYLSISDVKLKYIDSDLSQTFSWSVQWLQVDDQL
                     FNANFPNVVYPTLIEGVAADMSDRPVLLGSVSKLKDDKYGVLYFKHLTVLLQELSIQL
                     DEDFLYALIDFVKVPGAAWNKNTQEVIYNDIVTLPEFKELKLSEDVYFEVFHIQPTML
                     HLSFVRSETITKEDEGASKLDDSERNTRTLSFFINVLTMTIGNVNDAAIRMNSLYMDN
                     LSVPVDTLINSIRTHYGQQFIYQLHKILGSADFLGNPVGLFNTISSGVWDLFYEPYKG
                     YIMNDRPGDIGINIAKGSLSFAKKTVFGISDSMSKVTGSMAKGLSITQDMEFQESRRL
                     QNRITNNSRNVLATSAQSFATTIGSGLSGIALDPYKGVQKEGAAGFIKGIGKGLFGLP
                     TKTAIGILDLTNNLSQGVKSTTTITNATTNPGRVRMTRYIGHDNIIKTYNLREAQGQC
                     WLKTANGGVYMNDRYLAHVVLPGRQLTVVVSMQHIAEIKIADEEIMWSTAYQDIQGII
                     LEKGGIEIKLKSQAEYFIPIADRLERKSIYRNIAIAVTEYNKYCEATL"
     gene            complement(<43589..>44431)
                     /gene="TPHA0F00230"
                     /locus_tag="TPHA_0F00230"
                     /db_xref="GeneID:11535472"
     mRNA            complement(<43589..>44431)
                     /gene="TPHA0F00230"
                     /locus_tag="TPHA_0F00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685896.1"
                     /db_xref="GeneID:11535472"
     CDS             complement(43589..44431)
                     /gene="TPHA0F00230"
                     /locus_tag="TPHA_0F00230"
                     /inference="similar to DNA sequence:INSDC:YLL038C"
                     /note="similar to Saccharomyces cerevisiae ENT4 (YLL038C);
                     ancestral locus Anc_4.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685944.1"
                     /db_xref="GeneID:11535472"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:G8BUS8"
                     /translation="MPLFDSVRNFVQSPTESKVRQATDDDETSGATGTLMNEISVLTY
                     SPKTLKEIVQILKKRLTGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIM
                     LFEYLKNFEVQNLEDEKMGQQIVFICNDICNIINDDDMLEQKRKDVVQFRSSISFPGR
                     KSTDNSHIKTNSSATRGRTGFSLRDRFDERINQKEKQIDSTSETVNEYQFVSNSSSTF
                     RGGTTSLDLKRRSETLRRNNINTTNSDLWALPEEDSLRPDHLLEKENQLEYNTSLSYN
                     NPFD"
     gene            complement(<44772..>46340)
                     /gene="TPHA0F00240"
                     /locus_tag="TPHA_0F00240"
                     /db_xref="GeneID:11535473"
     mRNA            complement(<44772..>46340)
                     /gene="TPHA0F00240"
                     /locus_tag="TPHA_0F00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685897.1"
                     /db_xref="GeneID:11535473"
     CDS             complement(44772..46340)
                     /gene="TPHA0F00240"
                     /locus_tag="TPHA_0F00240"
                     /inference="similar to DNA sequence:INSDC:YLL036C"
                     /note="similar to Saccharomyces cerevisiae PRP19
                     (YLL036C); ancestral locus Anc_4.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685945.1"
                     /db_xref="GeneID:11535473"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8BUS9"
                     /translation="MICAISGKSPKNPALSLKSKCIFEKTLLEQYVATSAKDPITNET
                     MTMEDIIELANTPQQVSMINALNSSTLNSNYSIPNLLSTLQNEWDAVMLENFKVRKQL
                     DLFTKQLSTAMYERDAAKLVAAKLLREKEDLASELSRLTSHIASSESSDSTISEPLYG
                     LSKDTNKESSVLPIPKEFLERIITESQQFVQLSKTNQDKYKLSGSQKLVDNIKKWDIV
                     PSSGLSVIMNSDNGNTFKKAILHSRTINIIVNPDLIKSIDGEFIDNIKYCYSTTDDKV
                     LLYTDDRHQITIYNTETKAAQKVELTDVEDIILLRNHHQIANDYFLWADSQGKIGLTS
                     MDLKKTYIITEKSDEVTNYHSADLHKDGLLLALINDREVLITDITKPSETRITFQMGK
                     EIPDDNSTIKKVQFSTNGYWMLVATEKNVMVFDLRKDPGTLAIEPFNTSEFEFWDTDP
                     SQKYMLTLANSKITIHTFKKATKKWEAPTGSNNQFTFPEQTTDVTSFYVLCSNGKLTL
                     IMKTKTDISICSTV"
     gene            complement(<46771..>48969)
                     /gene="TPHA0F00250"
                     /locus_tag="TPHA_0F00250"
                     /db_xref="GeneID:11535410"
     mRNA            complement(<46771..>48969)
                     /gene="TPHA0F00250"
                     /locus_tag="TPHA_0F00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685898.1"
                     /db_xref="GeneID:11535410"
     CDS             complement(46771..48969)
                     /gene="TPHA0F00250"
                     /locus_tag="TPHA_0F00250"
                     /inference="similar to DNA sequence:INSDC:YHL029C"
                     /note="similar to Saccharomyces cerevisiae YHL029C;
                     ancestral locus Anc_4.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685946.1"
                     /db_xref="GeneID:11535410"
                     /db_xref="GOA:G8BUT0"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8BUT0"
                     /translation="MDYSHQKETSKIPTEETQKLSKKTYKPKNIKQQYQNRQLAQVVI
                     ELINANEHDSLAYLARTKGIPPQLRYLVWPILLKYHPMCISPNIISNTIIWNQETKSY
                     ELNAKESTTSVTETNKGNKNAQKQDINANDNKPDSELESLIKRDLKKYFHIRRKYPDN
                     QQENKTHPAASQPTVNDLETIDDLETIDLLKTSILNFLNKWSKVFSYEPGLAWIAVGL
                     AEWFPLFEEEEISAEGPLLLNVKKHSNVEQSKKQEAQETKNHAVENSAAINETQNEDA
                     TKSKNTTNAPPTSSSSSKVRTNYMRLFTEYPLPTLLKTQLPTSNMFNFSELYERLLLV
                     ILHSPDSIEAKNNIVKHLSLDVSNENSNNNYFPILSGGSLSFQIQLFFKVFSNILPEL
                     YQPLIDEIPYQQNTSSKSWLYWWIKFSGARTLHKLDRARVWDLLLGWRPEPNMNRINF
                     YLNYNQKKFDHLYSTTFSSNVKFLSSISKDDPFWFPDLDSIPIGDKNFPYDYDVFRQL
                     LILNKFEKSNLANKEESKAQESVSDTNDDKIPFSLIDPHIQIIFVYMAILQYNEFKLL
                     EYEESEITEFLNNVPLLSKADNASFKKIGESKKVFKILQPAEEEEKPISGKNIVDTDN
                     FKVNNESSKSKRNTPDISVTTTDSSTLEDITRQSTQSESKFQFPDENIDSISNSTQTT
                     SHMRIEVGNDAKASNSFDNILQMAGDIWRKWLWREIEDTSSDDLFNFVDS"
     gene            <50020..>51600
                     /gene="TPHA0F00260"
                     /locus_tag="TPHA_0F00260"
                     /db_xref="GeneID:11535421"
     mRNA            <50020..>51600
                     /gene="TPHA0F00260"
                     /locus_tag="TPHA_0F00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685899.1"
                     /db_xref="GeneID:11535421"
     CDS             50020..51600
                     /gene="TPHA0F00260"
                     /locus_tag="TPHA_0F00260"
                     /inference="similar to DNA sequence:INSDC:YHL027W"
                     /note="similar to Saccharomyces cerevisiae RIM101
                     (YHL027W); ancestral locus Anc_4.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685947.1"
                     /db_xref="GeneID:11535421"
                     /db_xref="GOA:G8BUT1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BUT1"
                     /translation="MSSVKNILNQEKHAELATDLAASPTHLPSPAGSSCSPVHSDTDC
                     DSDSSHSVPASSAVAPPQPAQPATCSAEKPLPCQWTDCQELFESAEFLYHHLCQDHVS
                     RKSRNNLQLACHWGDCKVKTEKRDHITSHLRVHVPLKPFACPTCVKKFKRPQDLKKHL
                     RIHITTGSEVRIKKKRGPKSKKEKELILQQQQLLQQQQQQQQQQQQFQGNQYPRKYND
                     YLTPTVDVQAYLPNELLESTHAPTKNQLLNKLQTILPPISSTLPAGSNYASGYPRAFN
                     RRDAAMFFTDLSKSITNAIKPQLNNTYTNVTAFQNKIPMPNSLATNAGYPKIRSYYPP
                     SNNMMSPPLASLPQNSQYLISTSQPVSNYRTFQKNAILPPISQVASLPTSSQYGNMSE
                     LPSLSTVGNNSIIHPTPHNSNNVGNEPPKFETFKREVFSTTQKSCGKMHDDENDEPAL
                     VESFSGLSVDVRNNEDDEDDYFECLKTINEIREYLICSMLEDDFEGEWENTENGSSIV
                     KNNIIGSLSLPRYPKIIV"
     gene            complement(<51618..>53564)
                     /gene="TPHA0F00270"
                     /locus_tag="TPHA_0F00270"
                     /db_xref="GeneID:11535512"
     mRNA            complement(<51618..>53564)
                     /gene="TPHA0F00270"
                     /locus_tag="TPHA_0F00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685900.1"
                     /db_xref="GeneID:11535512"
     CDS             complement(51618..53564)
                     /gene="TPHA0F00270"
                     /locus_tag="TPHA_0F00270"
                     /inference="similar to DNA sequence:INSDC:YNL279W"
                     /note="similar to Saccharomyces cerevisiae PRM1 (YNL279W);
                     ancestral locus Anc_1.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685948.1"
                     /db_xref="GeneID:11535512"
                     /db_xref="GOA:G8BUT2"
                     /db_xref="InterPro:IPR026777"
                     /db_xref="UniProtKB/TrEMBL:G8BUT2"
                     /translation="MPQNTYLYLQFHDRLTQIWLNKYTLVLILAALKLLMFLFSIKSS
                     LNIAQAYVLANCDTIDNLYAQAIEDTPYYIAKFGNYMIKESMEGSVKATLTVLSLLVY
                     SSEELFKFLIDLYLGTYECLIVSAIDGTVDVATNATEKLISYVNGSISTLANDLDNGL
                     DDISELINKVLKVADKVENFLTGDDDDDESQIASVNLTISALRNLYIPSSINDKLEAL
                     SAKTPSFSEVKNKTQNLIAVPFEKVRNEISDIDVSKIVGNPTNLYVPSTNTSDLSVET
                     SICSPHKAEIVSFFQDLSSVIRITVLVFVILLILGAFAMMIPEWWEEKLLWTKLYKLD
                     DSTYSGNTVEIESSSDEEINNPFNDKNHIKTNNRSDSDFGDVIKSYFECFNPWHNRVY
                     CLFTKISSSLSFLRRSETNTSDKPYLRWTILYVTSERALLILGIGLLGLLVCIVQLIT
                     ISILNSKLNAFEQNSSMLSLSANSSAVFDKNLELWGNQTNIYINDTQTNINEQVFGWV
                     DTTTKSLNETVTDFIDDIDDALADLFNGTLLYSPMKSVVSCVIESKLYAISNSLTWIN
                     EKAEVTLPRVNITEIKDVIVASNTSGTTQNVVERITADTLKFIRNIIKMYKQSVEIEV
                     EIVCAILGIWLLQIPIALLILYFK"
     gene            complement(<54034..>54873)
                     /gene="TPHA0F00280"
                     /locus_tag="TPHA_0F00280"
                     /db_xref="GeneID:11535513"
     mRNA            complement(<54034..>54873)
                     /gene="TPHA0F00280"
                     /locus_tag="TPHA_0F00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685901.1"
                     /db_xref="GeneID:11535513"
     CDS             complement(54034..54873)
                     /gene="TPHA0F00280"
                     /locus_tag="TPHA_0F00280"
                     /inference="similar to DNA sequence:INSDC:YHL026C"
                     /note="similar to Saccharomyces cerevisiae YHL026C;
                     ancestral locus Anc_4.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685949.1"
                     /db_xref="GeneID:11535513"
                     /db_xref="InterPro:IPR018852"
                     /db_xref="UniProtKB/TrEMBL:G8BUT3"
                     /translation="MTEPKVPKQRSWLYIFVYLVLYEGLMSGAISGGINFAISYGMYA
                     KRSRQVTLWRFPHTMSGDCAVTLFVQTVLTHIIEEIMVGWDCYTGDTFYFPSLPLGGR
                     LNKWAFKALEVDRGMVPFGLRPEAKEGAKPTFKGYVKQLITYDENRSNFVNFIICAVH
                     KVILALLIAIPIWFVEWPVTMGVLAGIGKYIGGIEYELGNYPKPQVIKLVYTVILGWV
                     STPISIAAVMLRNQWYVEYYSGNNQVLNGENAKLFDLEKTKKDNEKIVKNTDTSSSSE
                     SDE"
     gene            <56142..>56819
                     /gene="TPHA0F00290"
                     /locus_tag="TPHA_0F00290"
                     /db_xref="GeneID:11535369"
     mRNA            <56142..>56819
                     /gene="TPHA0F00290"
                     /locus_tag="TPHA_0F00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685902.1"
                     /db_xref="GeneID:11535369"
     CDS             56142..56819
                     /gene="TPHA0F00290"
                     /locus_tag="TPHA_0F00290"
                     /inference="similar to DNA sequence:INSDC:YLL033W"
                     /note="similar to Saccharomyces cerevisiae YLL033W;
                     ancestral locus Anc_4.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685950.1"
                     /db_xref="GeneID:11535369"
                     /db_xref="UniProtKB/TrEMBL:G8BUT4"
                     /translation="MNKPLRIVTNNAITTAEHSLYLNPAKYLVPPELRLCVFAHDNGF
                     LCKVYYRRFMRLKPFISNRAMVRDTYKEYIRYKFKQEKYARKRLLVLGNDHDKLTFLT
                     NDVNDNSHLLSRIHNTLTFIVKATSHISPEIEDVEGLTVDNSYCRKILKNLLTIEYEK
                     QSKISHSKDPSEMYDELRISFNYLQGDADSRVNNKSKSKMYSNSAVFREYDIFLVLLN
                     ETIGTML"
     gene            complement(<56941..>59250)
                     /gene="TPHA0F00300"
                     /locus_tag="TPHA_0F00300"
                     /db_xref="GeneID:11535493"
     mRNA            complement(<56941..>59250)
                     /gene="TPHA0F00300"
                     /locus_tag="TPHA_0F00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685903.1"
                     /db_xref="GeneID:11535493"
     CDS             complement(56941..59250)
                     /gene="TPHA0F00300"
                     /locus_tag="TPHA_0F00300"
                     /inference="similar to DNA sequence:INSDC:YLL032C"
                     /note="similar to Saccharomyces cerevisiae YLL032C;
                     ancestral locus Anc_4.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685951.1"
                     /db_xref="GeneID:11535493"
                     /db_xref="GOA:G8BUT5"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8BUT5"
                     /translation="MTLETISAVTIKAYCDIPHLFQTNRLWKDIDPSQFSIKGYDGKI
                     LLCLSTDLNANNFKFSHSSYKIENDIVSMPVLNKNVSFQSAAHAAVPLIIDDGVHFSR
                     DDLIEKLKPELIKLAIEFDVEIIVTEKSVYERDETEITNAIIYINIVGLISRVQNCEL
                     HTTILVQLVQNKIANTPLFIESLDIESSSLIPFCIGVDMTNIKHLASVYKTDIHIPTL
                     LNDDDMSLFAPQVFFSSRIHSLASEAKHEMSQYIEKLKENIYYRSLTSLSPGKLLYIK
                     TYYQEEIFKLMIKYNTYIKITDDSVKFQSSSNEFLAIVIKLFTTSILHEIVEVQMILD
                     GPFEFTDDNILNELHYSDKSHIVFMRNTSNLSQLVVIGSNSHNVKSTKLNEKHQLLQF
                     LTTVFENEKVNSNLVQLRAIFEIHPDYEEFISGKKNGKLTRIMEGAECLLELKMTEND
                     DNINLFLLTNTYKEFLRSYIQVMDELPAEKSFFIPEVYHRPVIGAGGSLIQTTMRKHN
                     VFIQFSNSFLLPRSEFSHLRYDNVIIRCPTKSESNIIHAKQELNVLAQNYGSTQSKSL
                     VNLSAGQYRYILKTSPEVIGQIEKSKNVYILFPFEQPGSEFLLEIRGTFENSEAAARE
                     LIDQAFGGEIIFDLETTIKDENDFYNSVIIPFNRVYNIIITLQKNHVTLTYNKNNSLL
                     EKCIEELEKYFLNNKLKITKREQIKDFIHIPPMELQDMTLAEDLKGTQMYYHNYNKNQ
                     YTNRDSVPDEIQNTKSYIQYPYYRYGYGY"
     gene            complement(<59665..>62745)
                     /gene="TPHA0F00310"
                     /locus_tag="TPHA_0F00310"
                     /db_xref="GeneID:11535494"
     mRNA            complement(<59665..>62745)
                     /gene="TPHA0F00310"
                     /locus_tag="TPHA_0F00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685904.1"
                     /db_xref="GeneID:11535494"
     CDS             complement(59665..62745)
                     /gene="TPHA0F00310"
                     /locus_tag="TPHA_0F00310"
                     /inference="similar to DNA sequence:INSDC:YLL031C"
                     /note="similar to Saccharomyces cerevisiae GPI13
                     (YLL031C); ancestral locus Anc_4.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685952.1"
                     /db_xref="GeneID:11535494"
                     /db_xref="GOA:G8BUT6"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:G8BUT6"
                     /translation="MIRNRMEQLSIYKIRFLKFRQSHTLYVLYLTAVAALQFIAIAFF
                     TKGFLLSRNVLDDINELKPSMYAANSSNNGFVHQQKFEKTVILVIDALRFDFVIPVNT
                     NNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKFLADPPTTTLQRLKGLTTGSLP
                     TFIDAGSNFDGTVIEEDNLIKQMYLNNKEVFFVGDDTWDALFSPFLSNHSIPYESLNV
                     WDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGHKYGPNHFTMKEK
                     QLQVNNFINDIINVIDDDTLLVIMGDHGMDHTGNHGGDSIDELESTLFLYSKRQNVWK
                     LEDDHSVYNIDDLGSNYKSINQIDLVPTLALLLDIPIPFNNLGWPIKEIAVNELEQQF
                     FSNITLDQLKKYQETNGLFPTGSDKYRMLENLFNTSKENYELSKEYQAYLLMLCKDLW
                     ANFEFPSIAIGIIFLFLSLIILITTTKLIPSIVVSQMVPIFVPLIIMMIFVSHLCLFS
                     LFYVFQPPAFIEERFWCSLLATAIGITLACFSQIFERYSLKWLIFRFFGELSDYWSRV
                     GSVFIILHAVIFTSNSFTIWEDRIISFFIATIGLFTMYEFIFVPNRESTSALLSGVLI
                     AKERDSKKIRNFEEEVYSDCLPLTKIQRALGIYHSLILICCTRISSFITICREEQGDF
                     CTPTFSTSSNYSINTIGILFVLMIVVPFCIQGYYNLTSSFQGSAPIWINLFLRLVLFG
                     VFCLWGLNTVENYLNEPILEINMFKISLARSLAGVSLIALNFGWIFGPLCVNLGITRT
                     KENSKENSATILGVKNIYGSQYFLLVLNIFMAVMIFSKPLAQISLYLMLNQILSVIEI
                     IDMFKLKENIIGPVILNLIAYQHFFTTGHQATIPAVQWDAGFILSETISFPLTHIAIF
                     LNTFGPQVLASVAIALFTLWKQPPLVLKPQTMLGRIVSNCGCLLIYNTVLCLSTFIWV
                     THFRRHLMVWKIFCPRFIFASLSLIVTQIIVILITIAFASGRLIRQINSFFWEF"
     gene            <64042..>66285
                     /gene="TPHA0F00320"
                     /locus_tag="TPHA_0F00320"
                     /db_xref="GeneID:11535602"
     mRNA            <64042..>66285
                     /gene="TPHA0F00320"
                     /locus_tag="TPHA_0F00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685905.1"
                     /db_xref="GeneID:11535602"
     CDS             64042..66285
                     /gene="TPHA0F00320"
                     /locus_tag="TPHA_0F00320"
                     /inference="similar to DNA sequence:INSDC:YLL029W"
                     /note="similar to Saccharomyces cerevisiae YLL029W;
                     ancestral locus Anc_4.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685953.1"
                     /db_xref="GeneID:11535602"
                     /db_xref="GOA:G8BUT7"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:G8BUT7"
                     /translation="MASVSHNTSRISMLGRPPNLKGSSFRSCDNCNCSPGLLSRNNKR
                     SSLLFRKFENTLSRQRSSSINFNVKGSNASVYSSDALCKTSKEINTSERLASLRKQMT
                     KFGLCCYIVPTEDEHQSEYVSEKDERRSFISGFSGSAGIACVTRDLLNFNDKTDPIGK
                     SILSTDGRYFNQALQELDFNWSLLRQGEDKLTWEDWCITEAIEMLKGLGVNNTDKKPL
                     KIGIDPKLITYKESLTFEKKIRKFLVDNGIITEEKAAEEANKFVQLVGVEENLIDLVW
                     GDFEEVPNMPTNDLILLSEDYHGESFASKRSRLLENLRENHHLSESKDDKKSVKNYYV
                     TVALDEIAWLLNLRGSDIKYNPVFFSYLLISDSDDETVLFSNAKYDDNISKYLKDNNI
                     TVQKYEEFWSSINDLATSAAESSHFIIPDNSSWNLVRSVENKNKMIHSPINVMKSVKN
                     ATEINNAHKAQTKDALCLIQFFAWLEDRLVNHETLISEYEAAEKLEQIRKVQKNFIGN
                     SFETISSSGANAAVIHYSPTAESSAMINPSKIYLCDAGSQFLEGTTDITRTMHLTEPT
                     QEETTNYTLVLKGNLALERAVFPEGTNGYQLDCIARQFLWERGLDYRHGTGHGIGATL
                     NVHEGPIGIQLKPHLVDFPLAAGNIISNEPGYYKDGEYGIRIENDILVKETEPSMRFG
                     DKKFFCFENMTLVPYCRKLIDVSLLDPVELKQVNDYNRKIWDSLVNYLQPQSITFKYL
                     KRETSPL"
     gene            <67642..>69396
                     /gene="TPHA0F00330"
                     /locus_tag="TPHA_0F00330"
                     /db_xref="GeneID:11535437"
     mRNA            <67642..>69396
                     /gene="TPHA0F00330"
                     /locus_tag="TPHA_0F00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685906.1"
                     /db_xref="GeneID:11535437"
     CDS             67642..69396
                     /gene="TPHA0F00330"
                     /locus_tag="TPHA_0F00330"
                     /inference="similar to DNA sequence:INSDC:YLL028W"
                     /note="similar to Saccharomyces cerevisiae TPO1 (YLL028W);
                     ancestral locus Anc_4.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685954.1"
                     /db_xref="GeneID:11535437"
                     /db_xref="GOA:G8BUT8"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BUT8"
                     /translation="MATSSVSTDKEGIDTVFTGSSSSRSVVEDIQAFDMENGAAVKEG
                     EDGNAGFPDIALTRKDSIASAAQSKVGSNRQLSRILTGSNPVGVDDEDNDISEPDYTD
                     VPAMGGDRPYPPPLPKQDLFEVTFDGPDDPIHPFNWPLRKKVILCVILCLDCIAISMG
                     SSIFGNGIAQLREEYGIATVVGILGVTLYVLGFAASPVIYAPLSEIYGRKGVIIISAF
                     GFSIFQFAVATAENLQTIFICRFFGGLIGAAPMAVVPAAFADMFDNNMRGKAISLFSL
                     GVFVGPVLGPVIGSYIVQHTTWRWLEYVIGCFSALIFVLICIFMEETHHPTILVNKAI
                     MMRKKTNNWGIHAAHETVELSIRDIVQNTITRPIIMLATEPVLLIITIYNSFVYGILY
                     LMLEAYPIVFVEGYGFLVNGELPYIALIVGILICTVFLWKFEEYYLKKCREAGGLVPE
                     IRLYPIIYSGVVFAIGILWFCWTGYYPKKIHFMVPTVAGAFIGFGLFGIFLPCLNYII
                     ESYLFVAASAVAANTFLRSGFGAVFPLFTNYMFHGMGVGWAGLLLGLFAFAMVPVPIF
                     LVKYGKRIRVKSKYAYSG"
     gene            <70646..>73366
                     /gene="TPHA0F00340"
                     /locus_tag="TPHA_0F00340"
                     /db_xref="GeneID:11535401"
     mRNA            <70646..>73366
                     /gene="TPHA0F00340"
                     /locus_tag="TPHA_0F00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685907.1"
                     /db_xref="GeneID:11535401"
     CDS             70646..73366
                     /gene="TPHA0F00340"
                     /locus_tag="TPHA_0F00340"
                     /inference="similar to DNA sequence:INSDC:YLL026W"
                     /note="similar to Saccharomyces cerevisiae HSP104
                     (YLL026W); ancestral locus Anc_4.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685955.1"
                     /db_xref="GeneID:11535401"
                     /db_xref="GOA:G8BUT9"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:G8BUT9"
                     /translation="MNDEMQFTERALNVLTIGQKLATDHQHAQLQPIHILAAFIETPE
                     DGSTPYLQNLIEKARYDYSNFKKIVNRTLVKVPQQHPAPAQITPSYALGQVLQDAAKI
                     QKQQKDSFIAQDHILFALLNDASIKQLFKEAQIETEAVKQQALELRGNQRIDSRGADT
                     NTPLEYLTKYAIDMTEEARLGKLDPVIGREEEIRGTIRVLARRIKSNPCLIGEPGIGK
                     TAIIEGVAQRIIDDDVPTILQNSKLFSLDLAALTAGAKYKGEFEERLKGVIKEIEDSK
                     VSIILFIDEIHMLMGNGKDDAANILKPALSRSGLKVIGATTNNEYRSIIEKDGAFERR
                     FQKIEVSEPTTRQTVAILRGLQQKYEIHHGVRILDSALVTASQLAKRYLPYRRLPDSA
                     LDLVDISCAGVAVARDSKPEELDSKERQLQLLQVEIQALERDKDADSTTKERLQKAKQ
                     GEASLIEELEPLRKRYEEERHGHQELTDAKKKLEELENKALDAERRNDTGTVADLRYF
                     AIPDIQKHIQELEDQVADEQSRAGANSMVQNVVDSDTIAETAARLTGIPVKKLTESEN
                     EKLIHMEKDLSSQVVGQLEAVKAVSNAVRLTRSGLANPRQPASFLFLGLSGSGKTELA
                     KKIAGFLFNDEDMIIRVDCSELSEKHSVSKLLGTTAGYVGFEEGGFLTNQLQYKPYSV
                     ILFDEVEKAHPDVLTVLLQMLDDGRITSGQGKTIDCSNSIIIMTSNLGAQYIQQQPGS
                     KVQEATKGLVMAAVKQHFRPEFLNRIAAITVFNKLSRKAIHKIVDIRLDELQKRFEEN
                     DKHYKLELTDEAKDFLTRFGYSDDMGARPLNRLIQNEILNKLAIRILRKEIKDKETVK
                     VVLNKTENASNDIVESLDVLPNHEATITDGLDFGEMDDIEMDVEPSIDLD"
     gene            <75008..>77479
                     /gene="TPHA0F00350"
                     /locus_tag="TPHA_0F00350"
                     /db_xref="GeneID:11535402"
     mRNA            <75008..>77479
                     /gene="TPHA0F00350"
                     /locus_tag="TPHA_0F00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685908.1"
                     /db_xref="GeneID:11535402"
     CDS             75008..77479
                     /gene="TPHA0F00350"
                     /locus_tag="TPHA_0F00350"
                     /inference="similar to DNA sequence:INSDC:YHL024W"
                     /note="similar to Saccharomyces cerevisiae RIM4 (YHL024W);
                     ancestral locus Anc_4.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685956.1"
                     /db_xref="GeneID:11535402"
                     /db_xref="GOA:G8BUU0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BUU0"
                     /translation="MNHKLKKNINDDAKEVKEDGEVVAATTEEEEEEEKEEEEEDERG
                     EVRESANSFRGRPSSCIFVASLAATLTDDELCISVTENFKKFGELARVKVLRDPSNRP
                     YAFVQYTNDKDAKKALKKAQGTSLNGRLLRCEPAKVNRTLFITHPIKKISSIDIQRLC
                     EKFGELELVVPNRENNQYIKRYSYPLSNSNSWFVQFAYRDDAIRAFANFRGDNYGSNN
                     THHHNQNNQNNNHINLNSLGTPSFKTSDGYEDNDSNENLNNFWEVDWVQNISVPKHFN
                     LLIKNDKETPTNVKVKNILLKSKDSKIDLTTTSSIRKNKYTARSQYSSENDNGEIIYN
                     SETDSEGFVEYDIDNSSTKLINELSLEDKDQHPILTRDGNFYSDEKINCDTNTSNDIK
                     HGEDEEVSDEDSVDEDEDDYYGNTTDDSDSVRIDKKSIFVGQLDPGSNKENLTDRFST
                     HGRILDLNLIVKPTNIFAFITFDTEAAAAAALERENHAIFLNKTMHVQYKEIGGLHRK
                     KSRFNKNFGNSFLDNSKTFTGPQFNLAPPPINIYRKRNSMDYEPANMYNYMSPLPPMP
                     IPPNCQYPTMTDYEMNNYIPYSKNSNYSFRRKSFPVRTNNSTANHSNSYPRYVVSPNN
                     YNFKNDYASNTISTNTCMSNTTGDLVSDKTDSIENSIVTSKDNDSIEGLVNLQNKGVS
                     NEKSNIKNKVDELTDSKSDINITEVSPTSRNAELNNKKKFYRRNSFYHQPIKPYYFPQ
                     YYYHPMNYPVGPNIASQTANSSYMMVYPFPPPPPSSTMMNSSMSMGRMSSNFQGSPPL
                     ASEHRYNAADAESFSNPNKSYELDY"
     gene            <80013..>83468
                     /gene="TPHA0F00360"
                     /locus_tag="TPHA_0F00360"
                     /db_xref="GeneID:11535419"
     mRNA            <80013..>83468
                     /gene="TPHA0F00360"
                     /locus_tag="TPHA_0F00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685909.1"
                     /db_xref="GeneID:11535419"
     CDS             80013..83468
                     /gene="TPHA0F00360"
                     /locus_tag="TPHA_0F00360"
                     /inference="similar to DNA sequence:INSDC:YLL021W,YLR313C"
                     /note="similar to Saccharomyces cerevisiae SPA2 (YLL021W)
                     and SPH1 (YLR313C); ancestral locus Anc_4.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685957.1"
                     /db_xref="GeneID:11535419"
                     /db_xref="InterPro:IPR013724"
                     /db_xref="UniProtKB/TrEMBL:G8BUU1"
                     /translation="MVKGDDFSASHKQAIYKHYQSLQIFFNITGIKHDRSKSVRAQKA
                     RLKLVKLSLLQFYELSTDVYDELNRRISEDQTTPNYLLPEPTFHLKRNQARQKLANLS
                     QTRFNDLVDDILYEIRRRKLNIDTSSNEMDTTLESGADNTFNSTVNSIAPNPSLQEIK
                     VIPKRASINWSSDEEKDEAEAKNEFKQNEEQQPQEDLNNSLSYNTETDINEAKEVNLN
                     QALTRSVEGPMASATNHTIETADEKSLVNHNIDNLASTENVLEKVIDEHYNNSNATEI
                     TSSEVANVPDTKLLLQIQQLTEELQKSKEENEVLRKSSMEAEPQEKYNSEFNSQFKEE
                     LTALNSQINSLLIENENLKQTVSELKLERNLEPTMSTNEMLTKLHNRYPLEKNSISAY
                     ISSDGIIPIDLVEYLYAAFNYFYELLIKDHPDSLGSDLFETLFKVSDTINKILSAVDT
                     NGFKSNIVLIKASLSHLITTVRYYSLYTSLLPKVTIQAAITEVAFSTFKLISTAKITG
                     DDHTIDENSPGIINNKNITTSLRNISSLPDNGVPTSPLDGKSVNSSSHNISDMKNRSL
                     LENLNEDEELSPVKPLKITQKANTSSPLKSQYQRRISGAGLFSSLLDSNRKNGSTVSK
                     IEKRQLKVVSSSSPVTSAGETFDKDFKLNERQSKISTDYHPLTKDSNDHENPTGRSDN
                     STLRNKIEKLDNHKDNKLNDFTKSSNIQTKPDRIPPAIIIPKKEDRVKPILIANGTDE
                     AKPIVEDIYSTKSNKGVDFTDTEDKTIDEDLDKAVEEDLNKSVETGRVIRDNKSSQEN
                     ADLTVNTTVNAMNTTNDSSIVDVSSEDNIKGKVPRSVMKEIQKVMPIKKESKKIRKMK
                     EFDTSYDEEHAVPAAFTDKMKKFNNVNGIGLRVLPDKPNSQNTEIELKNELQQNLVDS
                     VQPRSLERKSTEKSFPPTSSKITDKMKIALEEDELDIKQREVTQPNVVKKRAEMNPDN
                     REESEEESEEESEEEFDIDAFDIENPDNTLSELLLYLEHQTVEVISTIQSLLSSIKLS
                     NSTKGKLRSESNDISQVIKQMCNATSVSMNQSRNGNLKEHGSWVVQSLADCKRRIIML
                     CDLNDSGDFNSVANDSEFADKHFKQRLAGIAFDIAKCTKELVKSVEEASLKEEIEYLN
                     SHMKQ"
     gene            <83890..>84681
                     /gene="TPHA0F00370"
                     /locus_tag="TPHA_0F00370"
                     /db_xref="GeneID:11535370"
     mRNA            <83890..>84681
                     /gene="TPHA0F00370"
                     /locus_tag="TPHA_0F00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685910.1"
                     /db_xref="GeneID:11535370"
     CDS             83890..84681
                     /gene="TPHA0F00370"
                     /locus_tag="TPHA_0F00370"
                     /inference="similar to DNA sequence:INSDC:YLR312C"
                     /note="similar to Saccharomyces cerevisiae YLR312C;
                     ancestral locus Anc_4.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685958.1"
                     /db_xref="GeneID:11535370"
                     /db_xref="UniProtKB/TrEMBL:G8BUU2"
                     /translation="MRNEDTDLEFSWKFINENDGDDVLSSSSANSSDICETENDVSQI
                     NKRSLELPVSESKQEETNLSGAEVSGNEERSLATNTYLLICVGIGITILLESVALLYF
                     IHFEKYSFKKHDEGSGANPYRQNFETIVDYIRPDAKDNFHYEGYLQQQLDNFKTGKYY
                     IDFEKNIAIPLKNSTKIWRLGGKIENFNQFQAGYEDVFEYDFEKDVEQILKLIYEDLN
                     LIWIVTKTTINHSAWLNNTIKLLTNISSKLDHWKINIYEKVSYSL"
     gene            <85560..>90416
                     /gene="TPHA0F00380"
                     /locus_tag="TPHA_0F00380"
                     /db_xref="GeneID:11535371"
     mRNA            <85560..>90416
                     /gene="TPHA0F00380"
                     /locus_tag="TPHA_0F00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685911.1"
                     /db_xref="GeneID:11535371"
     CDS             85560..90416
                     /gene="TPHA0F00380"
                     /locus_tag="TPHA_0F00380"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_SDC25,YLR310C"
                     /note="similar to Saccharomyces cerevisiae SDC25
                     (Scer_YGOB_SDC25) and CDC25 (YLR310C); ancestral locus
                     Anc_4.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685959.1"
                     /db_xref="GeneID:11535371"
                     /db_xref="GOA:G8BUU3"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:G8BUU3"
                     /translation="MPSSHAHSHAHAPWTTATSTMSSHPLTTVVPIDRVVAIARHPTS
                     SNHPSDTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKPYRTVSPGA
                     KVAGNRRVSGARTGSGSAKLSSSSLSLSQFRSHSVSAANNAIPNSGRRCSAYSLSPTE
                     TSSTNVMLNPATPPVESGVIESGVTAHPTSLPGGSLTQNQNQGSFIPAVSPMVKSKSV
                     GSPIYPAPAKDKGRPTAHGKEQDRNTVERQVLARHAVSVDYHSDINTGGFQTGSVVDK
                     QGILTLDEVKAVVYNFTYKRSAHADRGHKFDNVSSFENNIINLLLDWKPIQNPGNESG
                     DRSGSGNSILYYNEFLKIYCKSLPIFDFDKIKESIKIEENDYITEEKKYSQNNNNDKS
                     KGVGNPVSNTTNLFRSKKYHNAFYYHQKDIRYWFELKDLIIKNLTSAHNAILSMNAKK
                     FEKYFSLSSDYITYLNLACHLFKKYHLTNLKNSILTKQLRLFLKRIMHSLSVISIKSA
                     MFFEISHINTKLDPDLKKSFTAKNSIDPLYYSQMERSVSKDIKNSLTLAPITPVLSRN
                     QETLNTPTPENNMEYLNGIDPVSTGITSPFPGIINSKSNSISTLRNNSENNIKFDLSM
                     ISHIRIFELIDNEFQNINKNVISLYQLIINNGNTHLVSPNKTTNVVDDLDALLLPQLL
                     PRFIKGSLNGGSWKNPFVMNSKIYPQNSKNDSKNHSVGSHNYNNYYNDQKIEENNDND
                     NDNSNNYNNLEVDNGKFISDYILHSKLLNNESVSKQNQSSSTMTDYSVRRGRHGKHKA
                     KEDYPLNNATLKLLKRLSLVALAKFLPEMNHKRNNASSRNFEMKSIQNIKILNQSASK
                     ERNLEIISKTYEEINVNLLVLEVMENLDLSIFINLKRLILNPSQTSNDTETEEFLNHA
                     LCIIASTLMDFYNIKQLLHDIYIKLVMSAQQVTIDDDPYSFQSMKPNFFVNYYDPKRS
                     DSNFMNYSKYHLSINEIENEKKYNNLSDELYNFLTSQDIENNSMNYLDTTIEFKDTLH
                     RYKELITHAYNVVEQLEIERENLLNYSARMMKNNLIIELLKNDKEFKESNISTNYDIE
                     NYVIISDILNRHDSESRDDLFDFTNLPSDRFTLDDANIELGIQSESQSRHSDDSGESD
                     LEWYLKCDDEENLFYDSKGRVKYGTKEALIEHLTRHLKPDHQFIFTMLLTFKSMFSTL
                     EFLYMLVYRYNISPPQGLSYDEYHEWITKKSNPIKHRVVEVLNLLFTDYWSDFYYEDG
                     LEVVLDIANVAVADDIPGSQKLVEIIEKNNIIKSASADNILKEKVQEVSSNPPANNTA
                     QTLLFTSKLFKSKKFRITDIDVNVYAYQLTLLEHQLFSKITLFDCLLRAWGEKYLNTK
                     GSTNISDFISYANKLTNYISYVIVTEREPKERAKIIEYFVNVADKCKELKNFSSMTAI
                     ISALYSSPIYRLKKTWPYLSSESNAILAELNSLTNSTKNFVKYRELVRAVKNVACVPF
                     FGVYLSDLTFTQYGNSDFVDGSTELVNFSKRNIIADIIFDIMRFKNYNYDLEPQMELQ
                     NYIKTSLEGIPHIEKQYELSLQLEARVNNNAYLKATYVNGSKNENANINIEGKGSKLL
                     NFGRKNNH"
     gene            complement(<90730..>91378)
                     /gene="TPHA0F00390"
                     /locus_tag="TPHA_0F00390"
                     /db_xref="GeneID:11535632"
     mRNA            complement(join(<90730..91308,91376..>91378))
                     /gene="TPHA0F00390"
                     /locus_tag="TPHA_0F00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685912.1"
                     /db_xref="GeneID:11535632"
     CDS             complement(join(90730..91308,91376..91378))
                     /gene="TPHA0F00390"
                     /locus_tag="TPHA_0F00390"
                     /inference="similar to DNA sequence:INSDC:YLR306W"
                     /note="similar to Saccharomyces cerevisiae UBC12
                     (YLR306W); ancestral locus Anc_4.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685960.1"
                     /db_xref="GeneID:11535632"
                     /db_xref="GOA:G8BUU4"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8BUU4"
                     /translation="MLKLRELKERKKRETQFLEKTGGATTGEPNLISLSPGRIRLQND
                     LDHLNLPPQCTLELQSSLSDMNEQPLITLCISPREGPYLGGAFKFNLKFNEMYPIEPP
                     SAICLNKIFHPNIDLNGKICLNILREDWSPALDLTSIVIGLLYLFLDFTSTDPLNQQA
                     AEVLANDRNRFCELVQRAMLGSEINNVRYDRVV"
     gene            <91892..>97645
                     /gene="TPHA0F00400"
                     /locus_tag="TPHA_0F00400"
                     /db_xref="GeneID:11535532"
     mRNA            <91892..>97645
                     /gene="TPHA0F00400"
                     /locus_tag="TPHA_0F00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685913.1"
                     /db_xref="GeneID:11535532"
     CDS             91892..97645
                     /gene="TPHA0F00400"
                     /locus_tag="TPHA_0F00400"
                     /inference="similar to DNA sequence:INSDC:YLR305C"
                     /note="similar to Saccharomyces cerevisiae STT4 (YLR305C);
                     ancestral locus Anc_4.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685961.1"
                     /db_xref="GeneID:11535532"
                     /db_xref="GOA:G8BUU5"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:G8BUU5"
                     /translation="MTSLRSQALKKLAQLSSDESAQFGVANDGSSTLDMLTHSLPIFY
                     STNVSKLYTIPLNLNEWDVLYAITSSKVKSLEQAHKLLDDVISVYFVESPRQRFSDVL
                     IMKFKQELLRNPNEISTFQLTRFILSISNSFPELNDKCFSLIEKYLSLVQSLFLIKPS
                     VLFSFLGFLNAVSSSMDDVSIDLSKKTWCSIINIINSSNFFQEIEKVLSSSSDFINDS
                     VVEYFKAGHEISGPLFFEVITSIGLALANTIVFKNMKDIGIDILNDSQMFSRNILQLK
                     HIEYNIDQDPSIATDINITTIDTFNQILKNNAEVLTSLTDFALENAADLDNLDLSTLN
                     RAKYTFNSRANLLQITCLVPFYSSLESKMFEDMTSVVSNYMENILLSGYISPQLIKSI
                     ISSVSLLNYYTEEYSSTILRLFPILVASDNITRETVEEVSVTFTLGLQPLNEDTIVNT
                     IYSINNMITVNDNGSPSSLIRERKLTGTISSMPMKGRSLTIDTLDAIKNFSSAHNSHE
                     SSPIPGQSLSNATFHGNLFENCISASIVITNNYNVPSITALTTTILTQKFGVISKNLD
                     KIIIKFLAKLVTCVTSAEFSLILKFYRLATQTSAKNDDANLSADIVSAKVFIANQLRK
                     GPKSSEIFKLYLHDLLDSIISSGEVEHKEHRTDTEISKVAEQISSLLRPLSALLPTLD
                     EEPLDLSSDELFTNMFRNIWFNMAIHGFYYNAEFLLPYKKYLLIIAYNTSPLASDFPA
                     NKKEISVEMNTVLRRSTSSTIEKKQKNLISGFLSSSTVQSRSPACERIMFLAAAHHLE
                     FLRCDAGDCSKMLLYFSDSSIISSSISRSIDLMNTAITHKYTNSVQLGNLEIFNSKAV
                     AKQLNNIILLLAHKNEMLQNSAFHTCERLIKTVPSSLCRHQSLYTLLDLMTVIFDGVI
                     DCERNRFEPHYIFHLKHSKTKVLLQNSISWRRNALSRLSKSAKSWIKIVMSKCPLDLK
                     MLFHSYLSDFNDYNIEHTVEYGVSFAIEMAGAILPVDRELSRLSLVGNEKPNNIAGFF
                     SQHSWKSKYLVDMVISSSPVDIYKQIGEYAQSIRTCISEKTTIGQDLLNKIFDLSFAL
                     IINRTPGSISLIKDLVHIPFEILTGNSMKTGINIWLSIMKEREDLSFYLLSEIGMCWM
                     RSIDNKIGLYSNELDLVKEENQMMEYKEYNKKLINKNISLAESLLKPHRLLINFLSSY
                     FEGSMFQSHSLLKLFNIWILNAVTELKTASLHPYARLVRNELIIFAILVLNANLKRPT
                     KAIPDLSSSIVIGNLSWFKKPLSWPFGADQLRNEADLAVSVELLSKLEHIMPTLSAYC
                     KNESALLKIALKLDIYNMKTWLSPLAKIDKPKTPLSLELLNAAIKIDPQIAYNISQFL
                     NVDKGKSALLSAIVSNPLQFVGVSDVLDLLLSSSSSSKDRNNLHYITYWSPTTPLKSI
                     NLLLPPWTTNKYILQYAVYSLESHDVNVTFFYVPQIVQCLRYDKTGYVERLILDTAMI
                     SVLFSHQIIWNMLANCYKGDEGLIEDEIKPKLDLVRKRLVAKFSTRHREFYEREFKFF
                     NEVTGISGKLKPYIKKSKAEKKQKIDEEMAKIDVEPGVYLPSNPDGVVVDIARKSGKP
                     LQSHAKAPFMATFKIKREVEPDDSTASLSSNAEGESSKNGNKKLVEKWQAAIFKVGDD
                     CRQDVLALQLISLFRTIWSNIGLDVFVFPYRVTATAPGCGVIDVLPNSISRDMLGREA
                     VNGLFEYFITKFGNETTFEFQNARNNFIKSLAGYSVISYLLQFKDRHNGNIMYDDQGH
                     CLHIDFGFIFDIVPGGVKFEAVPFKLTKEMVNVMGGSKDTAAFKDFEELCIKAYLSAR
                     VHMDAIIQCIEPMIGSGLPCFKGSKTIKNLQNRFQPQRTDQEAAVFMKGLIKKSYESL
                     FTKGYDEFQRLTNGIPY"
     gene            <98503..>103215
                     /gene="TPHA0F00410"
                     /locus_tag="TPHA_0F00410"
                     /db_xref="GeneID:11535379"
     mRNA            <98503..>103215
                     /gene="TPHA0F00410"
                     /locus_tag="TPHA_0F00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685914.1"
                     /db_xref="GeneID:11535379"
     CDS             98503..103215
                     /gene="TPHA0F00410"
                     /locus_tag="TPHA_0F00410"
                     /inference="similar to DNA sequence:INSDC:YLL015W"
                     /note="similar to Saccharomyces cerevisiae BPT1 (YLL015W);
                     ancestral locus Anc_4.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685962.1"
                     /db_xref="GeneID:11535379"
                     /db_xref="GOA:G8BUU6"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUU6"
                     /translation="MFSNVTMGCPNGFHPYLDNHTNALTPCFLSLVNLVSVLFFSCVG
                     VIQLIQLLRETKIPPNFKYKFRWSSLPSRHLLHITDISLQVVILVLQLCVLFSNSKSE
                     QPLITQYAILSNIGFLVLISYPTQYLEYYKSPCTIGNQIFYFMFQICLVSFQIIQRFT
                     HGNRDALVTVSGKYSSILECLLLFNTIVIFIYETRYFKPAPQVIDFYKSNDLFITNHA
                     LADIWFMWMNKLISQTYKDKKIKDPHNLPLPPIDLDIRTIATRMESSWEKQKWNGTNS
                     ILRVILTTFCKSLIIAMLYETTTDILTVIEPQFLRVFIKTFEMNETNVYPPLQGAIIV
                     VALFLSKFISTLLGNQFYIKIFEVGLGIRGSLMALVYKKSLRISSDARQKHSSGDIIN
                     LMSTDVLNLQRFFENSQSIIGAPIQIVIVLISLYLLLDKAVFAGMISMVIMIPINAYL
                     SRKVGSLYKTQMKYKDSRLTILTEILNSIKSIKLYSWEKPMLKKLLHVRNDLELENFK
                     KIGIFSNLIFFAWNCVPLMVTCSTFLIFSMISDVPLSPDIIFPSLTLFNILNDAIYVV
                     PSTINDVIQANISMKRLRDFLLAEELDDSFIEYKSPSETDDAPVIEINNATFLWQSKK
                     IINENSSTDEESNIETSKAALKNIDNFTVKKGSLTCIVGKVGSGKSTILHAILGQLPC
                     ISALDQTRAPKVTIRATSIAYCPQEAWIMNSSVKENIVFGHKHDENYYNLVIQACQLA
                     SDLSILPDGDETIVGEKGISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSK
                     NIIKYVLSKETGLLRNKTIILSTNNVNVLKNSQKIYAIEKGEIVEESDYENVMNSSDA
                     SRIKKLIEEFGTSTSNSNEVKETSSENSSSEIEDKTSNATELLKKKDIDEDNDIVESI
                     VSFDAENMFQNISMVNSRRASMATLKRKPVLDLDKSKKKTAQQEETKEEGRVKTRVYI
                     AYIKACGVTGVILFFVFMILTRIFDLAETFWLKYWSESNAKAGYNKDFLKFVTIYAII
                     GLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIVNRFSSD
                     LEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYYQAYYIMLS
                     RELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFNFFNFETVQYNIDCVFQFRST
                     NRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTSSLMWIVRM
                     TVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKYRENLDP
                     VLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIGLEDL
                     RSNLAIIPQDAQAFEGTIRSNLDPFDQHSDEELWRAVELSHLKQHILRMNEEANDRES
                     DSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDEATA
                     AIDMETDKIVQDTIKNEFKERTILTIAHRIDTVMNYDKILVLDKGEVAEFDTVSNLLS
                     DKNTMFYKLCEQGAYLKE"
     gene            complement(<103419..>104747)
                     /gene="TPHA0F00420"
                     /locus_tag="TPHA_0F00420"
                     /db_xref="GeneID:11535380"
     mRNA            complement(<103419..>104747)
                     /gene="TPHA0F00420"
                     /locus_tag="TPHA_0F00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685915.1"
                     /db_xref="GeneID:11535380"
     CDS             complement(103419..104747)
                     /gene="TPHA0F00420"
                     /locus_tag="TPHA_0F00420"
                     /inference="similar to DNA sequence:INSDC:YLR303W"
                     /note="similar to Saccharomyces cerevisiae MET17
                     (YLR303W); ancestral locus Anc_4.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685963.1"
                     /db_xref="GeneID:11535380"
                     /db_xref="GOA:G8BUU7"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8BUU7"
                     /translation="MPSHFDTVQLHAGQEDPGDNAHRPAAVPIYQTTSFVFEDSHHGA
                     QLFGLEKPGYMYSRVGNPTVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGD
                     NIVSTSYLYGGTYNQFKVAFKRLGIDVRFVLGDNPEDFEKLFDEKTKAVYIESIGNPK
                     YNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIKHGVDIVTHSATKWIGGHGTTI
                     AGVIVDSGKFPWKDYPEKFPQFSKPSEGYHGMIFNDAMGPLAYIAHVRTELLRDLGPV
                     MEPIAAFLLLQGVETLSLRAERQGQNALKLAQWLEKSPHVNWVSYPGLPSHPYHDNAK
                     KYLDNGFGGVLSIGVKPLKDVSDSDPFKKSGAQVVDNLKLALNLANVGDSKTLVIAPY
                     FTTHQQLSDEDKLKSGVTEDLIRISIGTEFIDDIIADFEQSFEKVFAGQK"
     gene            <105556..>106092
                     /gene="TPHA0F00430"
                     /locus_tag="TPHA_0F00430"
                     /db_xref="GeneID:11535330"
     mRNA            <105556..>106092
                     /gene="TPHA0F00430"
                     /locus_tag="TPHA_0F00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685916.1"
                     /db_xref="GeneID:11535330"
     CDS             105556..106092
                     /gene="TPHA0F00430"
                     /locus_tag="TPHA_0F00430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685964.1"
                     /db_xref="GeneID:11535330"
                     /db_xref="UniProtKB/TrEMBL:G8BUU8"
                     /translation="MDSMDSPLQSPAQLKVTWEVTNSESLDIDNTSVCKTVELNIYPS
                     NIRENKKKTIVAEVLFLSVSAFVALYINTYLNDLEPLHKPLKDLTPDENPLLSFKYIL
                     ASSFFVMNRYLFGFSMMFILAYYVIVRFILKLPKAFHDSLMFLFSLSFVNYFISASTA
                     VFISVHAITKTTMSEPQF"
     gene            complement(<106389..>107600)
                     /gene="TPHA0F00440"
                     /locus_tag="TPHA_0F00440"
                     /db_xref="GeneID:11535363"
     mRNA            complement(<106389..>107600)
                     /gene="TPHA0F00440"
                     /locus_tag="TPHA_0F00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685917.1"
                     /db_xref="GeneID:11535363"
     CDS             complement(106389..107600)
                     /gene="TPHA0F00440"
                     /locus_tag="TPHA_0F00440"
                     /inference="similar to DNA sequence:INSDC:YGL048C"
                     /note="similar to Saccharomyces cerevisiae RPT6 (YGL048C);
                     ancestral locus Anc_4.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685965.1"
                     /db_xref="GeneID:11535363"
                     /db_xref="GOA:G8BUU9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUU9"
                     /translation="MSSVATATMNSHESGIKPFFEQKIQETEIKVHARTENLRRLEAQ
                     RNALNDKVRFIEDELRLLQEPGSYVGEVIKVVSDKRVLVKVQPEGKYIVDVAPDINVK
                     ELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVEKVPDSTYDMVGGLTKQIREIKEV
                     IELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQK
                     YIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQ
                     LDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILKIHSRKMN
                     LTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKNN
                     ETAISVAKLFK"
     gene            <108720..>111473
                     /gene="TPHA0F00450"
                     /locus_tag="TPHA_0F00450"
                     /db_xref="GeneID:11535560"
     mRNA            <108720..>111473
                     /gene="TPHA0F00450"
                     /locus_tag="TPHA_0F00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685918.1"
                     /db_xref="GeneID:11535560"
     CDS             108720..111473
                     /gene="TPHA0F00450"
                     /locus_tag="TPHA_0F00450"
                     /note="ancestral locus Anc_4.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685966.1"
                     /db_xref="GeneID:11535560"
                     /db_xref="UniProtKB/TrEMBL:G8BUV0"
                     /translation="MMYWAYLFFLLGLFIQNVLAIDTTTIRRTIEFTSTMCPTCVTET
                     LVPVTVSDFVTYVVTETDNITFSVTTTISITSSTTVTANYTSIITDTVDVTETIDACN
                     TVNVTNTIENTITTTETAVETETQTSTAIVTSTAIVTSTEKTVSSSIVTSTVTATATV
                     TSTETITTILRSTDTEILTDTVDITEIWTEIDEQAVTISTTATTTLTTRETSTEVTTT
                     TKIVIESTTMTSIFSTTETFLTTVTDTTAVTSLTTSTVLTTDVIFVTDVISETLIQTD
                     PTTTTKIDYETDTVFVTSLVYLTTTNIVTVETDLIKTVTHTNVQNLTSTITIEHSEIN
                     TSIVDQTRYFTEDNTVYDTLTIYETINVTDYFTNNNTVYNNIYDTVTVSETIKHYVNS
                     EVPATFYLTDTEYRTNVVNITDTSYIEKELILTEVNTVIVTNTIPTTKTFNITITEID
                     TVTENLSLTQVLREIFTTTETNAVNTTEFSHMTETFSMTDTIVIPMTDIITKVANITL
                     TSTTTDIIEATNTETYLQTFDSTSEVTVTETNIIVNTVDYTNLETYVDVLNTTNFIDT
                     IETEYVTNTINKTNRVEVTETVDITNVNSIYETILETNTLDITQLIEEVNTINIYNRV
                     NTTLTMETTETVKEAITTNIIGTVRVTETSVITEFNNETLSETVFDIDEERSTVKLTN
                     TVNTINVVDVTLTCDTTKFIDVTHTFNSISTVSVINVFNSTIEENTTITLDAKSVLQD
                     NESSNVLCSEKPLYVPISASSHRTTQTKPSIDSLTKVTETIIGTPSITSNSVSLSQKE
                     VFNDASTLSIISLSYNSEESTSEIIENTKFSNQLSSDISITSRSLLPASNLPPSEISN
                     NVSSYDIRSTEVSPSMTLISNESSSTKYETGAAKISTYEGKASKLNLKVPSFIVTLLY
                     LLL"
     gene            complement(<111683..>114199)
                     /gene="TPHA0F00460"
                     /locus_tag="TPHA_0F00460"
                     /db_xref="GeneID:11535561"
     mRNA            complement(<111683..>114199)
                     /gene="TPHA0F00460"
                     /locus_tag="TPHA_0F00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685919.1"
                     /db_xref="GeneID:11535561"
     CDS             complement(111683..114199)
                     /gene="TPHA0F00460"
                     /locus_tag="TPHA_0F00460"
                     /inference="similar to DNA sequence:INSDC:YGR157W"
                     /note="similar to Saccharomyces cerevisiae CHO2 (YGR157W);
                     ancestral locus Anc_4.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685967.1"
                     /db_xref="GeneID:11535561"
                     /db_xref="GOA:G8BUV1"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR016219"
                     /db_xref="UniProtKB/TrEMBL:G8BUV1"
                     /translation="MADSNTMVDVKSDSVTVKTGDTCRTRSSGVMFTPKVTHDMVRSL
                     FDPTIRKSFLEYCVTLTVIGDILVGYWIGSKYSVQFAKYFFLVQYTIWRLAYNVGIGH
                     ILHQQSKYEILSNFAIKNKLFDKKNNSNLSRFCKFELQTKLGEEFDIESYPPEYLIWL
                     MFRQFVDLILMQDFTNYIIFVYFSLPDYQGDYVKSLLNFRTLIGIIMVMLNVWIKLDA
                     HRVVTDYAWYWGDFFSLQDSELTFDGVFNIVPHPMYSLGYLGYYGFSLLCGDYKVLLV
                     SIWGHILQFLFLKYVENPHIEKIYGSSKLTNNNDNIDDIIIKENNDYTKPLISNGLYF
                     ENFQLLRFTDVFTLASVIYLCAWVVKSKPGSYYLFIVTAASKLLSWSVYSALLYKQSQ
                     YRSYTKAFLKNGFTQIYSYKNWQFIYNYLLSITTTLLILQTLYKLYENYHAINTVNII
                     FGIIVCVIQIWCNYEIRQAISDFGYFYGDFFLTNYIIERKLTSQGIFRYLNNPDAFLS
                     NCGVLGSALMTNFNHENITLVGIWITTNLLFNKFIEQPHVDKVYGKNKRKAGVEKSLL
                     KIKPIKSLLNVLDSLEAALLNKIIHEKQLKDSHDAENLMDWGIAMQDTIRDVKTNLAP
                     NCLLKVESNGSDKCILPNRILVSWQLPSEVYDTKDWIGLYNVLSTRSDYKKTKISSFG
                     HWSATCKNSYKADPRNSNSVNEFRDKGSIIQGTVIFDNNLLVYEPGIYEFRYHSKNSH
                     NVFLISQPIQIEYPKFETDNPERLFEDFKRTLINIGSLLDNKFDGNGNKYFNIKAFVK
                     FIHYSTGIELSTDYIKNVNGDIETICNRICEIKKILNDFS"
     gene            complement(<114697..>116121)
                     /gene="TPHA0F00470"
                     /locus_tag="TPHA_0F00470"
                     /db_xref="GeneID:11535572"
     mRNA            complement(<114697..>116121)
                     /gene="TPHA0F00470"
                     /locus_tag="TPHA_0F00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685920.1"
                     /db_xref="GeneID:11535572"
     CDS             complement(114697..116121)
                     /gene="TPHA0F00470"
                     /locus_tag="TPHA_0F00470"
                     /inference="similar to DNA sequence:INSDC:YGR156W"
                     /note="similar to Saccharomyces cerevisiae PTI1 (YGR156W);
                     ancestral locus Anc_4.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685968.1"
                     /db_xref="GeneID:11535572"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="UniProtKB/TrEMBL:G8BUV2"
                     /translation="MKNLLRIICGDIVFFFSAFEERPSIRLETVKTRLTMTDPRTRTG
                     RHTMTFETLASAVEITNIPQEWTTETITSVVVGSGPIVHFSSKLEPRTGKLNSVIIHY
                     KTAKECQRAFHLLEKIDRFPCFLKRIIPQDVLLNGVNEDEQKDEIQLTRDNYPWDAGL
                     ELPFEMITEVPLSRRPLQPKPQMPVSNENVTIPDILSKASQQLPPLQEDILSKADAVS
                     KNLSKIPPLQLIEIISNLKILASQDATRRTQLENFLRTNLDISISVTQAMLEIGLINY
                     DVVTQVMKKHMDSSNVSNYSGTNMTMNGTRMPMNMAPVPPIGMPNMQQPHFIPKNPQM
                     PFTPPAFNNINSYPFMGQSAMPQMPQLSQRSQIPQIPQIPQVSRMQPVAQIPQMPQMS
                     QMPQMPQMTQMPQMPQMTQMPQMSPPPMQPSPPSINYGKLNALPSDQQTMIKQVLELT
                     PKQITLLPEDQRIMVTNLQNEYRI"
     gene            <116407..>117135
                     /gene="TPHA0F00480"
                     /locus_tag="TPHA_0F00480"
                     /db_xref="GeneID:11535332"
     mRNA            <116407..>117135
                     /gene="TPHA0F00480"
                     /locus_tag="TPHA_0F00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685921.1"
                     /db_xref="GeneID:11535332"
     CDS             116407..117135
                     /gene="TPHA0F00480"
                     /locus_tag="TPHA_0F00480"
                     /note="ancestral locus Anc_4.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685969.1"
                     /db_xref="GeneID:11535332"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:G8BUV3"
                     /translation="MAHHCEDEHHHSHGDDHVPPAPTYTSQTLANVIDTHKIRCLNVE
                     TSSTSQPLVSKFFLKSQDAKFDCKDYIQSDADCQIILHIPFTVNCKIYSIMLRTNAND
                     TDNELSTPKDIRIYKNYPKNIDFDTMGNTKEDYKIQQPENVGILFDEENLVNEDEDTF
                     VEHSLPRRVFQNCHSITLFVENNWSGDGDELTRIYYLEIRGEATSALKTNDGIPLATV
                     YESAPNPLDHGKLESEQTGLNMNF"
     gene            complement(<117246..>117887)
                     /gene="TPHA0F00490"
                     /locus_tag="TPHA_0F00490"
                     /db_xref="GeneID:11535333"
     mRNA            complement(<117246..>117887)
                     /gene="TPHA0F00490"
                     /locus_tag="TPHA_0F00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685922.1"
                     /db_xref="GeneID:11535333"
     CDS             complement(117246..117887)
                     /gene="TPHA0F00490"
                     /locus_tag="TPHA_0F00490"
                     /note="ancestral locus Anc_4.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685970.1"
                     /db_xref="GeneID:11535333"
                     /db_xref="GOA:G8BUV4"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BUV4"
                     /translation="MIRLNRYYVQNGNIARSIIPFRRCYHFNLLNLKIGYTNSVALHP
                     NSEKLYISQIQVSKNASDNQGEPITKQVCSGLQGIIPIAEFKNQLVVIVDNMKKRKLR
                     GEISEAMILCGEDLASNVVQLCQPQTTGDMRLIGHQVVLEGYKQEDTITTRRIKDKEW
                     ADITSRLFIGDGNKVMYREEDTNDVKALLVIGNSPEDLIPLIVRSLPKGSQVR"
     gene            complement(118035..118107)
                     /gene="TPHA0Ftrna4A"
                     /locus_tag="TPHA_0Ftrna4A"
                     /db_xref="GeneID:11535356"
     tRNA            complement(118035..118107)
                     /gene="TPHA0Ftrna4A"
                     /locus_tag="TPHA_0Ftrna4A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:11535356"
     gene            complement(<119121..>120554)
                     /gene="TPHA0F00500"
                     /locus_tag="TPHA_0F00500"
                     /db_xref="GeneID:11535638"
     mRNA            complement(<119121..>120554)
                     /gene="TPHA0F00500"
                     /locus_tag="TPHA_0F00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685923.1"
                     /db_xref="GeneID:11535638"
     CDS             complement(119121..120554)
                     /gene="TPHA0F00500"
                     /locus_tag="TPHA_0F00500"
                     /inference="similar to DNA sequence:INSDC:YGL038C"
                     /note="similar to Saccharomyces cerevisiae OCH1 (YGL038C);
                     ancestral locus Anc_4.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685971.1"
                     /db_xref="GeneID:11535638"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BUV5"
                     /translation="MTINRQIFNVFLCVLLLHICLDFGEHFIFSLADIEQVNSASQSA
                     SAAETLEVNHLTSDTIYDEELYVKLPSTFRSKTVNMRDFKMENSTSIEDLRDQLAYEF
                     PYNADISIPRSVWQTWKHSEHHELFPEYYKLLVEYWKNKTDHYSLITDQQLIPLLEDI
                     YSNVPLVLEAIRAMPVTILKIDFFRYLILYAKGGIYSDLDTLPLKPLEHWVSVNQTKL
                     NNLYQVSNRTNEPLTYQKLKNSNLPKMRKQGPGIVIGIEADPDRVDWQDWYARRVQFC
                     QWTIQAKPGHPMLRELILNITATTLNSVYETNGKFSSFLVGPTIDYDIVGRSSHPILI
                     NDSISHLKTRSNVDGTDIMNWTGPGIFTDLVFEYFNNLLSKNDDVLLLNRNIEPSNTT
                     QPNYKFYDHIYRNLNYRNIIPWEFFSLITKPVIIDDVMVLPITSFSPEVNQMGSKSRE
                     DPMAYVLHLFRGTWKQKADENKLNKTS"
     gene            complement(<120852..>121505)
                     /gene="TPHA0F00510"
                     /locus_tag="TPHA_0F00510"
                     /db_xref="GeneID:11535384"
     mRNA            complement(<120852..>121505)
                     /gene="TPHA0F00510"
                     /locus_tag="TPHA_0F00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685924.1"
                     /db_xref="GeneID:11535384"
     CDS             complement(120852..121505)
                     /gene="TPHA0F00510"
                     /locus_tag="TPHA_0F00510"
                     /inference="similar to DNA sequence:INSDC:YGL037C"
                     /note="similar to Saccharomyces cerevisiae PNC1 (YGL037C);
                     ancestral locus Anc_4.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685972.1"
                     /db_xref="GeneID:11535384"
                     /db_xref="GOA:G8BUV6"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:G8BUV6"
                     /translation="MSNDRKALLVIDVQNDFLPPNGSLAVNGGNEIIQPILSLIEKED
                     WDMVIMTQDWHSMDHTSFAQNHENVADFESVKYNSPVVGDTREQDVVVWPVHCVQNTK
                     GSEFHTDLKSVLLDRPDIVVLKKGYLKDREYYSAFNDIWNDHKTELNDLLQDNNIKEV
                     YIVGIALDYCVKDTAISASQLGYKTTVLKDYCRAIDTSQTAMANLTENFKIHNITLT"
     gene            <121962..>124103
                     /gene="TPHA0F00520"
                     /locus_tag="TPHA_0F00520"
                     /db_xref="GeneID:11535668"
     mRNA            <121962..>124103
                     /gene="TPHA0F00520"
                     /locus_tag="TPHA_0F00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685925.1"
                     /db_xref="GeneID:11535668"
     CDS             121962..124103
                     /gene="TPHA0F00520"
                     /locus_tag="TPHA_0F00520"
                     /inference="similar to DNA sequence:INSDC:YGR145W"
                     /note="similar to Saccharomyces cerevisiae ENP2 (YGR145W);
                     ancestral locus Anc_4.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685973.1"
                     /db_xref="GeneID:11535668"
                     /db_xref="GOA:G8BUV7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BUV7"
                     /translation="MVLKSTSASDVSVYQVSGTNVARSLPDWIAKKRKRSLKNDLDYQ
                     NRVELIQDFEFNEASNKIRVTKDGQYAMATGTYKPQIHVYDFNNLSLKFERHTDAENV
                     DFLLLSNDWTKSVHLQNDRSIQFQNKGGLYYSTRIPKFGRTLAYNDVNCDLYIGASGD
                     ELYRLNLEQGRFLNPFKLDINEEKATAVGGGGVNHVSINSANGLVAVGLEDSVVEFWD
                     PRARSRVSKLYLENTIDNSDFTVTTTSFRNDGINFACGTSNGYSYLYDLRASEPSIVK
                     DHGYGFEIKKLIWLDDVPGSSDKILACDKRIAKIWDRLDGKAYASMEPNVDINDIEHV
                     PGTGMFFTANEGIPMHTYYIPNLGPSPEWCSFLDSITEELEEKPSDSVYSNYRFITRD
                     DVKKLNIKHLVGTKVLRSYMHGFFINTELYDKVSLIANPNAYKDEREREIRKRIEKER
                     ESRIRSSGAVQKPKIKINKDLVERLSEKRGDKVAENVMTDDRFKEMFEDEEFQVDEDD
                     YDYKQLNPVKSARETEEGASKRIRALTAAEESDEERIAMREERKNGTRRGIYSDNESE
                     SEDDENEGEQVELTKKEKKQIQKEVAAIQRKKKERQESERFMSDIKVGTKGVAADTTH
                     DVSFGKKVREMRNEESEKKENSSILHRNHRGEAELTFIPQKQAKPKKKTVKYASEVED
                     SEDEEKEKDNGRSKPRFEGTRRASKNVFRGM"
     gene            complement(<124342..>124587)
                     /gene="TPHA0F00530"
                     /locus_tag="TPHA_0F00530"
                     /db_xref="GeneID:11535669"
     mRNA            complement(<124342..>124587)
                     /gene="TPHA0F00530"
                     /locus_tag="TPHA_0F00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685926.1"
                     /db_xref="GeneID:11535669"
     CDS             complement(124342..124587)
                     /gene="TPHA0F00530"
                     /locus_tag="TPHA_0F00530"
                     /inference="similar to DNA sequence:INSDC:YGR146C"
                     /note="similar to Saccharomyces cerevisiae YGR146C;
                     ancestral locus Anc_4.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685974.1"
                     /db_xref="GeneID:11535669"
                     /db_xref="InterPro:IPR024368"
                     /db_xref="UniProtKB/TrEMBL:G8BUV8"
                     /translation="MSAFTDYCISCERKLDSDHLMSLYCSNRCMVIDADKHDDRNQIY
                     QSDYSINLTVLNDFNNSLKKMDRITENNYNLWIINNV"
     gene            <126413..>127139
                     /gene="TPHA0F00540"
                     /locus_tag="TPHA_0F00540"
                     /db_xref="GeneID:11535392"
     mRNA            join(<126413..126452,126544..>127139)
                     /gene="TPHA0F00540"
                     /locus_tag="TPHA_0F00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685927.1"
                     /db_xref="GeneID:11535392"
     CDS             join(126413..126452,126544..127139)
                     /gene="TPHA0F00540"
                     /locus_tag="TPHA_0F00540"
                     /inference="similar to DNA sequence:INSDC:YGL033W"
                     /note="similar to Saccharomyces cerevisiae HOP2 (YGL033W);
                     ancestral locus Anc_4.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685975.1"
                     /db_xref="GeneID:11535392"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:G8BUV9"
                     /translation="MVATSKKEQESMVNYDEIVQTYLDKQYRPFSVNDIVNNLSKEIT
                     KKTIVIKSLESLVKQNRIVVKNFGKIQIYCCLDKELSSDIDLKLYNLTKLTELRTELI
                     EIDKKKSIVSETWNNLEKELSNNEIIDYNKNKLQEIESLEFKIHNIKQLQENSNIDQV
                     KINKIIDLNDKIEKDYKKRVKNMKDLMLLLKDVTQSKNIEDLLENIGVEKL"
     gene            complement(<127250..>129736)
                     /gene="TPHA0F00550"
                     /locus_tag="TPHA_0F00550"
                     /db_xref="GeneID:11535403"
     mRNA            complement(<127250..>129736)
                     /gene="TPHA0F00550"
                     /locus_tag="TPHA_0F00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685928.1"
                     /db_xref="GeneID:11535403"
     CDS             complement(127250..129736)
                     /gene="TPHA0F00550"
                     /locus_tag="TPHA_0F00550"
                     /inference="similar to DNA sequence:INSDC:YBL008W"
                     /note="similar to Saccharomyces cerevisiae HIR1 (YBL008W);
                     ancestral locus Anc_4.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685976.1"
                     /db_xref="GeneID:11535403"
                     /db_xref="GOA:G8BUW0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BUW0"
                     /translation="MKVIKFPWLAHREEHRKYEVYTADISPDGKRLATGGLDGKIRIW
                     SIDSIIETTKLKEANPDAEITDDLKRPLASMNRHTGSVTCLKFSPDGQYLASGSDDRI
                     LLIWALEEENRMEPLFGSENDKEHWTVRKRLVAHDNDIQDMCWAPDSSILVTVGLDRS
                     IIVWNGSTFEKIKRFNVHQSHVKGVVFDPANKYFATTSDDRSLKIFRYHKAGDTTFTV
                     EQVVRTPFLESPLTTYFRRLSWSPDGQHIAAPNATNGPVSSVVIINRGNWDTNISLIG
                     HDAPTEVVKFNPRLFENTIKIENEDSEVTSINSVDSIVASAGQDKTIALWSTSKQRPL
                     FIAYDIAHKSITDLAWSPNGRILVATSLDSSITMFLFEKQELGKTVSLERNMEELNRY
                     GVDKDSLDFPESIKQLELEEAAKKYNKQKFTQLDTNFLESRINMKIDENNLKGNRNTN
                     EQQISSYSVNTVDAVQEKVNILVPKRKNGEKLNKTTVKDGKKRVAPTLISSGYSRQKK
                     LATLTPVTNNQTNNIAKSLPSTSNAARELKSLKGKVSISSFPVPRLGVHTLIMGTRER
                     NSNKVDQDGESREDSSSPIVNTNNNDNFILDEENEEVEFLMTLNSKMTPEKIWSDEPN
                     TRYIENSGILPDSDAILLQCGTFEHFHTLEVRNGVERSLQFDTEALYDNPTRIIGYSD
                     GKRTVEMFFPEVIICAVGSLECKIWSLATSNGSLFLLSTNGQLKTPKISLGHKIINMI
                     INDKKLIALTERGLFYCWDLEKFKLVFKNISILPILNNEPVESNRVRINKRIKDFKLS
                     GDGKSLDLCLSNPDTNYSWVVELGCWTKKS"
     gene            complement(<130145..>133351)
                     /gene="TPHA0F00560"
                     /locus_tag="TPHA_0F00560"
                     /db_xref="GeneID:11535337"
     mRNA            complement(<130145..>133351)
                     /gene="TPHA0F00560"
                     /locus_tag="TPHA_0F00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685929.1"
                     /db_xref="GeneID:11535337"
     CDS             complement(130145..133351)
                     /gene="TPHA0F00560"
                     /locus_tag="TPHA_0F00560"
                     /inference="similar to DNA sequence:INSDC:YGL016W"
                     /note="similar to Saccharomyces cerevisiae KAP122
                     (YGL016W); ancestral locus Anc_4.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685977.1"
                     /db_xref="GeneID:11535337"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BUW1"
                     /translation="MSSIEEIVHLVESLYAPQPSQDVNQIQQSLQVLQKSPQGLAFAN
                     ELLKNDNYSPNVQYFGALTLTVQLNTNVNSFEKLWVLFKANLIHLTKYSKSYATNPQN
                     KSMLLTTIKKLMSNLSLIFTNINENETTTAESTTITSWNNPLNTLLVLLTNSNNSKVE
                     DWNLDDNVVDSMLVAAVNSQVSYQELSEFIQSSNELNNLLLTFTEIIVEDLVKYQSRK
                     ATMTNVYKILHDHLYITTMALININLNIPNNSNDTLYASISAWITCVSSFRNLSTHGN
                     MDLSEMFQNLITVMCTSSEQTDKYHKAEQILAIFDNCFSNDPNLMSYDLRSQVEAIFL
                     GVSKAGNADTSKNAWMLEYMNYLVTNEMVSELKELAICITDFLQISTLDVCNKLFTVI
                     GTNSASPDNLNQYINVLLQMTNFPLTPILQEVFSVRMIDFWLDLADSFTNLAPETLSP
                     QAQTLAADIFQQVVLIYLPKVSLINKEKILNEEGEDSSLHEFEDFKTATSDLIESLWN
                     ILGNDKLTNVLIDSISKTTSDSSKQQNVDLFQTEVMAFLLNTLLMDMNLAESHWICDI
                     IGSNKNFINNILFLLESGFELPDSTLSYRHLKIEFIRTSSVLIGTLSGCFLQDASQLN
                     QCVQTLFKGLESCIISASELNTKLENIVVKSIYTVFDTCRTELIPELSNSLTVLKSIL
                     RPDSNISNYSRERLMHTVGFIIQCVVANGPQEQANYICQLVDIISDLYERSLGIDMPN
                     KSDYVHCLLSCISELGSALVQPDEMENSAILPRLQEFQQYWMEDPLHIRIKILALLNS
                     ALSNPDYGKDSHFIETSCLILGKTLTLPDSEPHFLRYNMSEMMEFMINQLPKTNYVNS
                     LPFFSYLLERMVAHFKNNIGPQDIEFIFDRFFLSQYQQYIHNDPDLLQTLINFANSML
                     DSKPSQLMLCRYWNDFIVPEFLKLLPSREKFTISAVTKFWTKVINNRKYSQEELELSR
                     QLIAHVGQELVYQTMFGLFHTQRSDLSNYTDLIRALVAKYPLQTKEWMIEALPKICEG
                     KNAIHEKFINKLAITRGNRASGNAILEWWLQCNSLPTL"
     gene            complement(<133791..>135350)
                     /gene="TPHA0F00570"
                     /locus_tag="TPHA_0F00570"
                     /db_xref="GeneID:11535338"
     mRNA            complement(<133791..>135350)
                     /gene="TPHA0F00570"
                     /locus_tag="TPHA_0F00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685930.1"
                     /db_xref="GeneID:11535338"
     CDS             complement(133791..135350)
                     /gene="TPHA0F00570"
                     /locus_tag="TPHA_0F00570"
                     /inference="similar to DNA sequence:INSDC:YGL017W"
                     /note="similar to Saccharomyces cerevisiae ATE1 (YGL017W);
                     ancestral locus Anc_4.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685978.1"
                     /db_xref="GeneID:11535338"
                     /db_xref="GOA:G8BUW2"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:G8BUW2"
                     /translation="MDLTDRLIISYPLYFSNDTSGCGYCNGQKAIAENNYSLMSLMHK
                     ESNGITVNNSCVGFQSEQMSVEQYDRLCNMGYRRSGNFVYKGDMLRNCCRKYTIRTKM
                     EYLKIDKELKKSLRRFNKFVNPTENEMHKKNKGNVEYNVIEEVLKIKRSSSRLKTVFE
                     PSVYSQEKYELFCKFQENIHHDYKHSERGFRQFLCHSPFTDEEIMGTEEEWEQLNNWD
                     TLQDNEYIKRLGPAHECYYLDGKLIAFAVTDFLVTGLSSVYFVWDPDYARLSLGKVSA
                     LKELVLSTKIKNGYYYLGYYIGDCPKMNYKGKYGGELLDLCAANYVRLEKLDNITKHG
                     RLFIMTDSEDKCDTPQSEPYLNEKLKALWLPSLSGENLINIAENIYGSNGKALLDANK
                     AAISLKAFGMDFRTENMNGDKLNDNNTSITTNRTGNEGKKSKKKTSDAIRSIPNVLPG
                     LVPLPEVLEIINSGKIDTLKDKLLIFDTELGGLRPFMGSKLESPEVMKIICDTIRVMG
                     TENAMNTIIII"
     gene            complement(<135765..>137861)
                     /gene="TPHA0F00580"
                     /locus_tag="TPHA_0F00580"
                     /db_xref="GeneID:11535434"
     mRNA            complement(<135765..>137861)
                     /gene="TPHA0F00580"
                     /locus_tag="TPHA_0F00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685931.1"
                     /db_xref="GeneID:11535434"
     CDS             complement(135765..137861)
                     /gene="TPHA0F00580"
                     /locus_tag="TPHA_0F00580"
                     /inference="similar to DNA sequence:INSDC:YBL009W,YGL021W"
                     /note="similar to Saccharomyces cerevisiae ALK2 (YBL009W)
                     and ALK1 (YGL021W); ancestral locus Anc_4.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685979.1"
                     /db_xref="GeneID:11535434"
                     /db_xref="GOA:G8BUW3"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024604"
                     /db_xref="UniProtKB/TrEMBL:G8BUW3"
                     /translation="MSEQTVINLSPRKNFIAMVISDSDSDEGLNEGHERQGLPSSQDF
                     PVEKSDVVMNFDSRGKKDGKEKSKDKKRWSFMSTYSSSSSLSKKRKSTLSSNNSIDNN
                     GPQKSTPLKMKSISPQKSNSPNKRTSMSTLHTNYMDNDQNRSLFKRSSTSSSLKQLIG
                     KFNFADENHENRLKHSPSFNIKAHASERSVKTSLDNNKRKPLAPLASNVVQGGARDNT
                     KFKKPNDKSLLSLTTTSTNVSIDSKKNWKFWKKNSQLSRSTSSQSVAVNQQQREYSNV
                     APTLKKKSSLSSLFSSSSTTYSNVRGSEGAQINDYNLRKKSSTSNLSIKHLKHKTSQS
                     SLQNFKVRRKTNTTASIDREASISGNIKISLPTPDTESRNKIDTKLNNSNSLMSIKSH
                     ISSIPVSTADYKSIVLNRLLEHCDFKYIINDDELNDLEGSIYTIPKDKDNITDYISRF
                     IDPRTSESIISKQLSLDSEDNGFYSPEISLHELICLRLCQNSMGLPFLLQAYLYRKTE
                     QQSDKLYLMLFMKDSGEPLHSINISDWEQVASIFWQCTTILYVNEIKLSFEHRNLILQ
                     NILIDRVGNITLCDFKGSRLTSKFDTQVLFTRLDHPLFYQGGRNGQYEIYEMMRTILP
                     VPNSWSSFEPRINLLWLYYLITELLKKGYANNLPPSKILNNLIKLSEVLNPHATENIT
                     TSINSTGDLLKLKELF"
     gene            complement(<138282..>139418)
                     /gene="TPHA0F00590"
                     /locus_tag="TPHA_0F00590"
                     /db_xref="GeneID:11535608"
     mRNA            complement(<138282..>139418)
                     /gene="TPHA0F00590"
                     /locus_tag="TPHA_0F00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685932.1"
                     /db_xref="GeneID:11535608"
     CDS             complement(138282..139418)
                     /gene="TPHA0F00590"
                     /locus_tag="TPHA_0F00590"
                     /inference="similar to DNA sequence:INSDC:YBL013W"
                     /note="similar to Saccharomyces cerevisiae FMT1 (YBL013W);
                     ancestral locus Anc_4.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685980.1"
                     /db_xref="GeneID:11535608"
                     /db_xref="GOA:G8BUW4"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="UniProtKB/TrEMBL:G8BUW4"
                     /translation="MFAQLTAWKVKRLVFKRCQHGIGSHSLSSLDVLFFGSDEFSIHA
                     LDSLRSLQNNYPPLVKDIQVVTRKPKWCGRYKSVLKHTPIVEHCKTIGLREPLLCDSK
                     QDMLDIGDVHNYDMVVAVSFGKLIPSKLLSKAKYSLNIHPSLLPRYKGASPIQYALLN
                     RDTETGVTIQTLHPNKFDHGRIIAQTRPLSTSDLLAKGVVSEFPEKTPIYTAILMDQL
                     GLVGGELLKKVISEQLYTDQNKSIESGQVFEASYASRITSAMKQISWNTDEAIDLVVR
                     LNTLGPLFAPIKVLMRKNGNVNKRIIFHDFTVCSNYQEKLGSPGQFCYDDKSMTVVVC
                     CANNSYIQVKSLQFEGFTVETASEFVRRFRKRCGNKTESTFEFV"
     gene            <139959..>142715
                     /gene="TPHA0F00600"
                     /locus_tag="TPHA_0F00600"
                     /db_xref="GeneID:11535609"
     mRNA            <139959..>142715
                     /gene="TPHA0F00600"
                     /locus_tag="TPHA_0F00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685933.1"
                     /db_xref="GeneID:11535609"
     CDS             139959..142715
                     /gene="TPHA0F00600"
                     /locus_tag="TPHA_0F00600"
                     /inference="similar to DNA sequence:INSDC:YBL014C"
                     /note="similar to Saccharomyces cerevisiae RRN6 (YBL014C);
                     ancestral locus Anc_4.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685981.1"
                     /db_xref="GeneID:11535609"
                     /db_xref="InterPro:IPR019350"
                     /db_xref="UniProtKB/TrEMBL:G8BUW5"
                     /translation="MLPINRPIGSQLGLGVKGMSVYVGGDSKEKWIKSVQDKSIIDDS
                     ELHVISSEVFIDSDLQKMEKKFIDGEIVKDDYNSDDSGVEFENDEEFEHWKDILVSKM
                     EWQDLDPKISGDFRPFKKVNTSHDRAFDTHEGSLVKSMNFIPNSLISTLSETPIPVQM
                     TDTTGKKSIGNMHSNSTLSVDPNTGELMVIGLLQTVADLRANKDPQQVIAYVSGNSDS
                     VLNIAVLTRSKKEFIKVDKHTKVPGKTWEIKDQKSIESIELNSPIKKILFPQLSAIFR
                     RMSDLIGILTENSLHIIKVSNFNCQTLKFKFQQYKYLSYSSLGDFPFADFAFNPWDMN
                     ELAVIDIKGNWAVCSISSSLLKDDTIRVSQDARGTIYDPEELSNWKKIEWSSKFTKLI
                     VMDRSKLFEIDFQKDLQVEIIEAKTWSRLRDYKRIDENISVLLTTKEIIAIRTNKNTN
                     CFDRILSWKHDLDPNDNTLKFSIQKIIKDKVLTLIIYIFTSQSNNVYMHAFSIDTFNL
                     QLTTSCQSNVMTIPNITEGIQTISVPDESYDDDDDYDMNDSYENSSTEYVWINMFLKQ
                     YTSNEVTKVIVTNAPLHITKNKNHVHFKTDPNSEGGLKMRYKMKELQEMDNLIQLLTE
                     KYKDYPSNKNENIHDLLQDFGYKLSTLLNEEMVHFNKENRSNLLKNRSLKDLIDLSPS
                     IENLSEFESFLDQLIEHFEESSLKFSNLKSILSFFLHESVPSIDIFYNKLLQCWEIIT
                     SNSEVLTRELVKTIVWGAIRFCNKNCYQDKLHNSKDTLTTQYQEIIDLWELNDDEIEE
                     EANKLDNTESTAPMSQPHFTRESQSQIPTIKLSQRNERQERGIANNANRISKSSRNRK
                     SSQARPLCSQAFSSSQTSILPDNITPAFSLMQASAPSLSQSQSSQTSKNKKKKKKKKI
                     GGFK"
     gene            <143599..>145419
                     /gene="TPHA0F00610"
                     /locus_tag="TPHA_0F00610"
                     /db_xref="GeneID:11535627"
     mRNA            <143599..>145419
                     /gene="TPHA0F00610"
                     /locus_tag="TPHA_0F00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685934.1"
                     /db_xref="GeneID:11535627"
     CDS             143599..145419
                     /gene="TPHA0F00610"
                     /locus_tag="TPHA_0F00610"
                     /inference="similar to DNA sequence:INSDC:YGL028C"
                     /note="similar to Saccharomyces cerevisiae SCW11
                     (YGL028C); ancestral locus Anc_4.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685982.1"
                     /db_xref="GeneID:11535627"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8BUW6"
                     /translation="MISIIIYSVLSLLLSQAFAFPLVFKRDIVTRYHTASTATVTNFF
                     TTTTATIVAPTVEYIVYDGYTVTTTLPGSYYTVVYSAGSDTTSVVTTYTDAENKNGGS
                     YVQSLTSASSVTPIASLSSPSSSDSRDITSETGVVSSRTANMASSDPSVTGSSSNSTS
                     VFEISNGSGTTTSKNSSPLTTSSTSSTSKASTSSSKITKSTSSASSTSSTSSTSSTSS
                     TSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSST
                     SSTSSTSSASSTSSASSTSSTSAISSTSSMSSSSTSSVITSINSSAPSSSTVIVSTST
                     GVGYLSAAPSVIVYSPYNNDDSCKDADTVLADLTLIKSKGIYKVRIYGTDCNSLNTIE
                     PAAVQLGMTINQGLWMSSKGVDSIDSAVNDLISWGTTNGWGVFDFITIGNEAINAGYC
                     TADELIVKISSVKLQLREAGYTGLVTTAEPPVSYENNPSLCTNSEIDFVGINPHAYFD
                     TYSSAATAGTFVKGQVSLIESVCGRSDISVLETGYPSAGIQNGGNIPSPENQLIAIQA
                     ILDELNYDVTILTTFDDYWKDPGEYGIEQSFGIIQLLNDV"
     gene            146432..146521
                     /gene="TPHA0Ftrna3F"
                     /locus_tag="TPHA_0Ftrna3F"
                     /db_xref="GeneID:11535468"
     tRNA            join(146432..146469,146485..146521)
                     /gene="TPHA0Ftrna3F"
                     /locus_tag="TPHA_0Ftrna3F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11535468"
     gene            complement(<146806..>147174)
                     /gene="TPHA0F00620"
                     /locus_tag="TPHA_0F00620"
                     /db_xref="GeneID:11535381"
     mRNA            complement(<146806..>147174)
                     /gene="TPHA0F00620"
                     /locus_tag="TPHA_0F00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685935.1"
                     /db_xref="GeneID:11535381"
     CDS             complement(146806..147174)
                     /gene="TPHA0F00620"
                     /locus_tag="TPHA_0F00620"
                     /inference="similar to DNA sequence:INSDC:YGL029W"
                     /note="similar to Saccharomyces cerevisiae CGR1 (YGL029W);
                     ancestral locus Anc_4.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685983.1"
                     /db_xref="GeneID:11535381"
                     /db_xref="InterPro:IPR005579"
                     /db_xref="UniProtKB/TrEMBL:G8BUW7"
                     /translation="MSEVQNEIVDASKTRGTRVSGKTWKEERTPFRVTSSVIKNKKFT
                     SWEAKQQKKLEDKQFKDRLKALKDEKEEARKTKIQALKERREKKEEKERYERLAAKMH
                     AKKVDRLRRREKRNKALKER"
     gene            <147666..>150239
                     /gene="TPHA0F00640"
                     /locus_tag="TPHA_0F00640"
                     /db_xref="GeneID:11535408"
     mRNA            <147666..>150239
                     /gene="TPHA0F00640"
                     /locus_tag="TPHA_0F00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685936.1"
                     /db_xref="GeneID:11535408"
     CDS             147666..150239
                     /gene="TPHA0F00640"
                     /locus_tag="TPHA_0F00640"
                     /inference="similar to DNA sequence:INSDC:YGR150C"
                     /note="similar to Saccharomyces cerevisiae YGR150C;
                     ancestral locus Anc_4.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685984.1"
                     /db_xref="GeneID:11535408"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:G8BUW8"
                     /translation="MLHFRRIGSGLGKSNCLDRILIMRNIVLPRSKQKRSAGFVKRKK
                     FKSIGNVHLDDRILSDLDKLDSKELELKIKRLKTFTNEIKHQIKKTEQLKKIEMENKL
                     ESVKDREKDAEELYSALSGDGIGTQNKLLTSSEGLEVSNLSQFIAASESNQVDKLLPP
                     ILRKRIEDDDLILSSLLDSSSKDYNPIIHKLYNNTEQLQGISKKSLKNCVLIVDKLSF
                     DNIEKLDKMLMNYVNGDIMKFDSSMYFTILKNLSNLSSTMENNNINEQFNNSIILKMK
                     ELIKRHDDSLLKGTSVRLNQNILNFCIKFSSQIEDFDNLNYFLTKFKSYGIVPNRVNY
                     TTILQYYTRCNYVKHAWNIFDTMKFLSKEHFPDTVAYNSVLLLCSKEKNYSKALDLYD
                     EMISFNVIPNVSTLNIMAKVLAVCSRDAKTSEGKADSLRLLGWKYIHQIQDISGLNFS
                     VSTIESMMALAAYDGDVGMARALYYKYITGKYINITRTWKSKLDQKAVWRQVLDPKFL
                     NYLLLAYANYNKNRLPILLGYDKGIKLRRTIINSVDHSSKMIADEDSQYSLPLLPLSD
                     LSNHWEILAESRAIWQFNVEIGGQTNLRSFSRDLIKESEIKDILTTSKSFDEFKFNIM
                     HKIALLKSTLVDYKTLSQANIISYLTVPLKLGDKKEFWLRYKEFTFQEHQLDEKLKTF
                     YMNENSLLNSKTKPTNNSDNKTTSVDTVNATETFIDYLVSLIAKMCTNSSVYEILIKA
                     ATKFKDIELATKTWKDRGEFRKTSTFQNATKSDRMKSDAEFARLMVNFFTSERLYSDA
                     LSIIMTSQKYINWNYTMVKELHSGLINLEDQHSIDLLLNIVNKKSQVQLIEEKILDIK
                     L"
     gene            <150720..>150971
                     /gene="TPHA0F00650"
                     /locus_tag="TPHA_0F00650"
                     /db_xref="GeneID:11535409"
     mRNA            <150720..>150971
                     /gene="TPHA0F00650"
                     /locus_tag="TPHA_0F00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685937.1"
                     /db_xref="GeneID:11535409"
     CDS             150720..150971
                     /gene="TPHA0F00650"
                     /locus_tag="TPHA_0F00650"
                     /inference="similar to DNA sequence:INSDC:YGL032C"
                     /note="similar to Saccharomyces cerevisiae AGA2 (YGL032C);
                     ancestral locus Anc_4.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685985.1"
                     /db_xref="GeneID:11535409"
                     /db_xref="InterPro:IPR014404"
                     /db_xref="UniProtKB/TrEMBL:G8BUW9"
                     /translation="MKITQLAILFSSIYQLVASDLITSCETLPDEYVETTAYSTSSGT
                     GYVNGVQMVVVYELYSSVTYESGCGSAPSAAITTKPFFK"
     gene            complement(151191..151264)
                     /gene="TPHA0Ftrna6V"
                     /locus_tag="TPHA_0Ftrna6V"
                     /db_xref="GeneID:11535550"
     tRNA            complement(151191..151264)
                     /gene="TPHA0Ftrna6V"
                     /locus_tag="TPHA_0Ftrna6V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11535550"
     gene            complement(<152952..>153452)
                     /gene="TPHA0F00660"
                     /locus_tag="TPHA_0F00660"
                     /db_xref="GeneID:11535457"
     mRNA            complement(<152952..>153452)
                     /gene="TPHA0F00660"
                     /locus_tag="TPHA_0F00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685938.1"
                     /db_xref="GeneID:11535457"
     CDS             complement(152952..153452)
                     /gene="TPHA0F00660"
                     /locus_tag="TPHA_0F00660"
                     /inference="similar to DNA sequence:INSDC:YGL010W"
                     /note="similar to Saccharomyces cerevisiae YGL010W;
                     ancestral locus Anc_4.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685986.1"
                     /db_xref="GeneID:11535457"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:G8BUX0"
                     /translation="MVSDLFNLRTQLGFYKAYHHNTVNVMIHSVFVPTIFVTSCMILD
                     RIPVFNNWSLTDVLSIPFATYYIILHRVVGLMASALIMLILYYVKQRNTSLKLEAGIW
                     FTSWLFQFIGHGVFEKRKPALLDNLVQSLVLAPYFIFFEFLFVLGFYSEIDDQLKRDL
                     KESKDV"
     gene            <153895..>154668
                     /gene="TPHA0F00670"
                     /locus_tag="TPHA_0F00670"
                     /db_xref="GeneID:11535596"
     mRNA            <153895..>154668
                     /gene="TPHA0F00670"
                     /locus_tag="TPHA_0F00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685939.1"
                     /db_xref="GeneID:11535596"
     CDS             153895..154668
                     /gene="TPHA0F00670"
                     /locus_tag="TPHA_0F00670"
                     /inference="similar to DNA sequence:INSDC:YGL011C"
                     /note="similar to Saccharomyces cerevisiae SCL1 (YGL011C);
                     ancestral locus Anc_4.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685987.1"
                     /db_xref="GeneID:11535596"
                     /db_xref="GOA:G8BUX1"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BUX1"
                     /translation="MSGGAAAASAAGYDRHITIFSPEGRLFQVEYAFKACNQTNINSV
                     AVRGNDCTVIINQKKVPDKLLDADTVSYIFPISRTIGMVANGPIPDARNAALRCKAEA
                     AEFRYKYGYDMPADVLAKRMANLAQIYTQRAYMRPLGVILTFISVDEEKGPSIYKSDP
                     SGYYIGYKVTATGPKQQEIATSLENFFKKQKNPSKKDHYDEDTWEKVVEFAITQLIDS
                     LGTEFTKNDIEVGVALKDKFFTLTASEIEERLVAIAEQD"
     gene            complement(<154868..>155458)
                     /gene="TPHA0F00680"
                     /locus_tag="TPHA_0F00680"
                     /db_xref="GeneID:11535597"
     mRNA            complement(<154868..>155458)
                     /gene="TPHA0F00680"
                     /locus_tag="TPHA_0F00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685940.1"
                     /db_xref="GeneID:11535597"
     CDS             complement(154868..155458)
                     /gene="TPHA0F00680"
                     /locus_tag="TPHA_0F00680"
                     /inference="similar to DNA sequence:INSDC:YBL006C"
                     /note="similar to Saccharomyces cerevisiae LDB7 (YBL006C);
                     ancestral locus Anc_4.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685988.1"
                     /db_xref="GeneID:11535597"
                     /db_xref="InterPro:IPR013895"
                     /db_xref="UniProtKB/TrEMBL:G8BUX2"
                     /translation="MQKMEGTQKKNYYDVIAGLSAFEKSNEVTLSIQELEELTSTKKD
                     DTEKDNVDSITKKKILQEDEKKSKMIVHGYLGGKVDLSHASNATYDLSHCLLGGFVPK
                     PQLETLSSVDFANYFHRSLECENALEVYDFLVGNEYRHVQQQQLKQNQDSEGYKSKNE
                     NAVRKVIVCKKCNSKFKGQNRLRMLYNHICNSKINK"
     gene            complement(<155786..>157201)
                     /gene="TPHA0F00690"
                     /locus_tag="TPHA_0F00690"
                     /db_xref="GeneID:11535455"
     mRNA            complement(<155786..>157201)
                     /gene="TPHA0F00690"
                     /locus_tag="TPHA_0F00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685941.1"
                     /db_xref="GeneID:11535455"
     CDS             complement(155786..157201)
                     /gene="TPHA0F00690"
                     /locus_tag="TPHA_0F00690"
                     /inference="similar to DNA sequence:INSDC:YGL012W"
                     /note="similar to Saccharomyces cerevisiae ERG4 (YGL012W);
                     ancestral locus Anc_4.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685989.1"
                     /db_xref="GeneID:11535455"
                     /db_xref="GOA:G8BUX3"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:G8BUX3"
                     /translation="MAKKSNKKTPKQSPSPDAPVNFLPQGKYLKPNEIEYEFGGIPGV
                     IGMVVGFPLLMYYMWICAEFYRGRVELPMAGESWLQFIHRLYTVGVAHATPTLYSWSI
                     FLSFWIAQIVFYYTLPGIWTKGQPLTHLKNKQLPYYCNAMWTLYVSTTIVVVLHYTGI
                     FKLYTIIDLFGEIMTCAIISGFVFSIVLYVWTLFVSGDYHRMTGNHIYDFFMGGPLNP
                     RLGILDWKMFFEVRIPWFTLYFITLSACFKQVETYGYLSPQLGLIMLAHWLYANACAK
                     GEELIVPSWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLHYHDPSEYQWSTTYNVSLY
                     ATLLIAYYFFDTCNAQKNALRKQLAGDPTVRKTFPFLPRQILKDPKYMKTKTGSILLI
                     DGWVTYARKLAYTADWTQSLVWALSCGSNSVFPWFFPVFFFVVLVHRTIRDTTKCKKK
                     YGEEWDEYCRHCPYLFIPYIF"
     gene            <158182..>160752
                     /gene="TPHA0F00700"
                     /locus_tag="TPHA_0F00700"
                     /db_xref="GeneID:11535405"
     mRNA            <158182..>160752
                     /gene="TPHA0F00700"
                     /locus_tag="TPHA_0F00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685942.1"
                     /db_xref="GeneID:11535405"
     CDS             158182..160752
                     /gene="TPHA0F00700"
                     /locus_tag="TPHA_0F00700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685990.1"
                     /db_xref="GeneID:11535405"
                     /db_xref="GOA:G8BUX4"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BUX4"
                     /translation="MLSALIRILRSRRGAKLAVNLAFLVLSVCLWSSLSRKQKKSNEL
                     FRSIDDFTTTVGTSIFGESNVKYPPSNPDWNPHYSKYFADLKEKITSIDFIETSENIN
                     QFNDKPLSPFDNIPIYDNFIKAKLDSSKLYHNKFSLKYFKDIATVTKCKYYFNNLNQI
                     NPGWNNDVNKHSLLINSLNYDKNGKVRGKKSELQVKTTQMKKNLNFINERLRLYDLCF
                     IKNEFNMDDIFNNPVKDSVSLVLDNIAGDTTTTIAENQRVNQFQFEGQMFPYLQKFNS
                     SQEFNSILPRFSIGDGIWYSNGTFPKPLTSVSTYQDFKPDPENEELIHLEYDTKKSVW
                     ANWNSMSDLIPSWERGIIISISDAQLFLALKWIATARHNHIKLPIFFMYKDNELSQVS
                     INKLRRVAASDDIKFPTSSNLPKLDTWFVDLTPSINPIMMPEFITFKNKWLASTLNPC
                     KEILFLDTDTINYKDPNFYFETKGYKNSGTLFFRDRYLKVDKKEICSSFHDTLSPSFQ
                     ESFYFDKLPLFDKQYIVDNVAKNELTTEEHIFKSYFHLDIQHEMESGLMAIDKATHII
                     PMQMSANFNLFKPFSKCSHGDKEFFWLGFMASGTPFSIDPIKPGTVGEVITDKAGPTV
                     IEKRICNIQIVHFDENKDIMWMNGGANICKYPGYAEADWENPKLQSFTKNFKTLAEYK
                     KYYEQIPMKTDYGIIASEFSNQPWIRRFYHCHNLIWCARYTEELKPLSFEEKETHGEL
                     FPLDPEVKKRVDEINFVWATFDTYQVFSKEDIESAIKLARETSGLNKVLDQEAKKKAE
                     AAKKAAAEVKAALEAEIKAKADAEEAKAGVENGLGSIPHDAEGDKKEPAEVVKEVAAP
                     "
     gene            <161311..>162381
                     /gene="TPHA0F00710"
                     /locus_tag="TPHA_0F00710"
                     /db_xref="GeneID:11535428"
     mRNA            <161311..>162381
                     /gene="TPHA0F00710"
                     /locus_tag="TPHA_0F00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685943.1"
                     /db_xref="GeneID:11535428"
     CDS             161311..162381
                     /gene="TPHA0F00710"
                     /locus_tag="TPHA_0F00710"
                     /inference="similar to DNA sequence:INSDC:YLR316C"
                     /note="similar to Saccharomyces cerevisiae TAD3 (YLR316C);
                     ancestral locus Anc_4.133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685991.1"
                     /db_xref="GeneID:11535428"
                     /db_xref="GOA:G8BUX5"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G8BUX5"
                     /translation="MVKKEKNPIKIDYENCIVEGCLVQVKNNIQGNNPNLIKVWTIDI
                     NPKDSGSVIAFIRKYLQKNDPVTFTHVKRIQPFKEKNILKIILCSAQLHDENSRLLLE
                     NLLNGYNNHVNIENESIEVNDKINDNKNRRKPLPKAFQFNNLDCIYSIPLNLPPTKDI
                     MIEWSKKFWPLNWCGNPNDQILNDMEFNINWIRSHLKNISKLASELGIQNTNKKSIPV
                     VTSFVSPLDPTDIITTIDERENLNPLDHSIMCGIKRVSELERSRRIQNKQQDVNYLCL
                     NFDVYTTHEPCSMCSMALIHSRIKRLIFIKPMKKTGCLKPDSGDGYCMQDNKNLNSKY
                     EVFQWIGGEFQDIPTVSDKICC"
     gene            <162768..>166619
                     /gene="TPHA0F00720"
                     /locus_tag="TPHA_0F00720"
                     /db_xref="GeneID:11535429"
     mRNA            <162768..>166619
                     /gene="TPHA0F00720"
                     /locus_tag="TPHA_0F00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685944.1"
                     /db_xref="GeneID:11535429"
     CDS             162768..166619
                     /gene="TPHA0F00720"
                     /locus_tag="TPHA_0F00720"
                     /inference="similar to DNA sequence:INSDC:YAL002W"
                     /note="similar to Saccharomyces cerevisiae VPS8 (YAL002W);
                     ancestral locus Anc_4.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685992.1"
                     /db_xref="GeneID:11535429"
                     /db_xref="GOA:G8BUX6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR025941"
                     /db_xref="UniProtKB/TrEMBL:G8BUX6"
                     /translation="MSHDLTNENTSNGGTINYNDEISTIGTANETNKIGMYICSKNGV
                     KNVDFTIDTDELKNDYFLDSEKSINMIRWAELNNIYTTVGAYGGVSCIMLTKLYYVIG
                     TNKGSVLIFNTNQFLQAILIPKLSNDFSEGYLKSPVKNLTTSSDGTHLCASLKTNDIL
                     IWDLNLNTNEMGNDNKSISVPLTAILHITNHKNFEINGLGFLGERHTAIIVSDNSGSL
                     YYHSGYRNHLWNLMYTTKKVLTVKNEERLLNSKVPIFSDNYLQKLHWVAILTTKTFKV
                     ISTLPHLNIIYVENIIDSIAPTSYMNNCISWSKRGSKLAFSIENKLGVYYLSNDPVHA
                     RIESNFTITQKCLQHMDESILSLYWITENLIGILTISHQFIILSCDENINLILKLDLL
                     PYNIPIPPNKHFGIIDNHVYIFGKYSFMRGKFMTWSDIILNPVQKGDYITALKFIEYF
                     LKPTSNLNEIIQLKSLPIERYEQFKRPFHNLSLAAMRFLLKQKKADYDKIYELLVLIL
                     RNLNRFPDSDTKQILENSLIEKSFELLNGDNPEIFFEVLVNVISEGYIKKLPPTVFKA
                     ILSHYANLERIELMEILIVTLDPQTLDIDFAVKLCKEHRLYNVLIYLWNVVFADFITP
                     FVSFIAQITKTKIVNNLFEGMGEASFIGVYDLLSSIYCNSSSPSLVHELEPNIISNAK
                     LKINYVFFNGTLVTWPYHSGNKFHTCTEAEEEPVYPYFSVLLKHNSQNLLKIIDKMFE
                     EDALLNDDILREDSKNHKMWVNRQYIMDMLVDILNTASYQEYYRFLVIFLAKNITKYP
                     QYIKFSNNILQNIIDKIFTIDVEKNDDLELSLEYLLLVYEPTKLDDFVHELEIRQFFK
                     VLFRLYLKLNRYSNLLRLVFSTANPEEEFEINISNLLGLIFNNTKSDPLEKPIITNFI
                     IEHFEKILNESDIDNIVKIINNYNPEIHQAILTISSEDYQLRYLEKLFNFKSTDTLPL
                     CTLKKRYVNLSCKYKKGVQLDCWLKSVDLTNVDISAIIKNLKINNEYKSLAMIHKSVG
                     DNEEAIDYTVIAINALFEESTFEEKQLHEYIEFATGTATLAKRGLKEACWSKIITCLF
                     SIYTKNSLTETQMIVCGNILKNLFIKLALGQEPNGEEHLESFCSVLTNVLENQDVLMS
                     KSHVMRKLLQNVFTAFYLEEQYSSLIFKILDANASGLLITYGDKLIEGWSCDVIHCEV
                     CGKNIWGNGISDIIYYIWEQKRRDNNVEIGKNYDDLNLVIFSCHHGFHSKCLKNLGQN
                     NEKYYCLSCNDDNKKIDSSFL"
     gene            <167220..>168126
                     /gene="TPHA0F00730"
                     /locus_tag="TPHA_0F00730"
                     /db_xref="GeneID:11535471"
     mRNA            join(<167220..167260,167328..167806,167897..>168126)
                     /gene="TPHA0F00730"
                     /locus_tag="TPHA_0F00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685945.1"
                     /db_xref="GeneID:11535471"
     CDS             join(167220..167260,167328..167806,167897..168126)
                     /gene="TPHA0F00730"
                     /locus_tag="TPHA_0F00730"
                     /inference="similar to DNA sequence:INSDC:YGR001C"
                     /note="similar to Saccharomyces cerevisiae YGR001C;
                     ancestral locus Anc_4.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685993.1"
                     /db_xref="GeneID:11535471"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="UniProtKB/TrEMBL:G8BUX7"
                     /translation="MSDSDSDSDLDIELTLSSHALAALEEFRQEEVKYQEKFSKLLTS
                     ADEEFAQKKKEEGMNLFKEDWQLSQFWYNDATANMLADALLEGADEDTVIAIVSAPSV
                     YAAILKKNADEVPTKHIHLFEFDERFKLLAEKDHFFFYDYNKPLEFNEKLRGKVDRLL
                     IDPPFLNDDCQSKSSITANAMLKPKTNEKTKHGVIKSRFISCTGERVSDVIAKSYPDA
                     KVTTFIPEHKNGLSNEFKCYSNFEWRGWKFE"
     gene            169448..169556
                     /gene="TPHA0Ftrna2P"
                     /locus_tag="TPHA_0Ftrna2P"
                     /db_xref="GeneID:11535614"
     tRNA            join(169448..169484,169520..169556)
                     /gene="TPHA0Ftrna2P"
                     /locus_tag="TPHA_0Ftrna2P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11535614"
     gene            <169745..>171448
                     /gene="TPHA0F00740"
                     /locus_tag="TPHA_0F00740"
                     /db_xref="GeneID:11535651"
     mRNA            <169745..>171448
                     /gene="TPHA0F00740"
                     /locus_tag="TPHA_0F00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685946.1"
                     /db_xref="GeneID:11535651"
     CDS             169745..171448
                     /gene="TPHA0F00740"
                     /locus_tag="TPHA_0F00740"
                     /inference="similar to DNA sequence:INSDC:YAR002W"
                     /note="similar to Saccharomyces cerevisiae NUP60
                     (YAR002W); ancestral locus Anc_4.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685994.1"
                     /db_xref="GeneID:11535651"
                     /db_xref="UniProtKB/TrEMBL:G8BUX8"
                     /translation="MEGKSFRSNLRTAKYPDKKTKKSIFSKFKQVIEPLIDKFVRQND
                     NMSNGDTSIKFNRRTGETDTRSSSVNLPGSFFNPDSSYTRIIARDHQDETLINNFPDS
                     IRDLHDEGECTIDADVSNAKLSAFFAEKGDQPLTEIEKEGILSIIKRTVGVNEKRSNF
                     DNKSEIEGITSSRVLKSANNSMCSSPLNPPTFIPKFDNLPSPRNLSLPIYPKRRRIFD
                     YSRTPSTYRTTVLKYSSLPSSYTVSESTLPIQEKNDFNKVNSVQKKKKKISNTASALL
                     SLLDNQESEVNESSELANPYSAHVSKLRNYKKHQVDNQKDSAPLNIAEYKPISVGRSS
                     KFDSYNSLKSNELTPSTSNFDRYKPARSSSLRSSVITEDIPLSKFGNESKNSDSNVPH
                     NTLKLQSASSGFMSNPSTLKNEEKKVESNSIKTLFEMKPVVNPSLPSLSKNNDATIEH
                     NNNENNDNLELEHADDSVIKTNNIDSGTGMEPVSIFGKPENSKVEQPFTFGKVTTFDS
                     KVVNANSTIFQNPIATPIENKSIEEEGIKFEFGEPIASNIKLSDADELKVKKYTSMFV
                     F"
     gene            complement(<171727..>172386)
                     /gene="TPHA0F00750"
                     /locus_tag="TPHA_0F00750"
                     /db_xref="GeneID:11535515"
     mRNA            complement(<171727..>172386)
                     /gene="TPHA0F00750"
                     /locus_tag="TPHA_0F00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685947.1"
                     /db_xref="GeneID:11535515"
     CDS             complement(171727..172386)
                     /gene="TPHA0F00750"
                     /locus_tag="TPHA_0F00750"
                     /inference="similar to DNA
                     sequence:INSDC:YAR002C-A,YGL002W"
                     /note="similar to Saccharomyces cerevisiae ERP1
                     (YAR002C-A) and ERP6 (YGL002W); ancestral locus Anc_4.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685995.1"
                     /db_xref="GeneID:11535515"
                     /db_xref="GOA:G8BUX9"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8BUX9"
                     /translation="MQLVNFIKFALLCVILPTQVLGFYYYGNTGDRKCFIKELSKGTL
                     LEGKYAVQTFDEELKSYRDADSKNVGIVVDIEEIFDDNHRVVHQKNAPVGDFTFIALD
                     SGEHRICLETTDSSWVGKTKAKVSIDFSIGSDSKFDSKKKKTVKSLHQKVNYLNMKVD
                     DIRREQALVREREYKFRDISESVNSKAMWWTILQLCGLIGICVWQMKSLRSFFVKQKV
                     L"
     gene            <173015..>174415
                     /gene="TPHA0F00760"
                     /locus_tag="TPHA_0F00760"
                     /db_xref="GeneID:11535516"
     mRNA            <173015..>174415
                     /gene="TPHA0F00760"
                     /locus_tag="TPHA_0F00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685948.1"
                     /db_xref="GeneID:11535516"
     CDS             173015..174415
                     /gene="TPHA0F00760"
                     /locus_tag="TPHA_0F00760"
                     /inference="similar to DNA sequence:INSDC:YAR003W"
                     /note="similar to Saccharomyces cerevisiae SWD1 (YAR003W);
                     ancestral locus Anc_4.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685996.1"
                     /db_xref="GeneID:11535516"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BUY0"
                     /translation="MNLLFQDPFSVLKEYPEQLTHTIENPLHTVCIKFSQYGDYLAVG
                     SSNGSVIIFDMDTHKPITMLGNQLGSHTRSIQSIEWWSMDNRFILTSSRDWTIKLWDL
                     SDSKKVMKTIQFEEPVWNCKWIDMPATEGNDDFKRNLKYCIVTTYDSKNSYLVNLSES
                     DMGNESPVKSTLGENTFEIVDENESNEIDEGNTLTTCIYPIHKNLIIIGTSKGWLKFY
                     RLKFQDATLKIKLLYKSKISNAIIKHLVVSENGDKLAINSSDRTIRQYFLNVNDENMQ
                     KDDDNASNGIELTLVHKYQDVINRLQWNSIFFSNNSAEYLIASTHGSSAHELYIWEAN
                     SGSLVRVLEGSQEELMDIDWNFYKMCIASNGLESGDIYLWSIVIPPKWSSLAPDFEEI
                     EDNIDYQEKEDEFDRVDEIEFQQEQNEVEEMEIDLITREQYDIRGNDLFKPSFTIPPD
                     YLRSILAQSHNKVFLP"
     gene            <175091..>176986
                     /gene="TPHA0F00770"
                     /locus_tag="TPHA_0F00770"
                     /db_xref="GeneID:11535553"
     mRNA            <175091..>176986
                     /gene="TPHA0F00770"
                     /locus_tag="TPHA_0F00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685949.1"
                     /db_xref="GeneID:11535553"
     CDS             175091..176986
                     /gene="TPHA0F00770"
                     /locus_tag="TPHA_0F00770"
                     /inference="similar to DNA sequence:INSDC:YGL003C"
                     /note="similar to Saccharomyces cerevisiae CDH1 (YGL003C);
                     ancestral locus Anc_4.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685997.1"
                     /db_xref="GeneID:11535553"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BUY1"
                     /translation="MSYNPFMNNTPHSSPIKNTQDRSSDNNNGYRLRKKQSSNYANAS
                     PVSSISSTSQLLTSPFKRSRNAGSRIYNDRFIPSRTAIDLNTMMSITNTNIDYQSNEK
                     DSLSITEDQIELQKEREANHTFDTILKNELFGEKIINDFNSIESSIDRIQNTKSLVRI
                     KNNIRLNDSLPTLHNPLNNSTSSYGNRSDYDDDDNTDEVETDVDDFDSEENASGNNNR
                     VPSTPPHNVNRTSDYSSNSEPVTPRRLNMSQQADQQSFLSNYGRGASLLTYTERRATR
                     PSTESILQTQFNNSSSVVRPDSKQLLLSPKKKTRQIAKIPYRVLDAPSLADDFYYDLI
                     DWSSRDVLAVALGKSIFLTDNNNGDVIHLCDTDNEFTSLNWVGTGSHLAVGQSNGLVE
                     IYDIIKRKCIRTLSGHSDRVSCLSWNNHILSSGSRDRKILHRDVRSPDSYFTQIETHT
                     QEVCGLKWNIEDNRLASGGNDNIVYVYDGVNSKPTLMFTEHTAAVKAMTWSPHRRGIL
                     ATGGGTADRRLKIWNVNTSAKLNDVDSGSQICNMIWSKNTDEIVTSHGYSRYNLTLWN
                     YPTLEPVAIFKGHSFRVLHLTLSEDGTTVVSGAGDETLRYWKIFNKPKAKAQPESLIF
                     ESFYNIR"
     gene            complement(<177071..>179008)
                     /gene="TPHA0F00780"
                     /locus_tag="TPHA_0F00780"
                     /db_xref="GeneID:11535590"
     mRNA            complement(<177071..>179008)
                     /gene="TPHA0F00780"
                     /locus_tag="TPHA_0F00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685950.1"
                     /db_xref="GeneID:11535590"
     CDS             complement(177071..179008)
                     /gene="TPHA0F00780"
                     /locus_tag="TPHA_0F00780"
                     /note="ancestral locus Anc_4.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685998.1"
                     /db_xref="GeneID:11535590"
                     /db_xref="GOA:G8BUY2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BUY2"
                     /translation="MGNKRIIRKRIIKSCKFCYIHKIKCDRQLPCSNCATKVDVDPCK
                     YGFDKDDLIAESDNESNYSDYNNTKIKKLKGSIKKEIVFKPKYYNPFFSTLINNTLLS
                     IESFDELIDKQNFQRNVVVNFDRFKPYKLKYDEIIDLIPNNKDDAEFKLRRFYESINP
                     IIPIVSRVCITKIVNEIYLNRKDNKEVNPSSLILLIAMFFCELFADVAAKLKSDISTC
                     NKYFSAFRFLLDVINFPMKSSMECIQACVLVNFVIDPNMIHFTGYSTMLIRLAQQNGI
                     NKIAKEMKYQNDSIKILWNFLLYIEGSSSVTFGLPFFSSCELLDFAPLTITDIANNNS
                     EYPLEYTYGRFIINRIFKDLMKIISLNSVSKQHLSLIKRKIDGLYNEINFLNLNIRSK
                     YPVHPEYFTSTLFIFLYRLHLRYIALYTLRAQNDEIIEPLNNGQLALNMEHLLESEAI
                     FNDEVITLSLLLLLHTMKRLVQKDIEKFVWYTRGSTIMQYLFIVLKDIYQKPQKPYML
                     SNFPEITREIMDQDLKVIIDTDPILFKYVLVEDILKLVEMQLVSLWSNDDLYKFIIIK
                     SVKEEVWKKHESFLMHSKKELESIRECNMFASCNKYLNLDKDIELLDSMDHLKENVTS
                     TEISKILQEWVSEFNDRRQDS"
     gene            <179491..>180339
                     /gene="TPHA0F00790"
                     /locus_tag="TPHA_0F00790"
                     /db_xref="GeneID:11535591"
     mRNA            <179491..>180339
                     /gene="TPHA0F00790"
                     /locus_tag="TPHA_0F00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685951.1"
                     /db_xref="GeneID:11535591"
     CDS             179491..180339
                     /gene="TPHA0F00790"
                     /locus_tag="TPHA_0F00790"
                     /inference="similar to DNA sequence:INSDC:YGL005C"
                     /note="similar to Saccharomyces cerevisiae COG7 (YGL005C);
                     ancestral locus Anc_4.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003685999.1"
                     /db_xref="GeneID:11535591"
                     /db_xref="UniProtKB/TrEMBL:G8BUY3"
                     /translation="MTELNNKADSDKQVDNDKLLDMFLDKDFVPQSYVDVLLSATSTE
                     DLTKTQAVSSALLARFDYYTKTLTNELKTSLESLEKLSETIPSTWSSSTLDKATLGTS
                     EPSNAHGSSKLEYYLETLGSAVRALEADTQSIDEQIKELDSKYQSSDEVVEQLDKLVK
                     VRSRLNSVIKCFQELDNIFSISPNISRNEQDDVSSKSVSVFDFKLSLRTLEETIEESL
                     ASSTQAEKHNQRNTELLKKIDHFIELKPIFKGLDKFYPIYSDFVDSISKKMEIYMSTK
                     DIEDGF"
     gap             180407..180426
                     /estimated_length=20
     gene            complement(<180610..>183984)
                     /gene="TPHA0F00800"
                     /locus_tag="TPHA_0F00800"
                     /db_xref="GeneID:11535503"
     mRNA            complement(<180610..>183984)
                     /gene="TPHA0F00800"
                     /locus_tag="TPHA_0F00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685952.1"
                     /db_xref="GeneID:11535503"
     CDS             complement(180610..183984)
                     /gene="TPHA0F00800"
                     /locus_tag="TPHA_0F00800"
                     /inference="similar to DNA sequence:INSDC:YGL006W"
                     /note="similar to Saccharomyces cerevisiae PMC1 (YGL006W);
                     ancestral locus Anc_4.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686000.1"
                     /db_xref="GeneID:11535503"
                     /db_xref="GOA:G8BUY4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8BUY4"
                     /translation="MDQSPSVEQLSSFYSPKSVKLLVESFGIENKDGLSEICERLSTH
                     KTSGIDSDSVSSRIEKYGRNALPEHVPKTFWQLVYDAFNDKTMLLLSAAAVVSFLLGL
                     YQYFFQPPQYDPEGNKIPKVDWIEGVAIMMAVVVVVFVSAINDYQKELQFMKLNQKKE
                     NGKRIKIVRNNGSAMMLPNHDLVVGDIVELATGDVLPADCILITGECDVDESALTGES
                     DTIKKFPLEQALSYFFTTAKSKSTNVVDDKHFPDPILISGSKIIAGLGTALVTAVGVN
                     SVYGRTMVTLTSRTNSIEDNENGFEEDEEQTTPLQERLSKLTDRISVYGCIVAMLLFL
                     VLFFKFLYGIFSKNGFFRDLPPTAKGNKFLNIFITAITIIVVAVPEGLPLAVTLALAF
                     ATTRMTQEGNLVRVLKSCETMGSATAICSDKTGTLTENIMTVTDAVVGGETVKNINDF
                     SETLERYLIANITLNSTAFENNDYIDPQSTENPFNKNKNSTNDEPNVAPTNTKEMFIG
                     SKTETALLTFAKKYLNLNRLGKLQTLRNDPSSKFPTIISIPQIISFESSRKWSGIVIK
                     VHDDKTNKQLFRFYIKGAAEIVLKCCTHETLADGSTCAIDDKTSKKISNTVKTFANEA
                     LRAISLAHVDFHDVTKWPPKDLVDRLHSPDAKEASPELIFKQLIDSRLNSNGCGLTLD
                     GIFGIKDPLREGVDQSVLQCQNSGIVVRMVTGDNLMTAKAIARNCNILTDEQATNPEY
                     AMEGATFRKMSNEERRRILPHLRVMARCSPEDKRILVGTLKSMGEIVAVTGDGTNDAP
                     ALKLADVGFSMGIAGTEVAREASDIILTTDDFASIVSAIKWGRCVSLSIKKFIQFQLT
                     VNITAVVLTFVSAVLSQEENSVLTAVQLLWVNLIMDTLAALALATDKPDENIMNKKPL
                     GRDAALISFSSWKMIIAQSILQLIVTFILHFNGQAIFYGDQDDVSGKDQQRLDTLTFN
                     TFVWLQFFTLLVSRKLDEADGITTWRGRCTLSNLNFFQHLFRNYYFIAILLLIGILQI
                     LIVLFGGVAFSIEAQTKEMWFTAVLCGMLSLPMGILVRLCPDEVIITIFPERVVEKIR
                     YVIGLEFLTMFQENDDKSEDEESLLQNEQSTSYGTN"
     gene            <184471..>185196
                     /gene="TPHA0F00810"
                     /locus_tag="TPHA_0F00810"
                     /db_xref="GeneID:11535611"
     mRNA            <184471..>185196
                     /gene="TPHA0F00810"
                     /locus_tag="TPHA_0F00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685953.1"
                     /db_xref="GeneID:11535611"
     CDS             184471..185196
                     /gene="TPHA0F00810"
                     /locus_tag="TPHA_0F00810"
                     /inference="similar to DNA sequence:INSDC:YAR008W"
                     /note="similar to Saccharomyces cerevisiae SEN34
                     (YAR008W); ancestral locus Anc_4.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686001.1"
                     /db_xref="GeneID:11535611"
                     /db_xref="GOA:G8BUY5"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:G8BUY5"
                     /translation="MPTLQVIHYLHGGYSLPQVFSVEDAAELREKHGIYGILSGTLPL
                     NAQQNSFLYLPLTLSLEEAFFLVKNGHANLSVVESATNAAVIALKNQDLQSPVEGNYV
                     LTPDQFGVRPETPKDTALRWLLHNAGQVQLSYPLYEKLRSVGITVLPGARFGCKYVGY
                     PGDPLRYHSQHLVTEPLRYTDDTVNLLQLVNLTRLGTIVKKSVIVSGVLEAPTKLEQP
                     HKQKQKQKFDTVKVFTIEWCGFG"
     gene            <185723..>188107
                     /gene="TPHA0F00820"
                     /locus_tag="TPHA_0F00820"
                     /db_xref="GeneID:11535497"
     mRNA            <185723..>188107
                     /gene="TPHA0F00820"
                     /locus_tag="TPHA_0F00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685954.1"
                     /db_xref="GeneID:11535497"
     CDS             185723..188107
                     /gene="TPHA0F00820"
                     /locus_tag="TPHA_0F00820"
                     /inference="similar to DNA sequence:INSDC:YGL014W"
                     /note="similar to Saccharomyces cerevisiae PUF4 (YGL014W);
                     ancestral locus Anc_4.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686002.1"
                     /db_xref="GeneID:11535497"
                     /db_xref="GOA:G8BUY6"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BUY6"
                     /translation="MSLETVEKASTLPPVDPEVINSALNELHLDGVDVELPAGLPSGK
                     HDISLKDDKINKVSMKQNGGASNKSNNIKNKYKNKFKSKNYKEVDYSMSNFIPNADAI
                     DTANHGSFQLQSDSGINAMLQNNGANNFPPLFSPHQHSQMMNMNMNMNMNMNMNMNMN
                     VGMNMNFVPYNQMMPLPPHNMMPQNDSHLTLLETETEITTASGDDIDIQVKTDVSKTV
                     KSKGKSEIEDNNAENNENNDAEENNKENNDHSLNVINQSSSFPASAYPYGGPLLQPNQ
                     MNMSLSGNSSAANINHPPHFNSSFPGGYGFNSPFQSFSPILHHPHSPVPPNLAMNPSL
                     SLNPDISPEPLPLGTHDGTAITSGSMVNEPSGNEANTSSPSEFSQFHNGTPVPWMYGA
                     HPFGPMVPHPHSMPHHPHIMNNRNNGNYSNNTNGYNKDDNKVNYVRNRNGNQMKNQYG
                     GYVQRKYDDSLIYNDATLDQFIGSIYSLCKDQHGCRFLQKQLDLVGEQAANTIFEEIK
                     NHCIELMTDSFGNYLIQKLLERITLEQRLIIINISAPYFIDIALNPHGTRALQKLVEC
                     IKTDEEAKIIVDSLKPSIVELSKDLNGNHVVQKILQQFKPEFIQFIFEAACQNCIEIA
                     THRHGCCVLQRCLDSGTTTQCESLCEQLLINIDRLSFNPFGNYVIQYVITKEVETGNY
                     NYSYKYINILKHKIKDLSLHKFGSNVVEKLLRTPVLSETIILELLKKGGKNEIEILLN
                     DSYGNYVLQTALDVTHESNEALYKKLYDIVTPLLVGPIRNTPHGRRIMNKLNLE"
     gene            complement(<188299..>191877)
                     /gene="TPHA0F00830"
                     /locus_tag="TPHA_0F00830"
                     /db_xref="GeneID:11535498"
     mRNA            complement(<188299..>191877)
                     /gene="TPHA0F00830"
                     /locus_tag="TPHA_0F00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685955.1"
                     /db_xref="GeneID:11535498"
     CDS             complement(188299..191877)
                     /gene="TPHA0F00830"
                     /locus_tag="TPHA_0F00830"
                     /inference="similar to DNA sequence:INSDC:YBL005W,YGL013C"
                     /note="similar to Saccharomyces cerevisiae PDR3 (YBL005W)
                     and PDR1 (YGL013C); ancestral locus Anc_4.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686003.1"
                     /db_xref="GeneID:11535498"
                     /db_xref="GOA:G8BUY7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BUY7"
                     /translation="MDSSSHTSSSSQLSNTAKKQRNKVSKACQSCRRRKIKCNGINPC
                     SNCTTYECECIYSIPDSNSQTDKLGRANTIKKNKVKKPQNTTSPNDGIQKKTIKSLRK
                     DAFNKELNSDNIIAEVNESELIYRQDIDEVVLPVPLQTLENINVNEEDYGYFHDDTDI
                     QRKLLELQVTLKTLVSLNNRATDMETKKNMTNAIDNINIELKNISKNYIPKLDIVKFK
                     SFKNEKGGESLETIMLKNKYSAFSYLTSIVACYNSDRISKDGFESMGCMNSVLKYKLH
                     LTNEEEKNINQEHLQMLANRQVFSLNNYPLVDEIFGLYSMFSFFSFRGIGSFFQYKML
                     TNKYRKTEKSSQIQLKKTIYLFLRFFDTCVDHVVQSCVSISNPLEYYIENKARKDSSS
                     EVNTSPSLPYNSTPYSNNSKEMLLSLIKELPQPLLHNITNGITTEQLLVNADKPFHMF
                     SLISKIFDIHILSFQDFISNNSNPKKWIWLEGVMRENYQDQTNIFDNINDLFSEATLD
                     TYTRFCRQEELLLALIYYYYNATLYHFDDYKSLDYLEALISLLDKQLYLEEFYGCEKV
                     LEVAIGYASKMGLSRWEYYTGMSEEAAERRRNVWWKLYLIEKFVVVEHNHLSSIDDSK
                     VNCVLPKPFTDIGLLNITDFLANIENIDTLNDNFSDKSIEYLVDYGNFSLMFIMSDYS
                     SRVLYGERYTSIRNYSLPPYLKINLIGEIYNELNHAVSKLEIVKEQLKYLFDTLSSDE
                     EDRCNKKLTVKEFRDLSEFVFRYYFMYINIINATKNLLSRFSTQNIGLELKKQDETYS
                     ELGVNLLMKMNKLIQKDRRLFKSKICSKTYLISYLVLISNKVFSFITMDTILDMLELI
                     SRSFVAILFRKVLKVKSVNNTKPVKDFNRITGFLAVLTNIIITIYIDFNDLSESEFID
                     EVVKVSKKELHFSLHAVMDPNSLIYENIMSFGKESGFHLRVKDILRDTKNAILNNSTN
                     DKRYASKSTNPRSDNLKTAHCTENERKNGNPESKLSKSTGKSRKIKTNELRKLDLLIN
                     DILNSKPEDRFPTFPDNNSGELFSTFNNNSKTISKFSSEGNSSYQYNAGFIENNKISA
                     GGLPQAHEQNNYSIETLIDNNNNINNNNSNNSINNNNNNPKIDPGSSHTSLSSFAQAN
                     LLNELTPTKENNMIDGYNLGTLDEFINDGDLNDLYNTFWKDLYPIQ"
     gene            <193538..>198259
                     /gene="TPHA0F00840"
                     /locus_tag="TPHA_0F00840"
                     /db_xref="GeneID:11535383"
     mRNA            <193538..>198259
                     /gene="TPHA0F00840"
                     /locus_tag="TPHA_0F00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685956.1"
                     /db_xref="GeneID:11535383"
     CDS             193538..198259
                     /gene="TPHA0F00840"
                     /locus_tag="TPHA_0F00840"
                     /inference="similar to DNA sequence:INSDC:YLR320W"
                     /note="similar to Saccharomyces cerevisiae MMS22
                     (YLR320W); ancestral locus Anc_4.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686004.1"
                     /db_xref="GeneID:11535383"
                     /db_xref="InterPro:IPR019021"
                     /db_xref="UniProtKB/TrEMBL:G8BUY8"
                     /translation="MNSDDDTFPVVIPDSDTDYNECARYIIYKPVLESSSSESADSEK
                     SDSDSDIGFDTFYINDSIHNPRNEIFQDSQNFCSEEINKQSSIANSNPIVTPTGNILQ
                     LSTPLSDQKVDEQHSSNTSNISDIYNSFGLRRRLRTRKAIQKMPYSLDRLKHRQLLQG
                     YDVSNFDFISDKVKLPSHPVDANSQEKFMENINPNSDIDTDDAMFTENIYNLDSDPGS
                     NSDSSESTDVNEKNIIKANDNEQIETQEDIPNKYLNKSNDLMRVHEEVIEIEAEEENE
                     ESEADKEEQEEEHIIFRGRNIDIRKGFRGILPKIAWDKSLKEKRSAVKRKKTVLNGTY
                     KGLAKKKKIKQGNTNDDIGLLNELIAPDNDTHHNSNGILEDLIGLRNENIAEETEQFH
                     FKETIGNISQFERYMDDKYADLYLSDEEDSNNDVHIVTYEVNKNKDIKNIKFETATSQ
                     KTHSFINKENSIDTGNNFLPNATSFNGLAEETNKGTLDFMLSKQSKQLKNNTKQSEKK
                     GSIRSLKSYLHRHQNSRTKSFRKGVNKSSIKYLKLNTRDIKTNSFHKMQNATSTEDIG
                     KTKLETYRSSNKSTIETEKSGFEERKASENVSETLSKKLKNQTKNNYFGLNAGNNDVN
                     FRKGNTFSTVLETLGNKYAIRKRNKIGTHITELADLSANSESHLKQKKLKVVDALFYR
                     KQININEVEKIMISNKTFILSKLDLSKLPSVLTNIFLEITEHGVVDTELITICHQLTE
                     FLYFLNQPSLYHIIEDFHKRFRDKVATMGIRTKPIHFYQIMICQLMFFEISKYADISS
                     TFISEIYSKILDHISSFFSLLSKCYIPEFDKNSVYLLESYNILVLIVTQLGKEKELWN
                     RFVAHHFKPDICFLILNLFPTETAYWPIMQIENSYLSLSEAFKFTKFSIQHSNWKLSS
                     SLILFFNGIYKKRRFQDFEKESALSFKSQVISNFENVPSNSSLFNTYLYLLYQSELSD
                     SDIEKIMPLGEVSCTDPYSILVNRINLLLVLSKKSTWNLEKRFDVILKSIIFDPKIGT
                     LETRDLQRITTLVLNAQVNMFENNRNKNMSYKSKVIADIYDTLIHDNKALWSIWYHYL
                     KEVTEIMKQCSTTDLNMLKNLYRYLAKSITIFDMFPQSVIVVNLLISNLSQLGAKWTK
                     NRLLPTIKDVLKDNRYWIDAFCKIGSYLIKSGDISWWSLLVYTDMDHSLDDKIYFFNK
                     VLLMCDNRSFGMIKQYMYGIIIELIFTKSDELFENFINNLLKRENAVEYLYIDSSPEN
                     QKLQACKRLFAVLAECPDNTLLDRLIRTIQDRHLDNSLPHESVFSLISFLNSKYIDSI
                     KHNNIFIILKRELGISDVEFEKSSFRDTIKNFTNINDRAEFIENCLVESLSVQGEAIM
                     LSEKLISLFNSNMHMNTIGMFSDLVKCHILSNSIKQNTFMLAITGFLLQILNSHIENI
                     FGQLSSEEFTNIHGMLLSLCKSFSFTDSNVDDYLNVIIEETSRLFISSLQISEGFKEY
                     NLICKLGRGFLYNETLSREILDDKSSEIFDVIPIEMQQKIQQVIQRNKNNYNNDSFYK
                     PTVEIAYSSHLRELLPQSHNT"
     gene            complement(<198598..>199329)
                     /gene="TPHA0F00850"
                     /locus_tag="TPHA_0F00850"
                     /db_xref="GeneID:11535488"
     mRNA            complement(<198598..>199329)
                     /gene="TPHA0F00850"
                     /locus_tag="TPHA_0F00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685957.1"
                     /db_xref="GeneID:11535488"
     CDS             complement(198598..199329)
                     /gene="TPHA0F00850"
                     /locus_tag="TPHA_0F00850"
                     /inference="similar to DNA sequence:INSDC:YLR323C"
                     /note="similar to Saccharomyces cerevisiae CWC24
                     (YLR323C); ancestral locus Anc_4.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686005.1"
                     /db_xref="GeneID:11535488"
                     /db_xref="GOA:G8BUY9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BUY9"
                     /translation="MFKKRRVKESSIAQHSIKRLRIELEEKAGQDVENRDSLVTNEPQ
                     LDNTRASSVEVSESAPEEVITADSKEINVGTSHATNKDDVKYKLSSNDDAVKEDVLNK
                     EALGESRKPQPVRSLMSSKPLKGSSKKIHQPVNIRTTLLMDYQPDVCKDFKQTGYCGY
                     GDSCKFLHSRDDFKTGWKLDQDWKTKAGIDVEKLEEEMKEIPFKCVICKNDYKRPVVT
                     KCGHYFCSLCFTDRCKNSTNLFCLW"
     gene            <199814..>201520
                     /gene="TPHA0F00860"
                     /locus_tag="TPHA_0F00860"
                     /db_xref="GeneID:11535489"
     mRNA            <199814..>201520
                     /gene="TPHA0F00860"
                     /locus_tag="TPHA_0F00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685958.1"
                     /db_xref="GeneID:11535489"
     CDS             199814..201520
                     /gene="TPHA0F00860"
                     /locus_tag="TPHA_0F00860"
                     /inference="similar to DNA sequence:INSDC:YGR004W,YLR324W"
                     /note="similar to Saccharomyces cerevisiae PEX31 (YGR004W)
                     and PEX30 (YLR324W); ancestral locus Anc_4.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686006.1"
                     /db_xref="GeneID:11535489"
                     /db_xref="GOA:G8BUZ0"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ0"
                     /translation="MSEPDSKVKKDEVRAHFVEPSIPRIGGETTKVIKSALKKHSTLK
                     ITGDRQKNTDYNSESTVVSSPLLSSTPSTVSKSLLKIYPYLILADFFLSVLTWTNENI
                     WSSILTVLIYTFTVLYFQIITRYFGHVVIVGLLWSYSLLDEHIEERMISKPTLDDIVH
                     TMDKVTKKFDLLLSPITLLSAQDVKRLLFTTIFLSPLYICITVFIFSTKNVFLLMGIY
                     MLTYQSPWAKIARRILWKFKVVRLMVFYATGLDLGGINNHQGILDAVHNQVKKLSNSN
                     YNSTANSGMGLDRNGKQYTQSSFSDRNGKATDSSHDSEKPIRFTYVLYENQRRWIGIG
                     WTSSMLSYERTPWTDEFLNPAPSPDEFTLPEEDSHLKWKWIDKSWRLDMTNDGAIQLS
                     SSKPRTSASPTADASFIYYDNTWKKPSTQDSFSKYTRRRRWVRTAELIKTHSDDMMMP
                     SENTINTTAEETELESNSPVNDKENGKKVRNVTINEEPIIMGEDKVTKQPSKSNDGKK
                     DVSNDDSTKNADNTPSSSNPTLNTSNSDADLTGIEAIPDTKENENFNEERASLKESKK
                     DK"
     gene            <202119..>202982
                     /gene="TPHA0F00870"
                     /locus_tag="TPHA_0F00870"
                     /db_xref="GeneID:11535339"
     mRNA            <202119..>202982
                     /gene="TPHA0F00870"
                     /locus_tag="TPHA_0F00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685959.1"
                     /db_xref="GeneID:11535339"
     CDS             202119..202982
                     /gene="TPHA0F00870"
                     /locus_tag="TPHA_0F00870"
                     /inference="similar to DNA sequence:INSDC:YLR326W"
                     /note="similar to Saccharomyces cerevisiae YLR326W;
                     ancestral locus Anc_4.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686007.1"
                     /db_xref="GeneID:11535339"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ1"
                     /translation="MTDFIKSAVEGFFEDSVVGYGEEFAGAHFQPTKDPFYEKKKDQH
                     GESKEVKRRLPDNIGFSKSDSKHWKAVQTSAWVHDRSICGCCCWSDFIGWAPIVTILP
                     IIGPLCMYSVHKNLIKLADKHFNLPGDLKAKMYGNIGLDLAIALVPILGSIFVWLNAC
                     STRNAAMVYNYIVKRQTEECNHEKLASSQKPQTERQRPVQRPTEKPQQQPSRSQQPQQ
                     RSAPPIPNRQQQQQHFLDRAVPPIPTQAINNHEQPAYPQNAYHQDHINVRTQRYPPQE
                     TREPPSQRFHL"
     gene            <203566..>204873
                     /gene="TPHA0F00880"
                     /locus_tag="TPHA_0F00880"
                     /db_xref="GeneID:11531548"
     mRNA            <203566..>204873
                     /gene="TPHA0F00880"
                     /locus_tag="TPHA_0F00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685960.1"
                     /db_xref="GeneID:11531548"
     CDS             203566..204873
                     /gene="TPHA0F00880"
                     /locus_tag="TPHA_0F00880"
                     /inference="similar to DNA sequence:INSDC:YGR010W,YLR328W"
                     /note="similar to Saccharomyces cerevisiae NMA2 (YGR010W)
                     and NMA1 (YLR328W); ancestral locus Anc_4.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686008.1"
                     /db_xref="GeneID:11531548"
                     /db_xref="GOA:G8BUZ2"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ2"
                     /translation="MDPTRAPNFKPASPDEEPNPPNDPKSTIPQSKPILPNVLADNNL
                     SLDAPFTMEDHNISYEKHKKKNKRLAKQLRHHEKEEERRLSPVYIDTTRSLDMRLEKS
                     KSLLNPNNTKHFRSHRIPLNVDNFQPLSNEVSSEDSFDEDSEDDLPFSVANVGVLKSQ
                     IADLEEVPHGLVRQADTIEEYEFPTHRLAKRLNNPKKLPLVIVACGSFSPITYLHLRM
                     FEMALDAVNEQTRFEIIGGYYSPVSDNYKKAGLATSKHRVRMCELACERTSSWLMVDA
                     WESLQPEYTRTAKVLDHFNNEINVKRGGITTVTGEKIGVKIMLLAGGDLIESMGEPNV
                     WNDSDLHHILGNYGCLILERTGSDVRSFLLSHDVMYEHRRNVLVIKQLIYNDISSTKV
                     RLFLRRGMSVQYLLPNSVIRYIEEHGLYVDQTEPVKQVLGSKG"
     gene            <206111..>207325
                     /gene="TPHA0F00890"
                     /locus_tag="TPHA_0F00890"
                     /db_xref="GeneID:11535635"
     mRNA            <206111..>207325
                     /gene="TPHA0F00890"
                     /locus_tag="TPHA_0F00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685961.1"
                     /db_xref="GeneID:11535635"
     CDS             206111..207325
                     /gene="TPHA0F00890"
                     /locus_tag="TPHA_0F00890"
                     /inference="similar to DNA sequence:INSDC:YGR012W"
                     /note="similar to Saccharomyces cerevisiae YGR012W;
                     ancestral locus Anc_4.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686009.1"
                     /db_xref="GeneID:11535635"
                     /db_xref="GOA:G8BUZ3"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ3"
                     /translation="MTKAGSGADLYLTWKDIVTIASVVVSGVMSYKTYKLLKEKRDFG
                     NLPTPCSGIDELIGNTPMVLIKSLSEATGMNIYAKLELNNPAGSAKDRVALNIIKTAE
                     KEGLLVRGKPGVVFEGTSGSTGISIAMICNALGYKSYISLPDDTSNEKLALLESLGAT
                     LNKVKPAAIIDPNQYVNAAKKACGDLNRENEDKPDELRIRGIFADQFENESNWRAHYE
                     ATGPEIYKQLNGNIQAFIAGCGTGGTISGVSKYLKEKIGLINLHVVLADPQGSGFYNR
                     INYGVMYDTVEKEGTRRRHQVDTIVEGIGLNRITNNFSKGEHLIDESIRVNDEQAIKM
                     AKFLSVNDGLFIGSSTAINAVAAVILSKNMKPNSNIVIIACDSGSRHLSKFWKSAVAI
                     DSEVSLDEIMKS"
     gene            complement(<207377..>208192)
                     /gene="TPHA0F00900"
                     /locus_tag="TPHA_0F00900"
                     /db_xref="GeneID:11535636"
     mRNA            complement(<207377..>208192)
                     /gene="TPHA0F00900"
                     /locus_tag="TPHA_0F00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685962.1"
                     /db_xref="GeneID:11535636"
     CDS             complement(207377..208192)
                     /gene="TPHA0F00900"
                     /locus_tag="TPHA_0F00900"
                     /inference="similar to DNA sequence:INSDC:YLR329W"
                     /note="similar to Saccharomyces cerevisiae REC102
                     (YLR329W); ancestral locus Anc_4.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686010.1"
                     /db_xref="GeneID:11535636"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ4"
                     /translation="MELEPTFLNSQHLNNDGVISSWHTNIYFQDNFIVDNWDFDKIIV
                     LPPKFPGSLRFELELNFNDREPLANDTKYLKLFQQIKTTCVNGFRAIIEDKLNYSIEH
                     VEDQNRPYSIVFNLNCNVCTVNKVQTLLEEPIKKFNHLGNEIKIVNLTKVKILADFYF
                     HQATFNDLEYDDTVYQMIKSHMNEYLASLFLSQLEINFPICFSKYIREYLSANILEYP
                     QISFILSNSSKLIPYLITILKNDNNFKTIFKILTYKSKKVKDNEEMFLKFLCD"
     gene            <209132..>210706
                     /gene="TPHA0F00910"
                     /locus_tag="TPHA_0F00910"
                     /db_xref="GeneID:11535662"
     mRNA            <209132..>210706
                     /gene="TPHA0F00910"
                     /locus_tag="TPHA_0F00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685963.1"
                     /db_xref="GeneID:11535662"
     CDS             209132..210706
                     /gene="TPHA0F00910"
                     /locus_tag="TPHA_0F00910"
                     /inference="similar to DNA sequence:INSDC:YLR330W"
                     /note="similar to Saccharomyces cerevisiae CHS5 (YLR330W);
                     ancestral locus Anc_4.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686011.1"
                     /db_xref="GeneID:11535662"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ5"
                     /translation="MSNVDVLLTVGKLDASLALLTTQDHHVIEFPTMLLPDNIKAGSI
                     VKFSVSQSLEEERRQSEKFNSLQTKILEKYGTSKPEKPVLKIVNITQTSCVLAWDELK
                     LGSAKLKSLVLYRQGIRSMIVPSPLKITETKLSGLSIDHPYEFQLKLSTTSGNFWSEK
                     INIQTHKMTDMSGIVVCLGPLDPMERITDSQISNSLKKIGAKELQHKVAIDTTHFICN
                     DIDNEDDPELIKAKNNNIPIVRPEWVRACEIEQRIIGVRGFYLDADPSILKSYTFQGV
                     SSGTEEPVSVEIPQAEVIETEPIHKTEEKIEVAEEDSIDKSSIEIAQGNVREKDQIDE
                     KDQIEEETFEPLNETVTANIQEQDLVEDTGLTNDDIVKNIEGAQIEIVNSRDQEEMEM
                     VKESEGTTFNIEEGQKDDDEQLNEVELTVEDEHLNGVGGQLEEQQLNGTEENIEEEHE
                     VNDDQLNADEPNTEVQQKSESEEKTNAVSLDENIQNNNNVNANELEVNLEHVDTNNES
                     FDKDDEQKKTKMQTMV"
     gene            <211280..>212206
                     /gene="TPHA0F00920"
                     /locus_tag="TPHA_0F00920"
                     /db_xref="GeneID:11535541"
     mRNA            <211280..>212206
                     /gene="TPHA0F00920"
                     /locus_tag="TPHA_0F00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685964.1"
                     /db_xref="GeneID:11535541"
     CDS             211280..212206
                     /gene="TPHA0F00920"
                     /locus_tag="TPHA_0F00920"
                     /inference="similar to DNA sequence:INSDC:YGR021W"
                     /note="similar to Saccharomyces cerevisiae YGR021W;
                     ancestral locus Anc_4.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686012.1"
                     /db_xref="GeneID:11535541"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="InterPro:IPR017856"
                     /db_xref="InterPro:IPR026563"
                     /db_xref="InterPro:IPR026564"
                     /db_xref="InterPro:IPR029072"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ6"
                     /translation="MLRAVPKQSRCLVQERPQCCSLITTNANSKRSFNCGMNPTLSGH
                     NKWSTIKHDKAKNDAEKNKLFSKFANQIQLAVKLGGGSTDPTLNIRLATAMEAANKNN
                     VSKKVVDNAIKKAAGISLNKGSVMETCLYEGMGPGGVAFVIEALTDNRNRTFGFVRSA
                     FTKVNGSMTPTLYFFDKKGYAIVRAPIKYENDEDKILERVLDIKGVEDLEQIKDEEEA
                     SVTDEPGNSSDNSDKLALYSIRTEPSSTNAVAAELKQDGFKIEELAIGYFGKDDLQVT
                     LPDEESKAKFDRFMDTLDSIDEITAIHTNIRD"
     gene            <212694..>214103
                     /gene="TPHA0F00930"
                     /locus_tag="TPHA_0F00930"
                     /db_xref="GeneID:11535542"
     mRNA            <212694..>214103
                     /gene="TPHA0F00930"
                     /locus_tag="TPHA_0F00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685965.1"
                     /db_xref="GeneID:11535542"
     CDS             212694..214103
                     /gene="TPHA0F00930"
                     /locus_tag="TPHA_0F00930"
                     /inference="similar to DNA sequence:INSDC:YGR023W,YLR332W"
                     /note="similar to Saccharomyces cerevisiae MTL1 (YGR023W)
                     and MID2 (YLR332W); ancestral locus Anc_4.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686013.1"
                     /db_xref="GeneID:11535542"
                     /db_xref="InterPro:IPR007567"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ7"
                     /translation="MHLNYIVHRYLNRYIYKCEHVDDIQCSVNRKCCLTNIIWRHTST
                     QQKAVDEIVMSTSLLFLAQLQVVLMAFISAAVGLSGASNSTLASRSFAKGSSTSLFGT
                     YSSRDAAVEYASSEINEIIFSSSQRPLYFTSSYQSSSSLDIHSQISSDTAVSTVLNSS
                     LAYSLSALDSIEGSLSTSSPLSILPSSSSYIPSPTYYQGSSVHAPETYNSSVDVYTSL
                     ALVTNIVNGHTYVSNYYATVTEIDSSTAAVSFGSKQLGYKHVLSTHNRNIIIGCCVGL
                     GIPLMILLIVLFYYIFIRKTKTVDYINSEGGIVTAYDKNFIHKKWYLLIGKENKIEPT
                     FKNNKVTVLEPENSGVSYSSENLNLETSHDNNYKEFINTTATKNYKNYKISNSFNRHK
                     RNKSNQLPTHNFLVEEDQYYNRQSDNVISIDASNNGNNNANAKYTAIEGRNSTITQTS
                     ASTSGSPYEKYSSEESMTH"
     gene            complement(<214333..>215046)
                     /gene="TPHA0F00940"
                     /locus_tag="TPHA_0F00940"
                     /db_xref="GeneID:11535329"
     mRNA            complement(<214333..>215046)
                     /gene="TPHA0F00940"
                     /locus_tag="TPHA_0F00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685966.1"
                     /db_xref="GeneID:11535329"
     CDS             complement(214333..215046)
                     /gene="TPHA0F00940"
                     /locus_tag="TPHA_0F00940"
                     /inference="similar to DNA sequence:INSDC:YGR024C"
                     /note="similar to Saccharomyces cerevisiae THG1 (YGR024C);
                     ancestral locus Anc_4.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686014.1"
                     /db_xref="GeneID:11535329"
                     /db_xref="GOA:G8BUZ8"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="InterPro:IPR024956"
                     /db_xref="InterPro:IPR025845"
                     /db_xref="UniProtKB/TrEMBL:G8BUZ8"
                     /translation="MANSRFEYVRQFETHDTLLPETYIVIRIDGKKFHEFSKYYDFVK
                     PNDERALKLMNACAKNVVLTYRADMILAFGESDEYSFILKSDTNLFNRRSEKLSTLIC
                     SLYTSNYVALWPKFFPGVDLNAKHLPYFDSRCVVYPNLKTIKDYLSWRFVDTHINNLY
                     NTAFWQLIQVCGLTAQESENKLAGTVSSEKQEILFTDCSINYNNEPDMFKKGSLITRK
                     GEILHIDVIKQIDTLFEGF"
     gene            complement(<215337..>215663)
                     /gene="TPHA0F00950"
                     /locus_tag="TPHA_0F00950"
                     /db_xref="GeneID:11535510"
     mRNA            complement(<215337..>215663)
                     /gene="TPHA0F00950"
                     /locus_tag="TPHA_0F00950"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_003685967.1"
                     /db_xref="GeneID:11535510"
     CDS             complement(215337..215663)
                     /gene="TPHA0F00950"
                     /locus_tag="TPHA_0F00950"
                     /inference="similar to DNA sequence:INSDC:YGR027C,YLR333C"
                     /note="similar to Saccharomyces cerevisiae RPS25A
                     (YGR027C) and RPS25B (YLR333C); ancestral locus Anc_4.163"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_003686015.1"
                     /db_xref="GeneID:11535510"
                     /db_xref="InterPro:IPR004977"
                     /db_xref="UniProtKB/TrEMBL:G8BZD6"
                     /translation="MPPKQQISKAAKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQ
                     EKYDRIMKEVPTFRYVSVSVLVERLKLGGSMARVALRDLEAKGIIKPVSKHSKQAIYT
                     RATASE"
     gene            217012..217082
                     /gene="TPHA0Ftrna4E"
                     /locus_tag="TPHA_0Ftrna4E"
                     /db_xref="GeneID:11535588"
     tRNA            217012..217082
                     /gene="TPHA0Ftrna4E"
                     /locus_tag="TPHA_0Ftrna4E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11535588"
     gene            <217379..>219451
                     /gene="TPHA0F00960"
                     /locus_tag="TPHA_0F00960"
                     /db_xref="GeneID:11535639"
     mRNA            <217379..>219451
                     /gene="TPHA0F00960"
                     /locus_tag="TPHA_0F00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685968.1"
                     /db_xref="GeneID:11535639"
     CDS             217379..219451
                     /gene="TPHA0F00960"
                     /locus_tag="TPHA_0F00960"
                     /inference="similar to DNA sequence:INSDC:YLR335W"
                     /note="similar to Saccharomyces cerevisiae NUP2 (YLR335W);
                     ancestral locus Anc_4.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686016.1"
                     /db_xref="GeneID:11535639"
                     /db_xref="GOA:G8BV00"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015007"
                     /db_xref="UniProtKB/TrEMBL:G8BV00"
                     /translation="MSKRQSGSQITRDHIGEERSDDEEPKDFGIASSQVMSKRKIAMP
                     KRKMTFTAPQTNAKESSMASVFANNKPQANREDDNEKALKLKALNSQFSGKIIKCIKD
                     DPCCNLTPLFEKYKNYIDSIDKVADVKTSETKPATSSFTFGIQAKIPVSQPKQFAFGS
                     LTSKPVENDDVATKSHSSEEEDVENEEEEQDEQDEEEKKEIKIQGPTFTLSSNPIVKD
                     STFTFGSDLSKKQAEEKDSDSESEVEIKGPQFKFSGTVKSDVFKLPSKNGSDEKESIP
                     ITEEKNEPKQKPSTPFQFGLKSTTNDKSETPKTENPFTFGKSTVSATSTTDSGSKPVP
                     SFSFGAKKDEVKETSPVETPKFSFGTTTKSGPTTTPSFSFGNSEKKDNADDRENNNTA
                     KPSQGFSFSLPSSSNTSETKEESNPVASQDKPANGGFSFKIPDSASKTEESGKKFSFS
                     FGSNPSQESSNEEKKPAFTFGTSTATEEKKETMKPAFSFGQSNSSMPSFSFGKPTTPL
                     SNTSNAETPAGASDSAGFKFSLPFEQKSTPTKDVDDATEEKPTSATNDNATNGDGISN
                     SVSSVNGEEDEEVIFKQKSKLMVFNPETKGYDSKGVGEMKLLQQNNDKSKIRLLCRSD
                     GMGHILLNATIVKSFAYTPLTPEKDNFVKVPTVGPDGKLITYIVQYKQKSDGRQFIKS
                     IEDAKKDM"
     gene            complement(<219516..>222506)
                     /gene="TPHA0F00970"
                     /locus_tag="TPHA_0F00970"
                     /db_xref="GeneID:11535589"
     mRNA            complement(<219516..>222506)
                     /gene="TPHA0F00970"
                     /locus_tag="TPHA_0F00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685969.1"
                     /db_xref="GeneID:11535589"
     CDS             complement(219516..222506)
                     /gene="TPHA0F00970"
                     /locus_tag="TPHA_0F00970"
                     /inference="similar to DNA sequence:INSDC:YLR336C"
                     /note="similar to Saccharomyces cerevisiae SGD1 (YLR336C);
                     ancestral locus Anc_4.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686017.1"
                     /db_xref="GeneID:11535589"
                     /db_xref="GOA:G8BV01"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BV01"
                     /translation="MSKNKTINIPGIILDELKERDYSNDSRFNIDRSKNKKRGKGPTL
                     SRKEKRKQQRFEKKHKGSKHANTTNQETNDKIMKSYPRSPRQEPKVDQKRAQNNSQKK
                     SAKKDFELPFSSDDELSSGDFDDFADSDLNKEELEQLRELEEGSGSESEENSEDELLS
                     ESEYSNSSDNDDKEISAAETMAKLKSLQQKKSESSDNKDKKAIKHRKRKIEEEEDIEF
                     PMLPAERAALEKDEMEMQYYAKKLNLKGKVKKIKAKDEFDAIGGLLEGLDYFENYGNN
                     DEEYGDLAMDAKSNGKDEVSDSEASSSDKEVSESQSDGENEEHVENPFSSDDELSSGD
                     FDDFDEGDLNEEEWEQLRDLEGEDSSGRDDEHSDNDDTGKESKKKKKSKNERENPYAA
                     PGSSVLGEYVAPSMRKMQLENSNDSPEMIEIRKKVKSALNKLSDTNISVIISSLDELF
                     YKFPRQYVSEAITTQVLEIVGQNNKLFDTFIMNYAAVIYSLWELRGVEVGATFIQLIV
                     ERFMKDYNTEVIKIENSNEVIQTDDQNEEEKIARLSNKSCNNIITLIAYAYNFGLITC
                     KLIYNFIQKFVSKPNEFSTELLLRIVSVSGPLLRGDDPSALKDIITSLLTNVKSMSTP
                     GPRMKFLLDTMSDLKNNRLKPSILATSNKQLKKSLSSFLKKSTSSEPLQVSLDDIESV
                     KTKGKWWLVGASWRGNLENAFEEARIQNPTNNSVNDKIIVEDTLLDDIPDWSEISKQQ
                     RMNTDVRRAIFISIMSAQDYMEAFTKLEKLNLKNKQILEIPKVIYHCLLTDSVNNGYN
                     PYYALVATKLSEHHHNLLKSYQFLFWDIVKNFEDDGKDDFSDNDETDEDKQLMKTLAQ
                     GKFFGTLLSENILQLDIFKHVPIMGGLDSDGNLFIEVLFYQMLISIAKKSESKKKDDN
                     GNKRYYYNKEFIRGMLLNSLKLENKGTILKSLRWFISKKFKYHAYLPKKSDAKAFERD
                     SRRINWAVKEFVDLVTDELGNFDE"
     gene            <222909..>223991
                     /gene="TPHA0F00980"
                     /locus_tag="TPHA_0F00980"
                     /db_xref="GeneID:11531556"
     mRNA            <222909..>223991
                     /gene="TPHA0F00980"
                     /locus_tag="TPHA_0F00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685970.1"
                     /db_xref="GeneID:11531556"
     CDS             222909..223991
                     /gene="TPHA0F00980"
                     /locus_tag="TPHA_0F00980"
                     /inference="similar to DNA sequence:INSDC:YGR028W"
                     /note="similar to Saccharomyces cerevisiae MSP1 (YGR028W);
                     ancestral locus Anc_4.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686018.1"
                     /db_xref="GeneID:11531556"
                     /db_xref="GOA:G8BV02"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BV02"
                     /translation="MARKIDIKAITDICLFVGAGLSTYFLLNRLLSEEFGGYSSTSKE
                     NKEKQKKTLEKLIAKNPELNDLYLDHYENSILSSVILSEDIDTKFEDIGGLDELVSEL
                     NESVVYPLMVPELFESNSLLRAPNGVLLYGPPGCGKTMLAKALAKESGANFISLRMSS
                     IMDKWYGESNKIVNAIFSLANKIQPCMIFIDEIDSFLRERSSTDHEVTANLKAEFMTL
                     WDGLISNGRVMLIGATNRMNDIDSAFLRRLPKRFYITLPSKEQRLKILEVLLKDTKLD
                     SQECDIDFIAQKTEGLSGSDLKELCREAALNAAKEYIRNQRKSSHNIDKNDTDSKIRI
                     RPLKNSDFLPTSQLESKSVLSSMTLD"
     gene            <224440..>225167
                     /gene="TPHA0F00990"
                     /locus_tag="TPHA_0F00990"
                     /db_xref="GeneID:11535630"
     mRNA            join(<224440..224513,224702..>225167)
                     /gene="TPHA0F00990"
                     /locus_tag="TPHA_0F00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685971.1"
                     /db_xref="GeneID:11535630"
     CDS             join(224440..224513,224702..225167)
                     /gene="TPHA0F00990"
                     /locus_tag="TPHA_0F00990"
                     /inference="similar to DNA sequence:INSDC:YGR029W"
                     /note="similar to Saccharomyces cerevisiae ERV1 (YGR029W);
                     ancestral locus Anc_4.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686019.1"
                     /db_xref="GeneID:11535630"
                     /db_xref="GOA:G8BV03"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:G8BV03"
                     /translation="MSSRSTEETKGLTGRTVVYDEDGKPCRACNTLEDFRFVTGKVTT
                     SKIAAAGKPAKTMPEESLIPGSRSYERTNPPDVNELGKSTWNFLHSMTAQYPKEPSPV
                     QKTEMSNFLHLFSRVYPCNWCAKDFEKYLKENAPKVNSREELGRWMCEAHNSVNVKLR
                     KEKFNCDFWEKRWREGWEE"
     gene            <226461..>227405
                     /gene="TPHA0F01000"
                     /locus_tag="TPHA_0F01000"
                     /db_xref="GeneID:11535631"
     mRNA            <226461..>227405
                     /gene="TPHA0F01000"
                     /locus_tag="TPHA_0F01000"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="XM_003685972.1"
                     /db_xref="GeneID:11535631"
     CDS             226461..227405
                     /gene="TPHA0F01000"
                     /locus_tag="TPHA_0F01000"
                     /inference="similar to DNA sequence:INSDC:YLR340W"
                     /note="similar to Saccharomyces cerevisiae RPP0 (YLR340W);
                     ancestral locus Anc_4.170"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="XP_003686020.1"
                     /db_xref="GeneID:11535631"
                     /db_xref="GOA:G8BV04"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:G8BV04"
                     /translation="MGGIREKKVEYFAKLREYFEEYKSLFVVGVDNVSSQQMHQVRKA
                     LRGRGVVLMGKNTMVRRAIRGIVQEMPDLEKLVPFIRGNVGFIFTNSSLQEIKEVIIS
                     NKVSAPARAGAVAPEDIWVTAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVE
                     AGNKVGPSEASLLNLLNISPFTYGLTVVQVYDNGQVFPSSILDITDDELVSHFVSAVS
                     TIASVSLAIGYPTLPSVGHTLINNYKDLLAVAIASKYIFPEIEELADRIENPDKYASA
                     APAAAAAAASGSSDAPAADAAEEDDEEEDDDMGFGLFD"
     gene            <227759..>229375
                     /gene="TPHA0F01010"
                     /locus_tag="TPHA_0F01010"
                     /db_xref="GeneID:11535546"
     mRNA            <227759..>229375
                     /gene="TPHA0F01010"
                     /locus_tag="TPHA_0F01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685973.1"
                     /db_xref="GeneID:11535546"
     CDS             227759..229375
                     /gene="TPHA0F01010"
                     /locus_tag="TPHA_0F01010"
                     /inference="similar to DNA sequence:INSDC:YLR341W"
                     /note="similar to Saccharomyces cerevisiae SPO77
                     (YLR341W); ancestral locus Anc_4.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686021.1"
                     /db_xref="GeneID:11535546"
                     /db_xref="UniProtKB/TrEMBL:G8BV05"
                     /translation="MAILERKNNFQTPLTLTSSELYLDYNTFENDNIYNNTERNRSSK
                     KASSVLSISNCNLNEKYDQNRFYKNVLLPKPFSSAMLDTGTDSVIEYSIASTKNKNID
                     LSKFDRPDCVTTELTIDKIINDTYALLEREQTSSTYADMLLVSLIAFVRINKNLESMK
                     HENVMFEAQDLDSILKILTIIPTGQSYDTFDKYVCHVIKINQKRRLGLPSSTEADDLS
                     IDSIVEQLQGESYLPHMLIDSIDSYKNEKTAQIRYCKVLNILFSTIGIELSKIFSTVM
                     NIIFLHGSHETMVEFESIMGYLEMILRVSIESNNCEMLIGVEDTIVAWYNTNASIENK
                     RSFNNWIIKTLQELISTYNRDANESITIGSMISSVTDDTDLKLNKCDIVQEFLNSLQL
                     RCSENVTATTQKNFFALSILEPNETLVTVSMITEEEDEEADVVVPMRVDTTVTVSEES
                     SFNRWRHWVHNKLKSVCFHCGRCEEIDNIQHFVNRITYDNRHCIFSDLNVPQLSTIEE
                     PTEMERQYKQLLYDENKGSRKRDVIKLLFK"
     gene            <229551..>230504
                     /gene="TPHA0F01020"
                     /locus_tag="TPHA_0F01020"
                     /db_xref="GeneID:11535552"
     mRNA            <229551..>230504
                     /gene="TPHA0F01020"
                     /locus_tag="TPHA_0F01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685974.1"
                     /db_xref="GeneID:11535552"
     CDS             229551..230504
                     /gene="TPHA0F01020"
                     /locus_tag="TPHA_0F01020"
                     /inference="similar to DNA sequence:INSDC:YGR031W"
                     /note="similar to Saccharomyces cerevisiae YGR031W;
                     ancestral locus Anc_4.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686022.1"
                     /db_xref="GeneID:11535552"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BV06"
                     /translation="MMFSQTIRRISTKPRAIELAFDKIACKNNTNKTPLVLIHGLFGS
                     KTSNRSMARSLDTLFGNSRDIYLIDLRNHGESATARPHDYESMSLDVFKFLQAHALHR
                     SILVGHSMGGKVVMNMILQQQMQRKMACEITMGVCIENAPAVTMPNSKFVTYIDALQS
                     AISSGGGGETSLQTRDSVHRHLSEKLPGEQESIIQFLMTLLRRLRRNSNSNSDGSGGG
                     GAVFESKVPLQLLRESIVAGEVSGFPLVPSSDTPPCGTPMLFIRGEASNYLCDEYIVS
                     ISSFFANFEVQTVANSGHFVNSERPVECARLIHEYIDRRED"
     gene            <231078..>236705
                     /gene="TPHA0F01030"
                     /locus_tag="TPHA_0F01030"
                     /db_xref="GeneID:11535647"
     mRNA            <231078..>236705
                     /gene="TPHA0F01030"
                     /locus_tag="TPHA_0F01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685975.1"
                     /db_xref="GeneID:11535647"
     CDS             231078..236705
                     /gene="TPHA0F01030"
                     /locus_tag="TPHA_0F01030"
                     /inference="similar to DNA sequence:INSDC:YGR032W,YLR342W"
                     /note="similar to Saccharomyces cerevisiae GSC2 (YGR032W)
                     and FKS1 (YLR342W); ancestral locus Anc_4.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686023.1"
                     /db_xref="GeneID:11535647"
                     /db_xref="GOA:G8BV07"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:G8BV07"
                     /translation="MSYSANVNFDQYGQPIMDHSGNIGHVDRNYNDMNQSSQNSNDDV
                     MLNMDQDSFDNYAPSHMSFNDNSNHNNNNISNNIHNSNVNAGNQDHLNINAFNEYGKS
                     DDQGPFQNDSSNNMGSQYQNQSQYDEYDPYPAYNLDRKRPITMEKIEDIFIDLTNKMG
                     FQRDSMRNMFDHLMTMLDSRSSRMSSEKALISLHADYIGGDSSNYKKWYFTSQLDLDD
                     EVGFRNLKTNKTKKKFNKNNKSLLNDDGNNHNLSIEEMESIINQLKSDNSLEASDFRW
                     KYKMMKLSPYEMVSQLALYLLCWGEANQVRFTPECLCFIFKCALDFTGSTIYQNMSPQ
                     QYPMEGDYLNRIITPLYQFLRDQVYEILEGRYVKRERDHNQVIGYDDVNQLFWYPEGI
                     KKIKLNTANETYLIDLPIEERYIHLGNINWNDVFFKTYKETRTWLHMVTNFNRIWIMH
                     ASLYWMYTAYNAPALYTHNYQQLVDNQPLAAYRWASAALAGTLASLIQIAATLCEWLF
                     VPRNWAGAQRLSRRFVFLCIVLGINLAPVAWMFAYTDDTVYSNDARIVSIVMFFVAVV
                     TVVFFSIRPLGALFTSYLNKSSRVYVSSQTFTANFAPLYAWDQVLSYIIWIVVFGAKF
                     AESYFFLTLSLRDPIRILSTLTVRCAGEKWWGNALCRQQPKIVLGLMIATDFILFFLD
                     TYLWYVIVNTIFSVAKLFYIGMSVMTPWRNIFTRLPKRIYMKILSTNDMEVKYKPKIL
                     ISQIWNAIIISMYREHLLAIDHVQKLLYHQIPSDIEGRRALKAPAFFTSQVENSKGSA
                     DLSEFFPKDSETERRISFFAQSLALPLPTPVSIENMPTFTVLTPHYSERILLSLREII
                     REDDQYSRVTLLEYLKQLHPVEWDCFVKDTKYLAEETEAYEGNDDMGMKEHIKDEQMD
                     TAVDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGMMNYARAIKLLYRIENP
                     EVVQMFGSDIEGLENELEKMTRRKFKYLVSMQRLTKFKPHEMENTEFLLRAYPDLQIA
                     FLDEEPPLREGDEPRIFSALIDGHCEVLENGRRRPKFRIQLSGNPILGDGKSDNQNHA
                     LIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEDISREPLNPYVPGVTYENQFNNHP
                     VAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFVNATFMT
                     TRGGVSKAQKGLHLNEDIYSGMNALLRGGRIKHCEYYQCGKGRDLGFGTILNFTTKIG
                     AGMGEQMLSREYYYLGTQLPIDRFLSFYYAHPGFHLNNFFIQLSLQLFLLALVNMHSL
                     AHESIFCIYDRNKPKTDVLYPIGCYNLQPVVDWVRRYTLSIFIVFWIAIVPIIGQELI
                     ERGLWKATLRFFRQLLSLSPVFEVFAGQIYSASLLSDLTVGGARYISTGRGIATARIP
                     FSILYSRFAGSAIYMGSRSLLMLLFCTIAHWQSPLLWFWASICSLMWAPFIFNPHQFA
                     WDDFFLDYRDFIRWLSRGNAKYHKNSWIGYVKSSRSRVTGFKRKLIGVESEKGTGDSA
                     RAHRSNVISSEIIPCALYAAGCFISFTFINAQTGVQATEDERANSTLRFIICTVGPIA
                     VNAGTLLICMALSCCSGPLFGLCCKRTSAALAAIAHGVSVIVYLGTFIIMWVLEGFDF
                     TRMLIGIVACIQAERLIIQCMTVLLLTREQKHDSANTAFWAGSWSTAGYGSLSWAEPF
                     REYIAKVIEMSEFAADFILGHTLMICQLPILCIPQIDKLHSIMLFWLRPSRQIRPAIL
                     SLKQVRLRKLMITKYMSLFFIVLCVFAACIIGPAVGSAHVSKTFGSDLTGPWKNLVQS
                     RNVSNNDTGTGLSTYSGHYYTHTPSLKTWSTKT"
     gene            <237060..>238805
                     /gene="TPHA0F01040"
                     /locus_tag="TPHA_0F01040"
                     /db_xref="GeneID:11535648"
     mRNA            <237060..>238805
                     /gene="TPHA0F01040"
                     /locus_tag="TPHA_0F01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685976.1"
                     /db_xref="GeneID:11535648"
     CDS             237060..238805
                     /gene="TPHA0F01040"
                     /locus_tag="TPHA_0F01040"
                     /inference="similar to DNA sequence:INSDC:YLR343W"
                     /note="similar to Saccharomyces cerevisiae GAS2 (YLR343W);
                     ancestral locus Anc_4.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686024.1"
                     /db_xref="GeneID:11535648"
                     /db_xref="GOA:G8BV08"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8BV08"
                     /translation="MRLIFFYLIQYLYISICTAASIKANLPVIEVIGNKFFNSETHEQ
                     FFLKGIAYQPSRSLDMLMDADETFETKYIDPLADPDICLRDIPYLKKLNINTIRVYSI
                     DPTKSHETCMQALANEGIYVLLDLAEPDVSIARDNPTWDVTIWKRYRDVIDAMSQYTN
                     ILGYFAGNEVTNDTSNTDASPFVKAAIRDTKMYIKKNSYREIPVGYSTNDDVDTRDNL
                     AKYFVCKNEDKSADSSMMVADFYGINMYEWCGYSSYGTSGYKDRTEEFRDYPVPIFFS
                     EFGCNLVRPRPFTEVSALFGSKMSNVWSGGLAYMYFEEENQYGVVEVSKKNSKIVKEL
                     PDFNYLETQYKNANPSGVTKEEYLNSASYKNLINNIECPKNSLNNEFFEEELELAWEA
                     TTNNLPSTPNTEECACLSSYLPCKALIGESLVNTFNVENHFKYLCGQVNCQEIIADGK
                     AGVYGIYSSCSTEQKLSFLLSKLYYNNLHEGTMRKSDKICPVQDKGFFYNKKYDTFNN
                     GNIDNVCSRENIMSIEKALKSDYTRANNNKVSDPLKGGNKKDTQRGTEMNEGSKYSTK
                     VGMLAIFFFLATSLL"
     gene            <241252..>242823
                     /gene="TPHA0F01060"
                     /locus_tag="TPHA_0F01060"
                     /db_xref="GeneID:11535509"
     mRNA            <241252..>242823
                     /gene="TPHA0F01060"
                     /locus_tag="TPHA_0F01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685977.1"
                     /db_xref="GeneID:11535509"
     CDS             241252..242823
                     /gene="TPHA0F01060"
                     /locus_tag="TPHA_0F01060"
                     /inference="similar to DNA sequence:INSDC:YGR041W,YLR353W"
                     /note="similar to Saccharomyces cerevisiae BUD9 (YGR041W)
                     and BUD8 (YLR353W); ancestral locus Anc_4.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686025.1"
                     /db_xref="GeneID:11535509"
                     /db_xref="UniProtKB/TrEMBL:G8BV09"
                     /translation="MDQDFEQVTHNSDFLSILSDYDSDVQSYISTNDIYRKESAEENN
                     KESPSSSKSFFIENFPENVNDSSANSLQQTPRKFGVYINESAFASMNKTSKRRMQKTI
                     SKNNSSTTSINNLINDNIEKPFHYNSENGSSLNTISTKMLLSNQDVKLNQQKPVASIN
                     IYPENIESPDRVTSSLYSPLHGNHNSLSQVKESLPFFVEPREIYSSAQASLAHSCATT
                     NSSNYYNDTIPAIDQAQQIRKSNVAKTPVLSISKSKFSPIKYNLKKVSKTESIKKKGS
                     SLFSSSKNKLEQSSSRPSLTSPQPKSLLKNHLSFANDKIEGANDGSLPNGNKNAVQSS
                     YPPSLPDLSYGNEFAESQIDLTLDTLQNFRSKTYRRYNIDVEAMGNLFQEENEYNSIT
                     GSYDGINDDVFEHIPIQHIDSNSIYNFDSEISGYLQIYSIWRILLVVSGCILVLPLFF
                     IIGVGKKEKKIISDYKLMKMVLNKNHRIGLMKGFHWELDLQWLRTTFLILGVIETIAI
                     MACIAVGFSVGITSE"
     gene            <243205..>244188
                     /gene="TPHA0F01070"
                     /locus_tag="TPHA_0F01070"
                     /db_xref="GeneID:11535450"
     mRNA            <243205..>244188
                     /gene="TPHA0F01070"
                     /locus_tag="TPHA_0F01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685978.1"
                     /db_xref="GeneID:11535450"
     CDS             243205..244188
                     /gene="TPHA0F01070"
                     /locus_tag="TPHA_0F01070"
                     /inference="similar to DNA sequence:INSDC:YGR042W"
                     /note="similar to Saccharomyces cerevisiae YGR042W;
                     ancestral locus Anc_4.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686026.1"
                     /db_xref="GeneID:11535450"
                     /db_xref="InterPro:IPR018838"
                     /db_xref="UniProtKB/TrEMBL:G8BV10"
                     /translation="MNSHITEYQCQYTDQIRKKNKVWHDGKLKYFQINDKFQLFREED
                     NIQISSQFITNKKEVEYILDPENFDNIEHKIFGKYIVIILEKINEYDKEVKITLKHNN
                     IPPSQANTIHFNNNTLHLNGQSVTNTKSNSLQGKVIVKKPLSRIITSKVIADTSSISG
                     TSLALKMNKPFKRPRMANHPDSNLSRKIVKNRPSVRTDNVRLKEEDTSNNDTNIKSNE
                     LHNNDANTNLNKPKPPLIPSENEKLQANVEETLVEKQSTSPITNNIIIDKHYAQDKPP
                     LEKQINTDNILPEEKKISKSIIQKLPNKQSSSRIISGRTKIRSISHKPISL"
     gene            complement(<244390..>245439)
                     /gene="TPHA0F01080"
                     /locus_tag="TPHA_0F01080"
                     /db_xref="GeneID:11535606"
     mRNA            complement(<244390..>245439)
                     /gene="TPHA0F01080"
                     /locus_tag="TPHA_0F01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685979.1"
                     /db_xref="GeneID:11535606"
     CDS             complement(244390..245439)
                     /gene="TPHA0F01080"
                     /locus_tag="TPHA_0F01080"
                     /inference="similar to DNA sequence:INSDC:YGR043C,YLR354C"
                     /note="similar to Saccharomyces cerevisiae YGR043C and
                     TAL1 (YLR354C); ancestral locus Anc_4.188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686027.1"
                     /db_xref="GeneID:11535606"
                     /db_xref="GOA:G8BV11"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="UniProtKB/TrEMBL:G8BV11"
                     /translation="MPVSKKQNTGSSKSGQTTLEKLRETGTTIVADTGDFEMISQYKP
                     QDSTTNPTLILKASEKEAYTELVDSVIEKYVTAKKIKTESDVTPEVCEAIFDRILVAF
                     GEQILKIVPGRVSTEVDAKYSFDKEGSINKAKEIIKLYEDDGISKERVLIKLSSTWEG
                     IQAAKVLEKEYGIHVNCTLLFSFPQAVAAAEAGVSLISPFVGRIMDWYKNTYNKTYTA
                     EDDPGVHSVRRIYNYYKKHGYKTIVMGASFRTVDELKALGGIDFLTISLKLLDELNNS
                     TEDVTRSLDPETAKKEGEDKTSFINDESKFRFELNEDAMTTEKLAEGIRNFAKDAQTL
                     HGIIKDKIISKHINK"
     gene            <246368..>249058
                     /gene="TPHA0F01090"
                     /locus_tag="TPHA_0F01090"
                     /db_xref="GeneID:11535607"
     mRNA            <246368..>249058
                     /gene="TPHA0F01090"
                     /locus_tag="TPHA_0F01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685980.1"
                     /db_xref="GeneID:11535607"
     CDS             246368..249058
                     /gene="TPHA0F01090"
                     /locus_tag="TPHA_0F01090"
                     /inference="similar to DNA sequence:INSDC:YGR056W,YLR357W"
                     /note="similar to Saccharomyces cerevisiae RSC1 (YGR056W)
                     and RSC2 (YLR357W); ancestral locus Anc_4.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686028.1"
                     /db_xref="GeneID:11535607"
                     /db_xref="GOA:G8BV12"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="UniProtKB/TrEMBL:G8BV12"
                     /translation="MDVLPSNNNGTNSNTELYTILKTELDKLCLLKFNSNEFPNSDPA
                     KATIPNNISISLIFKELPSREDYPDYYNIIRNPMSLDMIYKRLENSQYDSIYKLQSFV
                     DDIAQISKNARYFYNMTTIIHKFANLLDNYLKAILIPFLNNKFNMNLSIQNDQNDQQE
                     QNVNALNVISNSNLYEQQVAVTQQRIQLSPSPPIQQQFQSQYLKHTHNNQQRKHIRRG
                     RPPIIDFPYVQRIKNVFKMLKKEIDQAGESLTSTFEKLPVSIEEYKQIIDNPMTLEDV
                     RKNVRGRKYKDFMTFKKDMDLMLSNYQTYNLYKDHKQNLKRYEILFSKFNLYCEVELN
                     KPDKDFIPESGDLRYPLNEVKWGNVLYSIGDWVLLKNPNDEAKPIVGQIFKMWNTTDG
                     KIWLNVCWYFRPEQTVHRYDRLFYKNEVVKSGQYRDHTFTSVLGKCYVVHFTRFQRGD
                     PANIKNLDIPLFICEYRYNENDKNFNKIRTWRACMPEEIRDQEEVTIPVPGRKFFKYL
                     SPLAHLLSPTATFTDPIPEATAGAHNGPPAIGAVYIRPVLEKDDLGEYSTSPDCPRYI
                     IRPNDPQPEGIIDFKNGIIVTKESSSHTVRRSSSCGSTSGGHVHARKPKPETPKININ
                     DLNMKSMVSTMHNNNDSFVSKPNIIINKSTYNQVTNEHTYLMNRKVMPKKAIIFNNKI
                     PIVTNKIIQTNTTTKVKKPSTVSYSRHVLEKVTTETQVKNMKRYQEKATNTRRRDYNL
                     SSIVSNLTNKASKSSLGKIIIETPNSYVLSIPLNSKFNTLQKCEKRNKSEKTPHNISV
                     NNNPYIADVLWFKGPGINVSARMVNSGVNLSSIALNTWKKRRRVHFDEVEESIEVADD
                     DAVFDSDDERVAEPDDVQEMPDMGLKPSASYIAYRMRQSK"
     gene            complement(<249205..>250881)
                     /gene="TPHA0F01100"
                     /locus_tag="TPHA_0F01100"
                     /db_xref="GeneID:11535440"
     mRNA            complement(<249205..>250881)
                     /gene="TPHA0F01100"
                     /locus_tag="TPHA_0F01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685981.1"
                     /db_xref="GeneID:11535440"
     CDS             complement(249205..250881)
                     /gene="TPHA0F01100"
                     /locus_tag="TPHA_0F01100"
                     /inference="similar to DNA sequence:INSDC:YLR361C"
                     /note="similar to Saccharomyces cerevisiae DCR2 (YLR361C);
                     ancestral locus Anc_4.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686029.1"
                     /db_xref="GeneID:11535440"
                     /db_xref="GOA:G8BV13"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BV13"
                     /translation="MIRFNRRFTKLYLPLVVFTVTIWFLFFHNAENIDRNADLLVFDK
                     YTGRKGNIVINAGVIRCISILGASWCPSVISSAGVKHGRSYRTIVKKDLDFYSSSLNI
                     FKKYFFYDSVNVGPLLKVKNFKYISDIVSKKALESQELGENVEKKHLLEDTYAIVSKL
                     TSPETFEPIADVDVLYNLEFDPRPGWKLVDGITINALTKFSIYKHMPASDKITSTKDR
                     TLVLKQDSAKYKIVQLADMHFSITDGECHDEFPPTDDCKADRKTQVFIDKVLDLEQPD
                     LVIFTGDQIMGDQCKKDSKSALLKVVGPIIARKIKWAMVWGNHDDEGSLDRFELSQLA
                     ASLPYSTFRINAGIDTLDTTFGIGNYVQKIYKEEKNKPDSYIPIGSLIFMDSHKYSKS
                     PKSFPGYDWIKPSQYNYIGKHYGLKTPLNMAFFHIPLPEYLNIKSESTGKENKIVGSG
                     REGVTAPKYNSGTLEFLKKELNVQLISVGHDHCNDYCLSNDDYGSKSWLCYGGGAGEG
                     GYSGYGGTERRIRVFEIDFDKLSIETWKRKQTNSQDTFDHQELVSGGIAV"
     gene            <252628..>253554
                     /gene="TPHA0F01110"
                     /locus_tag="TPHA_0F01110"
                     /db_xref="GeneID:11535575"
     mRNA            <252628..>253554
                     /gene="TPHA0F01110"
                     /locus_tag="TPHA_0F01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685982.1"
                     /db_xref="GeneID:11535575"
     CDS             252628..253554
                     /gene="TPHA0F01110"
                     /locus_tag="TPHA_0F01110"
                     /inference="similar to DNA sequence:INSDC:YGR060W"
                     /note="similar to Saccharomyces cerevisiae ERG25
                     (YGR060W); ancestral locus Anc_4.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686030.1"
                     /db_xref="GeneID:11535575"
                     /db_xref="GOA:G8BV14"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G8BV14"
                     /translation="MSSVFGNVTIANALKDPSYFKTLQNIAASQPQLNVVEQYWSAWY
                     TYMNNDVLATGIFFFLLHEFTYFFRCLPWMIIDQMPYFRKWKIQPTKIPSAKEQWYCF
                     KSVLLSHFLVEAIPIWTFHPMCESLGISVEVPFPTIKRMTLEIALFFCLEDMWHYWAH
                     RLFHYGVFYKYIHKQHHRYAAPFGLSAEYAHPAETLSLGFGTVGMPMLYVLYTGKLHL
                     FTLSVWVVLRLFQAVDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DYCLDTEAGPEAKSAREERMRSKAEKNVKKNN"
     gene            complement(<253774..>254658)
                     /gene="TPHA0F01120"
                     /locus_tag="TPHA_0F01120"
                     /db_xref="GeneID:11535576"
     mRNA            complement(<253774..>254658)
                     /gene="TPHA0F01120"
                     /locus_tag="TPHA_0F01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685983.1"
                     /db_xref="GeneID:11535576"
     CDS             complement(253774..254658)
                     /gene="TPHA0F01120"
                     /locus_tag="TPHA_0F01120"
                     /inference="similar to DNA sequence:INSDC:YGR062C"
                     /note="similar to Saccharomyces cerevisiae COX18
                     (YGR062C); ancestral locus Anc_4.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686031.1"
                     /db_xref="GeneID:11535576"
                     /db_xref="GOA:G8BV15"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:G8BV15"
                     /translation="MFTSVYKAGFFPLVSATRTCCIKTTSRSRSFSTITAVAEAFVSL
                     HEVTNIPWVILIPLSSVTLRTLFTLPLSILQRQRLVKQNNLRNVVLSIKPVVALRLAQ
                     TQKLTPEQIKMLSLKESRNRQKKLFKKYNIDLWKNMILPLVQIPLWVTISLGIRRLVT
                     DPDSNTMHVLKETNTDNILYANNILESTLDLSLPFEPLPMLLPVILGTLSIMNVEYNG
                     IMFARRRDKALVGGKLSNAMNSVLNVSRMSSVFMMGISTQTSMILSIYWITSQLFSYI
                     QNKLLDCLWPLHNKNDLM"
     gene            complement(<254994..>255305)
                     /gene="TPHA0F01130"
                     /locus_tag="TPHA_0F01130"
                     /db_xref="GeneID:11535397"
     mRNA            complement(<254994..>255305)
                     /gene="TPHA0F01130"
                     /locus_tag="TPHA_0F01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685984.1"
                     /db_xref="GeneID:11535397"
     CDS             complement(254994..255305)
                     /gene="TPHA0F01130"
                     /locus_tag="TPHA_0F01130"
                     /inference="similar to DNA sequence:INSDC:YGR063C"
                     /note="similar to Saccharomyces cerevisiae SPT4 (YGR063C);
                     ancestral locus Anc_4.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686032.1"
                     /db_xref="GeneID:11535397"
                     /db_xref="GOA:G8BV16"
                     /db_xref="InterPro:IPR009287"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:G8BV16"
                     /translation="MSSNDRACMLCGIVQTTNEFSREGCPNCQGIFEEAGVSSIECTS
                     PSFEGLVGMCKPSKSWVAKWLNVDSYIPGMYAVKVDGRLPIEVVDLLPHYKPRDGSQV
                     E"
     gene            <256330..>257340
                     /gene="TPHA0F01140"
                     /locus_tag="TPHA_0F01140"
                     /db_xref="GeneID:11531538"
     mRNA            join(<256330..256462,257081..>257340)
                     /gene="TPHA0F01140"
                     /locus_tag="TPHA_0F01140"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_003685985.1"
                     /db_xref="GeneID:11531538"
     CDS             join(256330..256462,257081..257340)
                     /gene="TPHA0F01140"
                     /locus_tag="TPHA_0F01140"
                     /inference="similar to DNA sequence:INSDC:YLR367W"
                     /note="similar to Saccharomyces cerevisiae RPS22B
                     (YLR367W); ancestral locus Anc_4.213"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_003686033.1"
                     /db_xref="GeneID:11531538"
                     /db_xref="GOA:G8BN65"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:G8BN65"
                     /translation="MTRTSVLADALNAINNAEKAGKRQVMIRPSSKVIIKFLQVVQKH
                     GYIGEFEYIDDHRSGKIVIQLNGRLNKVGVISPRFNVKISEIEKWTENLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<257787..>260525)
                     /gene="TPHA0F01150"
                     /locus_tag="TPHA_0F01150"
                     /db_xref="GeneID:11535573"
     mRNA            complement(<257787..>260525)
                     /gene="TPHA0F01150"
                     /locus_tag="TPHA_0F01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685986.1"
                     /db_xref="GeneID:11535573"
     CDS             complement(257787..260525)
                     /gene="TPHA0F01150"
                     /locus_tag="TPHA_0F01150"
                     /inference="similar to DNA sequence:INSDC:YGR067C"
                     /note="similar to Saccharomyces cerevisiae YGR067C;
                     ancestral locus Anc_4.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686034.1"
                     /db_xref="GeneID:11535573"
                     /db_xref="UniProtKB/TrEMBL:G8BV18"
                     /translation="MSINKPKWPKPTLYKAKAKTIEEKLKSADFMAPNQPYSGKIRFV
                     EKGSAKANSSISAKIEDSNNMSPTYSLSDDSPAPNTGNNNNFSGAGVNASKGWSYKKY
                     PRKNQFSLNCKEIILIKNNKLQILIDTLSNFYDLGMDFLNTLLPYNDLNISSRDMTLV
                     LIVTGSLVSADENFDEIWTAVMDSFRIDLSQDQQLEDVNTPAFKKLITNFLALSVLVF
                     LINGASYLDNIFIGHRAIELYLQQYKSIEGLSNSNMFTYIINQRITTEEKALALHSMV
                     LFVRYSTFITTSNQNEKLSNIKLFYDVFLNSIFTYNPPNQSKTLLEYIQEINYEDVSY
                     QMYTTCDYYLVTAICDCLYFEHLFNNPSFESKDQFHKALITIIKSQNEIANKSNSDPN
                     SSTPLNPFSHLFMENPMYDFFTIKDRKSISDGFWILLEISWLEFINSYYAESNSQKVL
                     PEPAVAETNLEESEDDIANGLMGKEHLEELERSDTLHVDKLSHLFLIPTTIVISLLTS
                     PNKLGLSERNLFLLVDVLSFQVNIFRIEITKITESKQFKDSLDNPVLKEFYSIWNYAL
                     MSDAIQTNAMPDRDLIAFQDFSRIYFVPNAILPMTEYSANDFAFEYHSFILSSMKFMK
                     FNILMNRLITSSTFISQQMKNAMISIWETLQRSITQNWSAPEIVLKKGFSYPTESNTN
                     DKKNFIEVAEDNTTNKTDKIILPPPLSMTMVPSSSQPLAYMTQSQSFNTKNSFLGTIG
                     TSMSATNSISQRIGSSAMTSQLSNRYNIQPPVSNFNIETANQSKTVYPYETNNTNFPT
                     PYSNMMFNPMTRDDSLSISSNSMNSRISMGTNSSSTKSQRSLSFKAIPMVERTESNYT
                     QFVQNSSISSINQYLGSNGPQFSNHKMSATNQSGNSQSIPDSLPLNQKYDSNFGAQ"
     gene            complement(<262758..>264830)
                     /gene="TPHA0F01160"
                     /locus_tag="TPHA_0F01160"
                     /db_xref="GeneID:11535574"
     mRNA            complement(<262758..>264830)
                     /gene="TPHA0F01160"
                     /locus_tag="TPHA_0F01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685987.1"
                     /db_xref="GeneID:11535574"
     CDS             complement(262758..264830)
                     /gene="TPHA0F01160"
                     /locus_tag="TPHA_0F01160"
                     /inference="similar to DNA sequence:INSDC:YGR068C"
                     /note="similar to Saccharomyces cerevisiae YGR068C;
                     ancestral locus Anc_4.215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686035.1"
                     /db_xref="GeneID:11535574"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G8BV19"
                     /translation="MFSKTYLTGASNSAKKAKSPVVYLDIRVDSPYKDIIILQGSPLE
                     TDPYILSGKLVFSLNDDVVVKKVSLKFTGVFKLEFMQYGRFKNAGKLASVIKEKDKIF
                     EATFDNLLISPQGTITIGSDTRHNSMYNTEEPGNSTSNFDGMARTSPNVYTNDNARDS
                     TPNLESSDNDRSQASKSKYLSSGLSKLIKKSSFYGANVLELPISGTSGTPYAHMREEL
                     NSMSSSTQIQFQLQKGNYELPFKVMLPREIPETIEGLQSASILYNFEAHIERARKAKG
                     FTSIIRDDNDNYLNENLSLAMTGTSSNMSFYTYKCFKYMRIFRTLSFDNLAIQEEMKV
                     GNTWANKLQYEVSIPSRAIPIGGYTPISIKIFPFQKNYKLEKITATLVQFYSMKDCSN
                     TFYDDSVNTFKQSMTDFDGFVTINERTGTLIEKVEIDSMIKIPDDLKKLTQDCDIVNE
                     LVQVRHKLTIQIFMKRIAENGEQKTLEIKANLPVLLYVSPQFGIKGRYVILDKIEGNI
                     HFRSGKFVNLFNDGSANDISGMTAAAVNNSNPLFVDNAAPPNYRDRTKDKLIHYNTST
                     STGMGSVLETQTADTNAAAPDDETSNEPRSTVKEETRENNRIIPLSAVPTYEQTMNET
                     TVNASTGSMTITTITTTPGAIHGNVHPTTTTTRVMDNTSNSAHASTTTESNAIYMVPS
                     HELAPRYY"
     gene            <265324..>267006
                     /gene="TPHA0F01170"
                     /locus_tag="TPHA_0F01170"
                     /db_xref="GeneID:11535554"
     mRNA            <265324..>267006
                     /gene="TPHA0F01170"
                     /locus_tag="TPHA_0F01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685988.1"
                     /db_xref="GeneID:11535554"
     CDS             265324..267006
                     /gene="TPHA0F01170"
                     /locus_tag="TPHA_0F01170"
                     /inference="similar to DNA sequence:INSDC:YLR368W"
                     /note="similar to Saccharomyces cerevisiae MDM30
                     (YLR368W); ancestral locus Anc_4.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686036.1"
                     /db_xref="GeneID:11535554"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8BV20"
                     /translation="MQYLELPTEVLSIICENLDIKDILKLRLCNKKLSNLILYLEFWK
                     EISRRNWTCHIDDDLILQSHINCHRDAIFEIGTQWFYFYKRYFVMEHDILNKVKTITT
                     HLNSATSYVEKSKQIIMESDYDIYFALSNIINTSINSYKEKIYNQSFEITSICKRLNL
                     TLLTNLFIEEFYPKILLSSDIFDLESNVLLPLSLIDPSYHYLHCYRAIFYRSFEKHIV
                     SKFTTIDDFLDHSLVQRVLEISTYLNNNLKGVYQNNDNYTCINNYSLLRIYSKANAGR
                     PILRLVILQYLLNKYHVISVISNNILTIRGNGKEHVCYIIIDKTLRFKLVNKQNMLSI
                     LLEAYGRTGYRESRELFFRKFFNPLRGKDLLNMLLEEVCENIAIENDPIPVEESTICP
                     ENMRSDVFKYLAIINHLWTPTNNELDSFDYVLYPQLFSYKGIVREEKVALSYWNLPIH
                     NKLQLNMENIGYIQQFDTRMKVIIFENTVHRIHMDSNGTITRTSRTYTQGQNLLSGPK
                     LEQFVFNISVLHFGKYFKSFNWNDKRFIMNENYRLLLEKHIKHITEISQKLH"
     gene            <267674..>270061
                     /gene="TPHA0F01180"
                     /locus_tag="TPHA_0F01180"
                     /db_xref="GeneID:11535548"
     mRNA            <267674..>270061
                     /gene="TPHA0F01180"
                     /locus_tag="TPHA_0F01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685989.1"
                     /db_xref="GeneID:11535548"
     CDS             267674..270061
                     /gene="TPHA0F01180"
                     /locus_tag="TPHA_0F01180"
                     /inference="similar to DNA sequence:INSDC:YIL107C"
                     /note="similar to Saccharomyces cerevisiae PFK26
                     (YIL107C); ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686037.1"
                     /db_xref="GeneID:11535548"
                     /db_xref="GOA:G8BV21"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8BV21"
                     /translation="MENTTSQAQPNGEEIDRSISSSSIDSLASSTLSKTSNNDVSPTN
                     STSNSAPNSKKHVRILTNKDSLLDDKEQGLYKTTSFLKRPLSDTPVGSVWNSPGTSRE
                     DTPNVSRESSAMNLLKLNKINSNTEPSIKALLKSNLITGNLHLQHGSTPNRSPNKNNE
                     NNIPSGMISPSRFTHPKKIPTTLDVPGLTKSKTSPDGTISTEDAGSKLIIIMVGLPAT
                     GKSFITNKLSRYLNYLLYYCRAFNVGNTRRQFAKEHGLQEQDSTFFDPDNQKSKQLRE
                     KWAMDTLQELLDYLLNGKGSVGIFDATNTSRKRRKHVLNTIRERSKDIQVLFLETVCS
                     DKFVVERNIQLKLCGPDYKGKDPTTSLRDFKERLSNYTKAYEPIEDSEDIPYIKMIDI
                     SKKVISYKIQGFLASQTVYYLLNFSLAYRQIWISRNGESEYNVSGRIGGDSHLTKRGE
                     KYALALTKFINERREIFHNAEIEKQYKNPRRDEDHQVNEFFVWHSPRRRCCETIKYFD
                     EADYPTKEMKMLEELNAGNCEGMTYAEIKRKYPEGYAERQRDKLRYRYPGIGGESYTD
                     VINRVKSVITEIERIEDNVLIVTHRVIARVLLGYFLNLGTDTIANLDIPLHCVYCLDL
                     KPYGISWTLYEYNEEKDSFYKVPESVLNTTKVREISLVNKERRYSVVPTAPTTKNRSV
                     SNPGPRSQLDDYNNGVSDDYDEVSTPVGSEINNTDRGGKPIRSKSVRKDMNPRATSNS
                     NTGYVKAEDRKKEIQFEIAELERRLKNLKEPSRISEYCDDQAINHDNDNDNENNS"
     gene            complement(<270259..>272235)
                     /gene="TPHA0F01190"
                     /locus_tag="TPHA_0F01190"
                     /db_xref="GeneID:11535659"
     mRNA            complement(<270259..>272235)
                     /gene="TPHA0F01190"
                     /locus_tag="TPHA_0F01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685990.1"
                     /db_xref="GeneID:11535659"
     CDS             complement(270259..272235)
                     /gene="TPHA0F01190"
                     /locus_tag="TPHA_0F01190"
                     /inference="similar to DNA sequence:INSDC:YIL108W"
                     /note="similar to Saccharomyces cerevisiae YIL108W;
                     ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686038.1"
                     /db_xref="GeneID:11535659"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:G8BV22"
                     /translation="MSGNIELFNLNDGDELVSPALILHGKVNNDENGKSIKVFHPQLP
                     SLSYPINENHFRATVILTPGENKFTLSTDTGNSTSIIKVNYTPMLNDQPIHLCLLVAK
                     DSEYVYDSPKTQIEKEGGHGLELAIKKMKLGGRLMQAYTNEQMLRNGFGNRTFQFVEE
                     FAKDTLFKSQQAMRSTIKVHILHSDRTVSEIRDHDVAQQNRSAKRSGALYEFAMEAMV
                     KYGGPFVTSEKPVQAAVMFMDAHWDKIFITGHAALGGGNDMFKLAIFGSHGLYSWPST
                     MEDIVEYFTDSTLVSKEEVANDNDECGSHWECLTVTLGAFLHEIGHSLGCPHQEYGVM
                     LRGYPVFNRSFLTKEAFSTRTNSYGVAAPIADDTECRWHRLDLLRFLYHPSFTLPSDY
                     YDETFSRPSKIGSFTSPRASVFPLGEKTCQIKSDTGVYSIEIFCGDLAHGYFEYLPKS
                     LGGTGPQKNITLTLEDFHKKIPDHLLAKFGNSFGVKILSINAPEAYIEDFASLLNVEY
                     ISMGDYGFDESIKGIKSITFGSTTAGDSTGIIAFDSRKVNCVRVFHGHALDGLQVFSK
                     GAVATFGNETAKFTDFEIEEDEHITGFNVRSGQWIDAIQILTSKGRKSEMLGNPTGGG
                     LGLLSPPDGFHILGLQGTISQWVQGVGIIYGELN"
     gene            complement(<272618..>273736)
                     /gene="TPHA0F01200"
                     /locus_tag="TPHA_0F01200"
                     /db_xref="GeneID:11535660"
     mRNA            complement(<272618..>273736)
                     /gene="TPHA0F01200"
                     /locus_tag="TPHA_0F01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685991.1"
                     /db_xref="GeneID:11535660"
     CDS             complement(272618..273736)
                     /gene="TPHA0F01200"
                     /locus_tag="TPHA_0F01200"
                     /inference="similar to DNA sequence:INSDC:YIL110W"
                     /note="similar to Saccharomyces cerevisiae YIL110W;
                     ancestral locus Anc_2.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686039.1"
                     /db_xref="GeneID:11535660"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BV23"
                     /translation="MSFSFGFTGNDLEDDELDGSNSVTNIVTDATIVNPLDEPRLLAD
                     ETFQPTLENLQLILESLSGVRLTFEEFQTPLTNTTLYRRELFDIKHQLMSEDLENDSA
                     TDKTELEILIGGTSEDVRKNVYEGGLKSWECSIDLVDALVDLKARYCTLSNYDTILEL
                     GCGTSLPTEYIFKNHLQENEDKGLNLILSDYNKSVLRLVTVPNLIITWAKTVLDTVQW
                     NDLQTKSSPDMPVRDDELMLTPELLTLFLSDLKNRNITVNIISGTWSRRFDELTKSVI
                     SPNAKNIMMLTSETIYQPENLTIVAETIIDLKTYYQQNAINLTCLLAAKDIYFGVGGS
                     IVEFENYLTKQIELQNLNIVHKTFKIDAGLKRSIMHIE"
     gene            complement(<274357..>274809)
                     /gene="TPHA0F01210"
                     /locus_tag="TPHA_0F01210"
                     /db_xref="GeneID:11535420"
     mRNA            complement(<274357..>274809)
                     /gene="TPHA0F01210"
                     /locus_tag="TPHA_0F01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685992.1"
                     /db_xref="GeneID:11535420"
     CDS             complement(274357..274809)
                     /gene="TPHA0F01210"
                     /locus_tag="TPHA_0F01210"
                     /inference="similar to DNA sequence:INSDC:YNL052W,YIL111W"
                     /note="similar to Saccharomyces cerevisiae COX5A (YNL052W)
                     and COX5B (YIL111W); ancestral locus Anc_2.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686040.1"
                     /db_xref="GeneID:11535420"
                     /db_xref="GOA:G8BV24"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:G8BV24"
                     /translation="MLRSSFSSITHIAQRRLIQSHALSKASIAELQNRWESMPPSEQN
                     SIVSKLAARQKLPWTQLTEEEKKAAWYISYGEWGPRRPVLAKGEGVFVTKGVIIGLLI
                     SFGVFAGVRELARDDPRTMTKEWQLKSNEYLQSVNANPWTGHDQVQSK"
     gene            complement(<275858..>279094)
                     /gene="TPHA0F01220"
                     /locus_tag="TPHA_0F01220"
                     /db_xref="GeneID:11535649"
     mRNA            complement(<275858..>279094)
                     /gene="TPHA0F01220"
                     /locus_tag="TPHA_0F01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685993.1"
                     /db_xref="GeneID:11535649"
     CDS             complement(275858..279094)
                     /gene="TPHA0F01220"
                     /locus_tag="TPHA_0F01220"
                     /inference="similar to DNA sequence:INSDC:YIL112W"
                     /note="similar to Saccharomyces cerevisiae HOS4 (YIL112W);
                     ancestral locus Anc_2.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686041.1"
                     /db_xref="GeneID:11535649"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BV25"
                     /translation="MSDNGNEPPVKKRSLSSYLSNMSSRRQELEQIAIDQKIKEEEDQ
                     VRMEKEQQRLEREKLERERLEKERLEKEKLEKERLEKEDLKNEPLEKESREYDKQEHK
                     IYTQEATSDEKLNANITKENLHNDIKTEDKEESPVNINKDNITSDLTDINHYSSINEN
                     DTSTNVNLGSILRVDLKNILVEPKKNSFSDSDNDDGDNNDLDDFVVSDDEILSDAPTE
                     PEPLPKAKLTRLVRSDQVSNRKSNSRKKSNENTDSDLSDIEDNKYNVLSSSVFADESF
                     TAKDGIRMIHSSPSKLKREQKFIRTKAEVSSSSTPSLKVRKPKKSIYRDAGGRSKLQI
                     ACDKGKFEIVKRLLEEGEIDVNDQDNAGNSSLHEAALNGYIDCVKLLVKYGANVNLIS
                     YEMFRDTPLIDAAANGHLDVVKFLLEKGADPTVVNAKGLNAYQSIEEEEDYSSDVIND
                     IMQIKACLMEASDKWDRKKGSMTATPEPDHVKNNEKNNDENIMEDEFHWTNITSKSGR
                     EKLLKASRNGNLTYVGLFLENGGRVDFKSFIESIRYGHEDITSLYLAFGAHVNSSLPD
                     GTTPLMAAVGRGHINIVKLLLEAGADKTKKDKKGKTAFYYAINNIHGTPDTNELKLVG
                     SSEELEMFNSGQLKPDVVKYIVDKGDDTKVDNSTRGKHQRSDVEFSESDQDESNRNKK
                     IAKIEVPKTEEQLLEEKAERKRQEEEELRLEKLRVEEERLARKRKEEEEEEDRKRREI
                     EAEEKQKRKEQEEKEERIRKAEEEIRMKKQKEEEEARAEKLKREEEEYRVKMLQQKKK
                     REQELLQKLAEDELKREAEKEKHKLEEDKRIKELELQKERELIKKQEEIEINHRRQVR
                     ALYPIGLKLINFQSDGILSISKLANCLPIYYITNVDDGLKYVLNLQMLLVLQDKVFGD
                     VESDINQSSTSIDITNSNKKLQVWNIFSFLFLFGGNNNRKKIDLGSISLNSRIVFEKK
                     EFIKFSLLPLRWIRWEEIDFQKYEGKYESENGKTLTETLEDSMIEIELTGPFITTKEK
                     IADDSAVREATHKHAPLQLNIDEMPTKFQNRNDVASLVSQLTVARPLW"
     gene            complement(<279548..>280693)
                     /gene="TPHA0F01230"
                     /locus_tag="TPHA_0F01230"
                     /db_xref="GeneID:11535650"
     mRNA            complement(<279548..>280693)
                     /gene="TPHA0F01230"
                     /locus_tag="TPHA_0F01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685994.1"
                     /db_xref="GeneID:11535650"
     CDS             complement(279548..280693)
                     /gene="TPHA0F01230"
                     /locus_tag="TPHA_0F01230"
                     /inference="similar to DNA sequence:INSDC:YIL113W,YNL053W"
                     /note="similar to Saccharomyces cerevisiae SDP1 (YIL113W)
                     and MSG5 (YNL053W); ancestral locus Anc_2.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686042.1"
                     /db_xref="GeneID:11535650"
                     /db_xref="GOA:G8BV26"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BV26"
                     /translation="MNVRDYGMDYANNLVAIDNTISKMSSIDISCKTKICSNRNTKKL
                     SLKLNNNDKLKDNLTYDKLDNAPSLSDLKSHNSDTHIYTLPKKKLPNVIIKKSKSTNS
                     SPVEPSIASKMRDIKRNQTLPVSINTTNVNTINKDGTEFINTYSNMRLQTLTPTSSLP
                     QSETESHFLPFDKQFLPITALNNIDNTGYSKEVHEEFAYPHGPMLVIEPYIYLYSEPS
                     LTEICDFDIVINVAKEIPNLGPLIPNNLKLDYYHIPWTHNSKIFLELKHVTDIMHSGV
                     IAKKKILIHCQCGISRSASLIVAYIMRYSKLSLNDAYDKLKNIVTLISPNMSLIFQLM
                     EWNDFLKNEKSSSNDIKQPQEQDEIDHRQNTTNDISLIQTHPELLNT"
     gene            complement(<281681..>285037)
                     /gene="TPHA0F01240"
                     /locus_tag="TPHA_0F01240"
                     /db_xref="GeneID:11535558"
     mRNA            complement(<281681..>285037)
                     /gene="TPHA0F01240"
                     /locus_tag="TPHA_0F01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685995.1"
                     /db_xref="GeneID:11535558"
     CDS             complement(281681..285037)
                     /gene="TPHA0F01240"
                     /locus_tag="TPHA_0F01240"
                     /inference="similar to DNA sequence:INSDC:YNL054W"
                     /note="similar to Saccharomyces cerevisiae VAC7 (YNL054W);
                     ancestral locus Anc_2.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686043.1"
                     /db_xref="GeneID:11535558"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:G8BV27"
                     /translation="MNGDHHKFLVETEMVDTPAVNIMPTTIPAGTTAAINQDNNKPQL
                     INSPKYESQNPIPLKMDNASSQSREIDQKQSVRNSHIKEHTYPQGTDVSDAALKSIQK
                     QPLNDKKITNTMDNTQIEDGSSRIPSASVITNSNLDQNDLNNRVTQDMIKDSLQHMIH
                     NEGYNNVPDHENNNFTSLSLPSKTDYTGKVPTITTPISLTSNVESTLFSGNQHNKSQK
                     ATDLRPAKIIERPSMQLLNSKRNFTRRWTTKINEKTNSEFHNACGRKIIAENNIKNNG
                     YNNYKELKSNSINNNNNSINNNNNNNNNNSNNGNNNGNSNHNSFINNSKPNNDTINVK
                     QLQGKNKSTDALATNIATLKNSDDNIQHSDGNDNEVLVHPTKTDFFAARLASAVGERE
                     ASDSEETFVYESAANSSRHVAAINTIESAIEGNDQQVFKNGNVQLNSNTNKTYGIAPK
                     MSVPLLNTNKKFLNKIKNQRHTSMGAAPLGNKMSVSNVHTNVPTSNPNNMLNYANSNI
                     SPTSRTFQLVPDDLSSLRSSNSMRSTSSITQSPSHGIHMATSNGNLIHSPTHKMHVNT
                     NGVNPQVRLRNSGMLNKNNGPSRNVSHNNQAMRQNSGYRQRAPNNSNNHENKRKLRTT
                     ASRIFDTNGAPLRKYSSIPDNVNLEDFMEEPKEIQPSTTLSNSVVRNDHFLDYHDNVQ
                     NNSHNNGFNTNFTNNTIQEEDSDINDESNNTKKSVNPQHSNSIVNTESTSENKNKQNA
                     YHNTEDHPNMSNRNDDNMHENNTHVLEDDEDDDRSMFFYNHGGDLGTRPQISDYEDND
                     ELIESDGADVDPRLYDTYPYYESDNRYGKRRPEHGSNYQDYSLYTGNTNRHESYSSQF
                     ANNKGFQNYNENQFVGDDDINEQTPLRNNQFYYGDESNNSPHNFVTKKSSWSKIKYCV
                     YFSLSVVFLVTIGFILGFLLATNKELQGLNVVFIDNIISSTSILLFDLTCGAYNPGFF
                     TINVQDADIDIFAKSIYVTENDYNFKRKNKVLETVLLGTISSLESPLEFRGEFFRRRY
                     DVSSSSVKLLNPGKNKVASDPNGDNAINIESDVEKWKQLIKHDYELLIKGSLKYRVPF
                     FNTERSVSIQQSIEVHPDDKDKGDDYLSLL"
     gene            <286089..>289925
                     /gene="TPHA0F01250"
                     /locus_tag="TPHA_0F01250"
                     /db_xref="GeneID:11535355"
     mRNA            <286089..>289925
                     /gene="TPHA0F01250"
                     /locus_tag="TPHA_0F01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685996.1"
                     /db_xref="GeneID:11535355"
     CDS             286089..289925
                     /gene="TPHA0F01250"
                     /locus_tag="TPHA_0F01250"
                     /inference="similar to DNA sequence:INSDC:YIL115C"
                     /note="similar to Saccharomyces cerevisiae NUP159
                     (YIL115C); ancestral locus Anc_2.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686044.1"
                     /db_xref="GeneID:11535355"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8BV28"
                     /translation="MSIISNELETNVSDDFGFKALGLKNILPPYTSNKPYASLQNFDI
                     SNERELYIAATGNKIVVGKVQNLREFVVVDEPEAEGIEDENTIKLEFLWEDDVENVIF
                     VKFTTNHIIFVCSTGELYSLDYDNIQEGKKLLHTLSNEIRDMKIQHSTNLLLLLLKSS
                     KLLCYNYETGQELKEISDNVLSFDITYKKLALAFSKEDSKQIKLLDATNTEFKEEQSI
                     DYPTEVIEFCDEGYSTVNVTILSDSQLLMVLDEVYDRLHEEDEISYDQKMYVIDLTLP
                     EVSFKESFDITPAFGSVLRVPTLYNIILNGLIDDKKQLNVIGSSCASELTIIDESGVL
                     QPSQDGERAILPINKETDNDTNPIGIAIDISSSGVISDPCMGVDKIDQMALIYILTDD
                     GSIIIDGIYDSKAMKEGKYNIDNLKNRLHTRENFSIEEATKVNNLPTPEKTDDSSLAL
                     KLDTDDDLDISSKLSLDVNNDQPDNVKSHSIFENPAFGSTGFGSTDSKPAFGSTGFGS
                     TDSKPAFGSTGFGSTDSKPAFGSTGFGSTDAKPAFGSTGFGSTDSKPAFGSTGFGSTD
                     SKPAFGSTGFGSTDSKPAFGSTGFGSTDKKSPFAGTAFGTTGTKSLFGTSSFGQLSTE
                     SNKQSPFAKLSLNKGNSDSIDNPFLKPTEQMKSNLSIENNSNITAFSPSKSVRSDNEG
                     DESFDITESELANENDNDEKDYVVLEKENPLDNAPIKDINEEADSVSIKSDYEVTSDT
                     AGYGHEENNRDVKEDQSISISSDENISPSSDLSDSTINQTPISNIPDTINDETDVKVA
                     STKTMNEPKTFSLANFTDRLKQKTNIDTDSTALSFPDRTAKTNNLSPFASYTSEIHKP
                     TTSSFSLGSNDVNKEDDEKVEDRHSPSLNDLATPSATEIPNDNIENLDIIDHSAELFE
                     QNSTPSVDDDIENERANLSSPEELIDDDAEVSENTSDSPNNDKPLMTDFAMQVQCAGQ
                     CDIGNQTIIKEACDFSMLSFEDDEEYLSKVTVPKRLGNFYSGALIDKLESVSTNVNLQ
                     AIEKTCSFIDAEISVLELNIKTLKDFISDHSIAQIEKRTDLTLPNIYSWRLAEAKTFT
                     EILSKISTDVANIFTDVSHCDEDASILYSKISSIIESKNEVTSIIDQFQNGLDNIKSS
                     DFLSCYQEALQNKLRVSIKNILDKLKLIEESTNLLKVYTIRNDSLKQNPYVNKLISDS
                     MNRGTLLEQIKGLRQDVSHLSISDNQKQLELVKSSTVSRLGLNSYKDSESIKISETAL
                     RMNTKREIGILFKEIL"
     gene            complement(<290133..>291311)
                     /gene="TPHA0F01260"
                     /locus_tag="TPHA_0F01260"
                     /db_xref="GeneID:11535464"
     mRNA            complement(<290133..>291311)
                     /gene="TPHA0F01260"
                     /locus_tag="TPHA_0F01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685997.1"
                     /db_xref="GeneID:11535464"
     CDS             complement(290133..291311)
                     /gene="TPHA0F01260"
                     /locus_tag="TPHA_0F01260"
                     /inference="similar to DNA sequence:INSDC:YIL116W"
                     /note="similar to Saccharomyces cerevisiae HIS5 (YIL116W);
                     ancestral locus Anc_2.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686045.1"
                     /db_xref="GeneID:11535464"
                     /db_xref="GOA:G8BV29"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8BV29"
                     /translation="MTFHLESIVRPKIYNLTPYRCARDDFTEGILLDANENANGPIPF
                     ELRDTDLNRYPDPHQIEFKTLFAHYRNSKDNTANVPDLSHKNLCLGVGSDECIDALIR
                     ACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNSFQMDVKRTLETLKKDD
                     LIRLLFITSPGNPTGKIIAIKDIIYVLEHWKNGLVVVDEAYVDFSTYFNEETKKTEYF
                     SVAKLVTKYPNLTVLQTLSKSFGLAGIRLGVTFASEELARILNAMKAPYNISSTTSNH
                     AIKAVQPESLRLMEDNANEVNKEKYRVLEALTALPLVDDQYVGGLDANFVMIRINKGD
                     NELAKNVYLSLATQSKVVIRFRGNELGCQGCLRITIGTPSENDQLIAKFSETLSTLSK
                     "
     gene            <292197..>292700
                     /gene="TPHA0F01270"
                     /locus_tag="TPHA_0F01270"
                     /db_xref="GeneID:11535465"
     mRNA            <292197..>292700
                     /gene="TPHA0F01270"
                     /locus_tag="TPHA_0F01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685998.1"
                     /db_xref="GeneID:11535465"
     CDS             292197..292700
                     /gene="TPHA0F01270"
                     /locus_tag="TPHA_0F01270"
                     /inference="similar to DNA sequence:INSDC:YIL117C,YNL058C"
                     /note="similar to Saccharomyces cerevisiae PRM5 (YIL117C)
                     and YNL058C; ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686046.1"
                     /db_xref="GeneID:11535465"
                     /db_xref="UniProtKB/TrEMBL:G8BV30"
                     /translation="MELTSHSDMIHQIEIPSSLDNPYIWKTSDLPNGLVFIVVGAIFA
                     AVISFLVIWIVFDNYDSQKRTSESFRSYHEKYEQQKKKKVTLSVDNLTDIVRKFPFVG
                     TKPDSEASCMFDEEALQNRRNPLIISPTLEMQIAQKQNIIKYHSRSALSSNGVVNEIN
                     NSTTNVK"
     gene            complement(<293022..>293657)
                     /gene="TPHA0F01280"
                     /locus_tag="TPHA_0F01280"
                     /db_xref="GeneID:11535378"
     mRNA            complement(<293022..>293657)
                     /gene="TPHA0F01280"
                     /locus_tag="TPHA_0F01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003685999.1"
                     /db_xref="GeneID:11535378"
     CDS             complement(293022..293657)
                     /gene="TPHA0F01280"
                     /locus_tag="TPHA_0F01280"
                     /inference="similar to DNA sequence:INSDC:YIL118W"
                     /note="similar to Saccharomyces cerevisiae RHO3 (YIL118W);
                     ancestral locus Anc_2.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686047.1"
                     /db_xref="GeneID:11535378"
                     /db_xref="GOA:G8BV31"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BV31"
                     /translation="MLCGTSSSATKPIERKIVILGDGACGKTSLLNVFTRGYFPKVYE
                     PTVFENYIHDIFVDGKHITLSLWDTAGQEEFDRLRSLSYSDTDTIMLCFSVDSRDSLE
                     NVQHKWVGEIADNCEDVKLVLVALKCDLRNEEHNDDPDGNNNRPEELITYDEGLALAK
                     KIGALRYLECSAKQNKGVNEAFTEATRVVLTTDSKRNDIEEEKSGFDCSIM"
     gene            complement(<294550..>296238)
                     /gene="TPHA0F01290"
                     /locus_tag="TPHA_0F01290"
                     /db_xref="GeneID:11535357"
     mRNA            complement(<294550..>296238)
                     /gene="TPHA0F01290"
                     /locus_tag="TPHA_0F01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686000.1"
                     /db_xref="GeneID:11535357"
     CDS             complement(294550..296238)
                     /gene="TPHA0F01290"
                     /locus_tag="TPHA_0F01290"
                     /inference="similar to DNA sequence:INSDC:YNL065W,YIL120W"
                     /note="similar to Saccharomyces cerevisiae AQR1 (YNL065W)
                     and QDR1 (YIL120W); ancestral locus Anc_2.242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686048.1"
                     /db_xref="GeneID:11535357"
                     /db_xref="GOA:G8BV32"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BV32"
                     /translation="MDSGTESISSMDDRHSYGLKEADQNRKLYNDSDDKNDSVTHSKA
                     DLHGTLSHTRTRELSCSSDLESQQSHDINSENSNKVPHSLFTYNQKWMMVGVLTMCGF
                     WSSLGSPIYYPALKQLEKQFDVDENMVNVTVVVYLIFQGLSPTFCGGLADLFGRRPVI
                     LTGMLIYTVASIGLACSNSYGVIVFLRCLQSAGISPTISISSGAVGDFTVKSERGTFV
                     GAVSGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGVSMMVAFFVLPETKRTIVG
                     NLSIRPNIYIIELQFLALNSVQKSFRYDNPDTETLEVNTSKYDPIAAFKILASPEIFL
                     SLLPGGMIFAQWTLMLSAISSELSTAPYNYKLTIIGVCYLPAGIGGLLGSLITGRVID
                     YYYKRSLRKFEEDKMNGIIPMDAEFNAIKIRLTASLPQILLSVIVYIIFGWCLGEGEP
                     VESMLIVSFFCSFCTMSTLSTSSTLLVDLYPGKSSTATSCFNFIRCSLSAMFMGCFAD
                     MKAAMTLGGTFTFLSGIVCISIGLLYFPMYHGMEWRNRRALKSELKAKEVMDTE"
     gene            complement(<297880..>298725)
                     /gene="TPHA0F01300"
                     /locus_tag="TPHA_0F01300"
                     /db_xref="GeneID:11535358"
     mRNA            complement(<297880..>298725)
                     /gene="TPHA0F01300"
                     /locus_tag="TPHA_0F01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686001.1"
                     /db_xref="GeneID:11535358"
     CDS             complement(297880..298725)
                     /gene="TPHA0F01300"
                     /locus_tag="TPHA_0F01300"
                     /inference="similar to DNA sequence:INSDC:YIL122W"
                     /note="similar to Saccharomyces cerevisiae POG1 (YIL122W);
                     ancestral locus Anc_2.240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686049.1"
                     /db_xref="GeneID:11535358"
                     /db_xref="UniProtKB/TrEMBL:G8BV33"
                     /translation="MADISTSFKDAVLKDIGMDNISDTDKVPDDLFNSYINLKLEKTK
                     KEVEEIRMNNINSLSKIINKCNKNNGISESLIKQILGITENIGEIQHGLGNNEMAFSA
                     SKKRRMEYTKPNTDGSSIIQPGHRRYQSEINIVPEYSFRGPLAKNNPNNLNQLAQNTN
                     QFSKPTQLAPLSFNQTPSHSSLTSGTNENLNPHPSYNINTQADNSTMFVYQEQQRGLQ
                     PSTQIPPARDQAQLKYGHRRTHSAQVFPQSYVSKPSSPTRNDTGSSLKEMNFLIHTPK
                     HPPPQ"
     gene            complement(<300284..>301297)
                     /gene="TPHA0F01310"
                     /locus_tag="TPHA_0F01310"
                     /db_xref="GeneID:11531541"
     mRNA            complement(<300284..>301297)
                     /gene="TPHA0F01310"
                     /locus_tag="TPHA_0F01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686002.1"
                     /db_xref="GeneID:11531541"
     CDS             complement(300284..301297)
                     /gene="TPHA0F01310"
                     /locus_tag="TPHA_0F01310"
                     /inference="similar to DNA sequence:INSDC:YIL123W,YNL066W"
                     /note="similar to Saccharomyces cerevisiae SIM1 (YIL123W)
                     and SUN4 (YNL066W); ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686050.1"
                     /db_xref="GeneID:11531541"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:G8BV34"
                     /translation="MTDTVIPSIESSSLNLLCQTTPSSPLLSSSSSSSIATTTSSSSR
                     SSCSLLSIAEKATSTPTSSGIYDDLENMIDPTVKFEDGTIACTDFPVGQGVIALDWLS
                     FGGWSGIQNPSDDSTGGTCRDGTYCSYACQAGMSKTQWPSTQPSDGESLGGLYCKSGY
                     LYRTNTDTDYLCEWGVDAAYVVSELDSSVAICRTDYPGTENMVIPTYVTAGSTLPLTV
                     VDEETYYIWQGSMTSAQYYVNNAGVSYEDGCAWGTDGNGVGNWAPLNFGAGYTNGVSY
                     LSLIPNPNNSGDINFNVKIVAADDSSTISGTYYCENGVFSGDNTDGCTVGVTSGKAHF
                     VLY"
     gene            complement(<302353..>303228)
                     /gene="TPHA0F01320"
                     /locus_tag="TPHA_0F01320"
                     /db_xref="GeneID:11535562"
     mRNA            complement(<302353..>303228)
                     /gene="TPHA0F01320"
                     /locus_tag="TPHA_0F01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686003.1"
                     /db_xref="GeneID:11535562"
     CDS             complement(302353..303228)
                     /gene="TPHA0F01320"
                     /locus_tag="TPHA_0F01320"
                     /inference="similar to DNA sequence:INSDC:YIL124W"
                     /note="similar to Saccharomyces cerevisiae AYR1 (YIL124W);
                     ancestral locus Anc_2.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686051.1"
                     /db_xref="GeneID:11535562"
                     /db_xref="GOA:G8BV35"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:G8BV35"
                     /translation="MPKSRTQVALVTGASSGIGFNVSKQLAAKGYKVYACARRTEPIE
                     PLSKEFPGLIIPTKLDISKELEILELKKRLSEDLPEGKLDILYNNAGQSCTYPALDVS
                     NIAMEQCFQVNVFGHINLCRELSQFLINSQGTIVFTGSLAGIISFPFGSIYSATKAAI
                     HAYARGLHLELKPFNVRVINVVTGGVDTNIADTRPLPESSIYNFPAGLEAFQGRQKMA
                     KNNHPISAEIYAKQVLDVVFSKKDPVDLYRGTMSTFLRYVAQFVPYSILEYGLVAKFK
                     LGKVFEVLKTKTKQE"
     gene            complement(<303698..>306775)
                     /gene="TPHA0F01330"
                     /locus_tag="TPHA_0F01330"
                     /db_xref="GeneID:11535430"
     mRNA            complement(<303698..>306775)
                     /gene="TPHA0F01330"
                     /locus_tag="TPHA_0F01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686004.1"
                     /db_xref="GeneID:11535430"
     CDS             complement(303698..306775)
                     /gene="TPHA0F01330"
                     /locus_tag="TPHA_0F01330"
                     /inference="similar to DNA sequence:INSDC:YIL125W"
                     /note="similar to Saccharomyces cerevisiae KGD1 (YIL125W);
                     ancestral locus Anc_2.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686052.1"
                     /db_xref="GeneID:11535430"
                     /db_xref="GOA:G8BV36"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8BV36"
                     /translation="MLKAISSVSSRNMTKRLLLRANNLTTNERSILIKSSYSNVSKRF
                     LSSSSSGEDEFMSTSNANYIDEMYEAWQQDPTSVHASWNAYFKNMKNLNIPASAAFRV
                     PPTLVGTPTGVEQVPITSGLSSNVDENVLTHLKVQLLCRAYQVRGHLKAHIDPLKISF
                     GDDKSKPIPKELTIQYYGFTENDLNKEINLGPGILPRFAKDGKTKMTLKEIIDHMETL
                     YCSSYGIQYTHIPSKEKCDWLRERIEIPSPYNYSINEKRQILDRLSWATGFEAFLSNK
                     FPNDKRFGLEGLEAVVPGIKTLIDRAVDMGVEDVVLGMAHRGRLNVLSNVVRKPNDSI
                     FSEFKGTASADDLEGSGDVKYHLGMNYERPTTSGKHVSLSLVANPSHLEAQDPVVLGR
                     TRALLDAKGDLENKTKAIGVLLHGDAAFAGQGVVYETMGFEQLPEYSTGGTIHVITNN
                     QIGFTTDPRFARSTPYPSDLAKAFDAPIFHVNANDVEAVTFIFNLAAEWRNTFHSDAI
                     IDVVGWRKHGHNETDQPSFTQPLMYKKIANQKSVIDVYTEQLVKEGSFSQKDIDECRE
                     NIWQSFERAFEKAKDYTPTQREWLTASWENFKSPKELATEILPHNPTNVPAETLKKIG
                     KCISSWPEDFEVHRNLKRILNNRGKSLETGTGIDWSTGEALAFGSLLLEGYQVRVSGE
                     DVERGTFSQRHSVLHDQKSDATYTYLKHLDPNQGKFTVSNSSLSEYGVMGFEYGYSLT
                     SPDYLVMWEAQFGDFANTAQVIVDQFISSGEQKWKQRSGLILSLPHGYDGQGPEHSSG
                     RLERFLQMANEDPRYFPSPEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPL
                     ALFFSKQLLRHPLARSELSEFTEGGFQWLIEDVEHGKTIGTKEDTKRLVLLTGQVYTA
                     LHKKREELGDKTTAFLKIEELHPFPYAALRDTLNSYPNLEDIVWCQEEPLNMGAWNYV
                     SPRLQTTMKETDNYKDVTVRYAGRNPSGAVAAGSKILHTAEEKAFLRDAFNES"
     gene            complement(<308359..>312621)
                     /gene="TPHA0F01340"
                     /locus_tag="TPHA_0F01340"
                     /db_xref="GeneID:11535431"
     mRNA            complement(<308359..>312621)
                     /gene="TPHA0F01340"
                     /locus_tag="TPHA_0F01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686005.1"
                     /db_xref="GeneID:11535431"
     CDS             complement(308359..312621)
                     /gene="TPHA0F01340"
                     /locus_tag="TPHA_0F01340"
                     /inference="similar to DNA sequence:INSDC:YIL126W"
                     /note="similar to Saccharomyces cerevisiae STH1 (YIL126W);
                     ancestral locus Anc_2.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686053.1"
                     /db_xref="GeneID:11535431"
                     /db_xref="GOA:G8BV37"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:G8BV37"
                     /translation="MIENVGSVATDVIAIPGEVSNTEIKTETEEISNITIPYPDSRDQ
                     LDQLLYRYKALLDYPSDNKVEINAIENVFYKVSKDQDAYNENLDELRKYTFSGIEYDD
                     EVLKKQLYILKLIEKDVDVPDNLLEGSFSDIFEDSGILNANVTVEAEQTSNNADVFRP
                     IQINTNYNVNAELFDLKNNFVNISETKLGTTKSEPIISAAIARRISELERLPANLGTY
                     SLDDALGFFTKSDIPTNIDTLKIKALIELKCLKLLTKQKSLRQKLLNNVSNQAHHSIT
                     ELRDSPFTMAAQRAVQVRSKVIVPQTVRLAEELERQQLVEKRKKERNLHIQKVNSIIR
                     ASEKYNDEYSGASERSLQLGRSLQYLHTQIEKDEQKRLERTAKQRLAALKSNDEEAYL
                     KLLDQTKDTRITQLLRQTNSFLDSLAQAVQVQQNEAKLLKNEESVPITTDDREKIDYY
                     EVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNNLNGILADEMGLGKTIQSI
                     SLITYLFEVKNETGPFLVIVPLSTITNWTLEFEKWAPSLKTIIYKGTPNQRRTLQGQI
                     RMNDFDVVLTTYEYIIKDRNLLAKKDWAHMIIDEGHRMKNAQSKLSYTIQHYYRTRNR
                     LILTGTPLQNNLPELWALLNFVLPKIFNSAKTFDDWFNTPFANTGGQEKLELTEEEML
                     LIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYEQMLKHNALFIG
                     AGAEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVINPSRGNTDLLYRVSGKFELL
                     DRVLSKFHATGHRVLIFFQMTQVMDIMEDFLRMRNLKYMRLDGTTKADERTDMLKAFN
                     APDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRI
                     LRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLLEDESNKDN
                     EDDAELDADELNQILARSEEEKALFDQMDKDRIQRAKDDAKLQGLKTVPPRLIQVDEL
                     PSVFTEDIAIHLKPEPVAVGRIREQKRVYYDDGLTEDQFLQAVENEEATLDEIIEKKR
                     SQRERRKRRRNDTDGNGDELSGDEIKTLENTPEKEIEETTVQTDSINTSTEVPDVTDE
                     TFRSTRGGASGRRATRGRGRGRGRGRGRGRSKVVEVHTDMEIPDNTVDTKSEAETEAV
                     ALPDSAVADAHLDEVISPAADAKSQVTIDPMSYDAGNPSLKVKISLSKGLPSDETSKK
                     QPKKKKLKIVIRSKNGSTAVNTPTSTKDESESTKKTVKNEDKLTDDIKKDGKKLIEEI
                     RKQLDKEDSHPLAEIFEKLPSKKLYPDYYKLIENPIAIENISKKLNDKKKSHYNQLQE
                     LIDDFHLMFKNAMFFNEQDSWVYNDASELNTFVDTWFKEQSK"
     gene            <313270..>313902
                     /gene="TPHA0F01350"
                     /locus_tag="TPHA_0F01350"
                     /db_xref="GeneID:11535481"
     mRNA            <313270..>313902
                     /gene="TPHA0F01350"
                     /locus_tag="TPHA_0F01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686006.1"
                     /db_xref="GeneID:11535481"
     CDS             313270..313902
                     /gene="TPHA0F01350"
                     /locus_tag="TPHA_0F01350"
                     /inference="similar to DNA sequence:INSDC:YIL127C"
                     /note="similar to Saccharomyces cerevisiae YIL127C;
                     ancestral locus Anc_2.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686054.1"
                     /db_xref="GeneID:11535481"
                     /db_xref="UniProtKB/TrEMBL:G8BV38"
                     /translation="MTSFVNSTEQATKSVNDLLSSLLPGATKLKINSNNIRSESTKGS
                     KAKLIDRNLKKNIEIKERDVYKIKKKKKLIEQKEFKINKVKELKLEQNAKLSILKKHK
                     SEGTLTKKEKKYLRAVSDQNINKAKSWDFDEDEKEELQNVQNEIMNFMKSNNNYDKHK
                     RRRSKKKQFKEEISAKKQLNVDHRYPGLTPGLAPVGLSDEEDSSEEEKGF"
     gene            complement(<314026..>317094)
                     /gene="TPHA0F01360"
                     /locus_tag="TPHA_0F01360"
                     /db_xref="GeneID:11535507"
     mRNA            complement(<314026..>317094)
                     /gene="TPHA0F01360"
                     /locus_tag="TPHA_0F01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686007.1"
                     /db_xref="GeneID:11535507"
     CDS             complement(314026..317094)
                     /gene="TPHA0F01360"
                     /locus_tag="TPHA_0F01360"
                     /inference="similar to DNA sequence:INSDC:YIL128W"
                     /note="similar to Saccharomyces cerevisiae MET18
                     (YIL128W); ancestral locus Anc_2.233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686055.1"
                     /db_xref="GeneID:11535507"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:G8BV39"
                     /translation="MILKSLVDSYLANIDINKEKTDELGSSIANAINSGDFKILDVII
                     NLKNEFISEDEKKRQQSLHCLSNILNNLSSATLKKNELNVIFNFYQSKIDELNNMTEI
                     LSGFNSLTTMDSVSMLEISTLLNIISNEYEPSKFLTPTRYQTFLILSNIIEKYKIEMK
                     EDPKFLELFVSTFLHIANGEKDPRNLLLSFKINKTITTNFKNIEQFAEDLFDVLFCYF
                     PITFRPPKDDPYKITAEDLKSALQSTIASTPLFAADAFSNLTDKLKASSTVVKSDTLS
                     ALNECINNFGAKYCLTEYVPLWNAIKFELMRNSEGGDVGLATIIPGNVNINSDVSNYQ
                     LAINIVISLARVLSEFDINAFNKFFNYILGELKPNFKYNKDLKQSSTVLSALGSVNAQ
                     SFNKVITNSLPLFLQNTSETNQLKLIIMNLSFFFDSYIAVYGSAEKDMLNNTVIESSL
                     TPYKDEILMILGKALTGSSEVEVTLRTLSIVQFTKMIKMKEFLSEEEVSLIVQYLSET
                     ILEDKNKNIYYACLEGLKVISDIYEPIVYEISLKRMLSLLPNEINATINLSEGKTIEK
                     ELILKIILDYTTSRHCLVKESIYGICEKLYEIAPLENSNNYCFILITALYTLLENNIS
                     LIKDEEGKEIKNTIEDRLLSTLINNSSILNDNHNLNLLSIALFFINASSDRSGHQSAL
                     EKINDLFIEKYQIFNKHSRLVIPYTKLISGLDKDCKFNNCDKYFESCIILLQKHSDEI
                     VQFNKLGYLELLMVMSNKWLDEKYVSDSLDNLDWSNLSSINLEILTWITKALVIKNSK
                     YSAGPLEKFVNLLENDKVGDFVAKLFEVFVVDIGSYCSKKGISRSNNVKVLYKQKFFN
                     YVFPEIVSKYKLVTDLNIKSNYLTALSMILKHVPNLLLELVIQELVPMLLEALKMQNA
                     DVKISSLETLNSVCEKNSVLTTKYFHTLVPLLLKLLKKSNTNNVRVRLLTMQLLQLIA
                     LSVPINYSQSMKNNVLTELLDTLDDPKRIIRKKGIDTRQIYFEIGQTPSS"
     gene            complement(<318207..>320879)
                     /gene="TPHA0F01380"
                     /locus_tag="TPHA_0F01380"
                     /db_xref="GeneID:11535508"
     mRNA            complement(<318207..>320879)
                     /gene="TPHA0F01380"
                     /locus_tag="TPHA_0F01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686008.1"
                     /db_xref="GeneID:11535508"
     CDS             complement(318207..320879)
                     /gene="TPHA0F01380"
                     /locus_tag="TPHA_0F01380"
                     /inference="similar to DNA sequence:INSDC:YIL130W"
                     /note="similar to Saccharomyces cerevisiae ASG1 (YIL130W);
                     ancestral locus Anc_2.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686056.1"
                     /db_xref="GeneID:11535508"
                     /db_xref="GOA:G8BV40"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BV40"
                     /translation="MNQKKVSPRRLQGTSDEVKGITLDDFSNQIQLKAIPSNDGSQKF
                     ELNYMNSNKLSNVASVTQKKRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSYDQ
                     PVKKNNTNHNTSGFSKKLNQTVTSSNNSSKKVNSREGLGKSTLTFAKTNLNSSTSSNK
                     RKSNLLKNLDAKELKQAIDKYKFLLSDLFEQLPDPDSVDIETFAALYNKNKNDGLRLQ
                     FTSILNETLSQYGQLPEVNSSNKISSHVPPSITHYDVVENIDDSAHSQIGREIKIILP
                     PKNVVLHFISYTWENCCVLFRFYHRPSFLKKLDALYETDPDDYTEEQIKFLPLCYATI
                     AVGILFYEDKKDRNSTSKFSKDLNVGATYLDESLKSKFNEYKLIDGMGSVDVQMRSSL
                     IQDEGYKFFIASRKLIDMTNVRGRHSIQTIIILLFFCQCSARLTTCYSYIGAALRAAL
                     KEGYHRRVDPNNTTLNPIEIEMRKRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPI
                     EISDECITENGYLSEQEGQQLSSISIANYHTKLYLILADIVQRLYSIKKKNRSITENT
                     VISLENKLRKWADSLPHELKPGAVDVPQKYERANKLLHLSYLQVQLILYRPFIHYLSR
                     NLRVPSNIGPYEIARKSIAVSRNVMQLVQLLMSNNLLPDAYWYGVYTVFFSIAGLLYY
                     VQQVHPTSKEEAQEYYAIVNEIEIGRSVLLELKDSSAAANRTYCLLNRLFEKLNLKTL
                     SLAKDHSDDHNLDTNMKEKDEVSGRFGANPDINITYSNKLPSSHRIFDSDSAKKSTKQ
                     ESLENLNINEFSLPTDMESKPDNRMHGNVFNSEEMNNYHRKTDVNFDNFLQNILTQMP
                     FSNNSNDISTDFNDPINECNPIELDSFIKDMFQI"
     gene            <322309..>324303
                     /gene="TPHA0F01390"
                     /locus_tag="TPHA_0F01390"
                     /db_xref="GeneID:11535665"
     mRNA            <322309..>324303
                     /gene="TPHA0F01390"
                     /locus_tag="TPHA_0F01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686009.1"
                     /db_xref="GeneID:11535665"
     CDS             322309..324303
                     /gene="TPHA0F01390"
                     /locus_tag="TPHA_0F01390"
                     /inference="similar to DNA sequence:INSDC:YIL131C,YNL068C"
                     /note="similar to Saccharomyces cerevisiae FKH1 (YIL131C)
                     and FKH2 (YNL068C); ancestral locus Anc_2.230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686057.1"
                     /db_xref="GeneID:11535665"
                     /db_xref="GOA:G8BV41"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:G8BV41"
                     /translation="MVPMDFTSNTIGLKSHYNQQQQQHLINTIISTLSAPEKYTNVSR
                     DHSNDSNSAVEVQAYAKLSGNKWTYYIKDLEISIGRDTADENKNITSKVHVDLGPAKV
                     VSRHHAQIKFNMQNGGWELHLYGRNGAKVNFKRVSPKHSPIAISSGSIIDIGGTQMMF
                     ILPDQEPLVIQTYLHYLIPKLSSHYDVSGKEDSKLLNDLIKNSDYYKNNINNIQEYIK
                     KIIPNSHALTNSHGNIRSDNSQGLDSNQENNAKSLDFSSSLALDENKHIKPPHSYATM
                     ITQAILSTEEGIISLSDIYRFISSNYSYYRFAKTGWQNSIRHNLSLNKAFDKVPRKPN
                     EPGKGMKWRISEDYRNEFLNKWNTGKISKIRRGSSVARQLQLHMSKYSTLPAQKGSSP
                     QINESTSLQPASRTLLPMTNSNNQPNGLSLGQRTNLLTPEYLKNTPMPMKQQQHPITK
                     GGTHNPTNSALVSFTASSNLVPPANHASNHSSINIPTTNLMDFNSAYLRPNALPSIST
                     KPLPSTIATLLPTNANAFQSQNIYSKKAGSISPTNNPLMNSPSKSFHITAIEAYTPER
                     GSTVTTSKSPARNNNHLETVNVLDDRKLYIGSDKNLLVPPANFNSQSIDKNPNENDAS
                     KSWGLNQYNPIHNRITPNGITAQSNNSTVPAIDINSLTNN"
     gene            <325520..>326632
                     /gene="TPHA0F01400"
                     /locus_tag="TPHA_0F01400"
                     /db_xref="GeneID:11535577"
     mRNA            join(<325520..325553,326064..>326632)
                     /gene="TPHA0F01400"
                     /locus_tag="TPHA_0F01400"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_003686010.1"
                     /db_xref="GeneID:11535577"
     CDS             join(325520..325553,326064..326632)
                     /gene="TPHA0F01400"
                     /locus_tag="TPHA_0F01400"
                     /inference="similar to DNA sequence:INSDC:YIL133C,YNL069C"
                     /note="similar to Saccharomyces cerevisiae RPL16A
                     (YIL133C) and RPL16B (YNL069C); ancestral locus Anc_2.228"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_003686058.1"
                     /db_xref="GeneID:11535577"
                     /db_xref="GOA:G8BV42"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:G8BV42"
                     /translation="MSTFEPVVVIDGKGHLVGRLASTVAKQLLNGQKIVVVRAEALNI
                     SGEFFRNKLKYHDYLRKATAFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAAMER
                     LKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLSKLSSAVGWKYEDVVAKLEEK
                     RKVRSAEFYAKKKAFNKKVAAATAASAESEAAKQLATFGY"
     gene            complement(<327058..>328095)
                     /gene="TPHA0F01410"
                     /locus_tag="TPHA_0F01410"
                     /db_xref="GeneID:11531542"
     mRNA            complement(<327058..>328095)
                     /gene="TPHA0F01410"
                     /locus_tag="TPHA_0F01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686011.1"
                     /db_xref="GeneID:11531542"
     CDS             complement(327058..328095)
                     /gene="TPHA0F01410"
                     /locus_tag="TPHA_0F01410"
                     /inference="similar to DNA sequence:INSDC:YIL134W"
                     /note="similar to Saccharomyces cerevisiae FLX1 (YIL134W);
                     ancestral locus Anc_2.227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686059.1"
                     /db_xref="GeneID:11531542"
                     /db_xref="GOA:G8BV43"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BV43"
                     /translation="MGYDLSPLQKEFISGITTGCITTIVVHPLDLIKVRLQLSATGQG
                     IIPNINNIKRNRYRLVLENIIKHEKKPFGKLLTVKEIYRGLGINILGNTIAWGLYFGL
                     YRQSKDILYNVYHKNNIQDAGFYRGKEENSTVENIIHDQKMSPIMYLSAGAISGLITS
                     VVTNPIWVLKTRIMSTSKYAEGSYVSIIHGFKTLLEKEGLKSFWRGTLPAVLGVSQGA
                     IYFMVYDTLKYKYSSLPHNRFVQSGKLNSKESNSKSEYKLKNLEIIGITSLSKMLSVS
                     SVYPFQLLKSNLQSFKAVNHNYTLINLAKNIFKEKGLLGLYTGLSANLLRAIPSTCIT
                     FCIYENFRNWI"
     gene            complement(<328481..>329896)
                     /gene="TPHA0F01420"
                     /locus_tag="TPHA_0F01420"
                     /db_xref="GeneID:11531543"
     mRNA            complement(<328481..>329896)
                     /gene="TPHA0F01420"
                     /locus_tag="TPHA_0F01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686012.1"
                     /db_xref="GeneID:11531543"
     CDS             complement(328481..329896)
                     /gene="TPHA0F01420"
                     /locus_tag="TPHA_0F01420"
                     /inference="similar to DNA sequence:INSDC:YNL071W"
                     /note="similar to Saccharomyces cerevisiae LAT1 (YNL071W);
                     ancestral locus Anc_2.225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686060.1"
                     /db_xref="GeneID:11531543"
                     /db_xref="GOA:G8BV44"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:G8BV44"
                     /translation="MLRAVTRSTVVRNSLVRLYASKSYPSYTVINMPALSPTMTSGNL
                     ASWSKNVGDQLAVGEVLAEVETDKATMDFEFQDDGYLAQILVPNGSKDIPVNKPIGIF
                     VEEKKDVDAFKDFTIADIADAGSATATPAEKKSPESSADAAPAEKPSPAAQKTAGTDV
                     TRIFASPLAKNIALAHGVALKDITGTGPRGRIVRADVEKFMSEQKSAASPAAAASTPA
                     PAQKAAQAPSAQVSDLYKDIEITTMRNIIGKRLLESTQSIPSYIVSSDIAVSKLLKLR
                     QSLNNDNTIDKTKNNYKLSINDILIKAISLAAKRIPDVNAYWLPQENVIRQFKNVDVS
                     VAVATETGLITPIVKSANAKGLVSISTEVKDLVKRAKINKLLPAEFQGGTICISNLGM
                     NDAVSMFTSIINPPQSTILAIGTKKRQAIEDVGSPNGISFQDVITITGTFDHRVVDGS
                     KAGEFMRELKKIIENPLQLLL"
     gene            <331070..>332500
                     /gene="TPHA0F01430"
                     /locus_tag="TPHA_0F01430"
                     /db_xref="GeneID:11535424"
     mRNA            <331070..>332500
                     /gene="TPHA0F01430"
                     /locus_tag="TPHA_0F01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686013.1"
                     /db_xref="GeneID:11535424"
     CDS             331070..332500
                     /gene="TPHA0F01430"
                     /locus_tag="TPHA_0F01430"
                     /inference="similar to DNA sequence:INSDC:YIL135C,YNL074C"
                     /note="similar to Saccharomyces cerevisiae VHS2 (YIL135C)
                     and MLF3 (YNL074C); ancestral locus Anc_2.222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686061.1"
                     /db_xref="GeneID:11535424"
                     /db_xref="UniProtKB/TrEMBL:G8BV45"
                     /translation="MDTINNPNDHDLEEDRDLIFERDVEDPGMASTLTLTRASTLDNM
                     YAPVPEQALRFTSPSSPLSLSRRQSSNSLYSQNGLRQCVTHTGAPRLNENPLTEPQNT
                     IHHTLENMIPPALDASCSIVTDDNTDLNQVDMIYSPRPSTLGLSSALGNYNSTSTSSS
                     PVLFRSYSHTTSFPTAGTKNSSLSTSKSPPLALTRSYSNNYQLPASTENNISSNNNNR
                     VLRFYSYFDMLSDELNSHPISRAPSALQQPDATITAFNNPFDPMQARTGTSLEKNKNK
                     ASEKKSPKQSVAGFHISLGESDAYTTDEEESEEPTDTDANANAQNRNVVTFLQHPRPS
                     VAVKNSLGSHLSRSRSNSSNYAFTANRNPLMINSNTSPTGSVSQSKNNSSLLTQPHSP
                     PMRGRAYSHTTGIPSSNASVPAKSLSLRKTNTFSTSNQLRRSRTPGHYMSINDDAFAP
                     LQTECIGSVLRKKISRTADSLDSLTS"
     gene            complement(<332671..>333543)
                     /gene="TPHA0F01440"
                     /locus_tag="TPHA_0F01440"
                     /db_xref="GeneID:11535531"
     mRNA            complement(<332671..>333543)
                     /gene="TPHA0F01440"
                     /locus_tag="TPHA_0F01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686014.1"
                     /db_xref="GeneID:11535531"
     CDS             complement(332671..333543)
                     /gene="TPHA0F01440"
                     /locus_tag="TPHA_0F01440"
                     /inference="similar to DNA sequence:INSDC:YNL075W"
                     /note="similar to Saccharomyces cerevisiae IMP4 (YNL075W);
                     ancestral locus Anc_2.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686062.1"
                     /db_xref="GeneID:11535531"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:G8BV46"
                     /translation="MLRRQARERREYLYRKAQELQDSQLQQKRQIIRQSLAQGKPLPK
                     EIAEDEKLQEDYRYDQTIKGELEGDLDDIDDEYSETSGIVEPRLIVTTSRDPSTRLSQ
                     FAKEIKLLFPNAVRLNRGNYIMPNLVGACIKSGTSDLVVLHEHRGVPTSLTISHFPHG
                     PTAFFTLHNVVLRHDILNHGNQSEVNPHLIFDNFTTPLGERVVKVLKHLFSPSPKKDS
                     PRVITFANRGDFISVRQHVYVKTREGVEMAEVGPRFEMKLFELRLGTLDNKDADVEWK
                     LRRFIRTAGRKDYL"
     gene            complement(<333965..>335887)
                     /gene="TPHA0F01450"
                     /locus_tag="TPHA_0F01450"
                     /db_xref="GeneID:11535527"
     mRNA            complement(<333965..>335887)
                     /gene="TPHA0F01450"
                     /locus_tag="TPHA_0F01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686015.1"
                     /db_xref="GeneID:11535527"
     CDS             complement(333965..335887)
                     /gene="TPHA0F01450"
                     /locus_tag="TPHA_0F01450"
                     /inference="similar to DNA sequence:INSDC:YNL076W"
                     /note="similar to Saccharomyces cerevisiae MKS1 (YNL076W);
                     ancestral locus Anc_2.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686063.1"
                     /db_xref="GeneID:11535527"
                     /db_xref="UniProtKB/TrEMBL:G8BV47"
                     /translation="MVISQTINSPDNMNSCSALPSSGTNTEITQNMIQSMNKINLNKY
                     IDKSNNEKFLKISPNLFTHERLHLFDSMDLYLDLMKINSIFTKSNTNYTSIMEQGDRL
                     NNISTRILNKSLLKDKQLNKSKKKEGVKNMYHILNSSLMQAVNNGTSNNITQKQTLNT
                     HDTSASNITTIANSKIVRQPVVVSVTSNTSNHGAIFHDTNTENKNSDNIQNKSRDYES
                     QINLQRIHSRPRTRQEDPDVVVKGFDTTTVIVRKSPSTIDNNNIITPVSKQSSSNVDQ
                     HLHKQNSLFSNLNTYHNTTTNDNINKQINIKDDNRGNTSVGTSSALGFQAQNKNSKLF
                     FSSADEDSDCDAFSDTEDDDDDEDDDDFDSLYEEEIEDKYMKKKWDNMIFSKKNTGDL
                     SNNSSASTNKSSTDPIKKSLLSGLFLNNMNKETKDQFKGEINKEDSELIKTSSTSPGM
                     GHRSKLTMEKIKSKEISGKFTDLLGSDLSKISNNSTNYINDINKSGSNSAIDTPTIKT
                     FNVNALGAMSPPRDAISSFDPQAFRSSTRTRSSFSSIVSEFTSERYIHQSNAPPSAHT
                     ILPTALSTHMFLPNNIHQQRLAASSMNKSRSFFEQGSRRESIDIPSKSRNSVSIKTRV
                     EIKEEEPFARDLNRRK"
     gene            complement(<336966..>338300)
                     /gene="TPHA0F01460"
                     /locus_tag="TPHA_0F01460"
                     /db_xref="GeneID:11535528"
     mRNA            complement(<336966..>338300)
                     /gene="TPHA0F01460"
                     /locus_tag="TPHA_0F01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686016.1"
                     /db_xref="GeneID:11535528"
     CDS             complement(336966..338300)
                     /gene="TPHA0F01460"
                     /locus_tag="TPHA_0F01460"
                     /inference="similar to DNA sequence:INSDC:YIL136W"
                     /note="similar to Saccharomyces cerevisiae OM45 (YIL136W);
                     ancestral locus Anc_2.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686064.1"
                     /db_xref="GeneID:11535528"
                     /db_xref="UniProtKB/TrEMBL:G8BV48"
                     /translation="MSTKLVVGGITAVTAGYLIYNINYNNNRDHRHVNTSSATYKLTN
                     ENQDDHLPLRSHYKQTSNTDNQKLRDFTTANAGAKNNSKSIFNWGFNEAERNKAIAIG
                     EYDMVNKKYNDLVKEFQENSANLDKEESEVKKLILKDYEEELKLKKQILEEATEIYNK
                     FVKNENFNELADKIYKENLDVMNGEKSIFQWLRSTGIDDEGDNNAHLIPLNGDGTKID
                     KIASESVMGWGESAQEFAKEAIEEQLRNKEIGPSEAQKRLDELKEIKKRGWLNYGGKT
                     PEVENDIASKVAEGVRGWGESASQFANDELEDVNIQYDKNVTFESAKSEVEKKLKKLE
                     DCRQLYQQALDSKNGDFIWNKLFVKPKKDQDLSPSNNNDSNNTDSTNKRISKDIETHE
                     LKKQLDVAQSEYDHAIDILSKFLEDNALPSNRKNLKQTRTQLMGKLWDQMNE"
     gene            complement(<339280..>340428)
                     /gene="TPHA0F01470"
                     /locus_tag="TPHA_0F01470"
                     /db_xref="GeneID:11535583"
     mRNA            complement(<339280..>340428)
                     /gene="TPHA0F01470"
                     /locus_tag="TPHA_0F01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686017.1"
                     /db_xref="GeneID:11535583"
     CDS             complement(339280..340428)
                     /gene="TPHA0F01470"
                     /locus_tag="TPHA_0F01470"
                     /inference="similar to DNA sequence:INSDC:YNL078W"
                     /note="similar to Saccharomyces cerevisiae NIS1 (YNL078W);
                     ancestral locus Anc_2.216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686065.1"
                     /db_xref="GeneID:11535583"
                     /db_xref="UniProtKB/TrEMBL:G8BV49"
                     /translation="MDTFYNNDRIEIRSRADFDIPELPLNENIVYDYSSDRVVRTSSN
                     VDYRDGSGHNIGKSITTSFQLLNEEYQDYQRTLGNSNIQILRDYENHVLIKTDAQPTG
                     TSNNSSNANENGDYLNQFSNWERYANQRRVDIPVNIQPFNSAIGRHSSTTDDKGFNLK
                     FMKRHVSLRRKDFTNDKEYNNFEKRHKKIFHRGFFGRNNSIKNQHKPVTTNDGKPRSS
                     HRRNRSKFRNKFELYSVLKFINLQTLPLDERDCDENDTTSYSNIKYFLNQKQLFKLNP
                     KLMVDLKSIANSSNANFYMNRKRSVIKRKNIIPRPTTATATVTNNNRTIKSINNIKRG
                     NSICTTTLNKYSKNSQEYQACSLWKEYLTNIMYQRIELRLKLLNMESS"
     gene            <341338..>342714
                     /gene="TPHA0F01480"
                     /locus_tag="TPHA_0F01480"
                     /db_xref="GeneID:11535447"
     mRNA            <341338..>342714
                     /gene="TPHA0F01480"
                     /locus_tag="TPHA_0F01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686018.1"
                     /db_xref="GeneID:11535447"
     CDS             341338..342714
                     /gene="TPHA0F01480"
                     /locus_tag="TPHA_0F01480"
                     /inference="similar to DNA sequence:INSDC:YNL080C"
                     /note="similar to Saccharomyces cerevisiae EOS1 (YNL080C);
                     ancestral locus Anc_2.214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686066.1"
                     /db_xref="GeneID:11535447"
                     /db_xref="GOA:G8BV50"
                     /db_xref="InterPro:IPR021100"
                     /db_xref="UniProtKB/TrEMBL:G8BV50"
                     /translation="MPTGNNSPNERAYSMVVDDNISITNHQGQEHAVSTAIQAGTTVH
                     HVHHHHHHHHHYNRDELNENVYNIQSGNEINDNNTNSIVENGNTTMAIPNLASISNAS
                     ISNNANRSDKNGIPFLKLYSSVKTLSLNHLTAKQHLLMAVCRDFSLVLPIMYLFSTMK
                     KSYEVLYAKKNIQLYDIQSITETLALLWQSYKLNKSNTSISDSTLSTAYSTTTSSLSN
                     TSSTLSDSTNSNNSNDISSLLTSLIKPDYSEYLLSAIWCVVSLYLTYSILDSLMVRWI
                     VKYSTVAAIMRMFSMSILILAIELLLLNSFSPQSEYYLHTWILISCILTAVYIWQSYL
                     TSNLNYVSNDDEEYKNDKIINDNNNNSVSDGFQSHPGDNSNSSSSDNLRTRNSGRKKK
                     MPKNYKPFKFSKRRTIDLYKITVFCVVPVGVASFVTMVGLLRNLFIQRLDVQQISMML
                     KGSYTMEL"
     gene            complement(<342923..>345628)
                     /gene="TPHA0F01490"
                     /locus_tag="TPHA_0F01490"
                     /db_xref="GeneID:11535448"
     mRNA            complement(<342923..>345628)
                     /gene="TPHA0F01490"
                     /locus_tag="TPHA_0F01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686019.1"
                     /db_xref="GeneID:11535448"
     CDS             complement(342923..345628)
                     /gene="TPHA0F01490"
                     /locus_tag="TPHA_0F01490"
                     /inference="similar to DNA sequence:INSDC:YNL082W"
                     /note="similar to Saccharomyces cerevisiae PMS1 (YNL082W);
                     ancestral locus Anc_2.212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686067.1"
                     /db_xref="GeneID:11535448"
                     /db_xref="GOA:G8BV51"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:G8BV51"
                     /translation="MSKINAIDVKDVHILTSGQVIIDISTTVKELVDNSIDANASQID
                     IIFKKYGIDSVECSDDGNGIQPDDYKSLTMKHYTSKIANFQDITNVTTLGFRGEALSS
                     LCAISQVVVTTTVNPPRADKIEYDISGNIYSQTVTSRNKGTSVQISDLFYNLPVRRKE
                     LMKTGKRQFTKCITLLQSYAIINTNIKFSVVNITPSGKRQRVFSTLSNKGMQKNILSV
                     FGSTNLHGLAEVKFTLDLNPYKSHFSKRYDEDDTFDDLNYTITVEGLLSKSSFGSGRN
                     NKDRQFVYINKRPIEYPTLVKSCNETYRQFNNVQYPAFFLNFIVSPELIDLNVTPDKR
                     TVILHNERYVIDLFKEELLKYFQNQDLQLPKKEMTVLKEVSLKNDSIDILPNAALKVT
                     DEEKKSNSSFIDTDMDDTATKNYSSEIDIPFDVNTQIQSSSLVDTDLKPKLNKVESHV
                     KVIEGESMLDGSVHNVREYEDKINSADDIDNSTFNENHSPNSNVNKQLDLHSFKNPLA
                     EEFENVSQNKHNDIDQEDVEQVIINIDGEVEEHFVKIIEDKKLLFVGDHDSYSETPYE
                     DTDKYNTNNVEVDNCDISNADSHDDLEVGLLSQETNVRVPIRDFHRDVTTEKLRSISD
                     FNGINSTKKDNGLIYSTNLFINKPNRVFDEGAQFLKYIEKMKLVHHSLSIKQSDHLND
                     LEEGDRYLTLTVKKKQFNNMNLVGQFNLGFIITTCNIDGKSNLFIVDQHASDEKYNFE
                     TLQKNTVFKSQKLISSLPVELSVVDELVVMENIEIFEKNGFKLEVDDDGNQGCKIRLT
                     SLPVSKRTLFNIEDFNELVQLVKVNDGMNKESIKCSKIRSMFAMRACRSSIMIGKPLN
                     RKVMSRVVKNLSTLDKPWNCPHGRPTMRHLMELKNWDSYMDDYTI"
     gene            <346152..>346886
                     /gene="TPHA0F01500"
                     /locus_tag="TPHA_0F01500"
                     /db_xref="GeneID:11535425"
     mRNA            <346152..>346886
                     /gene="TPHA0F01500"
                     /locus_tag="TPHA_0F01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686020.1"
                     /db_xref="GeneID:11535425"
     CDS             346152..346886
                     /gene="TPHA0F01500"
                     /locus_tag="TPHA_0F01500"
                     /inference="similar to DNA sequence:INSDC:YIL139C"
                     /note="similar to Saccharomyces cerevisiae REV7 (YIL139C);
                     ancestral locus Anc_2.211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686068.1"
                     /db_xref="GeneID:11535425"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:G8BV52"
                     /translation="MNELIEKWIKVYLKSYINLVLYHRNVYPSITFELTTYQAFTLPK
                     FIPINRHQGLQQYIEELINDVLSKLIHIFKVSIGIIDKENNVCIEKYVLDFGEFQHLD
                     DISSLTEMDVYNEFRSSLNCLITQLEDMPQVKDDTVAFQVFINTVEYNPLATIESIER
                     VSNEDIKNTFDRAANWTKCEEHEYIENLHENNGQPKVKLISLIGCDIGPFVIYNYIEQ
                     LMIKDMNHVYSTLNSNKDGTSSMGSI"
     gene            complement(<347073..>348911)
                     /gene="TPHA0F01510"
                     /locus_tag="TPHA_0F01510"
                     /db_xref="GeneID:11535484"
     mRNA            complement(<347073..>348911)
                     /gene="TPHA0F01510"
                     /locus_tag="TPHA_0F01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686021.1"
                     /db_xref="GeneID:11535484"
     CDS             complement(347073..348911)
                     /gene="TPHA0F01510"
                     /locus_tag="TPHA_0F01510"
                     /inference="similar to DNA sequence:INSDC:YNL083W"
                     /note="similar to Saccharomyces cerevisiae SAL1 (YNL083W);
                     ancestral locus Anc_2.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686069.1"
                     /db_xref="GeneID:11535484"
                     /db_xref="GOA:G8BV53"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BV53"
                     /translation="MVIRSDGGKDENGNDNQNNVHRNTHATDKGNSKLKKLPILKYLF
                     EDELSRDRRYETIFNRLDINKDGKITQLGLNEAFVKNDMPLKNNNEALVNLFHAMDAN
                     DDKIIDLEDFKIYAKTAEKQIRSGFEKIDTDGDGLVKPEEISNYLIRLSKDAHQDPIK
                     LDNGNNNSHNSKSMHSEDKVSRKHPSQSLLNPNLEQFISWAFHMKGKPDIILTKSAEH
                     MHKSDPKGSISSNGIDQNTDQEFITYDQWRDFLLMMPKSKGSRLQTAYFYLFKEDVDL
                     SSEGDMTLINDFLKGFGFFIAGGISGVISRTCTAPFDRLKVFLIARTDLTSTLLHSKK
                     SIAAQKPNIKIDKIRSPIIKAITTLYNQGGLRAFYVGNGLNVMKVFPESSIKFGSFEM
                     TKSLMASIEGIDNKNELSKVSTYIAGGLAGVVAQFSIYPIDTLKFRVQCASLGGNALK
                     GNRLLFETAKQLYREGGIKLFYRGILVGLMGVFPYAALDLGTFSALKKWYINKQSIKL
                     GIPKDDVELSNLVVLPMGALSGTVGASIVYPINLLRTRLQAQGTYAHPYRYTGIKDVF
                     IQTVKRESYSGLYKGLLPTLAKVCPAVSISYLCYENLKKVMKLENH"
     gene            <349498..>351081
                     /gene="TPHA0F01520"
                     /locus_tag="TPHA_0F01520"
                     /db_xref="GeneID:11535491"
     mRNA            <349498..>351081
                     /gene="TPHA0F01520"
                     /locus_tag="TPHA_0F01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686022.1"
                     /db_xref="GeneID:11535491"
     CDS             349498..351081
                     /gene="TPHA0F01520"
                     /locus_tag="TPHA_0F01520"
                     /note="ancestral locus Anc_2.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686070.1"
                     /db_xref="GeneID:11535491"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:G8BV54"
                     /translation="MISYSSKCFTQSKIRFTPITQVALRVEREFSSNSTICSLAGKDN
                     KANKDLTSRPDATATQSTDYYEYQKLTVDSVNNYKATWLNALNERKKQLANGKIIDSF
                     VYNHIKSTDIVDKTQKESFAYIYLPFKENPLIADFYVNAAGRIRMGQLFQDLDSLAGK
                     IAYKHTSPVEPMIVTASIDRIYLLKQIDLISNFNVILSGNVIYTGRSSMEIAITARAM
                     EHELNENTLQDDSNLSDDDIFLTASFTFVARNPETHKSLAINRLLPLNEKQWMDFKRA
                     ESRITAKKMKNINENLAKIPPTHEESKMIHKLWGASKKLMNSTSGKLENAMLMNDTTL
                     KSTMFMQPQYRNRHSYMIFGGYLMRQTFELAYCAAAAFSHALPRFVSLDSTTFKTPVP
                     VGSILHMNATVVYTEHLHSKNSTPNRDIDISISDFQPTPANELSVHKGDFLSKPGTLV
                     QVKVDTWVQQLASDKQDKSGSFIYSFFVSSDTFDDKGNTVGYPTVIPKSYSEMIEYIE
                     ARRRAFETAQYAKTLKGNY"
     gene            complement(<351338..>353809)
                     /gene="TPHA0F01530"
                     /locus_tag="TPHA_0F01530"
                     /db_xref="GeneID:11535492"
     mRNA            complement(<351338..>353809)
                     /gene="TPHA0F01530"
                     /locus_tag="TPHA_0F01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686023.1"
                     /db_xref="GeneID:11535492"
     CDS             complement(351338..353809)
                     /gene="TPHA0F01530"
                     /locus_tag="TPHA_0F01530"
                     /inference="similar to DNA sequence:INSDC:YIL140W"
                     /note="similar to Saccharomyces cerevisiae AXL2 (YIL140W);
                     ancestral locus Anc_2.208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686071.1"
                     /db_xref="GeneID:11535492"
                     /db_xref="GOA:G8BV55"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="UniProtKB/TrEMBL:G8BV55"
                     /translation="MIRTLSTVLAYLLFLIANVNSYPYEAYPINKQIPPVARVNEDFQ
                     FMISNDTYKSSLNDYQQITYKAFNLPTWLSFDESTRTLTGSPSSDIFTDLTAELLYFN
                     FILEGTDSSDNKKLNNTYQLVITNYTSVEVAESFNLLALLKNYGDTDGKNGLILSPND
                     VFNITFERSDFDSSSGYSVSTYYGRSEKYHAPLPNWIFFDSNNLKFSGTAPVANSQIA
                     PQVSYDFSFIASDIEGYAGSEIPFSIVVGAHSLTTTVQNTILINVTDDGAFNYELPLD
                     YTFLDQQLVSTENISSVQLIDAPDWVSLNNYTIEGTVNSDSANYGNNTFSVSLYDIYG
                     DAIYFNFEILSTTSLFAITSFPSVNATRGSYFQYAFLPSQFTDYDNTEVTIKPSNSSQ
                     DYSWLSFSSSNLTILGNVPELFESLDLSVIATKGEETESLIFSIMGVGNSSTTFNSTN
                     STSMSSRSSSSTRTSLSSSTTSTSSSSSTSASSSQSQSTTASSTASTVAVSKTSSNKK
                     TVAIACGVVIPICFIILLVLVFLFWRRKTNKAAADEEEHPTTDGPAIKPYSPNNGESS
                     PSDPFVDDNNQRSITGLVYNSSSSDSSSFSDKDTRSSSESSNDIYVDANHNPSREMLL
                     GSMDNYSSENLNDNNRTSSLYLNDEPALRKSWRYTQNTLSNITEGKGRESILSLNTIS
                     TDEFINTKISNEGQVNKDPRKSTLGLRDSVFGSKSSVYFNRNSASNQESSEIALPTLQ
                     ENRKSLNPFINQTESDSKLSPSLVSSSSDEIIPIRQGNSYGWVNKNDSLNSKLGKKKV
                     VTINDDSNIDIGEGLEYEGHLAEQV"
     gene            complement(<354829..>356412)
                     /gene="TPHA0F01540"
                     /locus_tag="TPHA_0F01540"
                     /db_xref="GeneID:11535452"
     mRNA            complement(<354829..>356412)
                     /gene="TPHA0F01540"
                     /locus_tag="TPHA_0F01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686024.1"
                     /db_xref="GeneID:11535452"
     CDS             complement(354829..356412)
                     /gene="TPHA0F01540"
                     /locus_tag="TPHA_0F01540"
                     /inference="similar to DNA sequence:INSDC:YIL142W"
                     /note="similar to Saccharomyces cerevisiae CCT2 (YIL142W);
                     ancestral locus Anc_2.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686072.1"
                     /db_xref="GeneID:11535452"
                     /db_xref="GOA:G8BV56"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8BV56"
                     /translation="MSVQIFGDQVTEERAENARMSAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASSDASLVTNDGATILKSIPLDNPAAKVLVNISKVQDDEIGDGTTSVTVLSAEL
                     LREAEKLIEHSKIHPQTIIEGYRIASNAALNALEKHAVDNSGDKEKFRKDLVDIAKTT
                     LSSKILSQDKEYFSNLATDAILRLNGSTNLEHIQIIKILGGNLSDSFLDEGFVLAKKF
                     GNSQPKRVENAKILIANTPLDTDKVKIFGTKFKVDSTSKLAQLELAEKNKMKNKIDKI
                     SKFGINTFINRQLIYDYPEQLFTDLKINSIEHADFEGVERLALVTGGEVVSTFDDPEK
                     CKLGECDLIEEIFIGEQQFLRFSGCKAGQACTIVLRGATDQVLAEAERSLHDALSVLS
                     QTTRDTKTILGGGNSEMLMSKAVDTEAQNVDGKKALAVEAFARALRQLPTILSDNAGF
                     DSSELVAKLRSSIYNGILTSGLDLDNGTIADMRELGIIESYKLKRAVVNSASEAAEVL
                     LRVDNIIRAKPRTANRQHM"
     gene            complement(<357911..>358219)
                     /gene="TPHA0F01550"
                     /locus_tag="TPHA_0F01550"
                     /db_xref="GeneID:11535422"
     mRNA            complement(<357911..>358219)
                     /gene="TPHA0F01550"
                     /locus_tag="TPHA_0F01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686025.1"
                     /db_xref="GeneID:11535422"
     CDS             complement(357911..358219)
                     /gene="TPHA0F01550"
                     /locus_tag="TPHA_0F01550"
                     /inference="similar to DNA sequence:INSDC:YNL086W"
                     /note="similar to Saccharomyces cerevisiae YNL086W;
                     ancestral locus Anc_2.203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686073.1"
                     /db_xref="GeneID:11535422"
                     /db_xref="InterPro:IPR020515"
                     /db_xref="InterPro:IPR028119"
                     /db_xref="UniProtKB/TrEMBL:G8BV57"
                     /translation="MELDKNCSVHPIELCVYSMLSSDLDGLYQTINELRNSQVLLILF
                     IKKCRDSLKRENDVLYSAKDLEESIIKLKNLTKRIESLRGKYNKLKEKTDTLTKTIAS
                     "
     gene            <358657..>359679
                     /gene="TPHA0F01560"
                     /locus_tag="TPHA_0F01560"
                     /db_xref="GeneID:11535423"
     mRNA            <358657..>359679
                     /gene="TPHA0F01560"
                     /locus_tag="TPHA_0F01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686026.1"
                     /db_xref="GeneID:11535423"
     CDS             358657..359679
                     /gene="TPHA0F01560"
                     /locus_tag="TPHA_0F01560"
                     /inference="similar to DNA sequence:INSDC:YOR091W"
                     /note="similar to Saccharomyces cerevisiae TMA46
                     (YOR091W); ancestral locus Anc_2.194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686074.1"
                     /db_xref="GeneID:11535423"
                     /db_xref="GOA:G8BV58"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G8BV58"
                     /translation="MPPKKNQKQPVAKKKDNVDKTFGMKNKNRSTKVQKYIKQVQSDP
                     LKEDLKRQKLEEKKRLEAAEAERRALFNPVLDQRVRAGVDPKTIVCALFKLGNCNKGN
                     KCKFSHDLNVGRKVEKRDLYQDARSEKEEDTMDNWDEEKLRSVITSKHGNPRTTTDKV
                     CKFFIEAVENGKYGWFWVCPNNGDKCMYRHSLPEGFVLKTKEQQRLERESLANQPKIT
                     LEEFIETEREKLDRTKLTPIVVKNFAEWKRNHMIERINSDNEKNSKKKPTGREVVLKM
                     FKDNKNFDETTIADGTQGSTWDLTEFTNALHEAEHKDDIAIKDYGDGSNPTFEIVVNN
                     SIKSTA"
     gene            complement(<359916..>361850)
                     /gene="TPHA0F01570"
                     /locus_tag="TPHA_0F01570"
                     /db_xref="GeneID:11535506"
     mRNA            complement(<359916..>361850)
                     /gene="TPHA0F01570"
                     /locus_tag="TPHA_0F01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686027.1"
                     /db_xref="GeneID:11535506"
     CDS             complement(359916..361850)
                     /gene="TPHA0F01570"
                     /locus_tag="TPHA_0F01570"
                     /inference="similar to DNA sequence:INSDC:YNL094W"
                     /note="similar to Saccharomyces cerevisiae APP1 (YNL094W);
                     ancestral locus Anc_2.193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686075.1"
                     /db_xref="GeneID:11535506"
                     /db_xref="InterPro:IPR019236"
                     /db_xref="UniProtKB/TrEMBL:G8BV59"
                     /translation="MSSYLNDKYNKNNSSLMYNDEVNTDNLSGSRKQKFFNLVKTTRD
                     TYLPTIQQKTIDGIRSTRESINNYKNSNSKDFFNNTSPPRENALQTDIPGNINIENFP
                     TYSTLIKTSADGTKEYETVVRFLITSPGDVNSMKNKLLLSLCKQYLRPSTSAGSDIND
                     DDSQYLEQKFNELEIDNGSSQQHNTTTENAFNKPLMHPTSTSISSTSSPSMTSSMKNE
                     VNTLQDRITGFLSKKLSGIPTIITLFSSDLTVGKFTSNEGNYEYYTSFATTDTYGYTA
                     LKIKSNFVPKSIKISLDTPSGYLSDEVAEIFPVSLFKCDGIGLISDIDDTIKHTGVTE
                     DKRSMFRNVFIQSEDFWVIDGMPDWYNSLYESYQTDFFYVSNSPMQLYHTLNQYISDY
                     FPVGPIFLKQYSGNIISSIMSPSSNGKLDRIINIIQDFPSKKFILVGDSGEKDFETYV
                     SAALQFPNQILGIFIRCCKNSMSDFGLKEFESKEVLNGIIKEKYESLMCENNITKLEV
                     RRRPPPPPIARNKPTLNAVQVDSIRQSRSSVIFNSQSTSNIDATTIKANSAPPPLPQR
                     PIAGKNMPFDINIDDRSIDSSNVLYDNKANQWKARVEEGIFRLKANGNHKLVMRVMFF
                     TDSKKCFETSVSLINNSLNK"
     gene            <363221..>365347
                     /gene="TPHA0F01580"
                     /locus_tag="TPHA_0F01580"
                     /db_xref="GeneID:11535514"
     mRNA            <363221..>365347
                     /gene="TPHA0F01580"
                     /locus_tag="TPHA_0F01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686028.1"
                     /db_xref="GeneID:11535514"
     CDS             363221..365347
                     /gene="TPHA0F01580"
                     /locus_tag="TPHA_0F01580"
                     /inference="similar to DNA sequence:INSDC:YNL095C,YOR092W"
                     /note="similar to Saccharomyces cerevisiae YNL095C and
                     ECM3 (YOR092W); ancestral locus Anc_2.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686076.1"
                     /db_xref="GeneID:11535514"
                     /db_xref="GOA:G8BV60"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:G8BV60"
                     /translation="MTVSLGAVIWSSVKPIIKIYLIIGVGFLCAKLEIVSAESIKSIS
                     NIVLTVLLPCLSFNKIVSSIEDKDIKDVGIICLSAALIFGTGMFFAFVCSKFLPVPKE
                     WRGGILAGGMFPNISDLPIAYLQTLDQGLIFTEEEGEKGIASVIIFLTMFLLCVFNLG
                     GFRLIEYDFTYNDEENAVHDSDRNSNSLGVPSNPKKEIDNLSASPKGLVNTKNKIKFN
                     LNLLRIRKKNQSDLSIPDIKNNNVSSAESSTISMLSTGSGSNSRFTVISPMPIPEEGP
                     TLQFNETELINKQIRRGLQNDISNNASNMSSINSYDDDLNDSTSDRELSSSKIILGTD
                     SSELDLGVENSKNERNDDKTENDSINQSDSDNTTSIASTALSPTQTWGNFSTRTSIAS
                     EEAISNALPYRISSQPIAFTSALSDEQHNIAIRRHSDATTSMNQLIRSYSNVDQYGNY
                     VERRQSIADSQADSINTMSSFQRFKSADLTRMVTTDVNVTSKDVKESGSSLPESIRKL
                     PFVPLTIFFLKNCLRPASMAVIIALICAFIPWVKALFVTTDTTPYIPNAPDLKPPLSF
                     IIDFTGYVGAASVPFGLLLLGATLGRLSVGELYPGFWKTASLLVILRQCVMPIFGVLW
                     CDRLVKAGWVNWEDDRMLLFVIAITWSLPTMTTLIYFTASYTSPDVEKPVQMECVSFF
                     LMIQYPLLVVSLPFLVTYFLKVQLKI"
     gene            complement(<365642..>370519)
                     /gene="TPHA0F01590"
                     /locus_tag="TPHA_0F01590"
                     /db_xref="GeneID:11535459"
     mRNA            complement(<365642..>370519)
                     /gene="TPHA0F01590"
                     /locus_tag="TPHA_0F01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686029.1"
                     /db_xref="GeneID:11535459"
     CDS             complement(365642..370519)
                     /gene="TPHA0F01590"
                     /locus_tag="TPHA_0F01590"
                     /inference="similar to DNA sequence:INSDC:YOR093C"
                     /note="similar to Saccharomyces cerevisiae YOR093C;
                     ancestral locus Anc_2.191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686077.1"
                     /db_xref="GeneID:11535459"
                     /db_xref="GOA:G8BV61"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010506"
                     /db_xref="UniProtKB/TrEMBL:G8BV61"
                     /translation="MDFSIPPELPLVLQNQLNELIKDYKEENLTSKGYETKRKQLLDK
                     YRNNEQKLLLSKHSNLSLNINRREPDLYGSLRISNSSTSSADASNLQDSLKYNRSSID
                     STREDYKVGSVRQNQIYRVTTTNSNSTLFSPRKHKQSSSLQLSLNSYESGLESYTPMT
                     PLLPRLESLLESTFLPLILRGRYNHYEKETAIISINEKNKESSITWGKLYLRAEKVAH
                     ELKKSQLKKMDKVLLWYNKDEVIDFTVALLGCFIADMIAVPVSFQTYSLVEIIQIIKL
                     TNSQFSLISSECHKQLDNLQTTNNNTKIKLIKSGFISQVTFLKTTDLGTYNKAKKMTP
                     TYDVSQISYIEFTRTPLGRLSGIVMKPRVINDQLTMLSKIIDSRAMPHWKKGEINRSY
                     KTRTAEKGFTILNTLDPTRSTGLICGVLFNIFSGNLLISIDNSLTTKPGSYEELIYRF
                     SADILLNEQLQLKQVVIGYLEDPKVINSRKQKINLSCIKCCLTCCTTIDTEVSDMVVH
                     KWLKNLGCYDANICYSPMLTLPDIGGIFISLKDQLGMLDNFPIHNTKLRLQDDVFINK
                     EKLKGNIVESSITAMINSSSSFTEYLRLTTFGFPIPNATVCVVNLDDCTLVPDLTVGE
                     IWISSKSLTDEFYQMDRVNEFVFHARINFQKMFSFVKGNTLEAAQSKEKINTIMSIVP
                     PSTQFLRTKLMGFVHNGKIYVLSMIEDMFLQNMLVQLPNWSHTSDITRAKKPIPSPNK
                     SVNNFVEKNDNELTLEKGPKRIVQTYYLQQITESIVRTVSTVSDVAAFELNHNSDEHF
                     LVIIVESSLSRSTLFQEDNLLVQSKEKLKKREQKMNELTEQIYRILWIFHKIQPLCVL
                     VVSPNTLPRRYCSLELANSTIESKFQSGELVANFVKFQFDNVILDFIPHSLYYNESIF
                     SEHLSNLRHLALEQERGSDGENQRMILQTSGVDYRDIVYDHRTNKNLGIFKNLLDILE
                     WRIEAFPNESAFNDGTFKGSSKENENNIHKNISWGTFHNIIASYLRKILTSKMPLNKG
                     DRVVVMCENSIEYTAIIIACFYCNLVVLPIDIINEDTAAEDISYLTNIISSFSVKRLF
                     VDGNTNFLLESNTTISRLWKKEKAVIPKVTNISKVKIKTDVSIKMFKTYAIQKRQKLN
                     SNTSTCLIWVNRDNSPIKNTHPTMTASSLLNSCKILKETLEITNDDTLFSLCNYTHGL
                     GFIIGNLLGIYAGCYTNYFTMDDIFVNPNNLLFGLQNMNVKNLFLTPSLFYAMISKAS
                     NVIDSEKTLKVNVPSKKNPATATIKPDFLRNVKNIMIPFTGRPKTTTIENILKKNGNV
                     QVSIEQISYIYQNQFNFNISMRSYMGIPPVDIYLDRSALREGLIKELNGSDRMKSGLR
                     IQDSGVVPVCTDVVIVNPETKKPCHEGEYGEIWCCSEANVSDYFISRDANDKSSKVKL
                     TRDTFVTEQFKSKMDESNDNGLTYLRTGDLGFIKPLKCLNNDGEEISFNLLYVLGSIG
                     DIIDILGLTHFVGDLESTVKETNPNIVNCIIAKCGGLLVCLVKCKETTKQIYANLTVL
                     ITSQLLSEHGVILDLCSFVGKNNIAKDIPENWSLHRTQVIEAWFAQTLNIESQFGINY
                     GENISLYLLSDLERS"
     gene            <371312..>371857
                     /gene="TPHA0F01600"
                     /locus_tag="TPHA_0F01600"
                     /db_xref="GeneID:11535460"
     mRNA            <371312..>371857
                     /gene="TPHA0F01600"
                     /locus_tag="TPHA_0F01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686030.1"
                     /db_xref="GeneID:11535460"
     CDS             371312..371857
                     /gene="TPHA0F01600"
                     /locus_tag="TPHA_0F01600"
                     /inference="similar to DNA sequence:INSDC:YOR094W"
                     /note="similar to Saccharomyces cerevisiae ARF3 (YOR094W);
                     ancestral locus Anc_2.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686078.1"
                     /db_xref="GeneID:11535460"
                     /db_xref="GOA:G8BV62"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BV62"
                     /translation="MGSSVSKALGKLFGSREMKILMLGLDNAGKTTILYKLKLNKIKT
                     SAPTVGFNVETVSFKNVKFNMWDVGGQERLRPLWRHYFPGTTSLIFVIDSQDKDRLNE
                     AKEELYSIISEKEMENVVLLVWANKQDLKGALKPQEISDFLELGDNLKNQMWCVIGSN
                     ALAGQGLVEGLSWISTNTAKK"
     gene            complement(<372278..>373054)
                     /gene="TPHA0F01610"
                     /locus_tag="TPHA_0F01610"
                     /db_xref="GeneID:11535385"
     mRNA            complement(<372278..>373054)
                     /gene="TPHA0F01610"
                     /locus_tag="TPHA_0F01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686031.1"
                     /db_xref="GeneID:11535385"
     CDS             complement(372278..373054)
                     /gene="TPHA0F01610"
                     /locus_tag="TPHA_0F01610"
                     /inference="similar to DNA sequence:INSDC:YOR095C"
                     /note="similar to Saccharomyces cerevisiae RKI1 (YOR095C);
                     ancestral locus Anc_2.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686079.1"
                     /db_xref="GeneID:11535385"
                     /db_xref="GOA:G8BV63"
                     /db_xref="InterPro:IPR004788"
                     /db_xref="UniProtKB/TrEMBL:G8BV63"
                     /translation="MSYTVPDVSSLPALSDPLETAKRLAAYRAIDENVDFKNDKVIGI
                     GSGSTVVYAAERLGQYLKDLKYTECVSKFICIPTGFQSRALILDNGLKLGTVDNYPEI
                     DVAFDGADEVDTNLQLIKGGGACLFQEKLVSTSAKKFIVIADHRKQSPHYLGTNWTKG
                     IPIEVVPAAYVRVQNDLKKLGAHKIVLRQGTPAKAGPVVTDNNNFLIDADFGQLEDPK
                     SLYFKILTLVGVVEVGLFIDNAERVYFGNSDGSVTHADRK"
     gene            <375313..>376272
                     /gene="TPHA0F01620"
                     /locus_tag="TPHA_0F01620"
                     /db_xref="GeneID:11531544"
     mRNA            join(<375313..375453,375844..>376272)
                     /gene="TPHA0F01620"
                     /locus_tag="TPHA_0F01620"
                     /product="40S ribosomal protein S7"
                     /transcript_id="XM_003686032.1"
                     /db_xref="GeneID:11531544"
     CDS             join(375313..375453,375844..376272)
                     /gene="TPHA0F01620"
                     /locus_tag="TPHA_0F01620"
                     /inference="similar to DNA sequence:INSDC:YNL096C,YOR096W"
                     /note="similar to Saccharomyces cerevisiae RPS7B (YNL096C)
                     and RPS7A (YOR096W); ancestral locus Anc_2.188"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_003686080.1"
                     /db_xref="GeneID:11531544"
                     /db_xref="GOA:G8BV64"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:G8BV64"
                     /translation="MSAQAKILSQAPTELELQVAQAFLELENSSADLKAELRPLQIKS
                     IREIDVAGGKKALAIFVPVPSLAAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPS
                     RTARQTQKRPRSRTLTAVHDKILEDMVFPTEIVGKRVRYLVGGNKIQKVLLDSKDIQQ
                     VDYKLESFQAVYNKLTGKQIVFEIPGETH"
     gene            complement(<376666..>377271)
                     /gene="TPHA0F01630"
                     /locus_tag="TPHA_0F01630"
                     /db_xref="GeneID:11531545"
     mRNA            complement(<376666..>377271)
                     /gene="TPHA0F01630"
                     /locus_tag="TPHA_0F01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686033.1"
                     /db_xref="GeneID:11531545"
     CDS             complement(376666..377271)
                     /gene="TPHA0F01630"
                     /locus_tag="TPHA_0F01630"
                     /inference="similar to DNA sequence:INSDC:YOR097C"
                     /note="similar to Saccharomyces cerevisiae YOR097C;
                     ancestral locus Anc_2.187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686081.1"
                     /db_xref="GeneID:11531545"
                     /db_xref="UniProtKB/TrEMBL:G8BV65"
                     /translation="MKQAQEIIDTYTNALPIKVRIDPINELHLPSLLLGLAITGILGP
                     LLNLFLGTILSSLLTLLKYVVIIGLFAGILFVAASGKKNNNNYNSSSNTNDVHSLKAN
                     KHEKKNRKVTKQDRSEREEFINAAISPYTIRDRTEMSDPGATLDKLNKIQHREPSKED
                     FEKLKYYDIPITKSNRFEKNDLIDKHDPYENFITMAQTRKK"
     gene            <378790..>380052
                     /gene="TPHA0F01640"
                     /locus_tag="TPHA_0F01640"
                     /db_xref="GeneID:11535353"
     mRNA            <378790..>380052
                     /gene="TPHA0F01640"
                     /locus_tag="TPHA_0F01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686034.1"
                     /db_xref="GeneID:11535353"
     CDS             378790..380052
                     /gene="TPHA0F01640"
                     /locus_tag="TPHA_0F01640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686082.1"
                     /db_xref="GeneID:11535353"
                     /db_xref="GOA:G8BV66"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BV66"
                     /translation="MASHSQSHEKSDQPRTITITIPSTRKIYQIVALTALFITTLVLV
                     IKGGAHIGRKESALARKQNMNYDSDAKYDSDAIKYKEQYSYVKYKVPEYTGKKARATF
                     VTLARNNDKNGLLSTVKSVEDRFNSKYQYDWVFLNDVEFNDDFKKTMTALISGTVKFG
                     VIPKEHWSFPSWIDQDRAAETRKKMKEEKIIYGDSIPYRHMCRFESGFFWRHPLLDEY
                     EYYWRVEPDTKLHCDIDYDIFRFMKDNKKKYGFTISIKEFMKTIPTLWDTTLNFTSLH
                     PEFVNKNNMLDFISNDNGKTYNSCHFWSNFEIASLDFWRSEAYTKYFEYLDNAGGFFY
                     ERWGDAPVHSIAASLFLDRNEIHHFADLGYFHGPFHQCPIDDVFRLGNRCACKPKDDF
                     TWKGYSCNTKYYDVNKLKKPENWEDYKK"
     gene            <381694..>382914
                     /gene="TPHA0F01650"
                     /locus_tag="TPHA_0F01650"
                     /db_xref="GeneID:11535501"
     mRNA            <381694..>382914
                     /gene="TPHA0F01650"
                     /locus_tag="TPHA_0F01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686035.1"
                     /db_xref="GeneID:11535501"
     CDS             381694..382914
                     /gene="TPHA0F01650"
                     /locus_tag="TPHA_0F01650"
                     /inference="similar to DNA sequence:INSDC:YOR099W"
                     /note="similar to Saccharomyces cerevisiae KTR1 (YOR099W);
                     ancestral locus Anc_2.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686083.1"
                     /db_xref="GeneID:11535501"
                     /db_xref="GOA:G8BV67"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BV67"
                     /translation="MAKFTIPVSSRRLYKLLGLFAIAIITIVIIVKGTDITSSLSGPI
                     DGKSDYVQGSKKANAPKKARTKYDDKYKYVKYSIPEYKGEKVRATFVTLARNKDLNGL
                     RETIKSFEDRFNSKFQYDWIFLNDSEFNDDFKVTMTALISGEVKFGIIPKEHWSFPSW
                     IDQDRAADTRKEMKDIIYGDSISYRNMCRFESGFFWRHPLLDEYEYYWRVEPDTKLYC
                     DVDYDIFRFMKDNDKKYGFTISIHEYRATIPTLWDTTVEFINLHPEYVAENNMLDFVS
                     NDDGMSYNLCHFWSNFEIASLDFWRSDAYRDYFDYLDHAGGFFYERWGDAPVHSIAAA
                     LFLNRTQVHHFDDLGYYHGPFHQCPTDEKIRLANRCDCDPNRDFTWRGYSCGKKYYKV
                     NNLAKPKNWADYSK"
     gene            complement(<383110..>384081)
                     /gene="TPHA0F01660"
                     /locus_tag="TPHA_0F01660"
                     /db_xref="GeneID:11535567"
     mRNA            complement(<383110..>384081)
                     /gene="TPHA0F01660"
                     /locus_tag="TPHA_0F01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686036.1"
                     /db_xref="GeneID:11535567"
     CDS             complement(383110..384081)
                     /gene="TPHA0F01660"
                     /locus_tag="TPHA_0F01660"
                     /inference="similar to DNA sequence:INSDC:YOR100C"
                     /note="similar to Saccharomyces cerevisiae CRC1 (YOR100C);
                     ancestral locus Anc_2.184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686084.1"
                     /db_xref="GeneID:11535567"
                     /db_xref="GOA:G8BV68"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BV68"
                     /translation="MSDVSSEEVYLEEASLWQENVRSLVAGGVGGVCAVLTGHPFDLV
                     KVRLQNNQASSTVDAIKKILIDVQVQNRIKFNPINYFKGFYKGVIPPLVGVTPIFAVS
                     FWGYDVGKKIVSYTADSSNSNNSLSNPQLAMAGFLSAIPTTLVTAPTERIKVVLQTQQ
                     PGVKNSSMISAATRIVKEGGVKSLFKGSLATLARDGPGSALYFGSYEVSKKFLNSRSS
                     NNNANGDEVNLLNVCLSGGIAGMSMWVVVFPIDTIKTKLQAGSTKTLNGGRVNMVSVA
                     KEIYFTKGGLKGFFPGIGPALLRSFPANAATFLGVELTHSLIKNYNL"
     gene            complement(<384748..>385206)
                     /gene="TPHA0F01670"
                     /locus_tag="TPHA_0F01670"
                     /db_xref="GeneID:11535568"
     mRNA            complement(<384748..>385206)
                     /gene="TPHA0F01670"
                     /locus_tag="TPHA_0F01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686037.1"
                     /db_xref="GeneID:11535568"
     CDS             complement(384748..385206)
                     /gene="TPHA0F01670"
                     /locus_tag="TPHA_0F01670"
                     /inference="similar to DNA sequence:INSDC:YOR103C"
                     /note="similar to Saccharomyces cerevisiae OST2 (YOR103C);
                     ancestral locus Anc_2.181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686085.1"
                     /db_xref="GeneID:11535568"
                     /db_xref="GOA:G8BV69"
                     /db_xref="InterPro:IPR003038"
                     /db_xref="UniProtKB/TrEMBL:G8BV69"
                     /translation="MAKKEVQVNKKEKTTEKAVEVPEAVEESKPVVSQKPINSSISKD
                     FSEAWGLSMKSYFEQVSEDKRIMLIDIFCLFLVIFAALQCVFMILIRSTFPFNAFLSS
                     FILCVGQFVLLISLRLQLTEPFPHISKSRAFGEFIFASLVLHFISLHFIN"
     gene            <385747..>386550
                     /gene="TPHA0F01680"
                     /locus_tag="TPHA_0F01680"
                     /db_xref="GeneID:11535463"
     mRNA            <385747..>386550
                     /gene="TPHA0F01680"
                     /locus_tag="TPHA_0F01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686038.1"
                     /db_xref="GeneID:11535463"
     CDS             385747..386550
                     /gene="TPHA0F01680"
                     /locus_tag="TPHA_0F01680"
                     /inference="similar to DNA sequence:INSDC:YNL099C"
                     /note="similar to Saccharomyces cerevisiae OCA1 (YNL099C);
                     ancestral locus Anc_2.180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686086.1"
                     /db_xref="GeneID:11535463"
                     /db_xref="GOA:G8BV70"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BV70"
                     /translation="MTDDVVDTLAEDLKISKAVEALHFNSPTKPKSESLNTTNKNENE
                     ANNYDDNDDEENDNDDDDDDDNDDEHIYINEETETGVERILVSKAPEERIVPPLNFCP
                     VERYLYRSGQPSPVNFPFLLNLHLKTIIWLANEEPQDTLLEFCESNNIELQFAAINPD
                     AGEDDNPWDGLTEHSIINALKTIVEKKNYPMLVCCGMGRHRTGTVIGCLRKLMAWNLA
                     SVSEEYRRFSGSRGGRILVELLIEAFDTKLIKIEKDKAPDWLLTAVESD"
     gene            complement(<386729..>387484)
                     /gene="TPHA0F01690"
                     /locus_tag="TPHA_0F01690"
                     /db_xref="GeneID:11535354"
     mRNA            complement(<386729..>387484)
                     /gene="TPHA0F01690"
                     /locus_tag="TPHA_0F01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686039.1"
                     /db_xref="GeneID:11535354"
     CDS             complement(386729..387484)
                     /gene="TPHA0F01690"
                     /locus_tag="TPHA_0F01690"
                     /inference="similar to DNA sequence:INSDC:YNL100W"
                     /note="similar to Saccharomyces cerevisiae YNL100W;
                     ancestral locus Anc_2.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686087.1"
                     /db_xref="GeneID:11535354"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:G8BV71"
                     /translation="MFIYNVQSFIEEKEEVPISKDKVNVPDSADNKSSNLNIFKKIDQ
                     DINNDLVNYTLDSGSKVTESKELTSWIHRWRTDVVDKYRFYSSSIKSQEEKLLKDKQN
                     ATKYIYSNILTDDLENSEDLVPGATLSLLAFFTGRVLTNKRNWSRINGTLVKSSFMGK
                     TLTSIPSRVVIPVFFACYTMKTFLPVTFQNLVNTIENDMLPRKFVNDYHELWNVGYVN
                     GIQKSCNNLHASINNASFESVRKLRELVDKVFR"
     gene            complement(<387868..>389202)
                     /gene="TPHA0F01700"
                     /locus_tag="TPHA_0F01700"
                     /db_xref="GeneID:11535342"
     mRNA            complement(<387868..>389202)
                     /gene="TPHA0F01700"
                     /locus_tag="TPHA_0F01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686040.1"
                     /db_xref="GeneID:11535342"
     CDS             complement(387868..389202)
                     /gene="TPHA0F01700"
                     /locus_tag="TPHA_0F01700"
                     /inference="similar to DNA sequence:INSDC:YNL101W"
                     /note="similar to Saccharomyces cerevisiae AVT4 (YNL101W);
                     ancestral locus Anc_2.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686088.1"
                     /db_xref="GeneID:11535342"
                     /db_xref="GOA:G8BV72"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:G8BV72"
                     /translation="MSTNSEKGFKNLNNNDTKQRTGTSNWKTYFLLLKSFVGTGSLLL
                     PSAFHKGGLVFSVILIVIFGLYSYWCYFIIIKLKTKVKANTFQEIGNNILGRWMSYVI
                     LGSLVLTQIGFSSAYIIFVGENFNQVVYNMTNYECNIIYPILFQLGFNFAMSFISRME
                     VLTIPAVIANVLIICGIILVISYSLHHLILISDKKSDPGVMLFFNSNEWTLFIGTAIY
                     AFEGVGLLIPIHNNMSSPKDFPKILLLVMLTMSIIFILIGTCGYLSYGEKIKVIILQS
                     FAPGIFVNIIIVCFTIGILLSTPLQLFSLTSLLEDFLFTKKKIAVADEDLKVLEESDI
                     LCSESDTEAQGTKHINLRVYKIILRFLIVTTVCLIGYITSDKLNKLVAIVGSLACIPL
                     VYIYPPLLNLYECSLPGIIKNNWSILPFVFDLFLIISGLCGMMYTSYRSVIL"
     gene            complement(<389548..>393930)
                     /gene="TPHA0F01710"
                     /locus_tag="TPHA_0F01710"
                     /db_xref="GeneID:11535343"
     mRNA            complement(<389548..>393930)
                     /gene="TPHA0F01710"
                     /locus_tag="TPHA_0F01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686041.1"
                     /db_xref="GeneID:11535343"
     CDS             complement(389548..393930)
                     /gene="TPHA0F01710"
                     /locus_tag="TPHA_0F01710"
                     /inference="similar to DNA sequence:INSDC:YNL102W"
                     /note="similar to Saccharomyces cerevisiae POL1 (YNL102W);
                     ancestral locus Anc_2.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686089.1"
                     /db_xref="GeneID:11535343"
                     /db_xref="GOA:G8BV73"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015088"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR024647"
                     /db_xref="InterPro:IPR029702"
                     /db_xref="UniProtKB/TrEMBL:G8BV73"
                     /translation="MTSNQSRLEKLKKLQAARNGGQASDDVEYDDVLYDELDENEYRS
                     RKRQELLQDDFVVDDDGLGYVDRGVGDDWDNRDEYYTDEEDIVGNQKNSKKKPLTEKD
                     TKSIENIIRAQNSKISISNQLNKPKKNFGVADFDDILDEFNDSNEEKMSFRTAPKVNI
                     PTHSKLPSSPTISNKRIMTKDVEVQEDGKQSKKLKTEEAFIHNSKILQISSSPLKSKS
                     NMINTSKEESETPVPSSPTATKSEKIIQKLSEDDSDSDEEIAFGRRTMRSAKSTRKIN
                     LSSKTNLGSSPFVTAPGTPLVSKAPDTPSKTGIDTQSIPDTESLVFKKYDKEQIIDPE
                     TNGFKMFWLDFSEVDSKLIIFGLVRALDGSLLSAMVQINGLARELFFLPREGVEPEEV
                     QEEIVPLLLEKYGLDKIRSKPQEMKYAFEIPGIPHVTNYLKVLLPFDTPKSKRDIIPS
                     DLNSEKFSHVFGGGTGILESFLVQNKIMGPCWLDIKNGDFETLQNTSHCKLEISVSNP
                     SDIKPIEDSGEVFLKCMSLSVQTVMNRSENKQEVVAITMATYNRISPENAIPENINPD
                     QLITLVRPPKGTSFPLGLAPLAKQKLNGQVRLFNNEKTLLACFCAMLRVSDPDVLIGH
                     RLENVILDVLSHRIWDFKIPNFSSLGRRNRREWPARFGKQNFNMNNFLIKDISSGRLL
                     CDIANEMGQSLTPKCQNWDLSEMYTVTTGIEHKSIDINYQNTQYHEDVNSMIMALQEN
                     VNNVKLTAEVSFRIQLLSLTKQLTNLAGNAWSQTLGGTRAGRNEYILLHEFVRNGYIV
                     PDKESNKSRARKNVEHQETEGNNSSMAPAVSSKKAKYQGGLVFEPEKGLHKNYILVMD
                     FNSLYPSIIQEFNICFTTVDRNLNDIEEIPEVPSSEKEQGVLPRLLQNLVQRRREVKK
                     LMINESDPHIRAQCDIRQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTGKGREILMN
                     TRQLAESMNLKVVYGDTDSVMIDTGSELYGQAIAVGLNFKKLVNERYKLLEIDIDNVF
                     KKLLLHSKKKYAALNVTIDKNKQEQTSLEVKGLDMRRREYCPLSKEVSTNILNLILSD
                     KDSETALQEIYDYLEDIKSKVENNEIRVDKYKINTKLSKDPSAYPGGKSMPAVQVALH
                     MRKAGRVVKAGSVITFVITKEKEDENKSASTTSPAERAFSLNEVMVKTNNLLPDPNYY
                     LEKQIFAPVERLLENIESFDIVRLSSALGLDSRKYLQRVNEYGNGANGIDNLQPLETT
                     ISDVERFKDTAFVILNCPSCDNEFPFGGIVASNYYTVCFNGIQCKKCEHIFSTIQFTS
                     QLERCIRSHISLYYAGWLHCDDRTCGNVTRQISVFGKRCLMDGCTGVMRYRYTDKQLY
                     NQLLYFDSLFDCKKIKNRELKPLYQFGDIHAPKEPLNELTVNALTEQNRELFQINHDV
                     VQKYLNDCGRRYVHMGSIFEFMTM"
     gene            complement(<394469..>396358)
                     /gene="TPHA0F01720"
                     /locus_tag="TPHA_0F01720"
                     /db_xref="GeneID:11535544"
     mRNA            complement(<394469..>396358)
                     /gene="TPHA0F01720"
                     /locus_tag="TPHA_0F01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686042.1"
                     /db_xref="GeneID:11535544"
     CDS             complement(394469..396358)
                     /gene="TPHA0F01720"
                     /locus_tag="TPHA_0F01720"
                     /inference="similar to DNA sequence:INSDC:YNL103W"
                     /note="similar to Saccharomyces cerevisiae MET4 (YNL103W);
                     ancestral locus Anc_2.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686090.1"
                     /db_xref="GeneID:11535544"
                     /db_xref="UniProtKB/TrEMBL:G8BV74"
                     /translation="MFNHNPNGSQGGKNIDKSKSYNTDFMNIFGDDGNGSSSINDVYH
                     HPNAMTTTNANSNESENTIFESDNTASILLEQLAYVDNFMASSENDFVDINSLVAMEN
                     GFYNHQVVNEGINSAQGLPNQNLDQDNIWGLDERLARELSVFADSSFIFHDEDKPKQD
                     GDENDNSNNNSNSNNNIADDTVLNNRDDITNQEYQRKPHYLTQRKNDILKSQYDHSKS
                     RFSSKKKKTPINAPASSAVDSVDFVHINRNDIEETFSNFDIIASDSVAQNSQSNHVTT
                     MGNNNNTVIINNDDDDNDDDDNNNSSNNDNDNDNDDNNNSNNSNNNDTQGRGTTVDNK
                     NTASLQIEQPDLASMPTSTLISFFPRLKVPTGVINSLTQRGLTMEQIDALSVIIAYHQ
                     QEKKKNPQNGETVTQIIDSQNINADYLVTLLSDSRLQHSNIASSSKSYTDSDSNSNPK
                     DIMKSNFVNVLFDLVKNNVLSNESKEDTLPHNEDSISTNLPESRLKKVNISENIIDTT
                     PTQVGQHKELKREIPESDVQGEKTLNIKRVKMENNIKYTIPTTPTMKAHQKRKKKEQE
                     LESSVNKLSELAISLQQKIHALEMENKLLKQMVYSNGKISTESDAENLKKFILENKSP
                     KKDNK"
     gap             399617..400047
                     /estimated_length=431
     gene            <400178..>400798
                     /gene="TPHA0F01730"
                     /locus_tag="TPHA_0F01730"
                     /db_xref="GeneID:11535417"
     mRNA            <400178..>400798
                     /gene="TPHA0F01730"
                     /locus_tag="TPHA_0F01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686043.1"
                     /db_xref="GeneID:11535417"
     CDS             400178..400798
                     /gene="TPHA0F01730"
                     /locus_tag="TPHA_0F01730"
                     /inference="similar to DNA sequence:INSDC:YOR107W"
                     /note="similar to Saccharomyces cerevisiae RGS2 (YOR107W);
                     ancestral locus Anc_2.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686091.1"
                     /db_xref="GeneID:11535417"
                     /db_xref="GOA:G8BV75"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G8BV75"
                     /translation="MNLRKYNALMLTPAMELRKKSQLAMRSMKMKNKNNDKEEFLFRA
                     KIMNYDGRTKITLSNILKYYNIYEVYQFSKAYNERPIASPVVTDEYVISFENYVISKH
                     CYENIEFLKESDCFLRFSDEELEANQDLKNELAQKWNNVFYPYFFNEDSDSEINLSPE
                     QFIIFKNYKMLNELPSKRDILNARREIIRILQDIFRMFNSSFTTHP"
     gene            <402161..>404005
                     /gene="TPHA0F01740"
                     /locus_tag="TPHA_0F01740"
                     /db_xref="GeneID:11535418"
     mRNA            <402161..>404005
                     /gene="TPHA0F01740"
                     /locus_tag="TPHA_0F01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686044.1"
                     /db_xref="GeneID:11535418"
     CDS             402161..404005
                     /gene="TPHA0F01740"
                     /locus_tag="TPHA_0F01740"
                     /inference="similar to DNA sequence:INSDC:YNL104C,YOR108W"
                     /note="similar to Saccharomyces cerevisiae LEU4 (YNL104C)
                     and LEU9 (YOR108W); ancestral locus Anc_2.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686092.1"
                     /db_xref="GeneID:11535418"
                     /db_xref="GOA:G8BV76"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BV76"
                     /translation="MFKQTFVILAHDSKSSASKIIPPVKLAYKNMLKDPSVKYQPFIR
                     PTMKERAWPDKTIKKAPRWLSTDLRDGNQSLPDPMNIEQKKEYFHKLVNIGFKEIEVS
                     FPSASQTDFDFTRYAVENAPEDVTIQCLVQSRDHLIKRTVESLTGAKRASIHTYLATS
                     DMFRSIVFDMSKEEAIKKAVEATKLVRKLTKDDPKQQGTRWSYQFSPECFSDTPVEFA
                     VEICEAVKEAWEPTVENPIVFNLPATVEVAMPNIYADQIEYFSNHISEREKVCISTHT
                     HNDRGCGVAATELGLLAGADRVEGCIFGNGERTGNVDLVTVALNMYTQGVSPNLDFSD
                     IKSLIEVVERCNKIPVAARAPYGGDLVVCAFSGSHQDAIKKGFALQEKRRAAGDNFWK
                     IPYLPLDPKDIGRDYEAVIRVNSQSGKGGAAWVILRALGLDLPRNMQIEFSNIVQEHA
                     DSLGKELQSEEITGLFKNVYNHNNEVSSYISLLDYDVKKVDTERRILTGQVEIAGQVV
                     SIEGTGNGPISSLVDALSNLLNVKIGVANYAEHSIGSGSTTRAASYVHLTYRRDSNNE
                     KSYQWGVGISEDVSDASIKAILSTVNNIIHSTEISLPSVLESKHAGTA"
     gene            <404587..>407595
                     /gene="TPHA0F01750"
                     /locus_tag="TPHA_0F01750"
                     /db_xref="GeneID:11535376"
     mRNA            <404587..>407595
                     /gene="TPHA0F01750"
                     /locus_tag="TPHA_0F01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686045.1"
                     /db_xref="GeneID:11535376"
     CDS             404587..407595
                     /gene="TPHA0F01750"
                     /locus_tag="TPHA_0F01750"
                     /inference="similar to DNA sequence:INSDC:YNL106C,YOR109W"
                     /note="similar to Saccharomyces cerevisiae INP52 (YNL106C)
                     and INP53 (YOR109W); ancestral locus Anc_2.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686093.1"
                     /db_xref="GeneID:11535376"
                     /db_xref="GOA:G8BV77"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8BV77"
                     /translation="MIIILSTTADRRLAIVSENHAIVFKAISEPSSKKPICNIELAEK
                     KTLRGHGFQKLSSHEIFGFIGLIEVNGLIFIGTIVGKSKVAQPVPGESINKINSVEFY
                     CLNDPTWDFTEFDANGYPLKTEQDSSEVREPIPRHPLSELRKLLSNGSFYYSSDFDLT
                     ATLQSRGYGAHSLSSDKYETEYMWNYFLMQDIIEYRDRLDNIAKQILDDNGFLTTMIC
                     GFAETFITAIEKTKVAITIISKQSWKRAGTRFNARGVDDDANVANFVETETVMYSLHY
                     CYSFTQIRGSIPVFWEQENGMINPKVEIRRSIEATQPIFDKHFENLNNKYGHVNIVNL
                     LAYKPSEIELSKRYHDHLKNSKKFQFGEDVSLTDFDFHKETSGEGFAGVRKLIPLITE
                     SMLSLGYFSYDIKEQKVLSEQHGVFRTNCLDCLDRTNVVQQAISKEGFKIFLEDFRLK
                     SSNDGVEDEDVMNKLNELWADNGDQISQIYTGTNALKSSYSRKGKMSLSGILSDATKS
                     VSRIYINNFVDTGKQHTIDFLLGRLPNQLTVQLFDPVSQYISKELSSQSDKFTTIANI
                     EIFAGTFNVSAATDNIDLTKWLFPVGERFKPDVFVLGLQEVIELSAGSILNADYTKGH
                     FWESMVSKCLNKFGDKYLLLRVEQVTSLLILLFVHVDKVQNFKEVEGASKKTGFGGIA
                     GNKGAVSIRFNYGDTSFCFINSHLSAGDNNVEDRKNDYWNILNGINFTRSKTISDHDN
                     IFWLGDLNFRVNLDSEIVRYELEKKKDDYINGLLKYDQLRHEIMTGEIFKGFKEAPIK
                     FRPTYKYDKGTENYDSSEKARTPSWTDRILYKGEDLSALSYSDALILDSDHRPVYGAY
                     RVITKFSDNDKKKELVKLLYTEFQRKHSDLVLTNIFSKSDSGLSLNSTPASNEDSNGY
                     NIEDLDLSRDSFRTLMSDTTTSSKLNLRPPPPPLTEDVSSNSDCKSPESIVKTISRTE
                     SLTNKERPLPPGFNDGIVLTPGKVNEDGNK"
     gene            complement(<407745..>408395)
                     /gene="TPHA0F01760"
                     /locus_tag="TPHA_0F01760"
                     /db_xref="GeneID:11535349"
     mRNA            complement(<407745..>408395)
                     /gene="TPHA0F01760"
                     /locus_tag="TPHA_0F01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686046.1"
                     /db_xref="GeneID:11535349"
     CDS             complement(407745..408395)
                     /gene="TPHA0F01760"
                     /locus_tag="TPHA_0F01760"
                     /inference="similar to DNA sequence:INSDC:YNL107W"
                     /note="similar to Saccharomyces cerevisiae YAF9 (YNL107W);
                     ancestral locus Anc_2.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686094.1"
                     /db_xref="GeneID:11535349"
                     /db_xref="GOA:G8BV78"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:G8BV78"
                     /translation="MAAPVSKRIKTLSVTRPIVFGNTAKKFGDVRPPNAPTEHTHLWT
                     IFVRGPQNEDISYYVEKVVFKLHDTYPNPIRTVEAPPFELTETGWGEFEINIKIYFVQ
                     ESGEKNISFYHHLRLHPYIFTTDQKPIPEQMNEVSSSFYDEIIFNEPNEAFFKILMSK
                     PGNLLPSNKTKDCVFSKQLEQEEIYRIQNGINTIKGQIEELKANITQKLKENESKN"
     gene            <408734..>410011
                     /gene="TPHA0F01770"
                     /locus_tag="TPHA_0F01770"
                     /db_xref="GeneID:11535395"
     mRNA            <408734..>410011
                     /gene="TPHA0F01770"
                     /locus_tag="TPHA_0F01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686047.1"
                     /db_xref="GeneID:11535395"
     CDS             408734..410011
                     /gene="TPHA0F01770"
                     /locus_tag="TPHA_0F01770"
                     /inference="similar to DNA sequence:INSDC:YNL108C,YOR110W"
                     /note="similar to Saccharomyces cerevisiae YNL108C and
                     TFC7 (YOR110W); ancestral locus Anc_2.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686095.1"
                     /db_xref="GeneID:11535395"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8BV79"
                     /translation="MTVKTIYIARHGYRSNWLPQGPYPPPPTGVDSDVPLAEHGLTQA
                     KELGHYILSLNNQPELLFSSPFYRCIQTSEAIAALLELPIYLDTGIGEWYKPDRAIIP
                     VPASYEVLSQLFPTKISDDWSSTILPSDKGETEEDIFNRCKTFWPKFIDTLEDSFPNI
                     ETIILVTHAATKIALGLSLLKKSSARDAIDSEGTLIRSGSCSLDKYELLETEYSKDDD
                     STFVLPFEKRTWKITMNGNTEYLTKGEEMNWNFQSSFEAGSDADIRARMMAAAEKGEA
                     PDASINNSHKAETETVYVSVDIPSKNYRNTHTIDRAATLQYSGLEENSPLFKIGDKIY
                     EGQWKKLVGTELAFPNAAKVMNKKVSLEHTIPKPLDLINQDNQTSNNASIDNPEEPTS
                     VNSIATEKDKNDVHPEKIYKITDRIILSEVKPM"
     gene            <410383..>411045
                     /gene="TPHA0F01780"
                     /locus_tag="TPHA_0F01780"
                     /db_xref="GeneID:11535396"
     mRNA            <410383..>411045
                     /gene="TPHA0F01780"
                     /locus_tag="TPHA_0F01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686048.1"
                     /db_xref="GeneID:11535396"
     CDS             410383..411045
                     /gene="TPHA0F01780"
                     /locus_tag="TPHA_0F01780"
                     /inference="similar to DNA sequence:INSDC:YOR111W"
                     /note="similar to Saccharomyces cerevisiae YOR111W;
                     ancestral locus Anc_2.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686096.1"
                     /db_xref="GeneID:11535396"
                     /db_xref="GOA:G8BV80"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:G8BV80"
                     /translation="MLETYLSGYDVILGSSSPRRYEIVHDNLGLQTFKVIVPEFEENL
                     DKQNYLNRPIDYVRDTSRYKAEGILDGLKEECKLKEHNSSKPIIVVCADTVIIDKDNK
                     IYEKPKSSEDQFNNLKKYCYSNEIFSVITGVTLILFDPYISQHKMLAFDDKTDLYFDS
                     SVPTELIDYYVKSGEGMNAAGGFKIQDTSGSFIKKIEGDFYNVIGLPLNKTVMNIFKL
                     IN"
     gene            <412270..>412818
                     /gene="TPHA0F01790"
                     /locus_tag="TPHA_0F01790"
                     /db_xref="GeneID:11535449"
     mRNA            <412270..>412818
                     /gene="TPHA0F01790"
                     /locus_tag="TPHA_0F01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686049.1"
                     /db_xref="GeneID:11535449"
     CDS             412270..412818
                     /gene="TPHA0F01790"
                     /locus_tag="TPHA_0F01790"
                     /inference="similar to DNA sequence:INSDC:YNL111C"
                     /note="similar to Saccharomyces cerevisiae CYB5 (YNL111C);
                     ancestral locus Anc_2.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686097.1"
                     /db_xref="GeneID:11535449"
                     /db_xref="GOA:G8BV81"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:G8BV81"
                     /translation="MYVYINCLNFILNKLERSHLLSFIFLKLYCSDCSLYTVFLRIRQ
                     IPIATKATKIKQYDMSKIYTYEEIAEHNTTESSWIVIEGKVYNVTKFLDEHPGGDEII
                     FDLAGTDATENFEDIGHSDQALKVLKTLYIGDVDKNSKPIAVKKTVNDHAESGEPWQG
                     NANIVMVLAAIFFYVAYQWGNK"
     gap             415998..416290
                     /estimated_length=293
     gene            <416859..>418136
                     /gene="TPHA0F01810"
                     /locus_tag="TPHA_0F01810"
                     /db_xref="GeneID:11535415"
     mRNA            <416859..>418136
                     /gene="TPHA0F01810"
                     /locus_tag="TPHA_0F01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686050.1"
                     /db_xref="GeneID:11535415"
     CDS             416859..418136
                     /gene="TPHA0F01810"
                     /locus_tag="TPHA_0F01810"
                     /inference="similar to DNA sequence:INSDC:YOR113W"
                     /note="similar to Saccharomyces cerevisiae AZF1 (YOR113W);
                     ancestral locus Anc_2.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686098.1"
                     /db_xref="GeneID:11535415"
                     /db_xref="GOA:G8BV82"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BV82"
                     /translation="MNMNNRPILVPNFDLGIDILVPHSEDNLVENTKDFSNDLAKDIL
                     RDGSSIDFKSPSKADENLDNYQYGNSYFTDAFSMNKFHNRNTPLNEQSLSPKDMDVND
                     SLYHSNSNTLTYSQSNDLQYDINDINLNQIFTVDDLMAIKARSYSTTAISNNNRGEVS
                     QVELIESTPLDGVSVETSFPEISNANDLRFKNTDYFKPFDMQSRVMSIPDSNELKKMV
                     DEIKRNSIVTISPPSTDAGMGKKSRRRSTARQTQCSFCLKVFNQASHFEVHIRSHIGY
                     KPHKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEICNKKFSRKGNLASHIATHNRLRL
                     HICKFDHCKKSFTQLGNMKAHHNKFHRETMARLSNILLNISAEDSLSDDDKYMLQYYL
                     TVYKNSKRLNLLTPFLNMPLIKEAISLPTTTGL"
     gene            <418648..>419472
                     /gene="TPHA0F01820"
                     /locus_tag="TPHA_0F01820"
                     /db_xref="GeneID:11535416"
     mRNA            <418648..>419472
                     /gene="TPHA0F01820"
                     /locus_tag="TPHA_0F01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686051.1"
                     /db_xref="GeneID:11535416"
     CDS             418648..419472
                     /gene="TPHA0F01820"
                     /locus_tag="TPHA_0F01820"
                     /inference="similar to DNA sequence:INSDC:YOR114W"
                     /note="similar to Saccharomyces cerevisiae YOR114W;
                     ancestral locus Anc_2.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686099.1"
                     /db_xref="GeneID:11535416"
                     /db_xref="UniProtKB/TrEMBL:G8BV83"
                     /translation="MKPNRPLFAQLSNTIYNTKQTFKNDNKPNLVTSFQYYYSLQFNK
                     LNLGDNTSIGMIKNISYNTNFKRYIRKEWDLLSTTSKRLYTALYIYDNNINYKSLNAF
                     ELAKMMEIETPVSSEYMLFRCNFKKHFELINNEQKGNSMKRTIINRYHVSLQKRILGV
                     RRNSGIKINKYIQSENKNISRTYQEFCRECRKVWKENVSELMKEQLREKLNTQTIKFE
                     SVIEKERDILEMNLNRISNILSKSKDTQVDFYKLKEERPDQLSKDLKFTLAYLKKV"
     gene            <420083..>422026
                     /gene="TPHA0F01830"
                     /locus_tag="TPHA_0F01830"
                     /db_xref="GeneID:11535478"
     mRNA            <420083..>422026
                     /gene="TPHA0F01830"
                     /locus_tag="TPHA_0F01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686052.1"
                     /db_xref="GeneID:11535478"
     CDS             420083..422026
                     /gene="TPHA0F01830"
                     /locus_tag="TPHA_0F01830"
                     /inference="similar to DNA sequence:INSDC:YNL115C"
                     /note="similar to Saccharomyces cerevisiae YNL115C;
                     ancestral locus Anc_2.158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686100.1"
                     /db_xref="GeneID:11535478"
                     /db_xref="InterPro:IPR019431"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BV84"
                     /translation="MNSKAQDTLPNAEVEPVIVNEDETEPLLNKHKQKPNSLKKSPRR
                     IGEESSEPIYMIENESQQNNSQLEEYVLQPNLKKIYLRYKKFRRYSSLILNVCIFVNI
                     LWLIFTLVTSYFFSFELQPIIHKRYSGYNDLCIITISIISNCLNLWSNNIEIYSHLDF
                     DLNIILFALTIFNLMLLKIVRYTSERIGIIGVITYAWAATTFGIGILLDWKTANFKKQ
                     IVVVYNSGTSQNDNARNINSSRATSIQNDSQINEPTNSNSLQSIYVLPVIGNSQNTQR
                     HTLQEWTYIFVKVFGKLLLLMYMIFFTLNTLLSIWDLSEVTKNLASNKQLKNPENLDG
                     FYWVDKEHTYQLHIKCYGDVFKREPSTSNYNNNIDKLQPIILYEHGGFDTEVSSAAWL
                     HELFVANEIDRYCTYDRPGYGLSDASPALQSISTVINGLGYALTQEANITGPFLCVGY
                     DIGGLYSQVFAGKYNDKTAGLLLIDSWHENLLIKDNIKHILSKDKLSNSHKELPISLQ
                     PHTGLTLFFDGLKSTLGLTLQYSWLFRSKNSNDRIFGDYMRFQGKFLRAKFLEKITSS
                     LLSYQDILEHRQILENTKLAVVTSKELVKKSLNWGIWQRELSKISGKTKEWKMVDGGH
                     EIYLSKKGINETKEVLLRLLASS"
     gap             422260..422279
                     /estimated_length=20
     gene            complement(<422396..>423961)
                     /gene="TPHA0F01840"
                     /locus_tag="TPHA_0F01840"
                     /db_xref="GeneID:11535563"
     mRNA            complement(<422396..>423961)
                     /gene="TPHA0F01840"
                     /locus_tag="TPHA_0F01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686053.1"
                     /db_xref="GeneID:11535563"
     CDS             complement(422396..423961)
                     /gene="TPHA0F01840"
                     /locus_tag="TPHA_0F01840"
                     /inference="similar to DNA sequence:INSDC:YHR115C,YNL116W"
                     /note="similar to Saccharomyces cerevisiae DMA1 (YHR115C)
                     and DMA2 (YNL116W); ancestral locus Anc_2.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686101.1"
                     /db_xref="GeneID:11535563"
                     /db_xref="GOA:G8BV85"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BV85"
                     /translation="MLTPIPFQTNQGNNNSTNGVNNPANNNSTNSASSGRRRGSSFNM
                     ILNTFGIRPNNSNTNSANNSNVNLSTNASNSASYDTTNNTTTNNENSNNAASSVNPNE
                     FYQLPISLSLTSTDNNNTNNDNNNSNNNNNNNNDDSNNGNNQSDFFFNLSSNLSNLNG
                     NMNSNTITANVSTNPVDNSNTNSINDLPNTNDALRNLRHYIYGANQENPDSLLQLDLP
                     PNGRAPEACDVDSVRRRKDKNGLFSIRLTPFIDTSSSSNPGLYFDPVIRTAGPGSQLV
                     IGRYTERVREAISKVPENYHPVVFKSKVVSRTHGCLKVDSNGNWYVKDAKSSSGTFLN
                     HQRLSPASTLSKDTILNDGDILQLGMDFRGGTEEIYRCVKMRVELNKSWKRKANTFNK
                     EALQRIRNLQQLTSGLEEEDCSICLSAIKPCQAIFISPCSHSWHFHCIRRLVMMSYPQ
                     FVCPNCRSSCDLEASLESSSEDEGDMLIDDENNVDDDLPNHASNENAEVNEAQVTSMN
                     VDSSDENVSSSTD"
     gene            complement(<425114..>426787)
                     /gene="TPHA0F01860"
                     /locus_tag="TPHA_0F01860"
                     /db_xref="GeneID:11535525"
     mRNA            complement(<425114..>426787)
                     /gene="TPHA0F01860"
                     /locus_tag="TPHA_0F01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686054.1"
                     /db_xref="GeneID:11535525"
     CDS             complement(425114..426787)
                     /gene="TPHA0F01860"
                     /locus_tag="TPHA_0F01860"
                     /inference="similar to DNA sequence:INSDC:YNL117W"
                     /note="similar to Saccharomyces cerevisiae MLS1 (YNL117W);
                     ancestral locus Anc_2.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686102.1"
                     /db_xref="GeneID:11535525"
                     /db_xref="GOA:G8BV86"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="InterPro:IPR006252"
                     /db_xref="InterPro:IPR011076"
                     /db_xref="InterPro:IPR019830"
                     /db_xref="UniProtKB/TrEMBL:G8BV86"
                     /translation="MVRVSLNNVKLLVDIDNKPQFHPSTTTVQTILTAECLEFIVLLH
                     RTFNSKRKLLLSNRQLLQKKLDSGLYQLDFLEETEYIRDDPTWKGPKSLGPGLIDRSV
                     EITGPPLRNMLINALNAEFVNTYMVDFEDSLSPTWQNIIYGQVNLYDLIRDNINFTSV
                     NGKNYSLKDKIQNLPTLIVRPRGWHMVEKHLYIDDEPISASIFDFGVFFYHNAQALID
                     LGKGPYFYLPKMEHHLEAKLWNDIFNVAQDYLSIPRGTIRATVLIETLPAAFQMEEII
                     YQLRDHSSGLNCGRWDYIFSTIKRLRNLPTHVLPNRDLVTMTSPFMDSYVKRLINTCH
                     RRNVHAMGGMAAQIPIKDDKTRNDAAMQKVRTDKIRELTNGHDGSWVAHPALAPICHE
                     VFVNMGTKNQIHYIPDTKITSADLTNTSIQDFQVTTEGIKQNLDIGLRYMEAWLRGSG
                     CVPINYLMEDAATAEVSRCQLYQWVKHGVTLSDTGEVVTPELTTKILTEQVSRLKQSS
                     PVGDKNKFDTAAKYFLPEITAKHFSEFLTTLLYDEIVTQKSAPTHLSKL"
     gap             427488..427527
                     /estimated_length=40
     gene            <427543..>428085
                     /gene="TPHA0F01870"
                     /locus_tag="TPHA_0F01870"
                     /db_xref="GeneID:11535526"
     mRNA            <427543..>428085
                     /gene="TPHA0F01870"
                     /locus_tag="TPHA_0F01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686055.1"
                     /db_xref="GeneID:11535526"
     CDS             427543..428085
                     /gene="TPHA0F01870"
                     /locus_tag="TPHA_0F01870"
                     /inference="similar to DNA sequence:INSDC:YHR116W"
                     /note="similar to Saccharomyces cerevisiae COX23
                     (YHR116W); ancestral locus Anc_2.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686103.1"
                     /db_xref="GeneID:11535526"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR027179"
                     /db_xref="UniProtKB/TrEMBL:G8BV87"
                     /translation="MYVVTDKWINNASTLPFLPIESISAFSNITIRLKQRSFHHIRLH
                     SASINTNQYLATMSDDNHISNNNNGSNDITKDSYDPSLVTNKESVDFTKPDITLNENR
                     FKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKCLDMNDYDRDKCRAYFDAYR
                     ECKKQWLRARRNNEDGNWGI"
     gene            <428432..>428731
                     /gene="TPHA0F01880"
                     /locus_tag="TPHA_0F01880"
                     /db_xref="GeneID:11535626"
     mRNA            <428432..>428731
                     /gene="TPHA0F01880"
                     /locus_tag="TPHA_0F01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686056.1"
                     /db_xref="GeneID:11535626"
     CDS             428432..428731
                     /gene="TPHA0F01880"
                     /locus_tag="TPHA_0F01880"
                     /inference="similar to DNA sequence:INSDC:YNL122C"
                     /note="similar to Saccharomyces cerevisiae YNL122C;
                     ancestral locus Anc_2.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686104.1"
                     /db_xref="GeneID:11535626"
                     /db_xref="GOA:G8BV88"
                     /db_xref="InterPro:IPR021137"
                     /db_xref="UniProtKB/TrEMBL:G8BV88"
                     /translation="MSMIGSLANSITKINAKNINIFNNKNVFHLDFRRTLMKTHKGTA
                     KRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHVSKLRKLLPYN"
     gene            complement(<428906..>430318)
                     /gene="TPHA0F01890"
                     /locus_tag="TPHA_0F01890"
                     /db_xref="GeneID:11531549"
     mRNA            complement(<428906..>430318)
                     /gene="TPHA0F01890"
                     /locus_tag="TPHA_0F01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686057.1"
                     /db_xref="GeneID:11531549"
     CDS             complement(428906..430318)
                     /gene="TPHA0F01890"
                     /locus_tag="TPHA_0F01890"
                     /inference="similar to DNA sequence:INSDC:YNL128W"
                     /note="similar to Saccharomyces cerevisiae TEP1 (YNL128W);
                     ancestral locus Anc_2.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686105.1"
                     /db_xref="GeneID:11531549"
                     /db_xref="GOA:G8BV89"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029023"
                     /db_xref="UniProtKB/TrEMBL:G8BV89"
                     /translation="MKDSKNKTTSPVSLILKKCFTFPMNRSKQNSGHTLDISYILPNL
                     IVCSYPANHYPKVFYRNSLPDLIDYLNTTHGYQRWKIYNIKGEHTKTDYSEEDVYEIL
                     DNDLNVKVNSLDFPGKFISNKEVGIIQKKECVLKKGWLDHCPPTFLRMQEIVDDIEAQ
                     LNKSEKNVAVVHCRMGKGRSGTIVIAYLMKILVCPLSEAKDIFQNARFKIGISKGVTI
                     RSQLRYLTYHELFLNYDMSKRKILLEILKNKENLFHFQLSSIELINPNSIIIPPKSIN
                     LVTIKVQTYNMDMNDLIQLNSSAKLEDGWKLDIYKKNSKYSGYDAYNNRRLIIHCPLD
                     IPYDVSDIRIIFGINNNCNHKGNNEKLKNNSNSNDFESFNYNISSDKDSISNVITNSV
                     TNRTSYSRVWFNLYWESLKCLQALSQTNFQIEQLLYEQFLGREFHMKINWNELDGPKG
                     TNKKGIKLFDMAIIKWKIKQ"
     gene            <431044..>431715
                     /gene="TPHA0F01900"
                     /locus_tag="TPHA_0F01900"
                     /db_xref="GeneID:11531550"
     mRNA            <431044..>431715
                     /gene="TPHA0F01900"
                     /locus_tag="TPHA_0F01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686058.1"
                     /db_xref="GeneID:11531550"
     CDS             431044..431715
                     /gene="TPHA0F01900"
                     /locus_tag="TPHA_0F01900"
                     /inference="similar to DNA sequence:INSDC:YHR122W"
                     /note="similar to Saccharomyces cerevisiae YHR122W;
                     ancestral locus Anc_2.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686106.1"
                     /db_xref="GeneID:11531550"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="UniProtKB/TrEMBL:G8BV90"
                     /translation="MSEFINENPEILDDSQLPTRKNDANDLLLGISDSIANLERKNLL
                     LKIDNSVESEVLQNIELLDKLLALQPVPLLVSDADENESTDMEDDLEESDPIDRQEIF
                     DLIASISDPEHPLSLAQLAIVNLNNIEVIDSGKRDEIAHVIVRITPTITHCSLATLIG
                     LGIRVRLERSLPSRFRIVIILTKGSHQSENQVNKQLNDKERVAAACENPQLLGVVSNM
                     LSTCK"
     gene            complement(<432076..>432540)
                     /gene="TPHA0F01910"
                     /locus_tag="TPHA_0F01910"
                     /db_xref="GeneID:11535622"
     mRNA            complement(<432076..>432540)
                     /gene="TPHA0F01910"
                     /locus_tag="TPHA_0F01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686059.1"
                     /db_xref="GeneID:11535622"
     CDS             complement(432076..432540)
                     /gene="TPHA0F01910"
                     /locus_tag="TPHA_0F01910"
                     /inference="similar to DNA sequence:INSDC:YNL131W"
                     /note="similar to Saccharomyces cerevisiae TOM22
                     (YNL131W); ancestral locus Anc_2.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686107.1"
                     /db_xref="GeneID:11535622"
                     /db_xref="GOA:G8BV91"
                     /db_xref="InterPro:IPR005683"
                     /db_xref="UniProtKB/TrEMBL:G8BV91"
                     /translation="MVELTEIKEENANVEVDGQSQPIVEDSIVNVTNKQESGELSDDE
                     FDSDFDDDFNENETLLERLSALKDIVPPKQRNIVSNCYTKTTSIIKSIFAKTGSVTWA
                     LTTSALLLGVPLSLSILSEQQLIEMEKSFDLQKDANDILAQGDSQTNTNPLA"
     gene            <434625..>434969
                     /gene="TPHA0F01920"
                     /locus_tag="TPHA_0F01920"
                     /db_xref="GeneID:11535555"
     mRNA            <434625..>434969
                     /gene="TPHA0F01920"
                     /locus_tag="TPHA_0F01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686060.1"
                     /db_xref="GeneID:11535555"
     CDS             434625..434969
                     /gene="TPHA0F01920"
                     /locus_tag="TPHA_0F01920"
                     /inference="similar to DNA sequence:INSDC:YNL135C"
                     /note="similar to Saccharomyces cerevisiae FPR1 (YNL135C);
                     ancestral locus Anc_2.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686108.1"
                     /db_xref="GeneID:11535555"
                     /db_xref="GOA:G8BV92"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:G8BV92"
                     /translation="MSEVIEGNVKIDRITPGDGASFPKVGDLVTIHYTGTLENGQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDAAIPKLSVGEKARLTIPGPFAYGPRGFPGLIPPNA
                     TLIFDVELLKVN"
     gene            complement(<435235..>437037)
                     /gene="TPHA0F01930"
                     /locus_tag="TPHA_0F01930"
                     /db_xref="GeneID:11535351"
     mRNA            complement(<435235..>437037)
                     /gene="TPHA0F01930"
                     /locus_tag="TPHA_0F01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686061.1"
                     /db_xref="GeneID:11535351"
     CDS             complement(435235..437037)
                     /gene="TPHA0F01930"
                     /locus_tag="TPHA_0F01930"
                     /inference="similar to DNA sequence:INSDC:YNL136W"
                     /note="similar to Saccharomyces cerevisiae EAF7 (YNL136W);
                     ancestral locus Anc_2.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686109.1"
                     /db_xref="GeneID:11535351"
                     /db_xref="GOA:G8BV93"
                     /db_xref="InterPro:IPR012423"
                     /db_xref="UniProtKB/TrEMBL:G8BV93"
                     /translation="MVEWTIVDEIRFFRWVSEFKPAGETKDSNVSAIVERMNNPQKFP
                     VTLLQKDVVRNDKKFSADDIWNKLKQYYDITEMDKIENNKWGITYDNENDNIVKPVIA
                     NDSASTKSEREVILKQDQKESQLPWDEYGDLLVDNAQESNEVGINKESKDSVNDIEPA
                     RSTDVSNNQNEQSNITSEKVCNDKKEDKRIKDKTVSNDSVKLQDDTSEPLGSDDIEVP
                     VVKKENTNKQAEEEKQIEKDESNINKDFEGADIEKIETEAVEEEVVEEQSEEKEAGEK
                     VERKDTKIAEGEEVHTGTNEEVKGNTGNSEIEDEEISRKHEIESRNEDEVIPRVEPVT
                     NEEDKITSEEIESKEKELKDDKASENAQKESITNEEPSLLEGTLNENNEEKVKAKQNA
                     DVKMGSEDNNELANGEMDIEAVKRVNPIKGIDTSNIIATDGDNNTVEEKSIPHTRRSV
                     RVLRKERKHPVDENQTKAMDENSTEASKNTKDEKENDDEVKDSRDKSDNEKKNNTVSS
                     EETEEVTKNNKDVSSDNIAEELQDNVVADERPLAKRTRHAFTVDTNKTKEAVSEHDTI
                     AQEKSQKRKKGKVDQPPVASRSSTRVSARLRNKK"
     gene            <437533..>439053
                     /gene="TPHA0F01940"
                     /locus_tag="TPHA_0F01940"
                     /db_xref="GeneID:11535352"
     mRNA            <437533..>439053
                     /gene="TPHA0F01940"
                     /locus_tag="TPHA_0F01940"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_003686062.1"
                     /db_xref="GeneID:11535352"
     CDS             437533..439053
                     /gene="TPHA0F01940"
                     /locus_tag="TPHA_0F01940"
                     /inference="similar to DNA sequence:INSDC:YNL137C"
                     /note="similar to Saccharomyces cerevisiae NAM9 (YNL137C);
                     ancestral locus Anc_2.129"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_003686110.1"
                     /db_xref="GeneID:11535352"
                     /db_xref="GOA:G8BV94"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:G8BV94"
                     /translation="MPKKGTLLKSLSRGRVRASFNKYNLFNLYKKSQISFRTKTLYQQ
                     KWQAKQETRSYHGEHIREGRWQIMFQSKLDSVAQLDASLRGGKVEDTPYLLQTYAVLE
                     KRLDFALFRAMFASSIRQARQFILHGNVHVNGVRVKHPSFILKPGDVFNVKQEKVLQA
                     LGAKKPDLKKALNVDKRQIILHNKFVEFAKKNPKQAWKQRIEKIKQLSNDSVEKKEYL
                     TLVENYKKGLDAKELEELRNCTPEELLKNIIKTQPKQAPGLENDKAEKSDASTEAEKP
                     NESAGKVENLTDADFESIFERDVTLKNLATQCYQEFSNSKLFDFESIKAKSEEEISTL
                     VKDLLSPSDNIKKNLTDSQKVSMRTGKKHLSELEKKYSEAIRKYYKIAKNDSKSNELP
                     FDSNWINSLVAHEKLDFAKLADNEQLAQTSIKLPNQHHVWGRKRSSLPFFTPWKPRPF
                     LAPFAILPHHLEISFLTCHAVYLRNPVARPGHSEVISPFDTPLHERAYMFYNRKGK"
     gene            complement(<439303..>440856)
                     /gene="TPHA0F01950"
                     /locus_tag="TPHA_0F01950"
                     /db_xref="GeneID:11535347"
     mRNA            complement(<439303..>440856)
                     /gene="TPHA0F01950"
                     /locus_tag="TPHA_0F01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686063.1"
                     /db_xref="GeneID:11535347"
     CDS             complement(439303..440856)
                     /gene="TPHA0F01950"
                     /locus_tag="TPHA_0F01950"
                     /inference="similar to DNA sequence:INSDC:YNL138W"
                     /note="similar to Saccharomyces cerevisiae SRV2 (YNL138W);
                     ancestral locus Anc_2.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686111.1"
                     /db_xref="GeneID:11535347"
                     /db_xref="GOA:G8BV95"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR018106"
                     /db_xref="InterPro:IPR028417"
                     /db_xref="InterPro:IPR028419"
                     /db_xref="UniProtKB/TrEMBL:G8BV95"
                     /translation="MTESKGNVPTYNLVKLLKRLEDATARLEDVTLYQEGYVQSKIEA
                     LGKSTATDSPASKTISTPAAPSAATATPAPAAEEDVPHSIEYFEQLINDHVKPLTKLA
                     TEIDPVVQSATEEFEAAFVSQLEFLKAAVKSKKPDLTSPEFANALKPVSEKIMKIGEI
                     KDTNRQSKYFPHLNALAEGAPLFSWVTVGKPAPLVTDFKDAAQFWTNRVLKDFKASDP
                     KSVEWVKLFSNVFDQLKDYVKDFHNSGVSWASNGLDLSKALEGVSSSTPAPAAGGPPP
                     PPPPPPAAVFEINDTTAPKEEGGLDAVFAQLNQGTDITKGLKKVDKSQQTHKNPALRA
                     SSSVPVSAKTPPPKPSKPNTLKTKKPPRKELVGNKWFIENFENVPEPIVIETNKDESV
                     FIGKCTGTIVQLKGKLNAITISESDSSSVILDSAISGLEIIKCTKFGIQVEQSLPQIT
                     IDKSDGGSIYFSKESLNTELFTSSTTSVNVNYPVGEDDDYVEFPLPEQIKHSFGDNKL
                     QSSVFEHVG"
     gene            complement(<441566..>442216)
                     /gene="TPHA0F01960"
                     /locus_tag="TPHA_0F01960"
                     /db_xref="GeneID:11535564"
     mRNA            complement(<441566..>442216)
                     /gene="TPHA0F01960"
                     /locus_tag="TPHA_0F01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686064.1"
                     /db_xref="GeneID:11535564"
     CDS             complement(441566..442216)
                     /gene="TPHA0F01960"
                     /locus_tag="TPHA_0F01960"
                     /inference="similar to DNA sequence:INSDC:YHR128W"
                     /note="similar to Saccharomyces cerevisiae FUR1 (YHR128W);
                     ancestral locus Anc_2.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686112.1"
                     /db_xref="GeneID:11535564"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8BV96"
                     /translation="MSTEPFKNVILLPQTNQLLGLYTIIRDKRTSRPDFIFYSDRIIR
                     LLVEEGLNYLPVQAKSVDTETNEVFEGVSFMGKICGVSIVRAGESMEQGLRECCRSVR
                     IGKILIQRDEETALPKLFYEKLPEDISERFVFLLDPMLATGGSAIMATDVLIKRGVKP
                     ERIFFLNLICSKEGIDKYHEAFPDVKIVTGAVDRGLDENKYLIPGLGDFGDRYYCI"
     gene            <443642..>444037
                     /gene="TPHA0F01970"
                     /locus_tag="TPHA_0F01970"
                     /db_xref="GeneID:11535565"
     mRNA            <443642..>444037
                     /gene="TPHA0F01970"
                     /locus_tag="TPHA_0F01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686065.1"
                     /db_xref="GeneID:11535565"
     CDS             443642..444037
                     /gene="TPHA0F01970"
                     /locus_tag="TPHA_0F01970"
                     /inference="similar to DNA sequence:INSDC:YNL149C"
                     /note="similar to Saccharomyces cerevisiae PGA2 (YNL149C);
                     ancestral locus Anc_2.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686113.1"
                     /db_xref="GeneID:11535565"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="InterPro:IPR016809"
                     /db_xref="UniProtKB/TrEMBL:G8BV97"
                     /translation="MFEFVNELIAGFSYEKFMRLVIILGGYILIRNLAQRELAKRKLS
                     AQLRDDRKFKSEKNTEQYLEDPKEEEKKEKELEEAAASSFGWGNKTRLRVKKQQKSFE
                     KAVDRLQQQQQNALSIEDEDADIQELLED"
     gene            complement(<444261..>445349)
                     /gene="TPHA0F01980"
                     /locus_tag="TPHA_0F01980"
                     /db_xref="GeneID:11535359"
     mRNA            complement(<444261..>445349)
                     /gene="TPHA0F01980"
                     /locus_tag="TPHA_0F01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686066.1"
                     /db_xref="GeneID:11535359"
     CDS             complement(444261..445349)
                     /gene="TPHA0F01980"
                     /locus_tag="TPHA_0F01980"
                     /note="ancestral locus Anc_2.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686114.1"
                     /db_xref="GeneID:11535359"
                     /db_xref="UniProtKB/TrEMBL:G8BV98"
                     /translation="MIHQDGTLIIIIKNKLCHRELFNGGYYFVFKIGNKCVRFHTPDG
                     TFKFFITKEEYNKTIDLFIFKRERIRKRSPGDNKPLTGVNMIRQMVSRDTIDFLKLRP
                     TLKVATRIEWNSIEVDFINGEVALLLDIEFYPTLPLLPGKIREAHALSEGESSLKPPL
                     PSRYKKPLVNYTHVPEHRRSSSKPLNYVRSAFSLSHSLNKKEQKRYQLHNAGSTIMLE
                     TKENYSISDMKSDAGYIHGDSTFKSNTTDVNPVLIANYIRKNVQPHKNPDKLSLYTTP
                     REYLQSEYNRLLHNESIDFSHPFSIDNIRVTGYVGNGRWCDSALNDSSQYYYLMKYVT
                     AFPSPRLPPKCPINMLLEEYYLIDKKIT"
     gene            complement(<445960..>447348)
                     /gene="TPHA0F01990"
                     /locus_tag="TPHA_0F01990"
                     /db_xref="GeneID:11535615"
     mRNA            complement(<445960..>447348)
                     /gene="TPHA0F01990"
                     /locus_tag="TPHA_0F01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686067.1"
                     /db_xref="GeneID:11535615"
     CDS             complement(445960..447348)
                     /gene="TPHA0F01990"
                     /locus_tag="TPHA_0F01990"
                     /inference="similar to DNA sequence:INSDC:YNL152W"
                     /note="similar to Saccharomyces cerevisiae YNL152W;
                     ancestral locus Anc_2.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686115.1"
                     /db_xref="GeneID:11535615"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:G8BV99"
                     /translation="MLNQSIDNDQGMLTVFISKAKDLPNLNKLDKQDVTLRLRIAHMT
                     RESEIQRRAGQTPIFNYLEKFQMTPDVQRVMHIELYCERKKKAPLPIGRCEVDLVNGM
                     RADPKEGYCSWYELKREKNEFAGTIFIELTYTPILPRIHKSQDGHNTRRADASIAARP
                     IPPLPHETQYTRAFRQEDVQTPPYLISITIYFAINRSSSRSPERYMHASNLRHATPSA
                     FKNSNGSYYSSKSESVEVDEFINTERSNGSTNNNSISNFTSSVDTSTSMRSQESAGTT
                     STNTTDTRFHFANLRKLKEKINVFKNPLPSSELQNESNESPVDIEALQKAIGITSVES
                     DNSDDEYLHSTDHDSYGGSNNYQRPQGHTRVSTKGSNRFYSEKTNVPELPQVPTAGHA
                     SRSPTNNSYENFSSRSSSVLPTLPELNHERSPRHRTPSKIHSPEIPQLPNSPRSRQHS
                     QSPSRRPPPPNF"
     gene            <447794..>448166
                     /gene="TPHA0F02000"
                     /locus_tag="TPHA_0F02000"
                     /db_xref="GeneID:11535624"
     mRNA            join(<447794..447796,447915..>448166)
                     /gene="TPHA0F02000"
                     /locus_tag="TPHA_0F02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686068.1"
                     /db_xref="GeneID:11535624"
     CDS             join(447794..447796,447915..448166)
                     /gene="TPHA0F02000"
                     /locus_tag="TPHA_0F02000"
                     /inference="similar to DNA sequence:INSDC:YNL138W-A"
                     /note="similar to Saccharomyces cerevisiae YSF3
                     (YNL138W-A); ancestral locus Anc_2.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686116.1"
                     /db_xref="GeneID:11535624"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="UniProtKB/TrEMBL:G8BVA0"
                     /translation="MSEKIRQKQLFQVYKQKYVGLGNENTTIEEWQKNIQRDTYNSIV
                     GHSGLLEYVSLGMKSECKRDMKINLIKKMCQQKHRTLDEE"
     gene            complement(<448436..>449323)
                     /gene="TPHA0F02010"
                     /locus_tag="TPHA_0F02010"
                     /db_xref="GeneID:11535625"
     mRNA            complement(<448436..>449323)
                     /gene="TPHA0F02010"
                     /locus_tag="TPHA_0F02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686069.1"
                     /db_xref="GeneID:11535625"
     CDS             complement(448436..449323)
                     /gene="TPHA0F02010"
                     /locus_tag="TPHA_0F02010"
                     /inference="similar to DNA sequence:INSDC:YHR127W"
                     /note="similar to Saccharomyces cerevisiae YHR127W;
                     ancestral locus Anc_2.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686117.1"
                     /db_xref="GeneID:11535625"
                     /db_xref="UniProtKB/TrEMBL:G8BVA1"
                     /translation="MAIRTRKAQPSGRSAKRTTSVPKKASTLKLSERITANTSKAKKS
                     KNATTEKKDALGYLTMNGKLVNANDIGVKLRMAGKQPAASQDPKASPAKTKTKKATAV
                     TTASKRQAVTNSQQTRIKKSLNAIASKNLPGNARRSKNIITTTSSGRRTRTINPKSIR
                     QAITNNRTRVAEVIKKRVTKNTRNKDQYFKAGSNYNQLIINTDIDNSDKILIFYNLAL
                     GIKQDSLKQIIERLSGISIKKVRVKDLATGSSTAQVWLSNPNIPDLEKIRTQFDSALV
                     DGRTIQVLLSSESTRTLVY"
     gene            complement(<449921..>452890)
                     /gene="TPHA0F02020"
                     /locus_tag="TPHA_0F02020"
                     /db_xref="GeneID:11535657"
     mRNA            complement(<449921..>452890)
                     /gene="TPHA0F02020"
                     /locus_tag="TPHA_0F02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686070.1"
                     /db_xref="GeneID:11535657"
     CDS             complement(449921..452890)
                     /gene="TPHA0F02020"
                     /locus_tag="TPHA_0F02020"
                     /inference="similar to DNA sequence:INSDC:YHR131C,YNL144C"
                     /note="similar to Saccharomyces cerevisiae YHR131C and
                     YNL144C; ancestral locus Anc_2.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686118.1"
                     /db_xref="GeneID:11535657"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BVA2"
                     /translation="MTMLQNLRKNLNTSKKDKTQLCGKFEGINTTHGDHGHALNNKNG
                     TTLYRDIYFDEIDLGSMRAMPNKFDSSGTVSGSTSIMNLSLTTSNGSNGTNNNIRTVG
                     GNSNKEANYIFGEKLTKCITDDESDHQNYDLSKRKYFTDIPALENLEFYNHKEKGKRN
                     HRANDNQNLFDNHHSFIQDITNDKQTELLRYLEPCKGVYPPSYDEVNANKLVRFPIYE
                     HTLPCSASDMPPTYEATIDKLTIASVKFEWTSPFDKIKNPIWKNFIVELNSTQLNFYE
                     LDKTLTLDISNYTNNLPEHDENPNNNLTQGSSSISSASSTSSSSSKHGYFKFGNIFNT
                     TPKSTYVFNKRDRDRIVDTVSKHKPRYLNYKNLFKSYSLQFGKLGLPVDYPHMLNGLR
                     LRLEGEQCLLNFPTTDDVILWIMYLEVGISISLDLDLRQPPNYRIVPRRSRYENIHTD
                     NLSGNLGINENASINSLMTTSLGDATNNYNGTNRTFRSNSVSTTSSVVSYGESVRSQN
                     GRRFSNASISTETSNLLAPTISHNINLRNSSIGGLPINYANVPSNISNNTIHRDMLSL
                     EKTVSNNKGRNCLLKDSANTGSCYNSLTGRTSEDHNNNKNHNIGGKLKALFKATDEHL
                     PGEHNGNSKPSYPDNNLHVILTDYSNNETGLAQRTFNQNKIPPIRPHVRRYSNTIDPI
                     HNDIHTVSEFGLMSPLHEMSTNSSHASRLRAEPLSISEDFYDINEINMLSRETTNNSD
                     FTQGLYYTTTNPDNASLWRSRSHSIAGQEQHKASLSQSTIEHQRGFSDNNHLKCPTNA
                     INPNNPNNYTNSSLVSHDTRHTELANFNNESSLSEQNSVYSASEFSDKFIRTRSHSIS
                     STLSYLHNTEDYDDPSDMDKKWKPKGIYISRRKFIRDTLRCIKPLTDETRWVGKAVCR
                     CTDKPRNQYKLQEIQYGEVKSNNLFQTESNVVSKQHNEENEYDNNYRIKNHFLKLLIV
                     GKNNFKTNVSAVYKMNT"
     gene            complement(<454390..>455346)
                     /gene="TPHA0F02030"
                     /locus_tag="TPHA_0F02030"
                     /db_xref="GeneID:11535559"
     mRNA            complement(<454390..>455346)
                     /gene="TPHA0F02030"
                     /locus_tag="TPHA_0F02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686071.1"
                     /db_xref="GeneID:11535559"
     CDS             complement(454390..455346)
                     /gene="TPHA0F02030"
                     /locus_tag="TPHA_0F02030"
                     /inference="similar to DNA sequence:INSDC:YNL159C"
                     /note="similar to Saccharomyces cerevisiae ASI2 (YNL159C);
                     ancestral locus Anc_2.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686119.1"
                     /db_xref="GeneID:11535559"
                     /db_xref="UniProtKB/TrEMBL:G8BVA3"
                     /translation="MDEYTFNSDFEKSRSNTPNVDEHLINDNGNNDDELYEQFVRESN
                     ALRIREEAQETQQTQEEFQRELEDTIHDILRDIDSGLQNSSNTQHRIVITANTNNNEI
                     IELNNDNLHNVNNHPLNVHNRRSPFEGERRPFLRTFLRNLLVLDYFVILLLFPFSLYN
                     ILKSGFSIMTFSENDFVQEMLYYLSDVQVFSENYKSLLIYKEINLGLLGKFHNIMIYY
                     SSPLITTVMSFLKRHAHKVFTNKAINMNFKILIMNVYSKSIKMITLTMYFIYGFGGTI
                     YLLAAGFFFLLCFTISVVRRYKGVHRIISKSVESVSHLPGVF"
     gene            complement(<455738..>457102)
                     /gene="TPHA0F02040"
                     /locus_tag="TPHA_0F02040"
                     /db_xref="GeneID:11535586"
     mRNA            complement(<455738..>457102)
                     /gene="TPHA0F02040"
                     /locus_tag="TPHA_0F02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686072.1"
                     /db_xref="GeneID:11535586"
     CDS             complement(455738..457102)
                     /gene="TPHA0F02040"
                     /locus_tag="TPHA_0F02040"
                     /inference="similar to DNA sequence:INSDC:YHR132C"
                     /note="similar to Saccharomyces cerevisiae ECM14
                     (YHR132C); ancestral locus Anc_2.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686120.1"
                     /db_xref="GeneID:11535586"
                     /db_xref="GOA:G8BVA4"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="InterPro:IPR003146"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:G8BVA4"
                     /translation="MARRMIPLFYFLVSVVGLINVALASNDGVGKGVVGYDSYKVYRF
                     YKNNGTGDLIKDMVLPLTDDFNVWTHNKNFIDIMIAKEINLENAKGIENYNYEVMIED
                     VYTAISETVPKKNENRNNNDINHQQESFDVGKINMDNFFFKEYRDLETIYVWLDLLKR
                     SFPDLVNIETVGETFEGREMKAVHVSANNRTMNPNKKTVVITGGVHAREWVSISTACW
                     VLYQLLARYGVYRKDTKYLNALDFLIIPVFNPDGYKYSWTTDRLWRKNRQNTYWPNCY
                     GVDIDHSFDYNWVSNDNFPCSEDYSGEKPFEALEASSWNNYLNTTKGEYQIYGYIDLH
                     SYSQEILYPYAYSCEAVPRDLENLIELSYGLGKAMRNKNGKKYQVLSACQDRGSDLTP
                     GLGAGSALDYMYHHRAHWAFQLKLRDTGRHGFLLPSDQITPVGKETYAAIRYFCDFVL
                     NPDL"
     gene            <458479..>458892
                     /gene="TPHA0F02050"
                     /locus_tag="TPHA_0F02050"
                     /db_xref="GeneID:11535587"
     mRNA            <458479..>458892
                     /gene="TPHA0F02050"
                     /locus_tag="TPHA_0F02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686073.1"
                     /db_xref="GeneID:11535587"
     CDS             458479..458892
                     /gene="TPHA0F02050"
                     /locus_tag="TPHA_0F02050"
                     /inference="similar to DNA
                     sequence:INSDC:YHR132W-A,YNL157W"
                     /note="similar to Saccharomyces cerevisiae YHR132W-A and
                     YNL157W; ancestral locus Anc_2.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686121.1"
                     /db_xref="GeneID:11535587"
                     /db_xref="InterPro:IPR006760"
                     /db_xref="UniProtKB/TrEMBL:G8BVA5"
                     /translation="MNPTTFNDTGISPTNSSENLKNAEADGVPLSKLTPEELKLYKLY
                     GKLPSKRDLFKHNMQERKYFDSGDYALKKAGLLHKDDMNSNLNSTNTLPVTNPSGLRE
                     SIIRRRMSTSTGTDNDTVARQGSISSGPPPKSPNK"
     gene            complement(<459315..>460211)
                     /gene="TPHA0F02060"
                     /locus_tag="TPHA_0F02060"
                     /db_xref="GeneID:11535629"
     mRNA            complement(<459315..>460211)
                     /gene="TPHA0F02060"
                     /locus_tag="TPHA_0F02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686074.1"
                     /db_xref="GeneID:11535629"
     CDS             complement(459315..460211)
                     /gene="TPHA0F02060"
                     /locus_tag="TPHA_0F02060"
                     /inference="similar to DNA sequence:INSDC:YHR133C,YNL156C"
                     /note="similar to Saccharomyces cerevisiae NSG1 (YHR133C)
                     and NSG2 (YNL156C); ancestral locus Anc_2.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686122.1"
                     /db_xref="GeneID:11535629"
                     /db_xref="InterPro:IPR025929"
                     /db_xref="UniProtKB/TrEMBL:G8BVA6"
                     /translation="MAKKKSKNNSKNTPTGPDIPVGTSNSNINKLLNKTKGAIPRVES
                     FTNLTKPALFSIYDDDIIKIEDTINEEQKANDIEFTNHAKKDEEPYIPMINENIFLTE
                     KFKKKSLTGKIFHIIFVLSMLSLSGICYHDLSRNLHDKHLLHPDLAARPLLVLTEFTK
                     YISLGLVPDWACFSLEGIIFGLLIPFLYTILNVSPRAPSNSSVIRSINAMLGVIFGIR
                     RVEWSSSLQASGAWALLNVIMWLFFDGTLSMLLPCSGLGIISCIIGYQNIEDVSQALF
                     FMDFYFLGFMLFGKIGIYLLSF"
     gene            <461156..>462076
                     /gene="TPHA0F02070"
                     /locus_tag="TPHA_0F02070"
                     /db_xref="GeneID:11535495"
     mRNA            <461156..>462076
                     /gene="TPHA0F02070"
                     /locus_tag="TPHA_0F02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686075.1"
                     /db_xref="GeneID:11535495"
     CDS             461156..462076
                     /gene="TPHA0F02070"
                     /locus_tag="TPHA_0F02070"
                     /inference="similar to DNA sequence:INSDC:YHR134W"
                     /note="similar to Saccharomyces cerevisiae WSS1 (YHR134W);
                     ancestral locus Anc_2.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686123.1"
                     /db_xref="GeneID:11535495"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:G8BVA7"
                     /translation="MVVNGDLNKKRRRYKAEHQTRVKKNEVTIQHKNPHIERVAVLQR
                     NPDKEYALEILKDIAHRVSYLMKENKFAVKDLVEFYPKDKRLLGMNVNRGAKIMLRLR
                     SPYDEFQFLPRESIMGTMLHELTHNIFGPHDKNFYSKLDNLAARQWVIEQQNLYDHFV
                     GTGAKLGAPSMDFIGGSKNNRVNEKLVRTKRINNVNFTNGKVLGSYTNNGRRIDVVNT
                     KSAKEMAAIAAERRFKDNLSCGEGHSIDIEQPEQGELTEVYVLTDSESESEGTVTDQS
                     GKRSKEEQVEKNIKKPKKNDDADIEIIDLT"
     gene            <462707..>463003
                     /gene="TPHA0F02080"
                     /locus_tag="TPHA_0F02080"
                     /db_xref="GeneID:11535496"
     mRNA            <462707..>463003
                     /gene="TPHA0F02080"
                     /locus_tag="TPHA_0F02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686076.1"
                     /db_xref="GeneID:11535496"
     CDS             462707..463003
                     /gene="TPHA0F02080"
                     /locus_tag="TPHA_0F02080"
                     /inference="similar to DNA sequence:INSDC:YNL155W"
                     /note="similar to Saccharomyces cerevisiae YNL155W;
                     ancestral locus Anc_2.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686124.1"
                     /db_xref="GeneID:11535496"
                     /db_xref="GOA:G8BVA8"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:G8BVA8"
                     /translation="MSTIVERETGMLDVGSHCQFCRQIDFLPFHCSYCNNDFCASHRF
                     KDDHRCTWLLEEIRKEHLRKEQKPAEKKHSKKKHKMTFFETLLPEKGYIRVNHA"
     gene            <465913..>466995
                     /gene="TPHA0F02090"
                     /locus_tag="TPHA_0F02090"
                     /db_xref="GeneID:11535584"
     mRNA            <465913..>466995
                     /gene="TPHA0F02090"
                     /locus_tag="TPHA_0F02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686077.1"
                     /db_xref="GeneID:11535584"
     CDS             465913..466995
                     /gene="TPHA0F02090"
                     /locus_tag="TPHA_0F02090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686125.1"
                     /db_xref="GeneID:11535584"
                     /db_xref="GOA:G8BVA9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BVA9"
                     /translation="MSYPEQFQGIAVTDGKDWTHPKKISFPPKKFDDRDVDIEIEACG
                     VCGSDVHCAASHWGPVKDNQVVGHEIIGKVVKVGPKCNTGIKVGDRVGVGAQALACLD
                     CNRCKEDHENYCFGNIWTYGGPTYADGYIPQGGYASHIRVHEHFAIPIPENIPSELAA
                     PLLCGGVTVFAPLLNGGAGPGKKVGIVGIGGIGHMGILFGKAMGAEVYALSRTQSKKA
                     DSLKLGADHYIATVEDKNWSETYKDTFDLLVICSSSLSQLDIDELIKTMRIGGRIISI
                     CAPEIGEKIVLNPLGLLGVSIENSGIGSRKEILQLLDLVSKKNIKPWVETLQVGEAGV
                     NEAFERMEKGTARYRFTLTGFDKEFK"
     gene            <467440..>467742
                     /gene="TPHA0F02100"
                     /locus_tag="TPHA_0F02100"
                     /db_xref="GeneID:11535414"
     mRNA            <467440..>467742
                     /gene="TPHA0F02100"
                     /locus_tag="TPHA_0F02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686078.1"
                     /db_xref="GeneID:11535414"
     CDS             467440..467742
                     /gene="TPHA0F02100"
                     /locus_tag="TPHA_0F02100"
                     /inference="similar to DNA sequence:INSDC:YNL153C"
                     /note="similar to Saccharomyces cerevisiae GIM3 (YNL153C);
                     ancestral locus Anc_2.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686126.1"
                     /db_xref="GeneID:11535414"
                     /db_xref="GOA:G8BVB0"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="UniProtKB/TrEMBL:G8BVB0"
                     /translation="MRKDLIDEELSREKQEKDYLDDVSLEIELIDEDDKVSYKVGDLF
                     LSLKQSEVTELLEKDIEAIDAKIEELESKESEISSRIKDLKSLLYAKFGDNINLER"
     gene            complement(<468138..>468539)
                     /gene="TPHA0F02110"
                     /locus_tag="TPHA_0F02110"
                     /db_xref="GeneID:11535482"
     mRNA            complement(join(<468138..468403,468476..>468539))
                     /gene="TPHA0F02110"
                     /locus_tag="TPHA_0F02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686079.1"
                     /db_xref="GeneID:11535482"
     CDS             complement(join(468138..468403,468476..468539))
                     /gene="TPHA0F02110"
                     /locus_tag="TPHA_0F02110"
                     /inference="similar to DNA sequence:INSDC:YHR138C"
                     /note="similar to Saccharomyces cerevisiae YHR138C;
                     ancestral locus Anc_2.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686127.1"
                     /db_xref="GeneID:11535482"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:G8BVB1"
                     /translation="MRISHFTYTVIFSIFLLINGVCASSYILTFNEPSGDVIVPTSFM
                     DDLKSIIKEFGGKVTHEYTLIRGFTIDMSSSNISGLKSRLTTIGNEFGYSFNIEQDSD
                     VHAIANH"
     gene            complement(<468922..>470430)
                     /gene="TPHA0F02120"
                     /locus_tag="TPHA_0F02120"
                     /db_xref="GeneID:11535483"
     mRNA            complement(<468922..>470430)
                     /gene="TPHA0F02120"
                     /locus_tag="TPHA_0F02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686080.1"
                     /db_xref="GeneID:11535483"
     CDS             complement(468922..470430)
                     /gene="TPHA0F02120"
                     /locus_tag="TPHA_0F02120"
                     /inference="similar to DNA sequence:INSDC:YNL142W"
                     /note="similar to Saccharomyces cerevisiae MEP2 (YNL142W);
                     ancestral locus Anc_2.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686128.1"
                     /db_xref="GeneID:11535483"
                     /db_xref="GOA:G8BVB2"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:G8BVB2"
                     /translation="MSFNFTGTPTGSGTGGDSLTTDLNTQFDLGNMSWIGTCAAGVWL
                     MVPGIGLLYSGMSRKKHALSLLWASLMAVSVVIFQWFFWGYSLAFSHSTRGDGFIGTL
                     QFFGFRNVLGAPSAVTSVPDVLFAVFQGMFAAVTGALMLGGACERARLFPMMVFLFLW
                     MTIVYCPIACWTWNADGWLVKLGSLDYAGGGPVHIASGHGALIYALILGKRNDPVTSK
                     GMPKYKPHSVTSVVLGTVFLWFGWQFFNPGSAGNATIRAWYSAMSTNLAAASGGLTWM
                     FIDYFRHGRKWTTVGLCSGIIAGLVGITPAAGFVPIWSSFVIGVVTAVGCNFAADLKN
                     LIHIDDGLDVWALHGVGGCIGSVFTGFFAADYVNATAGSYGAPIPGGWINHHWKQVGY
                     QLAAMSSTIAWTCVVTAILLLILDRIPFLRLRLRPEEEELGTDEAEIGEFTYGEDTGY
                     IPEPIRSHASNIVPKPVSAIDDQIIPSSEQDSKHSTSDNSNYDEEKGNVTEK"
     gene            complement(<471956..>473155)
                     /gene="TPHA0F02130"
                     /locus_tag="TPHA_0F02130"
                     /db_xref="GeneID:11535517"
     mRNA            complement(<471956..>473155)
                     /gene="TPHA0F02130"
                     /locus_tag="TPHA_0F02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686081.1"
                     /db_xref="GeneID:11535517"
     CDS             complement(471956..473155)
                     /gene="TPHA0F02130"
                     /locus_tag="TPHA_0F02130"
                     /inference="similar to DNA sequence:INSDC:YHR139C,YNL160W"
                     /note="similar to Saccharomyces cerevisiae SPS100
                     (YHR139C) and YGP1 (YNL160W); ancestral locus Anc_2.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686129.1"
                     /db_xref="GeneID:11535517"
                     /db_xref="GOA:G8BVB3"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="UniProtKB/TrEMBL:G8BVB3"
                     /translation="MRQQILFGLFVLIVSVFANPLFFQKRQNETGGVLPPTASGNGIN
                     GTSGNGTAGNGTAGNGTAGNGTAGNGTGAGGSGQGSMKLKVIVTGGEVPIESLSQYPD
                     VEVTTLYNVTNTLNLTQLYNVAKETNSSISGGNYKGVVIIGNSYSIESLGFLNSVVIN
                     SMKPVVVTENVWDGLLVANNTDSIPGGTVVIDDLKLIYPGFFSPYIKDHDTIAGTGAP
                     IGVCYNKTGQVSWFFNDGTPEVLASNGTIRTMFTNFTNTEPSSIPVVPILYGAGDLSS
                     NWIQGISSNIQGLVIVDAGGDLLTNPSGYSNSTNSAGGSGSSSNSTSGSGSSSSSSSN
                     TTSINIPIVYSNDEFLGYWDASYLSSSSNVIFGNYLSPIKSKLLLSIAIANGVTSTDS
                     LNQVFPR"
     gene            <474005..>474715
                     /gene="TPHA0F02140"
                     /locus_tag="TPHA_0F02140"
                     /db_xref="GeneID:11535644"
     mRNA            <474005..>474715
                     /gene="TPHA0F02140"
                     /locus_tag="TPHA_0F02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686082.1"
                     /db_xref="GeneID:11535644"
     CDS             474005..474715
                     /gene="TPHA0F02140"
                     /locus_tag="TPHA_0F02140"
                     /inference="similar to DNA sequence:INSDC:YHR140W"
                     /note="similar to Saccharomyces cerevisiae YHR140W;
                     ancestral locus Anc_2.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686130.1"
                     /db_xref="GeneID:11535644"
                     /db_xref="GOA:G8BVB4"
                     /db_xref="InterPro:IPR006838"
                     /db_xref="UniProtKB/TrEMBL:G8BVB4"
                     /translation="MTVSRLPTIRSIIINSASVIILSWGLWTCTSIILPQSLASAGHK
                     QFLTNISVVASLLSNYSNIFNFFIQRYSNDKVFKNTTNFIARHICLPIALVLESIVVL
                     VYWPLKIFFYYLIYQGANDNSRTPIPLSVDFAIHLFPIIFLLSDHYLSGYGEYFSISK
                     IKAFILVTILGFSYNRWLYYLIDLNGGGAFPYPFLSVPEPFRTIIFISITTVGWLFYV
                     LYQKFPPSSRLTSHKKIN"
     gene            complement(<475516..>477768)
                     /gene="TPHA0F02150"
                     /locus_tag="TPHA_0F02150"
                     /db_xref="GeneID:11535537"
     mRNA            complement(<475516..>477768)
                     /gene="TPHA0F02150"
                     /locus_tag="TPHA_0F02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686083.1"
                     /db_xref="GeneID:11535537"
     CDS             complement(475516..477768)
                     /gene="TPHA0F02150"
                     /locus_tag="TPHA_0F02150"
                     /inference="similar to DNA sequence:INSDC:YNL161W"
                     /note="similar to Saccharomyces cerevisiae CBK1 (YNL161W);
                     ancestral locus Anc_2.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686131.1"
                     /db_xref="GeneID:11535537"
                     /db_xref="GOA:G8BVB5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BVB5"
                     /translation="MFNGQYNSQAGNEHEYYQQQQQQHMQRQQQQQQQQQQQDNADRY
                     QQLQRPPNATFSENYMRAQNSHQSLQSNLQNEQQQQQQQQQQQHTGGINAYHDNLSLD
                     FPSTPPPAQNGYIPNQHNSGRQNSNSSMQQPIAPQQLVYNSSEGSNHSTADLHSTNSF
                     AMLQQQQQQQAFSPGQYTAESEYGQHSPLYNSNNASASSPLAQPQQLYNDSHYQSSPI
                     TSILSSNSEKNTQNMQNQQIQYQDNILSPSRKQNQANINSSNYMYFERRPDLLTKSTQ
                     DKAAAVKLRIENFYQSSVKYAIERNQRRVELETELASHDWSDERKSRQLTSLGKKESQ
                     FLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKVDTGKIYAMKTLLKSEMYKKDQLAH
                     VKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRF
                     YIAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL
                     LQEDETTTHLDKPGQPNVTDNNRQSMFVDSINLTMSNRQQIQTWRKSRRLMAYSTVGT
                     PDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQF
                     PDDIHISYEAEDLIRRLLTHSDNRLGRHGGAAELKSHPFFSGVDWNAIRQVDAPYIPK
                     LSSITDTRFFPTDELENVPDSPAMAQAAMQREQMLKNGAVVQASAKEDLPFIGYTYSR
                     FDYLTRKNAL"
     gene            complement(<478671..>479526)
                     /gene="TPHA0F02160"
                     /locus_tag="TPHA_0F02160"
                     /db_xref="GeneID:11535538"
     mRNA            complement(join(<478671..478987,479523..>479526))
                     /gene="TPHA0F02160"
                     /locus_tag="TPHA_0F02160"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_003686084.1"
                     /db_xref="GeneID:11535538"
     CDS             complement(join(478671..478987,479523..479526))
                     /gene="TPHA0F02160"
                     /locus_tag="TPHA_0F02160"
                     /inference="similar to DNA sequence:INSDC:YHR141C,YNL162W"
                     /note="similar to Saccharomyces cerevisiae RPL42B
                     (YHR141C) and RPL42A (YNL162W); ancestral locus Anc_2.95"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_003686132.1"
                     /db_xref="GeneID:11535538"
                     /db_xref="GOA:G8BVB6"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:G8BVB6"
                     /translation="MVNVPKTRKTYCKGKSCRKHTQHKVTQYKAGKASLFAQGKRRYD
                     RKQAGFGGQTKPVFHKKAKTTKKVVLRLECVACKTKAQLTLKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            <481087..>482004
                     /gene="TPHA0F02170"
                     /locus_tag="TPHA_0F02170"
                     /db_xref="GeneID:11535536"
     mRNA            <481087..>482004
                     /gene="TPHA0F02170"
                     /locus_tag="TPHA_0F02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686085.1"
                     /db_xref="GeneID:11535536"
     CDS             481087..482004
                     /gene="TPHA0F02170"
                     /locus_tag="TPHA_0F02170"
                     /inference="similar to DNA sequence:INSDC:YHR142W"
                     /note="similar to Saccharomyces cerevisiae CHS7 (YHR142W);
                     ancestral locus Anc_2.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686133.1"
                     /db_xref="GeneID:11535536"
                     /db_xref="InterPro:IPR022057"
                     /db_xref="UniProtKB/TrEMBL:G8BVB7"
                     /translation="MGVTNFADLCSKTPLPLCSVVKSTRHFVLSNSTFIDDFAPQNLN
                     IGILPKCYSRSVELANTMIFNIGNAFINIGGLVVILIILFNMRQKYTAIGRLEYIYFY
                     QLVIAYLVFTLVVNCGVSPPGSNVYPYIVAIQLGFAGSCCWTLMINGLLAFNLWEDGT
                     TKSMLIVRGFSFVGFISNFLASVLTFRAWIDNRHIPSINTTGLFVVVYIINAILLFMY
                     VLCQLMVSFFIVSNLWVTGAIVLGVAFFICGQVLVYAFSVQICEGCKHYIDGLFFGSI
                     CNIFTLMMVYKIWDMTTDDDLEFSINIKS"
     gene            complement(<482073..>482327)
                     /gene="TPHA0F02180"
                     /locus_tag="TPHA_0F02180"
                     /db_xref="GeneID:11535451"
     mRNA            complement(<482073..>482327)
                     /gene="TPHA0F02180"
                     /locus_tag="TPHA_0F02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686086.1"
                     /db_xref="GeneID:11535451"
     CDS             complement(482073..482327)
                     /gene="TPHA0F02180"
                     /locus_tag="TPHA_0F02180"
                     /inference="similar to DNA sequence:INSDC:YNL162W-A"
                     /note="similar to Saccharomyces cerevisiae YNL162W-A;
                     ancestral locus Anc_2.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686134.1"
                     /db_xref="GeneID:11535451"
                     /db_xref="UniProtKB/TrEMBL:G8BVB8"
                     /translation="MSNNNESDIQKENDLQTNDEQAILNCPQCDSFLQKCLIQQNYAM
                     VLCPNRECLYPFNEVSSTDNLFYVEGSEMLNAATERLSTK"
     gene            <482660..>486016
                     /gene="TPHA0F02190"
                     /locus_tag="TPHA_0F02190"
                     /db_xref="GeneID:11535466"
     mRNA            <482660..>486016
                     /gene="TPHA0F02190"
                     /locus_tag="TPHA_0F02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686087.1"
                     /db_xref="GeneID:11535466"
     CDS             482660..486016
                     /gene="TPHA0F02190"
                     /locus_tag="TPHA_0F02190"
                     /inference="similar to DNA sequence:INSDC:YNL163C"
                     /note="similar to Saccharomyces cerevisiae RIA1 (YNL163C);
                     ancestral locus Anc_2.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686135.1"
                     /db_xref="GeneID:11535466"
                     /db_xref="GOA:G8BVB9"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BVB9"
                     /translation="MVKISPDTFKRLQNDPSCIRNICIVAHVDHGKTSLSDSLLASNG
                     IISQRLAGKVRFLDSRPDEQLRGITMESSAISLYFRVLHKQENSDKPLVNEHLINLID
                     SPGHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTITVLRQCWTEKLKPVLVLNKIDR
                     LITELQLSSQEAYLHLTKVIEQVNSVLGSFFIGQQQLDDFSWKEQLEDDANTAFKDSD
                     DSELYFDPAKNNVVFASAVDGWGFNIGQLAKFYEVKLGAKRENLQKVLWGDFYMDPNE
                     KILNNKTLKGRSLKPLFVSLILDNIWKVYENTVIERNMEVVEKITKALNITLQSRDLM
                     SKDDKILLRTILGQWLPVSTAILITVIEKLPSPLLSQEDRLDTILGANIDQEEVDATL
                     LEGMKKCDRNGPSIAYVSKILSIPREELPMKASDNSPEAILERGRRAREMAMRAAKRA
                     ELLEKTSNLHISDSDNTLKIKDSDLYERAVETATTPSTDEIQKTVTGQKKTANDSFSI
                     VTEAAPALDLGFEYEEENVEHENENSEDDFVPDFEPPVIDPNDPLASMFEYEEEEDPF
                     EISENNEINVALEEEDEEEDLFDEVDEVLVGFARIYSGSLRVGQSISVLGPKYNPKCP
                     TEHIHSAEITDLYLFMGKELVPLDVCPAGNIVGVGGLAGKLLKNGTLVDNSIPGINLA
                     GVNLQIQPIVKVAVEPKNPMQLNKLVRGLKLLELADPCVQTYLESSGEHILCTAGELH
                     LERCIKDLQERFAGIEIACSEPAIPYRETFISDSNTNPVKNANFERGTVEKAIGPYKL
                     RLRSVPMNNDAVKYIENNADIIKDFLTTDYIQNHEGETKLTKQDFITKLKSILKSGNS
                     EIDIWDNLESEIVLFGPKRIGNNILMSKNNLLNSPFLITDGAFEFSDSVINGFQNSVN
                     EGPLANEVVQGMCVIIEDIYKMSDEEIASIEDPTYQKENVDLSGRLINVTRDTIHTSF
                     LDWSARLMWAMYSCDIQTSVEVLGKVYAVVQQRRGKIVSEELKEGTPFFQIEAHIPVV
                     NAFGFSEDIRKKTSGAAQPQLVFLGYESIDIDPFWVPTTEKELEELGDTADKENLARK
                     HMIQIRKRKGLFVDEKVITNAEKQRTLKRN"
     gene            <486361..>487287
                     /gene="TPHA0F02200"
                     /locus_tag="TPHA_0F02200"
                     /db_xref="GeneID:11535467"
     mRNA            <486361..>487287
                     /gene="TPHA0F02200"
                     /locus_tag="TPHA_0F02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686088.1"
                     /db_xref="GeneID:11535467"
     CDS             486361..487287
                     /gene="TPHA0F02200"
                     /locus_tag="TPHA_0F02200"
                     /inference="similar to DNA sequence:INSDC:YNL164C"
                     /note="similar to Saccharomyces cerevisiae IBD2 (YNL164C);
                     ancestral locus Anc_2.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686136.1"
                     /db_xref="GeneID:11535467"
                     /db_xref="GOA:G8BVC0"
                     /db_xref="InterPro:IPR026231"
                     /db_xref="UniProtKB/TrEMBL:G8BVC0"
                     /translation="MANSNINDTSIELISQDGPLPMNIMMQEGVKALTKILSDHLQDG
                     TSFEDDSRSMQVVFKNMQGVINESTNDSESKKIIELENEDKSVSTEQFVIRNQQNKAD
                     SEEYVSDPDLHLNGDDGELVFDYGSEIITDNPEELGERLSQMIESVIPNGFPKDKGGM
                     LHAVLNGDELKITEEDSTNTTSYLDNYDTPNNIEGNYQRNINPSEHLDKVDASISHIH
                     KTHHNHGYDSYNNQSSNRVKYKNYNYHDYKYYPINEKKQSTPDFSVLLSNEAHLCMFC
                     EYYMVFGEPPKNMIKWYNKIHGYNCVSPHSKN"
     gene            <488585..>489310
                     /gene="TPHA0F02210"
                     /locus_tag="TPHA_0F02210"
                     /db_xref="GeneID:11535336"
     mRNA            <488585..>489310
                     /gene="TPHA0F02210"
                     /locus_tag="TPHA_0F02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686089.1"
                     /db_xref="GeneID:11535336"
     CDS             488585..489310
                     /gene="TPHA0F02210"
                     /locus_tag="TPHA_0F02210"
                     /inference="similar to DNA sequence:INSDC:YHR143W"
                     /note="similar to Saccharomyces cerevisiae DSE2 (YHR143W);
                     ancestral locus Anc_2.90"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686137.1"
                     /db_xref="GeneID:11535336"
                     /db_xref="InterPro:IPR026225"
                     /db_xref="UniProtKB/TrEMBL:G8BVC1"
                     /translation="MNSTNNFIITIFFTLLLSFTHAADDVRFFTSDGVVYSYAVVTST
                     IRPATVVVETLYYTTTRVHEVTLSNNVVTSVTEEITSASTSSATSFLATTTSSPTATT
                     IAAVQSSSIQLAPEEEFVASTVDAQTSSGRLTTTLMPVSSNEGESQQASTSSTSVISS
                     IQLLTVESATQQAVPSSTSSSSPTTSSVPSSTLESATVTSPASDVCDDLYYSTYYITS
                     SGESIDAATTITSTKTTYVTVNV"
     gene            complement(<489671..>490951)
                     /gene="TPHA0F02220"
                     /locus_tag="TPHA_0F02220"
                     /db_xref="GeneID:11535663"
     mRNA            complement(<489671..>490951)
                     /gene="TPHA0F02220"
                     /locus_tag="TPHA_0F02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686090.1"
                     /db_xref="GeneID:11535663"
     CDS             complement(489671..490951)
                     /gene="TPHA0F02220"
                     /locus_tag="TPHA_0F02220"
                     /inference="similar to DNA sequence:INSDC:YNL165W"
                     /note="similar to Saccharomyces cerevisiae YNL165W;
                     ancestral locus Anc_2.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686138.1"
                     /db_xref="GeneID:11535663"
                     /db_xref="UniProtKB/TrEMBL:G8BVC2"
                     /translation="MNRVRQLVSGSRRQSSRPVRSDEQSNNNNSDNNIENRTENYDQN
                     YDDQTTVMESDAFPSDSITLNTFVSEDQTIGDLQRQGYVNRAPTFTHYRVLPFVSIVL
                     KKGFFAFPSEESFSVYKNNKRKFDSIDCTQALGIPLYHSVSLNVMKSMFNRKHPITTI
                     YRYIIYDPNSSIIKLPNSAEFVAHLNLESDESERRDLYKIEFCTVHKEVTDSYRRVEH
                     IFTFFRYEQFENQQYSKKTESDTALSSDGEPKVYSYSMFNHTERRNSDTKVGGLNLQW
                     YGTTGFASPFGSSILKLLILDDNMASLCDQRTMEEYDNYRRHNRVRPLGYLPVWAKYS
                     DAGATIIPKKLTLKLATLEIGESDRCNSGDNTDIHQSSVGIYGIPWETEVLTCMAMVL
                     HEYESRKDKRHSSAISRGSLASSGLLLTSGFMVT"
     gene            <491480..>492799
                     /gene="TPHA0F02240"
                     /locus_tag="TPHA_0F02240"
                     /db_xref="GeneID:11535664"
     mRNA            <491480..>492799
                     /gene="TPHA0F02240"
                     /locus_tag="TPHA_0F02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686091.1"
                     /db_xref="GeneID:11535664"
     CDS             491480..492799
                     /gene="TPHA0F02240"
                     /locus_tag="TPHA_0F02240"
                     /inference="similar to DNA sequence:INSDC:YNL166C"
                     /note="similar to Saccharomyces cerevisiae BNI5 (YNL166C);
                     ancestral locus Anc_2.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686139.1"
                     /db_xref="GeneID:11535664"
                     /db_xref="UniProtKB/TrEMBL:G8BUB9"
                     /translation="MSTNKETIDDRFTKIENDLEQMNKLIDENLKVDDDKLAVEAMTD
                     IQEEAAHEKDVVKEKEQEEEAEVVKGSADEVENEKQEELTFVNDSNIRELNEMLEAEI
                     DSTSVTEETKVTAVIKETEDTAIPEKTISDTAKVTEHEAENDLKHDDENEEMLEDTTE
                     DIVTSHVESDTVDKPQKELEEAAKDTVDEGKIQEHPIEDTPELKGSKIDTALASSCQT
                     SPEPKETDFMIEHGVDKSTTNDGILDSSVEENTAVKKSSSPMENLSPIMLPKNTAPRE
                     FNDTEQSNNKSSLRRTTNPFRVISVGAAHSRTPSGASSRVASANISLGNESQENSRVS
                     SISSDGKAEHNVSNENSIDKLQSRHDYLIDKCSKLQKEINYLKKMSNQAMLSIEDTRK
                     LKNALEKLQEYLDKKTKEKYDTGVMLSRHLRKQINRGEQGQFWISNK"
     gene            <493337..>493549
                     /gene="TPHA0F02250"
                     /locus_tag="TPHA_0F02250"
                     /db_xref="GeneID:11535540"
     mRNA            <493337..>493549
                     /gene="TPHA0F02250"
                     /locus_tag="TPHA_0F02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686092.1"
                     /db_xref="GeneID:11535540"
     CDS             493337..493549
                     /gene="TPHA0F02250"
                     /locus_tag="TPHA_0F02250"
                     /inference="similar to DNA sequence:INSDC:YHR143W-A"
                     /note="similar to Saccharomyces cerevisiae RPC10
                     (YHR143W-A); ancestral locus Anc_2.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686140.1"
                     /db_xref="GeneID:11535540"
                     /db_xref="GOA:G8BUC0"
                     /db_xref="InterPro:IPR006591"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:G8BUC0"
                     /translation="MSREGFQIPTNLDAAAAGTSQARAATLKYICAECSSKLSLSRTD
                     PVRCKDCGHRILLKARTKRMVQFEAR"
     gene            <494304..>495098
                     /gene="TPHA0F02260"
                     /locus_tag="TPHA_0F02260"
                     /db_xref="GeneID:11535539"
     mRNA            <494304..>495098
                     /gene="TPHA0F02260"
                     /locus_tag="TPHA_0F02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686093.1"
                     /db_xref="GeneID:11535539"
     CDS             494304..495098
                     /gene="TPHA0F02260"
                     /locus_tag="TPHA_0F02260"
                     /inference="similar to DNA sequence:INSDC:YNL168C"
                     /note="similar to Saccharomyces cerevisiae YNL168C;
                     ancestral locus Anc_2.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686141.1"
                     /db_xref="GeneID:11535539"
                     /db_xref="GOA:G8BUC1"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:G8BUC1"
                     /translation="MSYQYLKAAPKVICIGRNFAAHIQELNSATPKQPFFFLKPKSAI
                     ITQFSKHLPKEDQLRISGDESFHGLNENGTNPGHILLPNGTEVHHEIEVALVMNKYLS
                     NVSEANFKASDVYDSISGIALALDLTARNVQAEAKKKGLPWSIPKGFDTFLPMSQFIN
                     KDILTAHKDNLQDVFNLKCSVNGELRQNASSDLMLVTFHKIIQHISTKITLEPGDIIL
                     TGTPAGVGQLNPGDHISGELFYNGKKIINMEFDCLQRPGPFVYRET"
     gene            complement(<495236..>496192)
                     /gene="TPHA0F02270"
                     /locus_tag="TPHA_0F02270"
                     /db_xref="GeneID:11535603"
     mRNA            complement(<495236..>496192)
                     /gene="TPHA0F02270"
                     /locus_tag="TPHA_0F02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686094.1"
                     /db_xref="GeneID:11535603"
     CDS             complement(495236..496192)
                     /gene="TPHA0F02270"
                     /locus_tag="TPHA_0F02270"
                     /inference="similar to DNA sequence:INSDC:YHR144C"
                     /note="similar to Saccharomyces cerevisiae DCD1 (YHR144C);
                     ancestral locus Anc_2.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686142.1"
                     /db_xref="GeneID:11535603"
                     /db_xref="GOA:G8BUC2"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:G8BUC2"
                     /translation="MLVAVSGSGFECVELILNWLMKQHDFEVIDNSKKDDDILDYATK
                     NYTSNMVVHCEKLSLLDLLSKRPFFVHMSVEGTTALKLKFNNFYNKENKSDTMSMQEA
                     LDAISNINETKHSILLSENAHFKFKLVTDDDVDTLNEKLRKAISQILNEIELKNSASE
                     LSPPLRPNWDEYFMKLATLAASRANCMKRRVGCVIVRDRRVIATGYNGTPRHLTNCFN
                     GGCPRCNDGNSGNLHTCLCLHAEENALLEAGRDRIGSNATLYCDTCPCLTCSVKIVQT
                     GITEVVYSQSYNMDEDSFRVLKSGGVKIRKFNLIQEPRIIFI"
     gene            <496712..>498148
                     /gene="TPHA0F02280"
                     /locus_tag="TPHA_0F02280"
                     /db_xref="GeneID:11535604"
     mRNA            <496712..>498148
                     /gene="TPHA0F02280"
                     /locus_tag="TPHA_0F02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686095.1"
                     /db_xref="GeneID:11535604"
     CDS             496712..498148
                     /gene="TPHA0F02280"
                     /locus_tag="TPHA_0F02280"
                     /inference="similar to DNA sequence:INSDC:YNL169C"
                     /note="similar to Saccharomyces cerevisiae PSD1 (YNL169C);
                     ancestral locus Anc_2.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686143.1"
                     /db_xref="GeneID:11535604"
                     /db_xref="GOA:G8BUC3"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:G8BUC3"
                     /translation="MLGTKKLVLKAIIHNGRQPLHNGTTLNNGLRLFNDVHQAPLLLR
                     RLLSSTRQNFNKPNSETNGSGNKNQPKKRKISKIKILFISGFALGITATIIENRRHKD
                     NETVIKSKDINITSNSWFLFIYSTLPLNAISRIWGHFNNLTLPEWSRTYGFKLYSYLF
                     GVNLEEMADPNLSHYSNLAEFFYRDIKKESRPIALNPNAVASPSDGKILKLGIINKET
                     GDVDQIKGMSYSVKELLGTHSSSNTRVVKYTSDKIYENDTQDIPLVDTSDMKYQIKGN
                     LAVEKKKSSITESINFLHELSSNYITRGTHKSNVDDSQIYYAVIYLAPGDYHHFHSPV
                     NWVCQLRRHFPGALFSVSPFFQRNFHNLFVLNERVALLGYWKYGFFSMTPVGATNVGS
                     ITINFDKELVTNSKINKKSKEPICYESNYSNASKILAGIPLVKGEDMGGFKLGSTVVI
                     CFEAPRTFSYNVQEGDTVKMGQSLGSIN"
     gene            complement(<498306..>503381)
                     /gene="TPHA0F02290"
                     /locus_tag="TPHA_0F02290"
                     /db_xref="GeneID:11535623"
     mRNA            complement(<498306..>503381)
                     /gene="TPHA0F02290"
                     /locus_tag="TPHA_0F02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686096.1"
                     /db_xref="GeneID:11535623"
     CDS             complement(498306..503381)
                     /gene="TPHA0F02290"
                     /locus_tag="TPHA_0F02290"
                     /inference="similar to DNA sequence:INSDC:YNL172W"
                     /note="similar to Saccharomyces cerevisiae APC1 (YNL172W);
                     ancestral locus Anc_2.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686144.1"
                     /db_xref="GeneID:11535623"
                     /db_xref="GOA:G8BUC4"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:G8BUC4"
                     /translation="MYARDCLQKQYYNDTNTSPPNDRGEVWISPSRLVVEWYMKDVLI
                     RRFNFTQQVIKAGLIDFADSKNCIVIIVSDLAHVYDLKDGNSKSVSFPFPIITAFWYH
                     YGVVLQKQDNDVLSQVNCDNTNIISKNIDGSESNLNKYITLTDPMCPFGLITFTTNDA
                     FNNILDPNDIDLILTPQDLENKISVAYDRNSKEVVFFYSKVLDAKQSDIPLSNNMDRL
                     YNQNYNAQHTGISSTLKRQTSTSRRQLSTYLSKTEDAPHSKLLINNNNNNNNDNNNHV
                     NAHLGKYKQNFALDSPVILPNNAHRSLSATFDRMTNINNPPSIDFAPSTGSHLQPEYL
                     SQDISLKDTILTKISSLQLPNNIIDDKKNTQFIPLKFEDMEAIVIFNQKYQYMKLWLI
                     KLDSKFLDSIQFKIPELHVDKSINFIDIHMDHPVDSILPYHNNNIPGSIILTYDHESI
                     ITIYNPFLNNVWSSIKTDMHSIPKLSTLCYISSEEMIFDKFQFPNNEKQNFNTQSLFP
                     YPQKSSVKACFSALQLIFPIDIFIAFVFLWQEIYFHISTDKTYKTQNLEFDAFFMIYK
                     ILLEQDSMVTTHNYLSSNSLQYLGNSDISTILPNSILGLHLVREEQNLNILYKKDVDN
                     LADLLHLATKALNWPSTWNQYYLSTLNLPTVKVLDKYTSFPLDEPPSIFKSIFSITDG
                     SYLPITPFINFSRLIERGHEYDEIITPRTYKLLHLFESLHNNNFNSDNILNLLNELNI
                     TKEELETYPLGIMTPLNYMLKNLENNLSSIEGTMDVSILSRNDLKQCRSIINSILNKQ
                     TTRPVAAITHDSKMSIYSCTGNENSKNIKTLLTDIVTTATENNSKNLLLDNNGDDKET
                     DYGISSQENTNLIFSHDRRFNNALSLLLYYKPHAIPFYSKQSEYIKIINQKKIFAQIV
                     FLRTCVAGIGLGAIVYASEKPLSTQKWVIPKLNFVSLFSDGTKVSLESSEVNKDALMW
                     GEFHAGVSSGLRIFKKVNNINGSWISFNKPKELDSQHGGFLLGLGLNGHLKNLEEWHV
                     YNYLSPKNTHISIGLLLGMSVSMRGTMDVKLVKVFTVHVVALLPQRSNDLNINIEVQT
                     AGLVGIGFLYLKTNNTKMSGLLLSQITSNININDENKPNEGYRIAAGIAYGLVNLNAD
                     VESNKHSKDKNISINEQYDSKSKLEVTHQLLKLITSTYEKEPSWIPQNSHTGAIVALM
                     FIHLRSNDADIAMTLKPYSNKSNLRPEYLLYVEWAYYMIMWDEIEDNIGFIFQDLEIK
                     LHSTINSDNMQTYSIISGRILAMGIKYASTGDLNIKRILLKILDKFLPFYQYPGSTKV
                     DFKLSISTINVLINTILVTLGLIMCGTGDLQVFQRIKYLHETITGKHADLFYSSKKDH
                     KDKEVDNDIFDITATLNTNDEVQDVHQETANGSSSENTSEKERFKDDENHYSKYMCTS
                     LSLGFLFLASGQYAINISDNESIAYLIMSLLPTFYKPYYLQELRHFWSLSVEPRCLVI
                     KDIESNLLIKDPVIEIDILTENNDIRRIKKNIIPCLLPDPRKITMIKVEHPSYYPLQL
                     NFDENVTVTEFLNDGLVIKLQKKDQQNELNVMSSNIKSENLVSDINERIYDDSEMDNK
                     QSLPTKVSHILEKNLNIINLTMSELSSSLNDIEKKDEVSQMFNFEIMYSDLYSDDIVD
                     FELEIWRKRQETLTQTKLSQDNT"
     gene            complement(503630..503738)
                     /gene="TPHA0Ftrna3P"
                     /locus_tag="TPHA_0Ftrna3P"
                     /db_xref="GeneID:11535346"
     tRNA            complement(join(503630..503666,503702..503738))
                     /gene="TPHA0Ftrna3P"
                     /locus_tag="TPHA_0Ftrna3P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:11535346"
     gene            <505566..>506687
                     /gene="TPHA0F02300"
                     /locus_tag="TPHA_0F02300"
                     /db_xref="GeneID:11535382"
     mRNA            <505566..>506687
                     /gene="TPHA0F02300"
                     /locus_tag="TPHA_0F02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686097.1"
                     /db_xref="GeneID:11535382"
     CDS             505566..506687
                     /gene="TPHA0F02300"
                     /locus_tag="TPHA_0F02300"
                     /inference="similar to DNA sequence:INSDC:YHR146W,YNL173C"
                     /note="similar to Saccharomyces cerevisiae CRP1 (YHR146W)
                     and MDG1 (YNL173C); ancestral locus Anc_2.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686145.1"
                     /db_xref="GeneID:11535382"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8BUC5"
                     /translation="MSLQYKFSWPAGPGSVVITGAFDEWKGTLPLVKQSDGDFEITMP
                     VSFKDEDDSKFYFKFIVDEKWVTSDKYAKELDVEKKVENNYIVKSDVVNAATAQGAAI
                     PEAGALVAGASEQTASANKKKNKKKKNKKKNKKKKNAAAATAAVAAEGEAAGETEETS
                     DDVTEASKSATPATELEVENESENIVNILPVIETQAATTVAGEMGPVIVENPEEIKEF
                     REISDVDANELNERLNKENAKAIEEPVVEEAVAEEPKVEEPVVEEPVIEQPNVEEPVV
                     EEPVVEEPVAEEPVVEEPVAEEPKVEEPVVEEQTKEGATLDPKAQTESVAKETEKKEK
                     TKPVESVKKITKQVESAKPTEAEKPKKKGFFSKLKKLFG"
     gene            <507306..>508508
                     /gene="TPHA0F02310"
                     /locus_tag="TPHA_0F02310"
                     /db_xref="GeneID:11535654"
     mRNA            <507306..>508508
                     /gene="TPHA0F02310"
                     /locus_tag="TPHA_0F02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686098.1"
                     /db_xref="GeneID:11535654"
     CDS             507306..508508
                     /gene="TPHA0F02310"
                     /locus_tag="TPHA_0F02310"
                     /inference="similar to DNA sequence:INSDC:YNL175C"
                     /note="similar to Saccharomyces cerevisiae NOP13
                     (YNL175C); ancestral locus Anc_2.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686146.1"
                     /db_xref="GeneID:11535654"
                     /db_xref="GOA:G8BUC6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BUC6"
                     /translation="MSDVEKKDEGIVEEVNVDDSNVEVKSSEQKIKEALTDPTKKRKA
                     EDEIEIDINKSIPLSKKQKRLLRRGKITLEDLNAKFNIDPSAIEAYKKEAEGKGTSSE
                     INDAEGSKSEKEEKKAKKFGVWMGNMAFDTTKEDIIKYLVLKTKTLEGPSQITETDMV
                     RFNMPLAKSDGKKIKNKGFCYIDFKTLEQMESAIALSETELNGRKLLIKSSTDYAGRP
                     DKSDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGF
                     AFVDFKNEEGATKALSDKSCRKIAGRPLRMEFGEDRSKRVVKRKEQPASKREAFDIPT
                     QTRSEYSSSNTTSEAAPASATKKPFKKFNNRQHIDKNNRVKSSIALSSAQRGSVAIVQ
                     STGKKTTF"
     gene            <509490..>511016
                     /gene="TPHA0F02320"
                     /locus_tag="TPHA_0F02320"
                     /db_xref="GeneID:11535521"
     mRNA            <509490..>511016
                     /gene="TPHA0F02320"
                     /locus_tag="TPHA_0F02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686099.1"
                     /db_xref="GeneID:11535521"
     CDS             509490..511016
                     /gene="TPHA0F02320"
                     /locus_tag="TPHA_0F02320"
                     /inference="similar to DNA sequence:INSDC:YDL211C,YNL176C"
                     /note="similar to Saccharomyces cerevisiae YDL211C and
                     YNL176C; ancestral locus Anc_2.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686147.1"
                     /db_xref="GeneID:11535521"
                     /db_xref="UniProtKB/TrEMBL:G8BUC7"
                     /translation="MVLFSMTNKTSSVFPDSLTALSFDTVLYPTTSTQISYSSSSGSA
                     TEEITSHSFSSTTDIISESNTSLALDSNLYRTSSGDSSINAFQNSSATDLETHFTTSP
                     IHNLTISSHVSSDTSTVAGLVSSSSIESFNQTTSKSFNHITTITPSIYVQSFRHATTS
                     KLSSSTPSTLISTISSTSVYPSSSYSSEYSNYSTASPASISRYSLWSSDLESSTLFTS
                     TASSSNSEYSISTNSSKLYLIYTQTYVVTGSSIAFTTDILMTTRINPTKFQQNGTPTY
                     TYGSNTITTNLAYYNNLVTGKTTSTSSKNGKIAGGVIGALLGFIIICIVTLVNFRRKS
                     NKSNQLFLNKNNKRTKMYHTNGRKVNYDEEMVNNNYEIPRDVPEDVSNPFTDKTRTIA
                     TSPSTHAFQKEFNFENRKAPEIPRPRKIFNDDIVINDHDINGNVQFPSSVPFADNNTN
                     SNIVRISSTDSSIQSSDLSSSDITGSTITIDPFVSSAPHYPGNHSNSINDDGYLKEIF
                     "
     gene            <513129..>514112
                     /gene="TPHA0F02330"
                     /locus_tag="TPHA_0F02330"
                     /db_xref="GeneID:11535672"
     mRNA            <513129..>514112
                     /gene="TPHA0F02330"
                     /locus_tag="TPHA_0F02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686100.1"
                     /db_xref="GeneID:11535672"
     CDS             513129..514112
                     /gene="TPHA0F02330"
                     /locus_tag="TPHA_0F02330"
                     /inference="similar to DNA sequence:INSDC:YNL180C"
                     /note="similar to Saccharomyces cerevisiae RHO5 (YNL180C);
                     ancestral locus Anc_2.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686148.1"
                     /db_xref="GeneID:11535672"
                     /db_xref="GOA:G8BUC8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUC8"
                     /translation="MKSVKCVVIGDGGVGKSSLLISYTTNTFPQDYVPTVFDNYSTTV
                     AINDTDSGEDESDTQLFKLNLWDTAGQEEYDTLRPLSYPQTDIFLICFSVEDQAAFSN
                     ARSKWYNEVLGTINLKNSAIYKVKNKYPILLVGTKSDLRENEATREALEKSNSSFITK
                     EEIDGFINDTNILGYVECSAATQTGVSNVFETAVRHNILKVPGLDESLNGDQSSNENK
                     SSIKDINPTKTELDTVIESSHENTSTKSQKSVTENIPNDRQYKSSELVKKESEVKSNN
                     NVRKDSNDKKVTTPKSSTYKKTVVKNKITAKLKKVPTTKQAPDKNKNCIIV"
     gene            <514640..>515314
                     /gene="TPHA0F02340"
                     /locus_tag="TPHA_0F02340"
                     /db_xref="GeneID:11535444"
     mRNA            <514640..>515314
                     /gene="TPHA0F02340"
                     /locus_tag="TPHA_0F02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686101.1"
                     /db_xref="GeneID:11535444"
     CDS             514640..515314
                     /gene="TPHA0F02340"
                     /locus_tag="TPHA_0F02340"
                     /inference="similar to DNA sequence:INSDC:YDL213C"
                     /note="similar to Saccharomyces cerevisiae NOP6 (YDL213C);
                     ancestral locus Anc_2.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686149.1"
                     /db_xref="GeneID:11535444"
                     /db_xref="GOA:G8BUC9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BUC9"
                     /translation="MAEEETKKQLTKKQLKALESRKSKKDREKTKELKRSVADEPAPR
                     TNADGEPAKKKRKTRRGHGGKGKSGSQSKNRFIIFVGSLPKDITATELQTHFKSSSPD
                     FIRLRSDKGIAFLEFDTEKDLSNIQRRMDVALLQHRTTIRDKTINVELTVGGGGNSKD
                     RLEKLQKKNEKLDVERQERVRKMIKDSAKKAESKNTSNNNNSSSNENAPKTTNGIHPD
                     RLKLIK"
     gene            <516707..>520042
                     /gene="TPHA0F02350"
                     /locus_tag="TPHA_0F02350"
                     /db_xref="GeneID:11535445"
     mRNA            <516707..>520042
                     /gene="TPHA0F02350"
                     /locus_tag="TPHA_0F02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686102.1"
                     /db_xref="GeneID:11535445"
     CDS             516707..520042
                     /gene="TPHA0F02350"
                     /locus_tag="TPHA_0F02350"
                     /inference="similar to DNA sequence:INSDC:YDL215C"
                     /note="similar to Saccharomyces cerevisiae GDH2 (YDL215C);
                     ancestral locus Anc_2.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686150.1"
                     /db_xref="GeneID:11535445"
                     /db_xref="GOA:G8BUD0"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:G8BUD0"
                     /translation="MFLVSDVNNSKIPDISALSISSISDYHVFDFPGKDLQREQVIDL
                     IDQQGFIPDDLIEQEVDWFYNSLGIDDLFFARETPELLSSIIHSLYASKLDSFTKLSC
                     KTSDGSNLTRPNKSIRDLFKIKNKILTKDNHAIFMETSNLQITRSNERLIGNLENKAS
                     SLDSTIENAYNKNTLGSFGSNSLNIIGDETENVPYHLDGQIDELYLDNNSSLGTRSVS
                     FWTPQSGLKLTFVYNCNFDGTTEKNITSEQLLNGDIDSISDKTMTQVSSLETKNYTVI
                     LIKLVKEREGPVIKTVNSSENNDEIRLLIAFKRFTTKNYYEAISTLFHYYRLSPSKFY
                     LETFKLSNDVNNNSDNIVIFSIYLNRSQQLEDLSLGNNIELSLKQIEREASLLYAIPN
                     NSFDKLYEQRLFSPQEAVYAHVSANFINHFINRLGSDYQSLIAELNVKESNIILLELV
                     ENLKRKLRTETFTLQMIISSLEKYYMIVSKLYKTFAEVHYRRDEQSLKETLSFQRLER
                     LEPFKNDQEFESYLNKFIPNDSPALLILKTLNIFNKSILKTNFFVTRKVALSFRLDPK
                     LIMPVSEYSETPYGIFYVIGNTFKGFHIRFREISRGGIRIVTSKNADIYESNTRNVID
                     ENYQLALTQQCKNKDIPEGGSKGVILLSPGLTSSDQTFNAFSQYVDAIIDILIKDPLK
                     ETYVDLLGYEEILFFGPDEGTAGYVDWATQHARLRGCPWWKSFLTGKSASLGGIPHDE
                     YGMTSLGVRAYVNALYRTLNLENTTIRKFQTGGPDGDLGSNEILLSTNNELYVAIVDG
                     SGVLCDSNGLDSLELIKLANSRSTVSNYDMKKLSNMGFFVSVDDMDIMIPNSTIVANG
                     TTFRNTFHTQIFKFVDKIDLFVPCGGRPNSINLNNLHYFIDDKTNKSRIPYIIEGANL
                     FINKAAEIALDAHGCLLFKDMSVNKGGVTSSSLEVLASLSLNEEDFSQQFIGNSDEKS
                     PLYKGYICEVQSRIQDSAEKEFKLLWDLKRKTNKPTAKLSDLISQTINKLNDDLIDSN
                     ELWMNDIKLRDYLLFKKIIPSLLTEVAGEADILKNIPVPYLKALLSSYLSSSFVYKFG
                     VEVDIGNFLEYIGMLKREALESN"
     gene            <520386..>521684
                     /gene="TPHA0F02360"
                     /locus_tag="TPHA_0F02360"
                     /db_xref="GeneID:11535390"
     mRNA            <520386..>521684
                     /gene="TPHA0F02360"
                     /locus_tag="TPHA_0F02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686103.1"
                     /db_xref="GeneID:11535390"
     CDS             520386..521684
                     /gene="TPHA0F02360"
                     /locus_tag="TPHA_0F02360"
                     /inference="similar to DNA sequence:INSDC:YDL216C"
                     /note="similar to Saccharomyces cerevisiae RRI1 (YDL216C);
                     ancestral locus Anc_2.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686151.1"
                     /db_xref="GeneID:11535390"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:G8BUD1"
                     /translation="MSLENIQFSELDEAIRSHYDQKCDDNGKHNKNKHAELPNQEYLE
                     TSRSIYETSHRLESNFDNSESWGNNPNYFNQVLLSKLAACKMLNHGHRGEDIEVMGIL
                     VGTTIENNIVIHDTFEIPVEGTETRVNAQMESYEYMVQYAEEVIENNEKQSTIVGWYH
                     THPGYGCWLSNVDIQTQKLNQSYQDPYVAVVLDPHKSSKEGIIELGAFRTKPSPLNKT
                     IDTFYELPIKIFDSELNYSLAYNHLSYKCPQIDLNLSSILYSQLLESLKHNISLSKSS
                     KSKTLKISQDQLNNMNNDNIKTNMAMYRTVSSTSLTSTNSGRNTSDIDMIRNDIADSG
                     SMTSSINQYKEFGSTRSDSVHCLANESMFHSSNNPFKESLLRDASSNLVPNTLSFDIE
                     SEGIHTGNLKREFEQKKDMLLGLKLQEYRNLKLYHDIFSL"
     gene            complement(<521679..>522962)
                     /gene="TPHA0F02370"
                     /locus_tag="TPHA_0F02370"
                     /db_xref="GeneID:11535461"
     mRNA            complement(<521679..>522962)
                     /gene="TPHA0F02370"
                     /locus_tag="TPHA_0F02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686104.1"
                     /db_xref="GeneID:11535461"
     CDS             complement(521679..522962)
                     /gene="TPHA0F02370"
                     /locus_tag="TPHA_0F02370"
                     /inference="similar to DNA sequence:INSDC:YNL187W"
                     /note="similar to Saccharomyces cerevisiae YNL187W;
                     ancestral locus Anc_2.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686152.1"
                     /db_xref="GeneID:11535461"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BUD2"
                     /translation="MDQFHNILLQCSTKTIFEGSNLVTTWNKEKEIWRNTTRSSNYKY
                     PELSDPKLDTEKASKLRKPNICQDLYWAADGTSIVAVNSDYGIRQYLIPENSSDQHFN
                     QQMVPFTRFFRFSSTVSSAVNPKYSLFNNTDTNIILLSSKDLPLQAYSLNDELDSTST
                     KPLLSYNVTNDKNEKYETAYSIKFISQKQFLTGSIKNKISLYDASYKEPIWTSRLTNR
                     IIGKSSHKSIVSCFSEYPFLDNTRSVFHFGTYKNEIGLIDTRSEQINIKYRSKEGNGV
                     YQILMSENEHYLYSIKRNSNSIDILDTRMNCSIINELRLPFTTDNQKMKGNICSQNGM
                     LLGSLNGNLIQWGKDMIEFGGIMSRNIDELPGPEFTQHLTDYNDLRINLVVSNPIETD
                     QLAISYSPDKFKGNGENSANTQKHFSSGISLYNCS"
     gene            complement(<523459..>525090)
                     /gene="TPHA0F02380"
                     /locus_tag="TPHA_0F02380"
                     /db_xref="GeneID:11535462"
     mRNA            complement(<523459..>525090)
                     /gene="TPHA0F02380"
                     /locus_tag="TPHA_0F02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686105.1"
                     /db_xref="GeneID:11535462"
     CDS             complement(523459..525090)
                     /gene="TPHA0F02380"
                     /locus_tag="TPHA_0F02380"
                     /inference="similar to DNA sequence:INSDC:YNL189W"
                     /note="similar to Saccharomyces cerevisiae SRP1 (YNL189W);
                     ancestral locus Anc_2.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686153.1"
                     /db_xref="GeneID:11535462"
                     /db_xref="GOA:G8BUD3"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:G8BUD3"
                     /translation="MNEEDSTNKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKA
                     KRDEALAKRRNFNAAGASHADASDSEDEDDVSAADKQFYDQLQVELPQMIKQIQSNDM
                     QEQLNATVKFRQILSRENNPPIELVIQSGVVPTLINFMNENQPEMLQLEAAWALTNIA
                     SGSSSQTQVVVEAGAVPLFIQLLYTGTVEVQEQAIWALGNVAGDSTQYRDHVLQSGAM
                     DPILGLFNTNKTSLIRTATWTLSNLCRGKKPQPDWTIVSKALPTLAKLIYSLDTETLI
                     DACWAISYLSDGPSEAIQAVIDARIPKRLVELLTHQSTLVQTPALRAVGNIVTGTDLQ
                     TQVVINSGVLVALRHLLSSPKESIRKEACWTISNITAGNTDQIQSVIDADILPSLIRL
                     LETADYKTKKEACWAISNASSGGLHRPEIIRYLVAQGCIKPLCDLLEIADNKIVEVTL
                     DALENILKMGEADKEARGLTINENADYIEKAGGMEKIFNCQQNENDKIYEKAYTIIET
                     YFGEEDDAIDENMAPQTSENTFGFGSNVNQTFNFN"
     gene            complement(<527739..>528623)
                     /gene="TPHA0F02390"
                     /locus_tag="TPHA_0F02390"
                     /db_xref="GeneID:11535653"
     mRNA            complement(<527739..>528623)
                     /gene="TPHA0F02390"
                     /locus_tag="TPHA_0F02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686106.1"
                     /db_xref="GeneID:11535653"
     CDS             complement(527739..528623)
                     /gene="TPHA0F02390"
                     /locus_tag="TPHA_0F02390"
                     /inference="similar to DNA sequence:INSDC:YDL218W"
                     /note="similar to Saccharomyces cerevisiae YDL218W;
                     ancestral locus Anc_2.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686154.1"
                     /db_xref="GeneID:11535653"
                     /db_xref="GOA:G8BUD4"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:G8BUD4"
                     /translation="MVSSFVTRTLPLTGLRLCEFAASVIVMSLLSFAIHEFGFHGSKK
                     LTTGWLLVLSRFFILLAVIIGSLVTPGLVMAGLLLIGEFIMAGLWISAFIVIADSVGK
                     NGCSNKQSSTYNPNYGSMGDYGMSGGTYNEFTGQYGNQSSGRACNSIKTSVAFAGLAA
                     VLFIISLILVIVNIVVPVGRNYGGAGLFKTGSSMNSKVHRSSALTLSEPIEKTYAYET
                     GAGVPQAGTEQRVAEDGVATNQVGNNVPVTTADQHTFSTGASSNDAFIQEKNTGIDAA
                     NAAHRAASGGTTVNQPNV"
     gene            complement(<529278..>530351)
                     /gene="TPHA0F02400"
                     /locus_tag="TPHA_0F02400"
                     /db_xref="GeneID:11535500"
     mRNA            complement(<529278..>530351)
                     /gene="TPHA0F02400"
                     /locus_tag="TPHA_0F02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686107.1"
                     /db_xref="GeneID:11535500"
     CDS             complement(529278..530351)
                     /gene="TPHA0F02400"
                     /locus_tag="TPHA_0F02400"
                     /inference="similar to DNA sequence:INSDC:YNL191W"
                     /note="similar to Saccharomyces cerevisiae DUG3 (YNL191W);
                     ancestral locus Anc_2.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686155.1"
                     /db_xref="GeneID:11535500"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BUD5"
                     /translation="MCRFLIFKGKEPIRLSHLLTRPAHSIINQSYDSRLRLDRRRPMN
                     GDGFGVAYYPLDVELDKDGPCIFKAITPAWNNQNLSTLAEKTKSDLIFAHVRASTYGV
                     LSETNCHPFTYHNLCFMHNGGISNFQKIKRKLLNHIDDDYLNFLQGSTDSECAFALFL
                     DTLEKLGANPKDKEGQFGHTILRQALLKTIEYIKDWTKIMNTDEIKVEPSLLNFAVTD
                     GSTVVVSRYITSKVDEAASLHFSCGSSFVEVSPGEYRMERLDRNQDVIMVASEPLTFE
                     RGDWTAVPTNSTLTIKKQTILLHPIIDEYYQEDPQYIRNATLAESKGLMGSIPLSKSV
                     EKNVPPLEREGRSRPLSTNIRLA"
     gene            complement(<530755..>531325)
                     /gene="TPHA0F02410"
                     /locus_tag="TPHA_0F02410"
                     /db_xref="GeneID:11535469"
     mRNA            complement(join(<530755..531148,531261..>531325))
                     /gene="TPHA0F02410"
                     /locus_tag="TPHA_0F02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686108.1"
                     /db_xref="GeneID:11535469"
     CDS             complement(join(530755..531148,531261..531325))
                     /gene="TPHA0F02410"
                     /locus_tag="TPHA_0F02410"
                     /inference="similar to DNA sequence:INSDC:YDL219W"
                     /note="similar to Saccharomyces cerevisiae DTD1 (YDL219W);
                     ancestral locus Anc_2.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686156.1"
                     /db_xref="GeneID:11535469"
                     /db_xref="GOA:G8BUD6"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:G8BUD6"
                     /translation="MKVVIQKVSQASVVVEKQVISSIKHGYMLLVGISTEDTTQDIEK
                     LSKKVLNLRLFEDEEGAGWKKNIKEVNGEILSISQFTLLARTKKGTKPDFHMAQKGHI
                     SKEMYDNFLNLLKSDLGESKVQDGQFGAMMSCSLTNEGPVTILLDSNVST"
     gene            complement(<531713..>535228)
                     /gene="TPHA0F02420"
                     /locus_tag="TPHA_0F02420"
                     /db_xref="GeneID:11535470"
     mRNA            complement(<531713..>535228)
                     /gene="TPHA0F02420"
                     /locus_tag="TPHA_0F02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686109.1"
                     /db_xref="GeneID:11535470"
     CDS             complement(531713..535228)
                     /gene="TPHA0F02420"
                     /locus_tag="TPHA_0F02420"
                     /inference="similar to DNA sequence:INSDC:YNL192W"
                     /note="similar to Saccharomyces cerevisiae CHS1 (YNL192W);
                     ancestral locus Anc_2.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686157.1"
                     /db_xref="GeneID:11535470"
                     /db_xref="GOA:G8BUD7"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BUD7"
                     /translation="MSNNNDFNGNNYGEYEDHDMSYNDNQQNLYNQNSNDARNYNNGE
                     TRNFTRIISNRPAPPEVFLTNNNNNNNNNNTSNNGSPGVGRTDTQAYNSFINVRPIVH
                     NTDPINQPHNVFVDNTEASNSSNNVSIATGTPLHTNNNYALPNRIPSINIIKNSEVIP
                     QSPQTYQNIEMDNFNDELYYHQYNNTNSGDNTHHLNNTAPTFLRRNSSQDNVSIIDDY
                     AQQNETRPIFNYDQQYDYPQSNINQYPYDANNNMNGNNGPTKVVFDDDPEQFYIDHNG
                     SDYQICTYLGNDGEMVNPYSSNVSFTNSEQNESYLSPYKSQNINDGDVADIPNRYSHV
                     NLGEYSSAEDMDDENVLKKESAYLHVNRLESNSSNSNFGDDHINPLSMNFEDATSRDN
                     LVNNDPASTNKLVRRNTTVIKKFKLLMGNFIFDSPISKSLLGKYSIAVGGDSKLSNEF
                     KFMRYQAITCEPNKLFENNFTTRQLQYEVPRQTELMIVITMYNENHILLGRTLKGVMD
                     NIRHMVKKKHSSTWGQDAWKKIVVCVVSDGRAKIDQKSMALMSTLGCYQDGFAKDEVN
                     GKKVKMHLYEHSTMMNIKSVTEDDLEIVCDQSTVPIQLLFCLKEQNQKKINSHRWAFE
                     GFAKLISPNIVTLLDAGTMPGHDSIYELWTEFKNTQVGGACGEIKAEIGHLGKNLINP
                     LVASQNFEYKMSNILDKTTESNFGFISVLPGAFSAYRLTALEGEPLIKYFYGETMESE
                     VDKLNFFSSNMYLAEDRILCFEIVTKKECNWILKYSRSSYASTDVPTRVPEFILQRRR
                     WLNGSFFSSVYSLCHFHRIWTSGHSVIRKVMLSIEFMYLLFNTIMSWFSLSSFFLVFR
                     ILTLSIAVTYHSAFNILSVIFFWLYGICVLSTFILSLGNKPQSTEVFYVITCIFFAVL
                     MIYMLFCSIFLSVKAFENILDESIITFKGLISTRTFRDVLISLLSTYVLYFISSIIYL
                     QPWHMFTSFLQYLLLSPSYINVLNIYAFCNVHDLSWGTKGAVSKQLGKITTHEDGTFK
                     MEILVSSQEIQSNYNRYLGILKAPEDPEEAKQEVPFSEKKTGYYANIRSMVIIFWVLT
                     NFGVIAAVLLTGGIDDYLTLHKNVGSTSSNDSPIIESAILPVNATYYLTVILWLVALT
                     AFIRFIGCSWYMIMRVINKSFHTHN"
     gene            complement(<535865..>538261)
                     /gene="TPHA0F02430"
                     /locus_tag="TPHA_0F02430"
                     /db_xref="GeneID:11535617"
     mRNA            complement(<535865..>538261)
                     /gene="TPHA0F02430"
                     /locus_tag="TPHA_0F02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686110.1"
                     /db_xref="GeneID:11535617"
     CDS             complement(535865..538261)
                     /gene="TPHA0F02430"
                     /locus_tag="TPHA_0F02430"
                     /inference="similar to DNA sequence:INSDC:YMR001C"
                     /note="similar to Saccharomyces cerevisiae CDC5 (YMR001C);
                     ancestral locus Anc_6.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686158.1"
                     /db_xref="GeneID:11535617"
                     /db_xref="GOA:G8BUD8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BUD8"
                     /translation="MVLAPLQVVTDNQKVNRIENFKKSNNNNYINEDYINIKNTSKIS
                     YNENDVVQVINKKDNLIKQNNEKLNRKKEKTNLLCKTPPSVIKDNSKKYFRRECLGEG
                     GFARCFHIKDDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNLRYSHIVKFMDCFE
                     DELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVCGAINYMHSNNIIHRDLKL
                     GNVFFDKNFNIKIGDFGLAATLSNVSEKKYTMCGTPNYIAPEVILSKQIGHSFEADIW
                     SLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFPPDKYITNDVKVLIQDLLVLDPS
                     QRPRIMDILKYNWFKHSFPPKLPSTIFTEVPLYFIELSTLNSLKHFKNCLISCQLIVD
                     LSKNNKTPFHNVFLNERQNIKNNPINTNLTNNNDVLQFCDTSFNSNNNNQVRKSEKIR
                     KMNELNDDIRTNVLNPIGTTNLIKSRNAIKILNKACLDTLTTLLKIEQYNYNIKLDEI
                     EQDEWATQKMPIIITKWVDLTTSSIKSSIFHNPKATENCFIYQLSTEDIGVLKSNGTT
                     ILKLFDVPEYWLIETDFKVGWIAKHKQYNDNSKKNTNYNTTVSTSMTTSNSLNSNKDN
                     LNDQNRMEARTEEINTKKNMVFVEKYEEYMNKNLTRVSTFVKQKYHKDDIFLRRFTRC
                     KEFVMFELSDCGFQFNFKDHFKIVLSDNGHIISIITPKQDSFVLSTKHFLSVAKYLNA
                     NPKSTNLETVYLNTISYGSCSQQEVKNKLKKLKFNQLKILEKIEMIKNILNQKSHGTI
                     "
     gene            <539089..>539832
                     /gene="TPHA0F02440"
                     /locus_tag="TPHA_0F02440"
                     /db_xref="GeneID:11535566"
     mRNA            <539089..>539832
                     /gene="TPHA0F02440"
                     /locus_tag="TPHA_0F02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686111.1"
                     /db_xref="GeneID:11535566"
     CDS             539089..539832
                     /gene="TPHA0F02440"
                     /locus_tag="TPHA_0F02440"
                     /inference="similar to DNA sequence:INSDC:YOL009C"
                     /note="similar to Saccharomyces cerevisiae MDM12
                     (YOL009C); ancestral locus Anc_6.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686159.1"
                     /db_xref="GeneID:11535566"
                     /db_xref="GOA:G8BUD9"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR027532"
                     /db_xref="UniProtKB/TrEMBL:G8BUD9"
                     /translation="MSFDINWNNLSNDSELNNSIFQSLNNFLNSITLPSYVKNLKLEK
                     FSLGSTAPDIKIKQITEPLVDFYDDIQNELSDDQVIEKSPNDVQILTEVEYKGDLSFT
                     LSAELVLNYPSAEFMTLPVKITVGNLGFHSLCILAYLSKQAFFSFLCDINDSHLVEES
                     MVNEPNGFNISANRRLERIFIIRSLSIETEAGEQNQKEGSILKNIGKLELFLSDKLKE
                     YLTRELAWPSWINLDFNDEETDVFSKEED"
     gene            <540578..>541993
                     /gene="TPHA0F02450"
                     /locus_tag="TPHA_0F02450"
                     /db_xref="GeneID:11535655"
     mRNA            <540578..>541993
                     /gene="TPHA0F02450"
                     /locus_tag="TPHA_0F02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686112.1"
                     /db_xref="GeneID:11535655"
     CDS             540578..541993
                     /gene="TPHA0F02450"
                     /locus_tag="TPHA_0F02450"
                     /inference="similar to DNA sequence:INSDC:YMR004W"
                     /note="similar to Saccharomyces cerevisiae MVP1 (YMR004W);
                     ancestral locus Anc_6.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686160.1"
                     /db_xref="GeneID:11535655"
                     /db_xref="GOA:G8BUE0"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8BUE0"
                     /translation="MRNSYSDDEGYYDTNNRNHPEESENNYLSLPKKNENIFREDDKL
                     SNQFYIDGLVNRNEDSDDDELTLDNRVESFEKWSTKIRNSYNPISPDLLDLEEINEKE
                     GLIFKHLNYKITILNDIPNTNATAGKSVIRRYSDFLWLRNVLLKKYPFRIIPLLPPKH
                     VGLQSPSKIFLDARRDGLSKFINMVVRHPVLKKEELMSTFLTVPIEISSWRKTALYDT
                     SDEYHDKKVKEEFKRIFVPSLMDEWNSLPKSLNKSIILWSKLLNLVERHRYKEYLIAK
                     HNLLFKNNLNEFTIQTNALYPTTFSNTTHNINDHLNEIGKHLSKSSELQEKENLEMVN
                     RLIPKFITYVITLKSLQKLRQRYDILATNSIGNLRKRVLLNEEKLESMKGKPDVSGVE
                     YDTILIRLNQDKKLIADQINRSWLIKKTILEEFIIFQQTQFMITETFQEWTNLHAKYH
                     GLELNEWEALAVDLTRMATIE"
     gene            complement(<542190..>544211)
                     /gene="TPHA0F02460"
                     /locus_tag="TPHA_0F02460"
                     /db_xref="GeneID:11535656"
     mRNA            complement(<542190..>544211)
                     /gene="TPHA0F02460"
                     /locus_tag="TPHA_0F02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686113.1"
                     /db_xref="GeneID:11535656"
     CDS             complement(542190..544211)
                     /gene="TPHA0F02460"
                     /locus_tag="TPHA_0F02460"
                     /inference="similar to DNA sequence:INSDC:YMR008C,YOL011W"
                     /note="similar to Saccharomyces cerevisiae PLB1 (YMR008C)
                     and PLB3 (YOL011W); ancestral locus Anc_6.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686161.1"
                     /db_xref="GeneID:11535656"
                     /db_xref="GOA:G8BUE1"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:G8BUE1"
                     /translation="MQLFSFLVTAPLLASILEVQAWSPHNSYTPANVTCPNDFNLIRE
                     GASSLSSNETEWLSRRDEITKAALKEFLQRATSNFTDSSIVNEIFGASNSSNSSNSTV
                     SKLRVGIAASGGGYRAMLSGAGMVAAFDNRTIGANAYGFGGLLQGSTYLSGLSGGNWL
                     TGTLAWNNWTSVQDIIDNTYTDNSIWDITDGLVSGTANNTLMWETIFAEVAGKSAAGY
                     NTSLADYWGRGLAYNFFPNLPNGGSGYTWSTLRDSNVFLNAEMPFPITVTDARDPNTT
                     ISYVNSTIVEFNPFEMGSWDPSLNSFADVKYIGSAVNNGSPIVDGVCAAGFDNAGFII
                     GTSSTLFTPAMSSAVGTLLGNSSSTVGTFLVNEIAVDTNDVANFGPNPFYGSSFGISN
                     IGNKDILTLADGGEDNIELPLIALIQKQRDLDVVFALDNSADTAENWPDGNGLISAYR
                     RQFYPQGSNISFPYVPDAETFVSEGLNKRPTFFGCDAANLTNLAYVPPLIVYLPNYEV
                     SYASNTSTLQLAYNETERLSMIQNGFEAVTRGNFTEDSKFLGCVACAVMRRSQESLGL
                     DLPSECQSCFDTYCWDGSLSDSAALDSAANSTSTISSTSASNSTTMSISMTTSTSASS
                     SNNNGTSASSNSTPSRSSTSSHNGATSLDVTTKITLVTVFIFNFLLGNF"
     gene            <545681..>546085
                     /gene="TPHA0F02470"
                     /locus_tag="TPHA_0F02470"
                     /db_xref="GeneID:11535505"
     mRNA            <545681..>546085
                     /gene="TPHA0F02470"
                     /locus_tag="TPHA_0F02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686114.1"
                     /db_xref="GeneID:11535505"
     CDS             545681..546085
                     /gene="TPHA0F02470"
                     /locus_tag="TPHA_0F02470"
                     /inference="similar to DNA sequence:INSDC:YOL012C"
                     /note="similar to Saccharomyces cerevisiae HTZ1 (YOL012C);
                     ancestral locus Anc_6.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686162.1"
                     /db_xref="GeneID:11535505"
                     /db_xref="GOA:G8BUE2"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BUE2"
                     /translation="MSGGKSHGGKGKSGAKEGGSSQTHSSSAKAGLQFPVGRIKRYLK
                     RHASGKIRVGSKSAIYLTAVLEYLTAEVLELSGNAAKDLKVKRITPRHLQLAIRGDDE
                     LDSLIKATIASGGVLPHINKALLLKVEQKKKK"
     gene            <546818..>548635
                     /gene="TPHA0F02480"
                     /locus_tag="TPHA_0F02480"
                     /db_xref="GeneID:11535518"
     mRNA            <546818..>548635
                     /gene="TPHA0F02480"
                     /locus_tag="TPHA_0F02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686115.1"
                     /db_xref="GeneID:11535518"
     CDS             546818..548635
                     /gene="TPHA0F02480"
                     /locus_tag="TPHA_0F02480"
                     /inference="similar to DNA sequence:INSDC:YOL013C"
                     /note="similar to Saccharomyces cerevisiae HRD1 (YOL013C);
                     ancestral locus Anc_6.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686163.1"
                     /db_xref="GeneID:11535518"
                     /db_xref="GOA:G8BUE3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BUE3"
                     /translation="MSSLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKL
                     TKGLNVIILVLFGLLNVAFIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMF
                     NERDIIMSISSYGMILIFMKVAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGL
                     FAVIDYQMMMQCVTNSIKNSMGASTSIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHK
                     SIEDRNLNIVGEDEDGLVDDEEEFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRM
                     KIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDS
                     LINIDFNSTEETENKEKEEQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPI
                     CRLSVFDSNGNILPFNNTRSDTMRNTELTATNSNDAADESTENDTEMDALLSSQVQES
                     VGDTLARDINFRSSIGDADVEGENNDNYDLDNELEIPNSDNPSQLLNSESQNAECEFN
                     NVKWKSFLIKSVNKESISFELTDLKNPDQTILTKLIIKEKPILKDSKNIKQVVIKDED
                     IWMATEPKTIKSLNDKINELERKLKDISSKIDEKETVEQ"
     gene            <549495..>551528
                     /gene="TPHA0F02490"
                     /locus_tag="TPHA_0F02490"
                     /db_xref="GeneID:11535519"
     mRNA            <549495..>551528
                     /gene="TPHA0F02490"
                     /locus_tag="TPHA_0F02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686116.1"
                     /db_xref="GeneID:11535519"
     CDS             549495..551528
                     /gene="TPHA0F02490"
                     /locus_tag="TPHA_0F02490"
                     /inference="similar to DNA sequence:INSDC:YLR260W,YOR171C"
                     /note="similar to Saccharomyces cerevisiae LCB5 (YLR260W)
                     and LCB4 (YOR171C); ancestral locus Anc_6.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686164.1"
                     /db_xref="GeneID:11535519"
                     /db_xref="GOA:G8BUE4"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:G8BUE4"
                     /translation="MVKLNSNKHRSKKQHWPKERTYNRALLTEEGIVIKSNNINEAYS
                     NLKRNSVSSLGPAQDSILRRSFSNSTSAFHNSGEFSRFNDLESTHTTDETPEKILSNA
                     DLDTLETASVVSCITCLSDTHSITSPRTSGDLPYSFLNGKFPINTVIPFGRILHAKYI
                     DRSLSRRGSDIKRKSPRSSLSKTTTGNSIQSVDSGRSTINESFKDAYEFPTSPDLKTF
                     HSNTSFNSELKDVNFNRKYAKKLIEITFAKPRRHDIIPKRLILDIESILPLEHDLVTE
                     ILNRSYQGTRRNRKILAIINEFGGKGNAKKLYFSKAKPILAASRCKVDIVFTEYTGHA
                     INVAKEMDINKYDTIVCASGDGIPYEIINGLYQRKDRAAAFSKLAITQLPCGSANAMS
                     VSCHWTDNVSYAALSIVKSKEVQIDVVCCSQPSYFSTSPRLSFLSQTYGLIAESDINT
                     EFFRWIGAARFEIGVAFNILQKKKYPCELYVKYQARNKNDLKEFYLKKHKSHQAWPNF
                     NSYDIDPENEFTEGSSDDFQEITEENFKLKYPYQEGIPSDWERVSPELTKNLGIFYTG
                     KMPYIAADIKFFPAALPTDGAIDMVLTDGRTAVTRMVPILLALDKGSHVLQPEVIHSK
                     VLAYRIVPKGNNTLFSVDGEKFPNEPLQAEVLPRLCKVLLRNGSFVETAFNNM"
     gene            complement(<551815..>552462)
                     /gene="TPHA0F02500"
                     /locus_tag="TPHA_0F02500"
                     /db_xref="GeneID:11535389"
     mRNA            complement(<551815..>552462)
                     /gene="TPHA0F02500"
                     /locus_tag="TPHA_0F02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686117.1"
                     /db_xref="GeneID:11535389"
     CDS             complement(551815..552462)
                     /gene="TPHA0F02500"
                     /locus_tag="TPHA_0F02500"
                     /inference="similar to DNA sequence:INSDC:YLR262C"
                     /note="similar to Saccharomyces cerevisiae YPT6 (YLR262C);
                     ancestral locus Anc_6.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686165.1"
                     /db_xref="GeneID:11535389"
                     /db_xref="GOA:G8BUE5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUE5"
                     /translation="MSRANKSLTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIG
                     IDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYID
                     KWIEDVKTERGSENVILCIVGNKSDLSDERQVTTEEGEAKAKELGATIFMETSTKAGH
                     NVKNLFKKIAKSLPEFQNSDSTPLDDNNESNTANNKAQVIDISSTENENQGNCQC"
     gene            <553151..>553720
                     /gene="TPHA0F02510"
                     /locus_tag="TPHA_0F02510"
                     /db_xref="GeneID:11535592"
     mRNA            <553151..>553720
                     /gene="TPHA0F02510"
                     /locus_tag="TPHA_0F02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686118.1"
                     /db_xref="GeneID:11535592"
     CDS             553151..553720
                     /gene="TPHA0F02510"
                     /locus_tag="TPHA_0F02510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686166.1"
                     /db_xref="GeneID:11535592"
                     /db_xref="UniProtKB/TrEMBL:G8BUE6"
                     /translation="MVAIDSPKGNTEEIKSYSLKRKKILNDTRNTFRILDESLLESNS
                     PNSNGKVHNLTTPTSSKLARNNNVRKRQSKKQKIHPHDDKVHMRTIFGENIVKTQPLK
                     SVPKTSTLKEININSKRGTSKSHNSVVTKIHTKVNDHETQLKLSSYSKSKMEIVDSEP
                     TKLNPEQLVFNAVERFASKVLEKYSDPNH"
     gene            <554194..>554397
                     /gene="TPHA0F02520"
                     /locus_tag="TPHA_0F02520"
                     /db_xref="GeneID:11535620"
     mRNA            <554194..>554397
                     /gene="TPHA0F02520"
                     /locus_tag="TPHA_0F02520"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_003686119.1"
                     /db_xref="GeneID:11535620"
     CDS             554194..554397
                     /gene="TPHA0F02520"
                     /locus_tag="TPHA_0F02520"
                     /inference="similar to DNA sequence:INSDC:YLR264W,YOR167C"
                     /note="similar to Saccharomyces cerevisiae RPS28B
                     (YLR264W) and RPS28A (YOR167C); ancestral locus Anc_6.53"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_003686167.1"
                     /db_xref="GeneID:11535620"
                     /db_xref="GOA:G8BUE7"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /db_xref="UniProtKB/TrEMBL:G8BUE7"
                     /translation="MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDSSRTIVRNV
                     KGPVRENDILVLMESEREARRLR"
     gene            complement(<554976..>556100)
                     /gene="TPHA0F02530"
                     /locus_tag="TPHA_0F02530"
                     /db_xref="GeneID:11535621"
     mRNA            complement(<554976..>556100)
                     /gene="TPHA0F02530"
                     /locus_tag="TPHA_0F02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686120.1"
                     /db_xref="GeneID:11535621"
     CDS             complement(554976..556100)
                     /gene="TPHA0F02530"
                     /locus_tag="TPHA_0F02530"
                     /inference="similar to DNA sequence:INSDC:YLR265C"
                     /note="similar to Saccharomyces cerevisiae NEJ1 (YLR265C);
                     ancestral locus Anc_6.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686168.1"
                     /db_xref="GeneID:11535621"
                     /db_xref="UniProtKB/TrEMBL:G8BUE8"
                     /translation="MSEELNTNEWTWNGWTNVSLDNTEYIINLVTISNKSLILVFVPI
                     AFTNDNNQDDAIFVAKLDDDYFIRQCSDQGFQRDSINQLKAHLSNSIYNGGTIQSLSK
                     VSLNIQIILQINCSMSINIFLPIIKISNEVLTHIYNTSMQYLIRNICMQNIESNILKQ
                     TIQTKYRAIQYISEQICTTMDDKEIIKKWVPPGSIHSRSLKPLSETWLDNTVVNSYHQ
                     AYDSKPIAENNHISKIFKRFQMWTTKYLTYKKKNSDNFSDNNNKSIDVGTSSFDENFD
                     SLINIDDDEHSLEGSLNNSGNSIRQSSDTDVSETYFNNVNGNAFESNSYHFEVTPELQ
                     QNSTFGETQEENSDINTDEHETIYHSPKKRRVFGKVKSQK"
     gene            <556797..>559178
                     /gene="TPHA0F02540"
                     /locus_tag="TPHA_0F02540"
                     /db_xref="GeneID:11535658"
     mRNA            <556797..>559178
                     /gene="TPHA0F02540"
                     /locus_tag="TPHA_0F02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686121.1"
                     /db_xref="GeneID:11535658"
     CDS             556797..559178
                     /gene="TPHA0F02540"
                     /locus_tag="TPHA_0F02540"
                     /inference="similar to DNA sequence:INSDC:YLR266C,YOR162C"
                     /note="similar to Saccharomyces cerevisiae PDR8 (YLR266C)
                     and YRR1 (YOR162C); ancestral locus Anc_6.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686169.1"
                     /db_xref="GeneID:11535658"
                     /db_xref="GOA:G8BUE9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BUE9"
                     /translation="MESYSKLNIHNNENNNVLNNSLTPESSTYTISKSTTDTSQRRKK
                     RKIPKSCYFCRKRKLKCDHSRPTCNQCSSRQLTGCVYMEAYNYNVTSSELLVDAPHEI
                     LLKKINDLELELTKYKNSSHVATNCPFGNHSSSNASPNTYDNVFNSKVNNVDPLSISE
                     LVGVNDSVNYITKEPQDFSSFRFIYGGNKWSVYYGTTSWKTIVQQSGDVYNTEYNKIG
                     NVLLPMNRNWKKEHGVKIMTSEFLLCNTILSGKKNSSLFESVIEVLPSYNEILTCIEV
                     YFNSPLHKLYGILDKEKVMREFQSSVIEVNPDTKIVTFNSSEENYFSFGVLLMIIIYA
                     KWKINVPEAVYEFVALLSGSTEYHFNKIEKLQFLFLNYLSKVYFQQDWFSGRDTVDSV
                     MHLCSSLISLGLSDLNWWYKSNTFDNVGSYESVRNLWYHILIADVLTSFDCGKPLALG
                     DSFINAKQFNISLTDNAEYSNRRLLLAKQFLRISRSYVNEMNASRCKVNVSYHVANLV
                     KFIEKSFSPLNLYINTKINESNFDDLIDDFDHLLLAPCIGMLINSHSILNYTLKDSSA
                     MLISGLCKYIIIGLSLCNNIYRKLYFRHLKARENSDNSELPEIILDDREMNLNMLTLI
                     NFSLCARTLTEAYALFFLHLTTINKNWIIIDNTATTFNDPLDTVSVTNSTSISIKSTT
                     LKFFELFDMFTSLHDNYLEKLTINSFYIFMINEFQRLSKSLFEKGVESRIKAENNLGS
                     ENVDISSLSKEQLDLLEKEIYLDYLQLTQESWNLGFPSLYNDNILESDLLPTQ"
     gene            <559614..>562013
                     /gene="TPHA0F02550"
                     /locus_tag="TPHA_0F02550"
                     /db_xref="GeneID:11531552"
     mRNA            <559614..>562013
                     /gene="TPHA0F02550"
                     /locus_tag="TPHA_0F02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686122.1"
                     /db_xref="GeneID:11531552"
     CDS             559614..562013
                     /gene="TPHA0F02550"
                     /locus_tag="TPHA_0F02550"
                     /inference="similar to DNA sequence:INSDC:YOR172W"
                     /note="similar to Saccharomyces cerevisiae YRM1 (YOR172W);
                     ancestral locus Anc_6.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686170.1"
                     /db_xref="GeneID:11531552"
                     /db_xref="GOA:G8BUF0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BUF0"
                     /translation="MIGASPSPSNGTNQGVKKKRNKLIKSCTFCRMRKLKCDKNKPMC
                     STCVVRQRKECSYTYTTSSRASSPTANDGKVNISNLSKKENVYDSLSPSEGNIEMLKD
                     TVNTNGYLADSPSVSNTKYKKNPYYDYYNFQMKESGKISVSGPTSIRTTLIENSTLFR
                     SNKLFNYIWEKVKISRDRWKLEHNFEKLNELSFEEQATFSKSKSLLYHITLNLPPYKE
                     IVESINDFFDKSDIYYHSMALDKNKILSDLKACFILDNFNEKVIQIILINKFNHFKVA
                     VILEILCITHFGLEVPHTIQIYRTHVKGITTSKSMYVEKAQFLLLHVFYLKTYCLTSG
                     DYTNLLTISDLLCSTCIGLGFNRNIDALYSNKETLCGSLKSIKHIWLFTLFLDWDVSF
                     NTGKGLAISKNDYDLDDFLKLYASEVEYTSITALILRFLKIIRKQYIIFTDRNETPDL
                     SQFVEEIISFLKLEFPDIKNYVNYDQMHNISLMKFIVLIPALSVIITFLGLNKNPHQS
                     VTKVRNYTYKFDMMIFKLTTNLVKYCFLLDNEYYPEIIRNTALDSDGYSRLNISPHLS
                     FSISLTNSATLRSQSHFFFVAYLQLTYFSNNLVLSSDLGTAPFDIQSFCTPNDENYNM
                     DSVFDFYVNVSIEWWEPQVTAMTNVLLRSYSCVIMKTLHKICFTIISTMRSIRDKTEH
                     QWAANNECLVNAGNVLQKEIDCQINKSSNEIKVGKERSLYISPQGYTSSIEESMEDIK
                     NPNFQYLDHLRRILDFDNCSLGSPTTKEESERYSKEFWANYVLDWEQEIAKIDNIFEA
                     V"
     gene            <562455..>563102
                     /gene="TPHA0F02570"
                     /locus_tag="TPHA_0F02570"
                     /db_xref="GeneID:11531553"
     mRNA            <562455..>563102
                     /gene="TPHA0F02570"
                     /locus_tag="TPHA_0F02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686123.1"
                     /db_xref="GeneID:11531553"
     CDS             562455..563102
                     /gene="TPHA0F02570"
                     /locus_tag="TPHA_0F02570"
                     /inference="similar to DNA sequence:INSDC:YLR268W"
                     /note="similar to Saccharomyces cerevisiae SEC22
                     (YLR268W); ancestral locus Anc_6.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686171.1"
                     /db_xref="GeneID:11531553"
                     /db_xref="GOA:G8BUF1"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8BUF1"
                     /translation="MIKSTLLYREDGLPLCTSVDDDNMNPQLSEQKKRVKMLVSRMTP
                     QSATEATIESNNYEINYIKNGVVIYFVIVEKNYPRNLAFSYLNDIQQEFQHSYINDVT
                     KPNIRPYAFVKFDNFLTKTKNIYSDKKVQDNLDQLNQELVGVKQVMSKNIEDLLYRGD
                     SLDKMSDMSSNLRETSKKYRKSAQKINFDLLLSQYAPIAISALLGVFLFWYIFLR"
     gene            <564129..>565244
                     /gene="TPHA0F02580"
                     /locus_tag="TPHA_0F02580"
                     /db_xref="GeneID:11535331"
     mRNA            <564129..>565244
                     /gene="TPHA0F02580"
                     /locus_tag="TPHA_0F02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686124.1"
                     /db_xref="GeneID:11535331"
     CDS             564129..565244
                     /gene="TPHA0F02580"
                     /locus_tag="TPHA_0F02580"
                     /inference="similar to DNA sequence:INSDC:YLR270W,YOR173W"
                     /note="similar to Saccharomyces cerevisiae DCS1 (YLR270W)
                     and DCS2 (YOR173W); ancestral locus Anc_6.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686172.1"
                     /db_xref="GeneID:11535331"
                     /db_xref="GOA:G8BUF2"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="InterPro:IPR011145"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:G8BUF2"
                     /translation="MSENFNKADSSCDMQKHKDFSDLINRFEFLKVLDTNPQTKTLSL
                     LGTIDNKKAIMTAEKTHFIFDETHLHSQDQSKASTGNLAKKIPIFYHCDDEFSCVNNI
                     ECIREVASNDVYHWGLIVLKQHITNNPTARLNLIWPASPVHIKKYEQTPLHMIKETPE
                     LYNRIVKPYIDEIFNSGKLDWVNDILYNDIEKERVIYKDFVEKQSAKASDGVIILPNT
                     KWDGVNVDSLYLVAIVYRNDLRTVRDLKQSDREWLINLDRKIRSVVPANYNYAVHSDE
                     LRLFVHYQPSYYYFHVHIVNIKHPGLEDNITAGRAILLDDVIDSLKFLGPEGYLKKTI
                     SYSIGENHELWSKGFKQEVDKQLDMDGVPCPPPAVNF"
     gene            <565725..>566645
                     /gene="TPHA0F02590"
                     /locus_tag="TPHA_0F02590"
                     /db_xref="GeneID:11535348"
     mRNA            <565725..>566645
                     /gene="TPHA0F02590"
                     /locus_tag="TPHA_0F02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686125.1"
                     /db_xref="GeneID:11535348"
     CDS             565725..566645
                     /gene="TPHA0F02590"
                     /locus_tag="TPHA_0F02590"
                     /inference="similar to DNA sequence:INSDC:YOR174W"
                     /note="similar to Saccharomyces cerevisiae MED4 (YOR174W);
                     ancestral locus Anc_6.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686173.1"
                     /db_xref="GeneID:11535348"
                     /db_xref="GOA:G8BUF3"
                     /db_xref="InterPro:IPR019258"
                     /db_xref="UniProtKB/TrEMBL:G8BUF3"
                     /translation="MSNNYNMHGLNASEFLTKSNAEAFNSTLTPVAVPQSTANNISQG
                     TASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYK
                     NLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDV
                     MHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASI
                     HRSELTKLPNDTSYDSDKELEEQQEQEQHGTENTREADVEQEQEESFVFDGKHKNEEK
                     TENSNEANSNDDNENDNMDLDLELFNPDEF"
     gene            complement(<566852..>568702)
                     /gene="TPHA0F02600"
                     /locus_tag="TPHA_0F02600"
                     /db_xref="GeneID:11531539"
     mRNA            complement(<566852..>568702)
                     /gene="TPHA0F02600"
                     /locus_tag="TPHA_0F02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686126.1"
                     /db_xref="GeneID:11531539"
     CDS             complement(566852..568702)
                     /gene="TPHA0F02600"
                     /locus_tag="TPHA_0F02600"
                     /inference="similar to DNA sequence:INSDC:YOR175C"
                     /note="similar to Saccharomyces cerevisiae ALE1 (YOR175C);
                     ancestral locus Anc_6.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686174.1"
                     /db_xref="GeneID:11531539"
                     /db_xref="GOA:G8BUF4"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:G8BUF4"
                     /translation="MYNPVNVLLLSVSEKIGLDAFILKYALCLLGSFSFNTVLKRLPD
                     DKINVKCLYILAVSLFYLFGLLNLYSGFRTLLISTMFTYTITKFYKSKFMPYVNFAVV
                     MGHLAVNHLYAQIYNVQESETIDITGSQMVLVMKLTSFAWSYYDGSLTSKEDFESLSD
                     FQKTQAVRQHPPLLNFLAYSFFYPSLLTGPSFDYTDFDSWLNCEIFKDLPESKKPKRR
                     LHPDKRRQIPKNGKLVFFKVLQGLAWMALSVLGPIYFKIDYMSNKAQFLEHSFIYRIH
                     YMYLVGLIYRFKYYAAWTISEASCISCGLGYNGYDSKKHVIKWNRVQNIDIPGVEFAQ
                     NTHDSLEAWNMNTNKWLKNSVYLRVSKKGKKPGFRSTLFTFLTSAFWHGSRPGYYLTF
                     ATGAFYQTCGRYYRRHLRPMFLEKDGKTPRKSKIIYDFICFYVIKLAFGYMVQPFVFL
                     DLKKSIEAWSTVYFYIHICVFITFILFMGPFSKQVIQFCKSKQPKAIVIKENKKFEDE
                     LSASAGSLSDIIKDKTEYEEKEKSMEPGIPHIDLSEWEWVDVKEDWDLFVEEYKAWRD
                     NNGLEVEEQNLKRAFTKFMEEVKDVSVPVPNKERRLSFSAYLPKTTSKDE"
     gene            complement(<569700..>573203)
                     /gene="TPHA0F02610"
                     /locus_tag="TPHA_0F02610"
                     /db_xref="GeneID:11531540"
     mRNA            complement(<569700..>573203)
                     /gene="TPHA0F02610"
                     /locus_tag="TPHA_0F02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686127.1"
                     /db_xref="GeneID:11531540"
     CDS             complement(569700..573203)
                     /gene="TPHA0F02610"
                     /locus_tag="TPHA_0F02610"
                     /inference="similar to DNA sequence:INSDC:YLR272C"
                     /note="similar to Saccharomyces cerevisiae YCS4 (YLR272C);
                     ancestral locus Anc_6.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686175.1"
                     /db_xref="GeneID:11531540"
                     /db_xref="GOA:G8BUF5"
                     /db_xref="InterPro:IPR007673"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024324"
                     /db_xref="InterPro:IPR026971"
                     /db_xref="UniProtKB/TrEMBL:G8BUF5"
                     /translation="MSEFSLSKYLTTFQTTEKRSYLPVEDASRELNTIIDRLAISPEQ
                     INSDPEIFESLTDLCHGFPHLPMKLQTQLTYLVASFVTNVANDISSTLVNKTSGDEII
                     ELIANWKIYLEQYGYLMHVLLTFLHDDIHIAALQSSNFARGVGGSSNKKANTNPNIEL
                     FKRSCSQIESIVDAILKILQLNLSRIFQTTPERDLFISLFIRPLYVIVEVEPIVKLNH
                     LKSFIQRALALSVKNHGQSSAIKASIMSTLTYFLHLSHFNAELLHLLNEQYDYPQLTE
                     DILKEISTRVFNAKDTTGPKAISNFLIKLSELSSHIMLRQMSLVIRLLNNSSITLRCS
                     VVESCGNIVTAIMKNSELLDHYKQQVLVLVKLLEERFQDSNPYVRTKAIQSCIKICQL
                     DIKINKVRSNFLLLAIRSLEDKSSLVRRNSVKLLSKLLLTHPFSGLDGNQLILTNWKK
                     LLDEAHNELDKYQENNENYDISVNNIDDDIINKDVTIDMDVNTKNTSSNIINKNGVET
                     DEANNQLSNKITKLKLMVAYFEEAVEFISNLHRAIFLASGLLSSRNRNEVLETMDFLV
                     LAGTYSLEPSGECIKHMLHLVWMKGATDEGTSIQSHLMTCYNQLFLTTPPEFNYKQRA
                     NYIANNLIKLTERSSLADLASLEQLLILMHKEKLIDDNVVVVLWAIYNAASLTSSMEE
                     KTQIHGAIIIIGMLALSDSNIALKGYVTLLNIGLGEIGMKDMIICRYSCLALERMTPE
                     NNLSSSHEVDMKHDEESVKKLYSIIILYSTDPEYYPMCEQAIRTLFRISRTPDKIAND
                     IIKEKTMMTFGSASEIDSVDNQSISRVTSLSQLLFIVGQVAVRTLIFLDSCETEFKKR
                     KHETEIRNSKDKEKVKDAVVNELNTDEADESKDNELAMIGGTNEDDFADAIQVIKEND
                     LLFGPDCLLGKFCPLVEEIISSSNDRYNDVMLQRTATLCLEKLMCVSSKYCEKSLPLL
                     ITVMEKSPDPIVRSNAVLGLGDMAVCFNNLVDENTDYLYRRLHDESLMVQRTCLMTVT
                     FLILAGQVKVKGQLGEMAKCLENSDQGISDMCKLFFTELATKDNAIYNGFIDIFSNLS
                     SDEDLKKDSFKNIIKFLLSFIVKERHQKQLSEKLSIRLNKCSDQQQWDDIAFVLNTLP
                     HKNEKITEMLSEGFKVVNARD"
     gene            complement(573456..573529)
                     /gene="TPHA0Ftrna7V"
                     /locus_tag="TPHA_0Ftrna7V"
                     /db_xref="GeneID:11535640"
     tRNA            complement(573456..573529)
                     /gene="TPHA0Ftrna7V"
                     /locus_tag="TPHA_0Ftrna7V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11535640"
     gene            complement(<577529..>580285)
                     /gene="TPHA0F02620"
                     /locus_tag="TPHA_0F02620"
                     /db_xref="GeneID:11535458"
     mRNA            complement(<577529..>580285)
                     /gene="TPHA0F02620"
                     /locus_tag="TPHA_0F02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686128.1"
                     /db_xref="GeneID:11535458"
     CDS             complement(577529..580285)
                     /gene="TPHA0F02620"
                     /locus_tag="TPHA_0F02620"
                     /inference="similar to DNA sequence:INSDC:YLR273C,YOR178C"
                     /note="similar to Saccharomyces cerevisiae PIG1 (YLR273C)
                     and GAC1 (YOR178C); ancestral locus Anc_6.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686176.1"
                     /db_xref="GeneID:11535458"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:G8BUF6"
                     /translation="MNINDVVSNNINFSNKEFPALKSSLKISRCSSSSNSCSFKSVRF
                     APELTTVKSFDCNLEPSSISNESSPNLYALDDHSQVSNFINPNSQLLLKNNNTPTTNN
                     NILIGSKSNNDTVWFSQLNIINSLQNNITTRNSNNNLLTDFGLDYDSDTSLDDIYLNS
                     SLINGNISDPTLRQFEINNDNDSKFPFFENNDDSDEGDSELDHLINNSYLFSKDLFFK
                     SNKNYTFSPKPMNQNQNIDDAINDFIDCTSLHRAVTTKNWKLLKSNVSSFEHTPEIVQ
                     SNSILEKKLFEYLDHSNIRLNSIDQVSDIIIGSIFVNNLNFEKHIEVKFTFNDWKDIH
                     YVTAQYNKSITKSIDQFEFKIDLDSFKHILQFKGLIYNNKDTRFSNCEFNIDLCCRYL
                     VNNETYYDNNNYENYQIYLSLETENLLYSDKLDDTRQEPVIDNSTHSLIRNDKLKPEQ
                     CNNYENNKTKIQKFNNSFLDDFITTTTLTHNSNPSKTANISRKFSVNTDYYNTSPLKH
                     LYHNDTTLIKPRSVNSVVLCDEAINQNSQNRTSNTDKNVNNSDFTSHIANPSKFPQDI
                     ALTNNIAISNNSHPDGNSTTIMNINTNNIANKNNNKNSEPNTDTNNSHVTNLNSGDRK
                     IVFNNSVNNKILSAISNNMGCNNVFVDGQGSSSSDSLQSSLTTSIFSQSTATSLSLNN
                     MKEQLRWDDYKGGSAIGSLKTPLIQQNPQFSSSSSSISSISDDVSSSFFQLQTRPSLA
                     SFLPPSSSSRNLSDVTCKNTLAHSCFNNLTRKRKNSNLVEVLDNCGYENDNVRDVDIL
                     PASPINNDTDTFFDSFNDDTNTIMTDTTTTFFGENATTNNYGAEINLFDNDYNYDSQT
                     IQPSSLSQKDLQTMENEERFHSCNGSNYLSLNIKSEFNSSLDTLIISSPSPKEVNICG
                     STIL"
     gene            complement(<583511..>587299)
                     /gene="TPHA0F02630"
                     /locus_tag="TPHA_0F02630"
                     /db_xref="GeneID:11531546"
     mRNA            complement(<583511..>587299)
                     /gene="TPHA0F02630"
                     /locus_tag="TPHA_0F02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686129.1"
                     /db_xref="GeneID:11531546"
     CDS             complement(583511..587299)
                     /gene="TPHA0F02630"
                     /locus_tag="TPHA_0F02630"
                     /inference="similar to DNA sequence:INSDC:YLR278C"
                     /note="similar to Saccharomyces cerevisiae YLR278C;
                     ancestral locus Anc_6.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686177.1"
                     /db_xref="GeneID:11531546"
                     /db_xref="GOA:G8BUF7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BUF7"
                     /translation="MARPKKEVTKENIERFQRELELAGDKVEVLLVDKKGRSKSCLLC
                     RRRKQKCDHNLPSCTSCLKAGVKCVQPERYINANNNNRTSNAENSLETNNIVVMKTKR
                     SNEILHKKKTKGKKKGSIVSPDVSEKGIISKPKSDKKPDKDKDEYTIFLEKKLKYLEK
                     LIDIPPTSASYNKKLAQYKKISNLLGDIGDLEPIIRHLIDRNTKSMNSPNDGNNQVNI
                     LGKRSPTLNTGYPSTINNMHASSPLTNNMGMLPPLPHQSQPKFTPLMKANSRNLENGY
                     QRSMGSDHTNFSTHSEVPNPYSMQSQFSNNFHVNSHQYSKPKIPTEPINFSKCFFSKY
                     NLKEFYLYDPAFDFDEKLSRSFLDIFFTRLQFKYPLLDENEIYQFHESYINNDIYSIP
                     EDKFHFCCARMWLIFSISACLHMTTGKYKGLPPGRYFSAALRHVTRCSDILGDVQKIE
                     LLTLLILYLIRTDRDSMILYQIIKDVMDLSRKLELNKMHPGDQLIKEKFRLFWCVYLL
                     ERMICVAVGCPFTISEREIDLPLFDEETFNTSSVSSATGKSNGVHFINQTLILKRLES
                     RFVEHLKIIPQSNLSKEDLSKQLPLVKKYFHDLELWRASCSRDDVRNFENETLKLYYY
                     RSVRLLTQPYLEILKPEDRLFRECQAAAGQICQLYKIFHQKTVYGHSTPAVHTVFVAG
                     VTLIYCMWLARNLDDERRRMLGDGSKHTRPLVSASLFSIMDDLRACSISLYVMTERSI
                     FARTFRDTFDQLMNATIGNLIERCGPDSSELIYISSGDHSVLLANDENGQTKRIENIG
                     SNSIYFSSTKISKSTEPGLPTELNNSNDEDNNESFSNSFKQKKNGLPPAIDRRFGRRN
                     IEEFIGMAEGTPVDAETEKESKKKQTVLEKNSIPKGLSHLLDHTSTAATEPEVAASAG
                     VEANTNTRTSSIGEDTQQFIVKKPIGKSDLDWQSKFEKQAFLQQKFAQENLKVYLSTL
                     NHPSMTIDTINGGPNLPGINTKFSNDNSMLISNAAAGSGNTSHTPSNQLNQATLVSGK
                     TTPASFQNVDSQNGIFNHASPTNSISSQVSYNKNINYSQLNGALPNMENSYIGGSQVR
                     GNSNLYSSRKVGQALTPIAITDNILTSGDILFKSGTHDMINNISTWTSNSVINVINKE
                     KVSYDENLALSKERSKTEKDQIFNTGLESQGPVSNPMAVSLNSSNISNNDNANNNGIL
                     ENQIIQPAMGDNLNNTARNNAVDVKVESNTVHKSNWNSNTLAPVEEFWTVNYDYGFLT
                     "
     gene            complement(<590052..>590879)
                     /gene="TPHA0F02640"
                     /locus_tag="TPHA_0F02640"
                     /db_xref="GeneID:11531547"
     mRNA            complement(<590052..>590879)
                     /gene="TPHA0F02640"
                     /locus_tag="TPHA_0F02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686130.1"
                     /db_xref="GeneID:11531547"
     CDS             complement(590052..590879)
                     /gene="TPHA0F02640"
                     /locus_tag="TPHA_0F02640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686178.1"
                     /db_xref="GeneID:11531547"
                     /db_xref="GOA:G8BUF8"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8BUF8"
                     /translation="MDSKYIGYSVDGPCFIIKINDPKHLNSISFEDFIYIGRLLEIAN
                     NDASIIYTIIQSTGNFFSAGGKIESVLDGQSNLDRSSSKKLTDTFGMVAKLNVLFADA
                     FLKHKKILICCLNGPAIGLSAAMVLLCDIVYGKDNNGYLLFPFSNLGFVAELGTSVTL
                     FEKLGYNSAMEHLIFSSPVSNKELIEKNIIVKNYNLDNTDVYNKQVILDLKDKSKKLY
                     GPSILGMKKMIFHESTYKQNLTKSQALETSATLPFWLEGEPFKRFQQMKNKERKHKL"
     gene            complement(<591392..>591898)
                     /gene="TPHA0F02650"
                     /locus_tag="TPHA_0F02650"
                     /db_xref="GeneID:11535585"
     mRNA            complement(<591392..>591898)
                     /gene="TPHA0F02650"
                     /locus_tag="TPHA_0F02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686131.1"
                     /db_xref="GeneID:11535585"
     CDS             complement(591392..591898)
                     /gene="TPHA0F02650"
                     /locus_tag="TPHA_0F02650"
                     /inference="similar to DNA sequence:INSDC:YLR281C"
                     /note="similar to Saccharomyces cerevisiae YLR281C;
                     ancestral locus Anc_6.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686179.1"
                     /db_xref="GeneID:11535585"
                     /db_xref="GOA:G8BUF9"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G8BUF9"
                     /translation="MTNQRMLRTSRFIHSFSVLLIKKHKLPPRSKFTISMENECVEAF
                     MHGGRGPGGQKINKCNSKVQLKHLPTGVVVSCQETRSREQNRKIAREKLALELDRLKR
                     KEETNSVGYIKTERELALQQWNQQSKKSKSKKSREKHTQHAIEREEQRLKQLQEDEKL
                     IREMINQQ"
     gene            <592297..>593391
                     /gene="TPHA0F02660"
                     /locus_tag="TPHA_0F02660"
                     /db_xref="GeneID:11535499"
     mRNA            <592297..>593391
                     /gene="TPHA0F02660"
                     /locus_tag="TPHA_0F02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686132.1"
                     /db_xref="GeneID:11535499"
     CDS             592297..593391
                     /gene="TPHA0F02660"
                     /locus_tag="TPHA_0F02660"
                     /inference="similar to DNA sequence:INSDC:YLR283W"
                     /note="similar to Saccharomyces cerevisiae YLR283W;
                     ancestral locus Anc_6.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686180.1"
                     /db_xref="GeneID:11535499"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:G8BUG0"
                     /translation="MFKQAYRVSRLTQRRSYVLSGVSNRITFNNFKIHNNVFRRQLSM
                     TKTIYEPQSLRSSLLINNITSNESDKDIGKQTDSDNNQNIQNILQAKNNSTFDEEDET
                     PIDFMNKLPEELISGGNGFKSTLAENELDTLQYHEMLTANGFTSEQSQIIIDLMLEVL
                     NEEFFRKYNSRFLRTVELDNQSHLFHVAETELRYTIQNSRETQLNDQHLQVTKLSRDL
                     DSLQDELRELAINFLEKDSKVDFNNQKIENTSLLKDIKLELANCDNKISTAILGKTRS
                     EIEHLRWYCTRAGLFTVIILVLFAISGISITRKINEQNDKPIEVVLHTVDKEEHEDIA
                     DESAPKAENNEEDSQNFEEYFGTKFDESKK"
     gene            complement(<593509..>594327)
                     /gene="TPHA0F02670"
                     /locus_tag="TPHA_0F02670"
                     /db_xref="GeneID:11535600"
     mRNA            complement(<593509..>594327)
                     /gene="TPHA0F02670"
                     /locus_tag="TPHA_0F02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686133.1"
                     /db_xref="GeneID:11535600"
     CDS             complement(593509..594327)
                     /gene="TPHA0F02670"
                     /locus_tag="TPHA_0F02670"
                     /inference="similar to DNA sequence:INSDC:YLR284C,YOR180C"
                     /note="similar to Saccharomyces cerevisiae ECI1 (YLR284C)
                     and DCI1 (YOR180C); ancestral locus Anc_6.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686181.1"
                     /db_xref="GeneID:11535600"
                     /db_xref="GOA:G8BUG1"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8BUG1"
                     /translation="MELPHSNIISYHVTSPFFIIKFTGPRSLNSFTKDDYLYLGQLLH
                     LADKDDSVYFTILQSCGTFFSSGANFQGIAKQAKNSNDPELSKWLKNFVATNLYVTDS
                     FARHSKVLIACLNGPAIGMSAAIVGLCDIVYANTEKVYLRFPFASLGLITEGGTSITL
                     PKKLGNNIAYQKLMFNEIFTHADLKDKVINKTYYIEDTEEFNKTILNELNEKIKTLYL
                     PSCLKMKKMLQSNLKDEIVKLNSLEVNDALQFWIDGEPIRRFDQLENRNRKVKL"
     gene            complement(<594884..>595885)
                     /gene="TPHA0F02680"
                     /locus_tag="TPHA_0F02680"
                     /db_xref="GeneID:11535601"
     mRNA            complement(<594884..>595885)
                     /gene="TPHA0F02680"
                     /locus_tag="TPHA_0F02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686134.1"
                     /db_xref="GeneID:11535601"
     CDS             complement(594884..595885)
                     /gene="TPHA0F02680"
                     /locus_tag="TPHA_0F02680"
                     /inference="similar to DNA sequence:INSDC:YLR286C"
                     /note="similar to Saccharomyces cerevisiae CTS1 (YLR286C);
                     ancestral locus Anc_6.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686182.1"
                     /db_xref="GeneID:11535601"
                     /db_xref="GOA:G8BUG2"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8BUG2"
                     /translation="MLTDLLIKYAILLTICGLVLASGVDIDSKTNIASYFTYEFGGTD
                     LLSYCENNDANILAISLPLKFNNLYADFSKDKKYKVDYKQLTSGIVSCQSLGKQVLLT
                     LSVNSQEYGFKDDSEAEIFAQNLWDTFGEGSAKHNSNNPFENISLDGFNFNVTDVSSN
                     EDNEGYSALISKLRSLFTLGKKDYFISATTYYSNAEQYITNDLLTNSDIDFIFLHDSV
                     GQDTNKKLINWQAWVNYSQTISPNPEVKLYVGLHFLEEPSLLNPPEFSELVKSISQSK
                     YFGGISFLDIMNSQKNLNVVSQLKEILVNNIQNNFVETVDTTIFRINVSENIAISTN"
     gene            <599500..>601479
                     /gene="TPHA0F02690"
                     /locus_tag="TPHA_0F02690"
                     /db_xref="GeneID:11535362"
     mRNA            <599500..>601479
                     /gene="TPHA0F02690"
                     /locus_tag="TPHA_0F02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686135.1"
                     /db_xref="GeneID:11535362"
     CDS             599500..601479
                     /gene="TPHA0F02690"
                     /locus_tag="TPHA_0F02690"
                     /inference="similar to DNA sequence:INSDC:YOR181W"
                     /note="similar to Saccharomyces cerevisiae LAS17
                     (YOR181W); ancestral locus Anc_6.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686183.1"
                     /db_xref="GeneID:11535362"
                     /db_xref="GOA:G8BUG3"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR028297"
                     /db_xref="UniProtKB/TrEMBL:G8BUG3"
                     /translation="MGLLTSQDKEVIKRALPKASNKIIDVAIARLYIAYPNPNEWQYT
                     GLSGAVVLVDDIVGDTFFLKLVDIYGHRGVIWDQEIYVNFEYYQDRTFLHTFELEECY
                     AGLLFEDVSEAQHFLKRVQRREKYGSKKTVNNKNAIAQTKKINDANKNVVVQGPRGEA
                     MISDQRQRYNYDESNIIPTTKSKAPPPPPPSAATPDTYDNTSESDNEGKFYSVPDSPT
                     SHAASPPSVDSTPAAAHPVHNVPPMPTHFLPTNNPPPTFPTTVVPSPPAGAPPPMSPP
                     PMSPPPMSPPPISPPAADLQKTPFPIPQPTASQVPAPQQLPGQPSTQQFPRQQQFQQQ
                     SRPVPQLPNRNARSVPPPPGSANAQMNGARIPPPAPQSRRGPAPPPPPHRQNNAPIPA
                     SGFRPTPQPPSSRRGPAPPPPPRKGSRPVPQVSTLPPRSPPAQAMSPPITSFTQPVQQ
                     PQPPSREYLAYAQQVPEMPMTTFGVPQSTPSPAMPTQQAYPAAVPAPPPPPIMPTQQA
                     YPTAVSAPPPPPAMPTQQAAPGAGLAPPPPPAFLSNPQSTSQIPPPPPMGAPQGSSQL
                     NETTGDAGRDALLASIRNSGGIGVLKKVDKSQLDKPSVILQEARGDAPPPSANSSNAA
                     PGGGQGSLADALAAALNKRKTKVSNEDNYDNGDDW"
     gene            complement(<601719..>602843)
                     /gene="TPHA0F02700"
                     /locus_tag="TPHA_0F02700"
                     /db_xref="GeneID:11535399"
     mRNA            complement(<601719..>602843)
                     /gene="TPHA0F02700"
                     /locus_tag="TPHA_0F02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686136.1"
                     /db_xref="GeneID:11535399"
     CDS             complement(601719..602843)
                     /gene="TPHA0F02700"
                     /locus_tag="TPHA_0F02700"
                     /inference="similar to DNA sequence:INSDC:YLR287C"
                     /note="similar to Saccharomyces cerevisiae YLR287C;
                     ancestral locus Anc_6.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686184.1"
                     /db_xref="GeneID:11535399"
                     /db_xref="UniProtKB/TrEMBL:G8BUG4"
                     /translation="MAENNERPVNKADIKDLLTKIRTDFVEPYQDDNLKRLHEISSTT
                     DLSKSQSTPVEELLKLSKLIKAYSTKVGIVCHPEKLLNDDNDKAVFTELSNLTNTLFY
                     FFSLLPLFYNDKKDSYAKFFIQHLDKDVLSLLNGLSKLVNDLISILEKENADGSKEDT
                     DSESLIDSENRLLSIGIIWSACDSLTLLAEKNSVGILSDNIRTSCSLTDDILIDIEEW
                     LEDPAIGYDMLLEAEDEANEELDSDSDIDKEGEAIERIKAFLLTWQVNVKLIRLLLSS
                     FTKSISDNSSKQVIKYEGSALDKLQNLHVKTIEYLDELIADVFMSDTSFNPEEMDDVI
                     ARLNETLKQMLKIIKKINNTDAMKSKWVTVWENKYFGNTN"
     gene            complement(<603366..>604196)
                     /gene="TPHA0F02710"
                     /locus_tag="TPHA_0F02710"
                     /db_xref="GeneID:11535400"
     mRNA            complement(join(<603366..603554,604194..>604196))
                     /gene="TPHA0F02710"
                     /locus_tag="TPHA_0F02710"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_003686137.1"
                     /db_xref="GeneID:11535400"
     CDS             complement(join(603366..603554,604194..604196))
                     /gene="TPHA0F02710"
                     /locus_tag="TPHA_0F02710"
                     /inference="similar to DNA
                     sequence:INSDC:YLR287C-A,YOR182C"
                     /note="similar to Saccharomyces cerevisiae RPS30A
                     (YLR287C-A) and RPS30B (YOR182C); ancestral locus
                     Anc_6.83"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_003686185.1"
                     /db_xref="GeneID:11535400"
                     /db_xref="GOA:G8BUG5"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:G8BUG5"
                     /translation="MAKVHGSLARAGKVKSQTPKVDKTEKPKTPKGRAKKRLLYTRRF
                     VNVTLTNGKRKMNPSPNQA"
     gene            <605618..>606808
                     /gene="TPHA0F02720"
                     /locus_tag="TPHA_0F02720"
                     /db_xref="GeneID:11535522"
     mRNA            <605618..>606808
                     /gene="TPHA0F02720"
                     /locus_tag="TPHA_0F02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686138.1"
                     /db_xref="GeneID:11535522"
     CDS             605618..606808
                     /gene="TPHA0F02720"
                     /locus_tag="TPHA_0F02720"
                     /inference="similar to DNA sequence:INSDC:YOR184W"
                     /note="similar to Saccharomyces cerevisiae SER1 (YOR184W);
                     ancestral locus Anc_6.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686186.1"
                     /db_xref="GeneID:11535522"
                     /db_xref="GOA:G8BUG6"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR022278"
                     /db_xref="UniProtKB/TrEMBL:G8BUG6"
                     /translation="MPIDRVEPQYFGAGPALLPTDVLKQASADLINFNDIGLGIGEIS
                     HRSKDATKVIEDSKQHLKQLMSIPDDYEVFFIQGGGTTGFSSIASNMAAAYLGKTGEM
                     APGGYLVSGSWSEKAYEEAQRLHIPSKVLFNSKDFNENGKYQDIPEESLWEDKIKNSK
                     FSYVYLCENETVHGIEWPSLPKCITERDDIELVADLSSDILSREIDVTKYGVIMAGAQ
                     KNIGLAGLTVYIIKKSILKNIEKATDEQLQEFGIPITPIASYYPTVVKNNSAYNTIPI
                     FTLHVMDLVFKHLIAKGGVPAQQKENEKKAQLLYAALDSHSDFYNLPVAKRVRSNMNA
                     VFTLKDSSLDEKFLKEAEAIKLIGLKGHRSVGGFRASIYNALSVQTVENLAKFISKFA
                     EENA"
     gene            complement(<606977..>608353)
                     /gene="TPHA0F02730"
                     /locus_tag="TPHA_0F02730"
                     /db_xref="GeneID:11535547"
     mRNA            complement(<606977..>608353)
                     /gene="TPHA0F02730"
                     /locus_tag="TPHA_0F02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686139.1"
                     /db_xref="GeneID:11535547"
     CDS             complement(606977..608353)
                     /gene="TPHA0F02730"
                     /locus_tag="TPHA_0F02730"
                     /inference="similar to DNA sequence:INSDC:YLR288C"
                     /note="similar to Saccharomyces cerevisiae MEC3 (YLR288C);
                     ancestral locus Anc_6.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686187.1"
                     /db_xref="GeneID:11535547"
                     /db_xref="GOA:G8BUG7"
                     /db_xref="InterPro:IPR007150"
                     /db_xref="UniProtKB/TrEMBL:G8BUG7"
                     /translation="MKLKLIINGTEANDDYKLLKTTISTVASIRKTFILKFDSERLVI
                     ISTPKSISVNNGTVLQQDVGQLWCTIPRDVFKLYNVKSARDLNNITMESNSDSLSNVF
                     KRYDKVINQGSSTNMTIKLQDMPEWNLKQNSIPGYEENTRPNPVCALAITFEEIVNTS
                     GPEFSAMNHENDMIDDNMAVATSNSNKVIVHSFKIPVKLLFKTQVARIQEPMINYENL
                     IMYNLPSMTEEFGSGFYNFMRRVERYSNVNHIRLSGAIKKDKRADDNSDNLADLKIII
                     NELDWHLEICWNGPLNYSCNLLGQDETEPSSNAQQSQNILNSNNDENIRDTPINGQLN
                     IENSLEVEDSAIGTLMNSKSHDTETNNNTQINYGMDDIAKMIQEKEANESLTHEVIIK
                     SKDWKVCSKLYSAFEEVILAISHNDSCAFHCSLDRGNVDTGNNDSASEQPRERGQIIY
                     YMARSKAI"
     gene            complement(<608812..>609636)
                     /gene="TPHA0F02740"
                     /locus_tag="TPHA_0F02740"
                     /db_xref="GeneID:11535426"
     mRNA            complement(<608812..>609636)
                     /gene="TPHA0F02740"
                     /locus_tag="TPHA_0F02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686140.1"
                     /db_xref="GeneID:11535426"
     CDS             complement(608812..609636)
                     /gene="TPHA0F02740"
                     /locus_tag="TPHA_0F02740"
                     /inference="similar to DNA sequence:INSDC:YLR290C"
                     /note="similar to Saccharomyces cerevisiae YLR290C;
                     ancestral locus Anc_6.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686188.1"
                     /db_xref="GeneID:11535426"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BUG8"
                     /translation="MSKRLLVFGGNGFLGKRICQEAVNKGFQVTALSRSGSPPILTSM
                     EDKLWISETKWVSCNVFDPSTYSHLLVDKPHVVHSLGILLENENYKKNVRGSPNIRAL
                     FTSSSLFQLPNPLLKKDSKFSYEWMNKRSAMILADAYNSISNKNTKNGSVLPSFTYIS
                     ADTKFPLIPEGYIHSKREAEEYLLNKKNQFRSIILRPGFMFDEIKGSTDTRSFIQTGI
                     DVLNCGNKLLLNNKLDCINQITRPTISTQQVAKNAITKIQDNDFKGVVYLDELIKI"
     gene            complement(<610335..>611543)
                     /gene="TPHA0F02750"
                     /locus_tag="TPHA_0F02750"
                     /db_xref="GeneID:11535427"
     mRNA            complement(<610335..>611543)
                     /gene="TPHA0F02750"
                     /locus_tag="TPHA_0F02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686141.1"
                     /db_xref="GeneID:11535427"
     CDS             complement(610335..611543)
                     /gene="TPHA0F02750"
                     /locus_tag="TPHA_0F02750"
                     /inference="similar to DNA sequence:INSDC:YLR291C"
                     /note="similar to Saccharomyces cerevisiae GCD7 (YLR291C);
                     ancestral locus Anc_6.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686189.1"
                     /db_xref="GeneID:11535427"
                     /db_xref="GOA:G8BUG9"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:G8BUG9"
                     /translation="MSSINLSNLANANAGGNTSAEINVMIDTFIARLKRRNIEGSYAI
                     ALETLQILKRFISAVRWSHVNELIEQIRNLGNRCEKAHPTAFTCGNVIRRVLAVIRDE
                     LEEDLRESQQQTSSPSTETIPSTIAEPMISSMFNLFQIPDESHNQEPNKSSRRSQKTK
                     TDYRQVAIQAIKDLVDEITNIDDGIQQIAIDLIHDNEILLTPTPESKTVLKFLIKARE
                     RNNRKFSVLVTEGFPNNTTKAHEFAKKLAQHNIETTVIPDSATFALMSRVGKVIVGTK
                     AVFINGGMSTSTSGVSTVCESAHQFKTPVFAVAGLYKLSPLYPFDIEKFIEFGGSQSA
                     LPKMDPENRLDTLNPITSYVPPENIDIYITNIGGFAPSFIYRIAWDNYKQIDVQLEPE
                     TPKSKSGSKK"
     gene            complement(<611977..>612576)
                     /gene="TPHA0F02760"
                     /locus_tag="TPHA_0F02760"
                     /db_xref="GeneID:11535610"
     mRNA            complement(<611977..>612576)
                     /gene="TPHA0F02760"
                     /locus_tag="TPHA_0F02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686142.1"
                     /db_xref="GeneID:11535610"
     CDS             complement(611977..612576)
                     /gene="TPHA0F02760"
                     /locus_tag="TPHA_0F02760"
                     /inference="similar to DNA sequence:INSDC:YLR292C"
                     /note="similar to Saccharomyces cerevisiae SEC72
                     (YLR292C); ancestral locus Anc_6.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686190.1"
                     /db_xref="GeneID:11535610"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BUH0"
                     /translation="MSTDLVYNTNSKQISLDESIGTSDISDATNTNIRQINKLTTAII
                     AESNPNFTPQPSDNLSKMIKSMFETGIKNLKQNKMQEALKNISLALEMSQRKRAPYEA
                     FQIQLQDMQFMLRQKIDIELILGKNLDAIQDLDMLLNTGMLDPELFLRKTDAYLKLKQ
                     YKLAISDCERGLSLFPANPKLRVMLLEAKRRFADYNGDI"
     gene            complement(<612966..>613847)
                     /gene="TPHA0F02770"
                     /locus_tag="TPHA_0F02770"
                     /db_xref="GeneID:11535652"
     mRNA            complement(<612966..>613847)
                     /gene="TPHA0F02770"
                     /locus_tag="TPHA_0F02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686143.1"
                     /db_xref="GeneID:11535652"
     CDS             complement(612966..613847)
                     /gene="TPHA0F02770"
                     /locus_tag="TPHA_0F02770"
                     /note="ancestral locus Anc_6.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686191.1"
                     /db_xref="GeneID:11535652"
                     /db_xref="UniProtKB/TrEMBL:G8BUH1"
                     /translation="MADSHFNPKKYNNIDDALKYVNEQLSLKGYFDTHNGHTNGPDSN
                     MKLLQLNNSIDDNKLIINTINKLLQSINTKNKQLEQINIEKNNLQDRLEKEIKEKTYI
                     NEKLIQFQKNTTHNRGNIQKPVHNKKLTVAKDSKYKNDLIALQKYSKINVNKLQNTID
                     ELRNSLLSTKMRKSNPGSNDLTWKIDKDITTKEDIQKQDTAPQEHVYKKYHDLIKLRL
                     ELVKFLNEVNKLTYQKNIHHFTRLNIDFIETSSIDEENSDSTKFSLKSFENDPEVYEL
                     ITDFIEIINLTNKEYIE"
     gene            <615755..>616180
                     /gene="TPHA0F02775"
                     /locus_tag="TPHA_0F02775"
                     /db_xref="GeneID:11535366"
     mRNA            <615755..>616180
                     /gene="TPHA0F02775"
                     /locus_tag="TPHA_0F02775"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686144.1"
                     /db_xref="GeneID:11535366"
     CDS             615755..616180
                     /gene="TPHA0F02775"
                     /locus_tag="TPHA_0F02775"
                     /inference="similar to DNA sequence:INSDC:YOR186W,YLR297W"
                     /note="similar to Saccharomyces cerevisiae YOR186W and
                     YLR297W; ancestral locus Anc_6.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686192.1"
                     /db_xref="GeneID:11535366"
                     /db_xref="UniProtKB/TrEMBL:G8BUH2"
                     /translation="MLTENEHILNENPTIFSTISKTVSDTISYLSSIDNRASNVAVDS
                     AQKSFDAEPLDNLIAVFIIWFIVFFVLLFFIGLVVVVLLNYRNSSNNVYNDDKLEYNE
                     DAYYDDDDDDEYYYSDEEYSSKSHSKSNDDIEKQLSSAV"
     gene            <617242..>621093
                     /gene="TPHA0F02780"
                     /locus_tag="TPHA_0F02780"
                     /db_xref="GeneID:11535367"
     mRNA            <617242..>621093
                     /gene="TPHA0F02780"
                     /locus_tag="TPHA_0F02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686145.1"
                     /db_xref="GeneID:11535367"
     CDS             617242..621093
                     /gene="TPHA0F02780"
                     /locus_tag="TPHA_0F02780"
                     /inference="similar to DNA sequence:INSDC:YOR188W"
                     /note="similar to Saccharomyces cerevisiae MSB1 (YOR188W);
                     ancestral locus Anc_6.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686193.1"
                     /db_xref="GeneID:11535367"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:G8BUH3"
                     /translation="MNSRDLPKLPASRDDESDKKNRGTITNNDDDDEFEFYHEFAREN
                     VKVIIHLITDELKTKGMDIEYLFIPFRKEQTNEKLLKFLNKLFPMAHGKKIGETKSIK
                     KIVSNTDCFTLFQALKYIWCRLPNGEIIGWNSYLEFKAREKYLGYPQKAFLEIMPKCL
                     TSSNHASIVYDFLDLIVTISSNSIVNKLSARKIAKMSAIWGFNNKHFPENIEQVNEDF
                     KFPVYNDNSIQDGIKQWLPAANAMFHLLLSFLRSFLPSDDNTGKSNSNLPKNLKNLLL
                     NNHYPPNIEKSTYSSSTILTIPVVTLNTNQFSRKAWELIERCNDILDFTNPDDFQVRE
                     DYALLKSLFRKKNNMEGISRKMSQESRRIMKAIQTKHSTFQAGWAKRTCLSDPANVLK
                     EEIEITRIDIDDYFIWTWLSSISYEETAEKKRIFGRSLILEFEFDGFKKWVVFQECDI
                     NAISSKSTTAKKQEEEIENEESYTMDSDTSKDYDKFQEQNASKIPEVRNISNISATSN
                     SSNGIYHTVISKDALNGGNHGKHNLHLIEQKISKWNPLNNLRKKSNGSSNDDSKKTND
                     NRKVSNEIISNNITTKTTPSGLAKQDVTVMETAKFNSKFKENNDYNQQPESYQNQDNY
                     TSRKNNKPPPHHSDNKKTDRVISQYSLLNSSKYQLPELETDATGFKIDLPDIDDNDIN
                     LDDNYNYNQKPVDIGEKMYLGTDAQPSVSPVKDRNSNTIDELQDMVEDMINGDGDSNT
                     NRNIDDLDVYNPAFAYSVQRQNETFESLTKFDKYKPSSKRDESEQSLQDNSLINTEIP
                     NLEKQYDSQNGRGRPTNSQASIPGSASKESSGSPDREAYSQGSYQVSSRDSTSNTTSQ
                     SPIRKRSPVRNIAGQGYSQSPIRSAGYHGNLQPYAMQEQSQSPVNLQNNTSNISQNSN
                     VISLNNQGNEMRAFDNNNYSSKSPSPGYPKQQQQGQYGIPGAIKLTSQNDRLSGDTRY
                     INNGDPSSASPNMKPIIQNSQSPSNNQRNQHQNPLGNNNASSSFPQKQHYSQYHPQQQ
                     GPPQHYSGDNSQRGYPQQGLQQDLQKIPIPNGPPQGFPQHGSQHSPQQGHQQSFQQGL
                     QKGLNPQATPHGYQQQGYSHRGPYQGPQKSPSPNAPQQGPQKNHIPNGLQQGYHQQGP
                     AQGPPQGYPHGQQKSPNPQVMPQGYPQQGYPQQGYPQSGLQKSPTPQGPPHGYPQQSY
                     PPQQGYSQQGFIPDNIPMSNGGRTKHMSMTPQAQNGEMPFNNFIPPAAGHPSKLHSAN
                     LNKTKGRKQLYNDIRSGNFGI"
     gene            <622925..>624244
                     /gene="TPHA0F02790"
                     /locus_tag="TPHA_0F02790"
                     /db_xref="GeneID:11535441"
     mRNA            <622925..>624244
                     /gene="TPHA0F02790"
                     /locus_tag="TPHA_0F02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686146.1"
                     /db_xref="GeneID:11535441"
     CDS             622925..624244
                     /gene="TPHA0F02790"
                     /locus_tag="TPHA_0F02790"
                     /inference="similar to DNA sequence:INSDC:YLR300W,YOR190W"
                     /note="similar to Saccharomyces cerevisiae EXG1 (YLR300W)
                     and SPR1 (YOR190W); ancestral locus Anc_6.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686194.1"
                     /db_xref="GeneID:11535441"
                     /db_xref="GOA:G8BUH4"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:G8BUH4"
                     /translation="MQLTFVALFLFLVSNAWSSPVPKKNENDIQFVHPQNKKRYFDYD
                     SFGQPLRGLNIGGWLVLEPYITPSLFEAFRTNPDNDNGIPVDEYHYCQYLGKDTAAER
                     LTNHWDTFYTEADFEDISKLGFNMVRLPIGYWAFKTLDNDPYVTGLQEAYLDKAIQWA
                     AKYNLKVWVDLHGAAGSQNGFDNSGLRDSINFLDDTNLALTTEVLNYILQKYSADEYL
                     DTVIGIELINEPLGPSLDMDKLKNDFLLPAYNYIRDNLQSNQVIIIHDAFQPFHYWDN
                     FLTPAQDAWGIVVDHHHYHVFSPGELSAEFDAKINDACNWGPDTLTEAHWTVAGEFSG
                     ALTDCTKWLNGVGVGARFDGTYPNSYYIGSCANNEDISTWSDERKMQTRKFIEAQLDA
                     FELRNGWVFWCYKTESTIEWDVRRLIENNLFPSPLTDRLYPNQCNFA"
     gene            <624731..>625474
                     /gene="TPHA0F02800"
                     /locus_tag="TPHA_0F02800"
                     /db_xref="GeneID:11535534"
     mRNA            <624731..>625474
                     /gene="TPHA0F02800"
                     /locus_tag="TPHA_0F02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686147.1"
                     /db_xref="GeneID:11535534"
     CDS             624731..625474
                     /gene="TPHA0F02800"
                     /locus_tag="TPHA_0F02800"
                     /inference="similar to DNA sequence:INSDC:YLR301W"
                     /note="similar to Saccharomyces cerevisiae YLR301W;
                     ancestral locus Anc_6.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686195.1"
                     /db_xref="GeneID:11535534"
                     /db_xref="UniProtKB/TrEMBL:G8BUH5"
                     /translation="MPSLLKRVLFQVGDAMNERTITYSSVSNDGHCISIRPFTKPTGE
                     KEEKFPIEWAFACTNKDVKVTKLSETSMKQDFDFLLDTNRYLAGEHEKSGDIVETQWD
                     TWESGLILEHGVVYPHGKDKEGVAFKELWQPLDCSIAEETILASSERNDVSRSIVLRT
                     EKSEKWDGLIIVTGRYVQGILLDKTKSDVTGISILRLVETGAMDSFSPLVVQGENTHK
                     FPKTYGKLELEDVIKLGGIGWEVIECHNQ"
     gene            <625876..>626289
                     /gene="TPHA0F02810"
                     /locus_tag="TPHA_0F02810"
                     /db_xref="GeneID:11535535"
     mRNA            <625876..>626289
                     /gene="TPHA0F02810"
                     /locus_tag="TPHA_0F02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686148.1"
                     /db_xref="GeneID:11535535"
     CDS             625876..626289
                     /gene="TPHA0F02810"
                     /locus_tag="TPHA_0F02810"
                     /inference="similar to DNA sequence:INSDC:YBR210W,YGL054C"
                     /note="similar to Saccharomyces cerevisiae ERV15 (YBR210W)
                     and ERV14 (YGL054C); ancestral locus Anc_6.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686196.1"
                     /db_xref="GeneID:11535535"
                     /db_xref="GOA:G8BUH6"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:G8BUH6"
                     /translation="MHNLYVYIAATIINCLNILGQIHFTVLYGDLEADYLNPIDLCSR
                     INKLVLPEALVQCFGTFLYLITGNFITFLINLPLSVFNIRKIMNKTNKLDATEIFRTL
                     KKNKTETTLKLTFYVFLFFYYVFFLIKNIIDYAST"
     gene            <627799..>629625
                     /gene="TPHA0F02820"
                     /locus_tag="TPHA_0F02820"
                     /db_xref="GeneID:11535580"
     mRNA            <627799..>629625
                     /gene="TPHA0F02820"
                     /locus_tag="TPHA_0F02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686149.1"
                     /db_xref="GeneID:11535580"
     CDS             627799..629625
                     /gene="TPHA0F02820"
                     /locus_tag="TPHA_0F02820"
                     /inference="similar to DNA sequence:INSDC:YBR212W"
                     /note="similar to Saccharomyces cerevisiae NGR1 (YBR212W);
                     ancestral locus Anc_6.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686197.1"
                     /db_xref="GeneID:11535580"
                     /db_xref="GOA:G8BUH7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BUH7"
                     /translation="MQDTDNSDPILPLPPTSTIRTSVESPRTLWMGDLNPLFDELTIT
                     KIWKSLNLPVFVKLIKARKNLLISSSSTKSQHSTSNNSPESGLSNNEDNFDLDIQRIN
                     INGVNFIDPNTVQLHHAGYCFVEFESQQDVIAALSLNKAVIPNIFSESINLYTNPNGR
                     RTFRLNWASGATLQSLIPATPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTD
                     PINGSSRGFGFIRFSDEDERKDALENMNGVMCHSRYFRLALATPRTNKFATSTNMTQV
                     REDNDGRSNSVTNVHTSPYEQTTTNINISNKFIDKLDVNNFIPTSNNSLQQSAQNIDH
                     VNLDNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANA
                     AIKGMQGFIINGNPIRLSWGKSNNNASTKLNHKHINIYNTSDSTGDTFNSSAHQQNYL
                     QQQLHQQSNNSYIYNNPPDFNFSTQAKTYNNYASTKLFFRRSESIDDEQFQQHLQANY
                     QFNQELHQQAPLLQQQLLDNTDSQVKNSNYNRNKHNLSYFTTNGHLNAYVSNVPNSEI
                     RQFSNDFNLAESQYTKENHVNNIPETNPYQLSLNNNFNGNYS"
     gene            <630038..>630916
                     /gene="TPHA0F02830"
                     /locus_tag="TPHA_0F02830"
                     /db_xref="GeneID:11535579"
     mRNA            <630038..>630916
                     /gene="TPHA0F02830"
                     /locus_tag="TPHA_0F02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686150.1"
                     /db_xref="GeneID:11535579"
     CDS             630038..630916
                     /gene="TPHA0F02830"
                     /locus_tag="TPHA_0F02830"
                     /inference="similar to DNA sequence:INSDC:YBR213W"
                     /note="similar to Saccharomyces cerevisiae MET8 (YBR213W);
                     ancestral locus Anc_6.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686198.1"
                     /db_xref="GeneID:11535579"
                     /db_xref="GOA:G8BUH8"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="UniProtKB/TrEMBL:G8BUH8"
                     /translation="MVLSLQLAHRLNNKNVLLVGGGEVALTRVEKLVITGCKITLIAN
                     DIHEDILERYAPFCLDNDSKDIINPEWEKTHPTEVYRVIRTPFEDKHFHLYQNPDGSS
                     VDSNWAMILTCIPDRAVSESIYLESKKLFGNQQLVNVADNPPYCDFYFGANLNIPATD
                     LSTQGKESLLQLLISSNGASPRFTALIRDEIDEFLRQFDIEDSVLKLGELRKQIRLQS
                     NKYVEEDNDDHLAVLKYRMQWIKKCTDIFGLQNCSRMNTEKLLTLYDKMYRDEKSTVF
                     PDSDEMLREYAITGSK"
     gene            <631693..>633615
                     /gene="TPHA0F02840"
                     /locus_tag="TPHA_0F02840"
                     /db_xref="GeneID:11535570"
     mRNA            <631693..>633615
                     /gene="TPHA0F02840"
                     /locus_tag="TPHA_0F02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686151.1"
                     /db_xref="GeneID:11535570"
     CDS             631693..633615
                     /gene="TPHA0F02840"
                     /locus_tag="TPHA_0F02840"
                     /inference="similar to DNA sequence:INSDC:YBR214W,YGL056C"
                     /note="similar to Saccharomyces cerevisiae SDS24 (YBR214W)
                     and SDS23 (YGL056C); ancestral locus Anc_6.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686199.1"
                     /db_xref="GeneID:11535570"
                     /db_xref="GOA:G8BUH9"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR016711"
                     /db_xref="UniProtKB/TrEMBL:G8BUH9"
                     /translation="MKAGKYMSGSANNSASNINAASSTQRHNSIMELLSTPPQLPHNP
                     GSASSTVTGATLGSNTNTLNVNKSGHNHHFNKSRQSSNLNDGFSQSASNAAEDPMVLG
                     RTESFSSADSISSLSITSSNNHFDMIDNNSDNNNTNSIYANITGNANNQANNANGPGS
                     PGISLHLTNSNGYNSNSILAQDSSFSHVTSTINTYPQQQQQQQQQPLLAEQQPQSQPH
                     QQQLHHDIEEYLSNVHHGELMENGDDRFPSHCISSVHAQKWQHIKLSQLIEQNKLITI
                     EGSISIEEAFNTLVKYHLTSLPVEQFSGDMDCLSFDYNDLNSYLLLVLNKISVNNEKV
                     TQDCQNGKPVPVGEIIKLTPKNPACRLPESENLSTVMGILGSGVHRVIITDNEITKMK
                     GILSQRRLVKYLWDNARSFPSLEPLLNSSLKDLQIGVFNLSSKPTSDQSRVISIRGEE
                     PLIMALYKMHTESISSIAVVDNQLNLIGNISVTDVKHVTRTSQYPLLHKTCRHFISII
                     LNSRGLENGKDSFPIFHVYPTSSLARTLAKLVATKSHRLWIVQPPEQQLNESGSASTS
                     TSNSTHSPIMTALDYSPSQTPNVSPTNLFEKEYRTGKLIGVVSLTDILSVLARKQTDN
                     KEVDPQSARRQRGYYK"
     gene            complement(<633867..>635480)
                     /gene="TPHA0F02850"
                     /locus_tag="TPHA_0F02850"
                     /db_xref="GeneID:11535571"
     mRNA            complement(<633867..>635480)
                     /gene="TPHA0F02850"
                     /locus_tag="TPHA_0F02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686152.1"
                     /db_xref="GeneID:11535571"
     CDS             complement(633867..635480)
                     /gene="TPHA0F02850"
                     /locus_tag="TPHA_0F02850"
                     /inference="similar to DNA sequence:INSDC:YDL156W"
                     /note="similar to Saccharomyces cerevisiae YDL156W;
                     ancestral locus Anc_7.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686200.1"
                     /db_xref="GeneID:11535571"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BUI0"
                     /translation="MVELTEFQKKRQENIKRNNDLMKKLQLGGVASQIKRESGIDDEK
                     ALNAKKKRKAPSVAKRAASPKVSAMPTRRSRRLRGENVNGEGIPNVNDTQLLKMGLDN
                     SSDSASMDKELLDDIKDTAVIGDVKLSDLIKDENEDNLIEKFKSFSNKNFSSGDFFEE
                     LKNRQTLERSPDLEQQQNDFDLKLYDVFQPNEIKIVYERIAATYFHPAIDQKLIVAGD
                     TSGTVGLWKVRDEPLSESGEDQMVEPDITRVKLFTKNVGRIDCYATDSSKLLIASYDG
                     SLRSIHLNGLESQEIMTLKNEYDEPLGISDFQFSYEDPNVLFFTTLSGEFATIDLRVK
                     GIQESVTSNLRRLADKKIGSFSINPARPYEIATGSLDRTLKIWDIRKLVDKPEWSQYE
                     DFPSHEVVSTYDSRLSVSGVSYSPTDGTLVCNGYDDTIRLFDTSSSSLPTDLQPKLTL
                     KHNCQTGRWTSILKARFKSDQNVFAIANMKRAIDIYNSSGQQLAHLPTATVPAVLSWH
                     PLQNWIAGGNSSGKIFLFTDSNIKEEDKS"
     gene            <635994..>636332
                     /gene="TPHA0F02860"
                     /locus_tag="TPHA_0F02860"
                     /db_xref="GeneID:11535485"
     mRNA            <635994..>636332
                     /gene="TPHA0F02860"
                     /locus_tag="TPHA_0F02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686153.1"
                     /db_xref="GeneID:11535485"
     CDS             635994..636332
                     /gene="TPHA0F02860"
                     /locus_tag="TPHA_0F02860"
                     /inference="similar to DNA sequence:INSDC:YDL157C"
                     /note="similar to Saccharomyces cerevisiae YDL157C;
                     ancestral locus Anc_7.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686201.1"
                     /db_xref="GeneID:11535485"
                     /db_xref="UniProtKB/TrEMBL:G8BUI1"
                     /translation="MSSNILAVFNPPPARDMDKSEYQDCLPCQIMSSFFAIGFGSYLA
                     SGKPFKYGEKERKAGMSLADFDKRNPKWWRGTMRGLGGSLVVLGVIRGTEGWMWNKDK
                     QYKKILNNDD"
     gene            complement(<636574..>638259)
                     /gene="TPHA0F02870"
                     /locus_tag="TPHA_0F02870"
                     /db_xref="GeneID:11535432"
     mRNA            complement(<636574..>638259)
                     /gene="TPHA0F02870"
                     /locus_tag="TPHA_0F02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686154.1"
                     /db_xref="GeneID:11535432"
     CDS             complement(636574..638259)
                     /gene="TPHA0F02870"
                     /locus_tag="TPHA_0F02870"
                     /inference="similar to DNA sequence:INSDC:YDL159W"
                     /note="similar to Saccharomyces cerevisiae STE7 (YDL159W);
                     ancestral locus Anc_7.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686202.1"
                     /db_xref="GeneID:11535432"
                     /db_xref="GOA:G8BUI2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BUI2"
                     /translation="MHSRFQKNTLERRNAKQLMLSDEISTTDDNKNNIFKYGGSDLSL
                     RRNFKKKLTLNQKGSENDSHSMDDGNHAGNDDNIDDREDENANENLLMEFSQTNNKLF
                     SRGNPLHHSQDSLLKTTQIKDNCIQINNSNLHDYSKTTSEESLNYLLSTQRKSVISSS
                     STATSEMSPVSSMHSKLKGLTPDGEEAMFTEKDKNSLSCNTSYQIDPQNLVQLGKIGS
                     GNSGTVTKALHVPNSTIIAKKVIPVEMNNEAVIKQIMRELTIMKSVKTHPNIVEFFGA
                     FTNHHDNNELVILLEYMNCGSLDQIIKINKSMQVLDETQNNPHLGMVTWFNELSISVI
                     SYSVLTALDYLYSNYKIIHRDIKPSNVLINSQGQVKICDFGVSRKMVNSIVDTFVGTS
                     TYMSPERIQGNVYSTKGDVWSLGLMIIELITGEFPLNNDGVDNSSPDGILDLLQRIVN
                     EPSPKLPTASDKDQTTSAYSVEITDFVNRCCIKSEKERSPINELLCHDFIVKYNTNSN
                     STHHNINREFRRWCKDIKTEIKKHKQMRREEIERVKYEKKQLERSAEAALARR"
     gene            <639397..>640338
                     /gene="TPHA0F02880"
                     /locus_tag="TPHA_0F02880"
                     /db_xref="GeneID:11535433"
     mRNA            <639397..>640338
                     /gene="TPHA0F02880"
                     /locus_tag="TPHA_0F02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686155.1"
                     /db_xref="GeneID:11535433"
     CDS             639397..640338
                     /gene="TPHA0F02880"
                     /locus_tag="TPHA_0F02880"
                     /inference="similar to DNA sequence:INSDC:YLR209C"
                     /note="similar to Saccharomyces cerevisiae PNP1 (YLR209C);
                     ancestral locus Anc_7.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686203.1"
                     /db_xref="GeneID:11535433"
                     /db_xref="GOA:G8BUI3"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="UniProtKB/TrEMBL:G8BUI3"
                     /translation="MDKFNIEDYREKIAKSAIFIKDQVEAHFGNTFQPRVLIICGSGL
                     GGITNRVATYPVPLKVPYAVIPGFKVSTVFGHEGSLLFGEIEGTPVVVMSGRLHGYEG
                     HTIYDTVFPIRALHEFSQIATMGSLSNLIVTNAAGATNPDYTVCDLMCIIDHINIPGL
                     AGAMHPLKGPNMDEYGPRFLALSDAYDLDLRRLLFQKQKELNIERKIHEGTYTFVSGP
                     TFESRAEVRMIKAMGGDAVGMSTVPEVIVARHCGWKVLAMSLITNECVSDPPASVFDI
                     DAVPLDKSLATHAEVLLNGTKASGDVEALVQAVVSEL"
     gene            complement(<640553..>641440)
                     /gene="TPHA0F02890"
                     /locus_tag="TPHA_0F02890"
                     /db_xref="GeneID:11535365"
     mRNA            complement(<640553..>641440)
                     /gene="TPHA0F02890"
                     /locus_tag="TPHA_0F02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686156.1"
                     /db_xref="GeneID:11535365"
     CDS             complement(640553..641440)
                     /gene="TPHA0F02890"
                     /locus_tag="TPHA_0F02890"
                     /inference="similar to DNA sequence:INSDC:YLR208W"
                     /note="similar to Saccharomyces cerevisiae SEC13
                     (YLR208W); ancestral locus Anc_7.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686204.1"
                     /db_xref="GeneID:11535365"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BUI4"
                     /translation="MVSIANPHSDLIHDTALDYYGKRLATCSSDKTIKIFDIEGGNQR
                     LVDTLFGHEGPVWRVEWAHPKFGNTLASCSYDGKVLIWKEENGKWSQIAVHSTHTASV
                     NSVKWAPHEYGALLLAGSSDGKVSIIEFEENGSLTPIVIDAHSIGVNSVCWAPAVVEE
                     QNKSLKQLRRFVTGGADNLVKVWKYESNSKTYSLEESLEGHSDWVRDVAWSPSLLSQS
                     YIASVSQDRTCVIWTQVNNDGPWKKTLLKSEKFSDVLWRASWSLSGNVLAISGGDNKV
                     TLWKQNLSGSWDSAGEVQQ"
     gene            complement(<641825..>644122)
                     /gene="TPHA0F02900"
                     /locus_tag="TPHA_0F02900"
                     /db_xref="GeneID:11535524"
     mRNA            complement(<641825..>644122)
                     /gene="TPHA0F02900"
                     /locus_tag="TPHA_0F02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686157.1"
                     /db_xref="GeneID:11535524"
     CDS             complement(641825..644122)
                     /gene="TPHA0F02900"
                     /locus_tag="TPHA_0F02900"
                     /inference="similar to DNA sequence:INSDC:YLR207W"
                     /note="similar to Saccharomyces cerevisiae HRD3 (YLR207W);
                     ancestral locus Anc_7.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686205.1"
                     /db_xref="GeneID:11535524"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BUI5"
                     /translation="MLLHRLCFTLVVSVNVLAQLVDPWNDVKTLLNEPQFNVDYFASD
                     NKMLDSKRLQLSDAYSPEQQLKEYDEFWNEQNSTNSLQLKLYNDLQISAEKFNNAEAL
                     YKLANINLLGSYGLPQNKTLAVEYLMRFNEVTNYTNSTGLFEMAVIYSTGLLGTIPID
                     TPKSLVYYEKSALLGDIRAKQALAYRYLAGLNVPRDCDKALLLYREVADYIKNTYTPE
                     EWNIFFPPLETYNIRVSDFEDGLIGSGLNTISASLTRTPSQKPDLSSIFYTQMNEGRI
                     VLSFTSENMFADDDDQMIDELVDIYYTALDMYKGTYNKRRDPERARIALENVYMEYDD
                     TTVLMENIQLYFYSKCIDLLGHLYLTGEGVPTADVATAEFYLKRSVEVLKPLTYIRSG
                     AYRDLGLISQYAYNNITKAAQYYKYMTGMNDEDGNDFFQLSKISIAHPEMKLGDPFVL
                     MQQAYSRGHVPSIYEFAKMLEDGFNNQHSCDDTAFLYKHFIEKNDHISAPQLKEAYVN
                     LLLGKTEAAIWGYLQAGEQGWEPALVSTAYLLYRMSPLLDDEYVTSEERKQLSISYYS
                     RAFNLHNTDAGVIAGNLYYNMGDYPRAITMYQSASLRYSSSALWNLGYMYEYGLGVEK
                     DYYLAKRFYDEALEYDKNILLGVKLSLLKLQLKAWWSRINGYNTSSDDKNIDLFNSIP
                     WYMQIITIFKNIINDNSRHSRTGSNADFHFGTYITTITEILGLTTEDLYGVAIVGLIF
                     LFYILVRAIARRQGVQIRVNDQRLV"
     gene            <644434..>644760
                     /gene="TPHA0F02910"
                     /locus_tag="TPHA_0F02910"
                     /db_xref="GeneID:11535453"
     mRNA            <644434..>644760
                     /gene="TPHA0F02910"
                     /locus_tag="TPHA_0F02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686158.1"
                     /db_xref="GeneID:11535453"
     CDS             644434..644760
                     /gene="TPHA0F02910"
                     /locus_tag="TPHA_0F02910"
                     /inference="similar to DNA sequence:INSDC:YDL160C-A"
                     /note="similar to Saccharomyces cerevisiae YDL160C-A;
                     ancestral locus Anc_7.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686206.1"
                     /db_xref="GeneID:11535453"
                     /db_xref="GOA:G8BUI6"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR018552"
                     /db_xref="UniProtKB/TrEMBL:G8BUI6"
                     /translation="MNEEELDGPIPKDTIARILQLESFGEETRISAESVGILQKYMEL
                     FVREAVLRSIENREQKQSNIEALKKAPAKANPDQLQTFQHSFNGIELTHEDLEEISGL
                     LLLDMS"
     gene            <645567..>646529
                     /gene="TPHA0F02920"
                     /locus_tag="TPHA_0F02920"
                     /db_xref="GeneID:11535454"
     mRNA            <645567..>646529
                     /gene="TPHA0F02920"
                     /locus_tag="TPHA_0F02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686159.1"
                     /db_xref="GeneID:11535454"
     CDS             645567..646529
                     /gene="TPHA0F02920"
                     /locus_tag="TPHA_0F02920"
                     /inference="similar to DNA sequence:INSDC:YLR205C"
                     /note="similar to Saccharomyces cerevisiae HMX1 (YLR205C);
                     ancestral locus Anc_7.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686207.1"
                     /db_xref="GeneID:11535454"
                     /db_xref="GOA:G8BUI7"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="UniProtKB/TrEMBL:G8BUI7"
                     /translation="MSNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALR
                     HGFIYRQGLVAFYHIFGTIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDN
                     LLQDLTVLYYPEFKGNRQDVLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAY
                     CHVLYLALFAGGKIMKSNVLKNVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSK
                     LRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLK
                     TITYLVEEWKYNEKLTKTNKQIILLIISIINILITYTIIKWFLS"
     gene            <647081..>648391
                     /gene="TPHA0F02930"
                     /locus_tag="TPHA_0F02930"
                     /db_xref="GeneID:11535368"
     mRNA            <647081..>648391
                     /gene="TPHA0F02930"
                     /locus_tag="TPHA_0F02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686160.1"
                     /db_xref="GeneID:11535368"
     CDS             647081..648391
                     /gene="TPHA0F02930"
                     /locus_tag="TPHA_0F02930"
                     /inference="similar to DNA sequence:INSDC:YLR203C"
                     /note="similar to Saccharomyces cerevisiae MSS51
                     (YLR203C); ancestral locus Anc_7.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686208.1"
                     /db_xref="GeneID:11535368"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:G8BUI8"
                     /translation="MTVLMSSINTLRHPMSMNILNKNTLTSLPSSQKRSLMGFVKNAL
                     GLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYTCPLSGIP
                     THHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRVVNLTN
                     WDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGLKSL
                     AALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEIH
                     FIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVF
                     FTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDT
                     LMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR"
     gene            complement(<648881..>649456)
                     /gene="TPHA0F02940"
                     /locus_tag="TPHA_0F02940"
                     /db_xref="GeneID:11535476"
     mRNA            complement(<648881..>649456)
                     /gene="TPHA0F02940"
                     /locus_tag="TPHA_0F02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686161.1"
                     /db_xref="GeneID:11535476"
     CDS             complement(648881..649456)
                     /gene="TPHA0F02940"
                     /locus_tag="TPHA_0F02940"
                     /inference="similar to DNA sequence:INSDC:YDL165W"
                     /note="similar to Saccharomyces cerevisiae CDC36
                     (YDL165W); ancestral locus Anc_7.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686209.1"
                     /db_xref="GeneID:11535476"
                     /db_xref="GOA:G8BUI9"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:G8BUI9"
                     /translation="MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIP
                     NNNKRYRVLDTFQSPWAETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQ
                     RISLFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTAD
                     GQSERGSYIFFDPQRWEKCQRDFVLFYNAIM"
     gene            <649875..>650525
                     /gene="TPHA0F02950"
                     /locus_tag="TPHA_0F02950"
                     /db_xref="GeneID:11535477"
     mRNA            <649875..>650525
                     /gene="TPHA0F02950"
                     /locus_tag="TPHA_0F02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686162.1"
                     /db_xref="GeneID:11535477"
     CDS             649875..650525
                     /gene="TPHA0F02950"
                     /locus_tag="TPHA_0F02950"
                     /inference="similar to DNA sequence:INSDC:YDL166C"
                     /note="similar to Saccharomyces cerevisiae FAP7 (YDL166C);
                     ancestral locus Anc_7.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686210.1"
                     /db_xref="GeneID:11535477"
                     /db_xref="GOA:G8BUJ0"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ0"
                     /translation="MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKE
                     HNCYDGFDEGRKSHIVDEDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCD
                     NSVLYDRLKSRGYHDSKIDENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENV
                     DKIVDWVELWIKQHKNGVTNELSKKAASSANESASESEQKEEEEEEEEEEGSDDGN"
     gene            <651108..>653072
                     /gene="TPHA0F02960"
                     /locus_tag="TPHA_0F02960"
                     /db_xref="GeneID:11535578"
     mRNA            <651108..>653072
                     /gene="TPHA0F02960"
                     /locus_tag="TPHA_0F02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686163.1"
                     /db_xref="GeneID:11535578"
     CDS             651108..653072
                     /gene="TPHA0F02960"
                     /locus_tag="TPHA_0F02960"
                     /inference="similar to DNA sequence:INSDC:YDL167C"
                     /note="similar to Saccharomyces cerevisiae NRP1 (YDL167C);
                     ancestral locus Anc_7.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686211.1"
                     /db_xref="GeneID:11535578"
                     /db_xref="GOA:G8BUJ1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ1"
                     /translation="MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVK
                     KNDVVILSLGDSMANGDIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPR
                     QSNDEGIILPSFLKLPIIFDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQ
                     NSDAKTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYN
                     SNVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTN
                     SNGNSNNSPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVE
                     LQPSSMVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAATSN
                     NGNGTNVNNTINTRKYNNGNNENSLNSANKNTMNSYSLNQYQLDNKDRISTDIHSPMD
                     SSNYNNMGIYGGNISAGNNILTQNSNMIMNNVNNHNLLSNYDNLTGNIGYSLNNGHTN
                     NQYRYNHNNHLGFQNNAYNANNNRYSNQGNGLNNGGSNVPFRAGDWKCSACSYHNFAK
                     NIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGHSNHKSQYNDHEKMGSNNRVDTPTS
                     SSTVSSEDLHDKNINKEYYIDNKKHNNSFV"
     gene            complement(<653405..>654550)
                     /gene="TPHA0F02970"
                     /locus_tag="TPHA_0F02970"
                     /db_xref="GeneID:11535391"
     mRNA            complement(<653405..>654550)
                     /gene="TPHA0F02970"
                     /locus_tag="TPHA_0F02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686164.1"
                     /db_xref="GeneID:11535391"
     CDS             complement(653405..654550)
                     /gene="TPHA0F02970"
                     /locus_tag="TPHA_0F02970"
                     /inference="similar to DNA sequence:INSDC:YDL168W"
                     /note="similar to Saccharomyces cerevisiae SFA1 (YDL168W);
                     ancestral locus Anc_7.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686212.1"
                     /db_xref="GeneID:11535391"
                     /db_xref="GOA:G8BUJ2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014183"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ2"
                     /translation="MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKT
                     AVCHTDAYSLSGVDPEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKC
                     KFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSL
                     VAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRG
                     ASKIIVVDLNNDKKDWSFEFGATDFVNPKELKDSEDIVSKLIEMTDGGLDFTFDCTGN
                     VNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMG
                     GLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNGSCLRTVLDTST"
     gene            <655375..>656169
                     /gene="TPHA0F02980"
                     /locus_tag="TPHA_0F02980"
                     /db_xref="GeneID:11535670"
     mRNA            <655375..>656169
                     /gene="TPHA0F02980"
                     /locus_tag="TPHA_0F02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686165.1"
                     /db_xref="GeneID:11535670"
     CDS             655375..656169
                     /gene="TPHA0F02980"
                     /locus_tag="TPHA_0F02980"
                     /inference="similar to DNA sequence:INSDC:YLR201C"
                     /note="similar to Saccharomyces cerevisiae COQ9 (YLR201C);
                     ancestral locus Anc_7.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686213.1"
                     /db_xref="GeneID:11535670"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ3"
                     /translation="MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQF
                     KILSHAIDNTVTKFGFSERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMEL
                     LKFNLVLKRYRMIEGLDPLTMQQEELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPG
                     PFLLDSALPELHRLADDMIYFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNY
                     KETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLLNSVNMVKSRMSRA"
     gene            complement(<656466..>656789)
                     /gene="TPHA0F02990"
                     /locus_tag="TPHA_0F02990"
                     /db_xref="GeneID:11535671"
     mRNA            complement(<656466..>656789)
                     /gene="TPHA0F02990"
                     /locus_tag="TPHA_0F02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686166.1"
                     /db_xref="GeneID:11535671"
     CDS             complement(656466..656789)
                     /gene="TPHA0F02990"
                     /locus_tag="TPHA_0F02990"
                     /inference="similar to DNA sequence:INSDC:YLR200W"
                     /note="similar to Saccharomyces cerevisiae YKE2 (YLR200W);
                     ancestral locus Anc_7.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686214.1"
                     /db_xref="GeneID:11535671"
                     /db_xref="GOA:G8BUJ4"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ4"
                     /translation="MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNE
                     DTPIYKLTGNVMLPIEQFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMK
                     MRGAN"
     gene            <657195..>658153
                     /gene="TPHA0F03000"
                     /locus_tag="TPHA_0F03000"
                     /db_xref="GeneID:11535364"
     mRNA            join(<657195..657200,657311..>658153)
                     /gene="TPHA0F03000"
                     /locus_tag="TPHA_0F03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686167.1"
                     /db_xref="GeneID:11535364"
     CDS             join(657195..657200,657311..658153)
                     /gene="TPHA0F03000"
                     /locus_tag="TPHA_0F03000"
                     /inference="similar to DNA sequence:INSDC:YLR199C"
                     /note="similar to Saccharomyces cerevisiae PBA1 (YLR199C);
                     ancestral locus Anc_7.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686215.1"
                     /db_xref="GeneID:11535364"
                     /db_xref="InterPro:IPR018855"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ5"
                     /translation="MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYE
                     DFENVIVTTKTMNALFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNE
                     VDIYSQEAIESEIGSNESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKIL
                     KVILTFCNSNIGILTLGTSDRVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP
                     NYKAVIVPSEGPIGFEKLSIETISELIDICKENLNINDPKYSNESHRLWKVAGSAMGA
                     QTGLYI"
     gene            complement(<658541..>660070)
                     /gene="TPHA0F03010"
                     /locus_tag="TPHA_0F03010"
                     /db_xref="GeneID:11535605"
     mRNA            complement(<658541..>660070)
                     /gene="TPHA0F03010"
                     /locus_tag="TPHA_0F03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686168.1"
                     /db_xref="GeneID:11535605"
     CDS             complement(658541..660070)
                     /gene="TPHA0F03010"
                     /locus_tag="TPHA_0F03010"
                     /inference="similar to DNA sequence:INSDC:YLR197W"
                     /note="similar to Saccharomyces cerevisiae SIK1 (YLR197W);
                     ancestral locus Anc_7.354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686216.1"
                     /db_xref="GeneID:11535605"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ6"
                     /translation="MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSF
                     TKLVELVSFAPFKGAAEALENANDISEGLVSENLKALLDLNLPKGSEKKSVVLGISDK
                     NLGPSIKEDFPYVDCMANELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRA
                     KVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARL
                     VLFIKDKASLNDESLHDLTAILNDDAGISQRVIDNARISMGQDLSETDMDNICVFAKR
                     VVSLVEYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYHSGFIAKAAAKNKGRISRYLANKCSMASRIDNYS
                     DEPTNVFGSVLKKQVEQRLEFYATGSPTLKNELAIQEAMKLYNKDAPKSEDAAEETKS
                     SKKRKLEVSDSEDEEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKEKKDKKEKKDKKKK
                     D"
     gene            <661109..>661576
                     /gene="TPHA0F03020"
                     /locus_tag="TPHA_0F03020"
                     /db_xref="GeneID:11535360"
     mRNA            <661109..>661576
                     /gene="TPHA0F03020"
                     /locus_tag="TPHA_0F03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686169.1"
                     /db_xref="GeneID:11535360"
     CDS             661109..661576
                     /gene="TPHA0F03020"
                     /locus_tag="TPHA_0F03020"
                     /inference="similar to DNA sequence:INSDC:YDL169C"
                     /note="similar to Saccharomyces cerevisiae UGX2 (YDL169C);
                     ancestral locus Anc_7.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686217.1"
                     /db_xref="GeneID:11535360"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ7"
                     /translation="MSRTVEYDDKLLVYSDRMSERLEESNHYLITVSSSEGFKWNQDI
                     FASQYQQSYRVVYDGYDDSYDDLLESFEAKLKQIEVDDIDGGTWPPYNQADIIDDLLF
                     RLQSQLRRSRRKSVHSISFLSDSKTGNFSKQIPVHISIDEETNEDDYFKWLAS"
     gene            complement(<661801..>663549)
                     /gene="TPHA0F03030"
                     /locus_tag="TPHA_0F03030"
                     /db_xref="GeneID:11535361"
     mRNA            complement(<661801..>663549)
                     /gene="TPHA0F03030"
                     /locus_tag="TPHA_0F03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686170.1"
                     /db_xref="GeneID:11535361"
     CDS             complement(661801..663549)
                     /gene="TPHA0F03030"
                     /locus_tag="TPHA_0F03030"
                     /inference="similar to DNA sequence:INSDC:YLR196W"
                     /note="similar to Saccharomyces cerevisiae PWP1 (YLR196W);
                     ancestral locus Anc_7.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686218.1"
                     /db_xref="GeneID:11535361"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ8"
                     /translation="MISATSWVPRGFASEFPVQYELDDEEMERINQLAKLNLEDAKAD
                     LEDVEQDNDETEATELDEEKGSKSSEKLKDQIDIDDNLKEFDLEHYDEEPSGTGEDVS
                     IFPGLANEEVKFYEGEEGEDPYITLPTQEDTKEEKEELQVYPTDNMVLATRTEDDISY
                     LDVYVYDDGAGFHDSEIPTEKGDEFDPDVARGFVRDSSLYVHHDLMLPAFPLCVEWLN
                     YRPGSNSEDPANFAAIGTFDPNIEIWNLDITEKAFPDMILGEPMENSMLGMTGKKKKK
                     NSKSKKQHITTHHTDAILSLSHNKHFRSVLASTSADHTVKIWDLNSGDAARSLASIHN
                     NTNVSSSEWHWTNGSILLTSGYDSRVALSDVRISDESQMSKYWSVMGGEDIETATFAD
                     ENIILCGTDAGNVYSFDVRNGDASKPVWTLKAHDAGISTLNSNRFIPGMMSTGAMGEK
                     TLKLWKFPVSESTSKGPRMVLSRDFDVGNVLSSSFAPDIEVSGNIVIGGVNGGLKLWD
                     VFSNRTVRKIFNDELHGVQKRARDEAKQNGRSSRITRKYIKNDNPDTVLTIEDKGEDE
                     EEREGEDDEGDWEDDM"
     gene            <663914..>665299
                     /gene="TPHA0F03040"
                     /locus_tag="TPHA_0F03040"
                     /db_xref="GeneID:11535375"
     mRNA            <663914..>665299
                     /gene="TPHA0F03040"
                     /locus_tag="TPHA_0F03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686171.1"
                     /db_xref="GeneID:11535375"
     CDS             663914..665299
                     /gene="TPHA0F03040"
                     /locus_tag="TPHA_0F03040"
                     /inference="similar to DNA sequence:INSDC:YLR195C"
                     /note="similar to Saccharomyces cerevisiae NMT1 (YLR195C);
                     ancestral locus Anc_7.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686219.1"
                     /db_xref="GeneID:11535375"
                     /db_xref="GOA:G8BUJ9"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="UniProtKB/TrEMBL:G8BUJ9"
                     /translation="MERKLNPETDKKKIEDVLRLLKLNDVDLSKLSEQQRKEMKDHKF
                     WKTQPVPSFDEKIEEEGPIHSDKTPDDIPNEPLPMLPDFEWCTVDIEDEGQLENVFVL
                     LNENYVEDRDAEFRFNYTKDFFKWALKCPGWKPEWNVGVRVKSTGKLVSFISAIPVDL
                     RVRSKFLKSVEINFLCIHKQLRSKRLAPVLIKEITRRVNKENIWHALYTAGTVLPSPI
                     STCRYTHRPLNWSKLCEVGFTALPEGKTNPQMVAQYTLPKGPLMKGFRPLELKDIDET
                     LSLFNRYQERFDLVQLFSKEEFKHWFLGSTDSKVSTESEVIYSYVVENENGKIVDFVS
                     FYSLPFTILNNAVYKNLGIGYLFYYASDADFTYTDRLNPEASEKLKKRLNSLVKDVLI
                     IAKSNKMDVFNALTSQDNSLFLDDLKFGPGDGFLNFYLFNYRAFPVHGGITETKKYDV
                     EKRSDVGIVML"
     gene            <666209..>667081
                     /gene="TPHA0F03050"
                     /locus_tag="TPHA_0F03050"
                     /db_xref="GeneID:11535581"
     mRNA            <666209..>667081
                     /gene="TPHA0F03050"
                     /locus_tag="TPHA_0F03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686172.1"
                     /db_xref="GeneID:11535581"
     CDS             666209..667081
                     /gene="TPHA0F03050"
                     /locus_tag="TPHA_0F03050"
                     /inference="similar to DNA sequence:INSDC:YLR194C"
                     /note="similar to Saccharomyces cerevisiae YLR194C;
                     ancestral locus Anc_7.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686220.1"
                     /db_xref="GeneID:11535581"
                     /db_xref="UniProtKB/TrEMBL:G8BUK0"
                     /translation="MKFSTSALLLTNTVAIASAYENLVAVSNVEGTAAAQTAATQAAA
                     VDGQYSSLVAVSNVEGPLTTVTAAQTSLVAVSNVEGVSSTADASAQEYAVEPSTTVTT
                     TDYLGRTTTEVLWYLPETSVAVASAVSGAETISSAANTDAVVKSVKSAETEKATSSQI
                     AASNNAEALTSSIRNWDEALTTVTATNSDGVVYTSKIWWLPSTSETEATASNDEDAEY
                     TTSYSKYETTYTSTSESELETITTTFSTAIVMRVASTNSTASVHSNATNGAFKNEYGF
                     GAGAGMVALAAFLL"
     gene            <667879..>668400
                     /gene="TPHA0F03060"
                     /locus_tag="TPHA_0F03060"
                     /db_xref="GeneID:11535582"
     mRNA            <667879..>668400
                     /gene="TPHA0F03060"
                     /locus_tag="TPHA_0F03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686173.1"
                     /db_xref="GeneID:11535582"
     CDS             667879..668400
                     /gene="TPHA0F03060"
                     /locus_tag="TPHA_0F03060"
                     /inference="similar to DNA sequence:INSDC:YLR193C"
                     /note="similar to Saccharomyces cerevisiae UPS1 (YLR193C);
                     ancestral locus Anc_7.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686221.1"
                     /db_xref="GeneID:11535582"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:G8BUK1"
                     /translation="MVLWHKNTHIFPNDFTSVSLAFFNRYPNPYASHVLSIDTLERRI
                     DSDGNLHTVRLIKKKGKLPRWVRPLLNNISDSWIVEFSVVDPRLNILKTYTKNLDHTR
                     IIKVEEFTDYQYDKANEYTSVNSMVKFSSGFRLGIKNKIENWSLNKFNENIINSRRGM
                     SFVMKKIKERTLE"
     gene            <670009..>676428
                     /gene="TPHA0F03070"
                     /locus_tag="TPHA_0F03070"
                     /db_xref="GeneID:11535386"
     mRNA            <670009..>676428
                     /gene="TPHA0F03070"
                     /locus_tag="TPHA_0F03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686174.1"
                     /db_xref="GeneID:11535386"
     CDS             670009..676428
                     /gene="TPHA0F03070"
                     /locus_tag="TPHA_0F03070"
                     /inference="similar to DNA sequence:INSDC:YDL171C"
                     /note="similar to Saccharomyces cerevisiae GLT1 (YDL171C);
                     ancestral locus Anc_7.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686222.1"
                     /db_xref="GeneID:11535386"
                     /db_xref="GOA:G8BUK2"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006005"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BUK2"
                     /translation="MTTLQSDTFDPLEESYQGGSTLNIEKVKHDHVSWSNVIPDKVGL
                     YDPDYEKDACGVGFVSNIKGIQSHKIVSDARFLLCNMTHRGAVSSDGNGDGAGILIAI
                     PHEFMTREFKLDLNIDVPGQGHYAVGNVFFKKDFPTELLESSKLVFEKLASDLNLKVL
                     GWRNVPCDSSILGQVALSREPTILQPIIVLSTDDQSESFNEFAFQKQLYLLRKKATSA
                     IGISNGFYVCSLNNKTIVYKGQLTPSQVYNYYPDLTNAYFKSHLALVHSRFSTNTFPS
                     WDRAQPLRLLAHNGEINTLRGNKNSMHAREGVMSSETFKDSLNDLYPIIEEGGSDSAS
                     LDNVLELLTINGVLSLPEAIMLMVPEAYHKDMDSNLKAWFEWAACLMEPWDGPALLTF
                     TDGRYIGAMLDRNGLRPCRYYLTNDDRVICASEVGVIPIDPSLVIQKGKLKPGDLFLV
                     DTEQGSIVDSKALKMQFAKRRDFKSWLSKVIKLEDIVSKLEDSLPSGIFDASELTESS
                     KVQSDPRLLANGYTLEHVSMLLTPMALTGKEALGSMGNDAPLACLNEDPVLVYDYFRQ
                     LFAQVTNPPIDPIREANVMSLECYVGPQGNLLEMNATQCNRLFLKSPVLQWKEFEALK
                     LIEKVHPTWTVANIDITFEKSEGLLGYTDAIGRVTSEVSEAIEGGKKIIILTDRALSA
                     SRVSLSSLIAVGAVHHHLVRNRQRSQAAIIVESAEVKEIHHFCVLLGYGCDAIYPYLA
                     MESLVRLNNEGLLRNIENDEIMLDSDTILENYKHAIDSGILKVMSKMGISTLASYKGA
                     QIFEALGLDNSVIDLCFAGTASRIRGVTFEYIAQDAFSLHERGYPSRKTVSRSINLPE
                     SGEYHYRDSGYKHINDPTAIATLQDVVRNKNEDAWELYVKKETEAIRDCTLRGLLELD
                     YENSSSIPVEQVEPWTEIARRFATGAMSYGSISMEAHSTLAIAMNRLGAKSNCGEGGE
                     DAERSIVSPNGDTMRSAIKQVASARFGVTSYYLSDADEIQIKVAQGAKPGEGGELPAH
                     KVSKEIAKTRHSTPNVGLISPPPHHDIYSIEDLKQLIYDLKCANPRAGISVKLVSEVG
                     VGIVASGVAKAKADHILVSGHDGGTGAARWTSVKYAGLPWELGLAETHQTLVLNDLRR
                     NVVVQTDGQLRTGFDIAVAVLLGAESFTLATIPLIAMGCVMLRRCHLNSCAVGIATQD
                     PFLRSKFKGQPEHVINFFYYLIQDLRKIMAKLGYRSIDEMVGHSEKLRKRADVNPKAI
                     NIDLSPILTAAHSIRPGVPTRFVKKQDLKLHTRLDNKLIDEAEITLDRGLPVTIEANI
                     INTDRAFGSTLSYRISKKFGEKGLPKDTVVVNITGSAGQSFGAFLASGITFILAGDAN
                     DYVGKGLSGGTIVIKPPKNSTFRSDENVIVGNTCFYGATSGSAFISGSAGERFGVRNS
                     GATIVVEKIKGNNAFEYMTGGRAVVLSQLESLNAFSGATGGIIYCLTSDFDDFSGKIN
                     HDTVVLESLTSTDEIAFVKNLIQEHYNFTKSTLAHKILGNFNHYLNNFVKVIPTDYKK
                     VLEKEVADVIVKKEFETQHYLKQFERSKDVIDATNGDIDKMLAIKMAETIISNKSILH
                     EPKVLDLEDSIPDSESITSNVEKVEKIRGFIKYKVRKESYRLARLRSKDWKEISNAIS
                     KKDAKYQTARCMDCGTPFCLSDTGCPISNIIPKFNDLVFKDQWKLALEKLLETNNFPE
                     FTGRVCPAPCQGACTLGIIAAPVGIKSIERLIIDNAFKEKWIKPCPPEIRTGNRVAII
                     GSGPAGMACADQLNKAGHFVTVYERADRCGGLLMYGIPNMKLDKKIVQRRIKLLEDEG
                     ITFITNTEVGKDIQLSQLKSQFNAIVFTIGSTIPRDLNIKGRELKNIDFAMTLLKDNT
                     EALLKKDLETVRASLEGKKVIVIGGGDTGNDCLGTSVRHGAASVLNFELLPQPPAERA
                     KDNPWPQWPRIMRIDYGHAEVKEHYGRDPREYCILSKEFIGNEQGEVKAIKTVRVEWK
                     KSESGVWQMIEIPGSEETFEADVVLLSMGFTGPELINDESIVKNKRGTIETLTASSYS
                     IDGDKLFAAGDCRRGQSLIVWAIQEGRKCAAAIDQHLMGNTYLPGNGGIVKRDYNLLE
                     ELASKIN"
     gene            complement(<676724..>677353)
                     /gene="TPHA0F03080"
                     /locus_tag="TPHA_0F03080"
                     /db_xref="GeneID:11535545"
     mRNA            complement(<676724..>677353)
                     /gene="TPHA0F03080"
                     /locus_tag="TPHA_0F03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686175.1"
                     /db_xref="GeneID:11535545"
     CDS             complement(676724..677353)
                     /gene="TPHA0F03080"
                     /locus_tag="TPHA_0F03080"
                     /inference="similar to DNA sequence:INSDC:YDL173W"
                     /note="similar to Saccharomyces cerevisiae YDL173W;
                     ancestral locus Anc_7.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686223.1"
                     /db_xref="GeneID:11535545"
                     /db_xref="InterPro:IPR022024"
                     /db_xref="UniProtKB/TrEMBL:G8BUK3"
                     /translation="MGSKYMISTGRGGAGNIHSSETKAAPKMVRQGSQTPNIIQPVYS
                     TGRGGAGNMRKNVDPKLTRKAQDVEECGEETDRSPDDDFINIDDVVEKSHDSDLIDDS
                     VTPIQILKGNSVNAAISNVRSQSATANNLSGSSGRSKSRRNSIKKTSTGGDKPKAIAI
                     GRGGAGNMLSPSASNKSLEAYLSNTSYDRAKAKKTRKNKSHKKSNCIIC"
     gene            <678497..>680254
                     /gene="TPHA0F03090"
                     /locus_tag="TPHA_0F03090"
                     /db_xref="GeneID:11531554"
     mRNA            <678497..>680254
                     /gene="TPHA0F03090"
                     /locus_tag="TPHA_0F03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686176.1"
                     /db_xref="GeneID:11531554"
     CDS             678497..680254
                     /gene="TPHA0F03090"
                     /locus_tag="TPHA_0F03090"
                     /inference="similar to DNA sequence:INSDC:YDL174C"
                     /note="similar to Saccharomyces cerevisiae DLD1 (YDL174C);
                     ancestral locus Anc_7.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686224.1"
                     /db_xref="GeneID:11531554"
                     /db_xref="GOA:G8BUK4"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:G8BUK4"
                     /translation="MLKRTVTTRLYKKVLNRAFNFTKLSKGNHLLNGSRLYTTASNIN
                     KVKRSKKYTWLLTWVIMGAAGYELNNFVNDRRIVKRNFEPESSTLPLDRLTPPRYETD
                     PEKLKLHIEDLKKIMDNDSNNYTEMHNELVNHADSYFNTHHPQDIELDKPTIVLFPRN
                     TQDVSKILKYCHTHNLPVIPYSGGTSLEGHYVTTRPPSTIMVDFSRYMANIIKFSPAD
                     LDVTVQPGLPWEDLNDFLEEKGYMLGVDPGPGAQMGGCIANSCSGTNAYRFGTMKENI
                     INITLVLPDGTIVKTKRRPRKSSAGYNLNGLFVGSEGTLGVVTEATVKCHVKPKCETV
                     AVVTFPTIQDAANCSSKLTQNGIQLNAMELLDENIMKLINLSKSTYKQHWDETPTMFF
                     KIGGQNETIVRELIHMMKRIAKENKSIKFEFSNGEEEKLEMWEARKVAVWTVLDTGKA
                     INEDAKLWTTDVAVPLSNFAKVVEETKADLKESKLLNIIVGHAGDGNFHAAIVYNNEE
                     EFKKCKKVVDDMITRALDHDGTCTGEHGVALGKRKYLLEELDEDTVDLMRRIKLAIDP
                     NRILNPDKIFKIDPNDTAE"
     gene            complement(<680407..>681552)
                     /gene="TPHA0F03100"
                     /locus_tag="TPHA_0F03100"
                     /db_xref="GeneID:11531555"
     mRNA            complement(<680407..>681552)
                     /gene="TPHA0F03100"
                     /locus_tag="TPHA_0F03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686177.1"
                     /db_xref="GeneID:11531555"
     CDS             complement(680407..681552)
                     /gene="TPHA0F03100"
                     /locus_tag="TPHA_0F03100"
                     /inference="similar to DNA sequence:INSDC:YLR191W"
                     /note="similar to Saccharomyces cerevisiae PEX13
                     (YLR191W); ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686225.1"
                     /db_xref="GeneID:11531555"
                     /db_xref="GOA:G8BUK5"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="UniProtKB/TrEMBL:G8BUK5"
                     /translation="MASLSTSNIRPKPWESRTMNEESLPNNDHVFNLSSIAKVSKKVT
                     FQENKSGRNDVYQEHNDASDNGRNEAPEIPNPLPANMFNQNHNNYDDLDRTTSNWNSI
                     NQNSSLPGYLNSAYSGTLNGFRNNFNSPYNNNMYEQGNPYSYNNMNGSNMNNSTESTF
                     QLIEGVIGAIGGFAQMLESTYVATHNSFFTLLSIAEQFNYLKEVFGSALGIFFFNKVY
                     EKILNIATHGTKGLPSSKNELKSSMIKEFVKFQQGINERRRHKISWKPLLLFLFSIVG
                     LPYILNRVISKLQTIESSHGVNEKIDLSNLEFARALFDFNPENRKIELTLTKGDLMAI
                     LTKKDPYGNTSKWWKVRTKNGDTGYVPSNYIEIIPRNKTKIKVTATE"
     gene            complement(<682012..>683664)
                     /gene="TPHA0F03110"
                     /locus_tag="TPHA_0F03110"
                     /db_xref="GeneID:11535645"
     mRNA            complement(<682012..>683664)
                     /gene="TPHA0F03110"
                     /locus_tag="TPHA_0F03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686178.1"
                     /db_xref="GeneID:11535645"
     CDS             complement(682012..683664)
                     /gene="TPHA0F03110"
                     /locus_tag="TPHA_0F03110"
                     /inference="similar to DNA sequence:INSDC:YLR190W"
                     /note="similar to Saccharomyces cerevisiae MMR1 (YLR190W);
                     ancestral locus Anc_7.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686226.1"
                     /db_xref="GeneID:11535645"
                     /db_xref="InterPro:IPR013712"
                     /db_xref="UniProtKB/TrEMBL:G8BUK6"
                     /translation="MYSPNFKADSPIMSPMAFHVKDPANKNNIQNLLLSPTKLSLDNT
                     KGSSIYRTSLSKLNESTRTGRSRQRRGSDIMRSGSPIQFPSIGSAAPKMLKPEYLNTQ
                     NSAIPLLSTIMKQSSKTMDTQKTDQDNTQNNQNSQRENVETRKLNTSIFAQLQESFIN
                     FNRQKEKVENIPVTTSKETHTEKEILTISKISKEEKHKPQSTMKNNALRKISHTESTL
                     SGSTMHEQDGISEIESLEANNCNVEKLPAVHPAKIVQKRIVSEHATIQESELHEVPKD
                     INVDALPTDRNGFVQLNNHKNNRYSFISSASTDFELDWYNQLQQQSNLQLSQPSQRFP
                     SQSESDDSARNEFRIKKLEIEINELKLQNEKLIQTFISENEKMRQLSTSQIQSIPATS
                     RVKYSEKDTRHMRNKVKRLERKLANYKKAMNKLVDNNFPSAHMKYISTDQDEVSSVKT
                     RISRISDKDLKQIEEAKSSSDQSTSELNDEEDDFSDSIGSLTDIKELVDMTYTSERDF
                     LTEEITEEIQRFSTPQLPSKRNSIIGNKKKVGFQLNLQIEKK"
     gene            <684605..>684850
                     /gene="TPHA0F03120"
                     /locus_tag="TPHA_0F03120"
                     /db_xref="GeneID:11535598"
     mRNA            <684605..>684850
                     /gene="TPHA0F03120"
                     /locus_tag="TPHA_0F03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686179.1"
                     /db_xref="GeneID:11535598"
     CDS             684605..684850
                     /gene="TPHA0F03120"
                     /locus_tag="TPHA_0F03120"
                     /inference="similar to DNA
                     sequence:INSDC:YER019C-A,YER087C-B"
                     /note="similar to Saccharomyces cerevisiae SBH2
                     (YER019C-A) and SBH1 (YER087C-B); ancestral locus
                     Anc_7.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686227.1"
                     /db_xref="GeneID:11535598"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:G8BUK7"
                     /translation="MSTPPGGQRTVAKRAKAQASKGKADAKQPENQQGGNSILKIYSD
                     EANGLRVDPLVIIFLAVGFIFSVVALHIIAKFTSKIF"
     gene            complement(<685292..>686998)
                     /gene="TPHA0F03130"
                     /locus_tag="TPHA_0F03130"
                     /db_xref="GeneID:11535599"
     mRNA            complement(<685292..>686998)
                     /gene="TPHA0F03130"
                     /locus_tag="TPHA_0F03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686180.1"
                     /db_xref="GeneID:11535599"
     CDS             complement(685292..686998)
                     /gene="TPHA0F03130"
                     /locus_tag="TPHA_0F03130"
                     /inference="similar to DNA sequence:INSDC:YER086W"
                     /note="similar to Saccharomyces cerevisiae ILV1 (YER086W);
                     ancestral locus Anc_7.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686228.1"
                     /db_xref="GeneID:11535599"
                     /db_xref="GOA:G8BUK8"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="UniProtKB/TrEMBL:G8BUK8"
                     /translation="MSTRLLLKTNLRTASRIRVPLNGLRFLHTKLSDNLVRLHSNLKL
                     DELQDDNTPDYVRLILRSSVYDVMDESPITTGTVLSSKLNTNVQLKRDDLLPVFSFKL
                     RGAYNMMAKLDDTQKNQGVIACSAGNHAQGVAYAAKHLKIPATIVMPVSTPSIKYQNV
                     SRLGSQVVLYGNDFDEAKAECARLAEERGLTNIPPFDHPYVIAGQGTVAMEILRQVHM
                     SSKIGAVFVPVGGGGLIAGVGTYLKRIAPHIKIIGVETYDACALYTSLQSGKRAALES
                     VGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDEICAGIKDIFEDTRSIVEPSGALA
                     VAGMKKYVSHLHPEIEHSKHTYVPVLSGANMNFDRLRFVSERAVLGEGKEVFMLITLP
                     DVPGSFKKLQNVIHPRSVTEFSYRYNEHRHDSTSEVPKAYIYTSFNVVDREKEIKQVM
                     QQIHALGFDAVDISDNDMAKSHGRYLVGGASKVPNERIISFEFPERPGALTKFLAGLS
                     DSWNLTLFHYRNHGADVGKILAGISVPPRENLTFQKFLEDLDYKYHDETGNMVYQKFL
                     KF"
     gene            <687861..>689183
                     /gene="TPHA0F03140"
                     /locus_tag="TPHA_0F03140"
                     /db_xref="GeneID:11535618"
     mRNA            <687861..>689183
                     /gene="TPHA0F03140"
                     /locus_tag="TPHA_0F03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686181.1"
                     /db_xref="GeneID:11535618"
     CDS             687861..689183
                     /gene="TPHA0F03140"
                     /locus_tag="TPHA_0F03140"
                     /inference="similar to DNA sequence:INSDC:YPL123C"
                     /note="similar to Saccharomyces cerevisiae RNY1 (YPL123C);
                     ancestral locus Anc_8.621"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686229.1"
                     /db_xref="GeneID:11535618"
                     /db_xref="GOA:G8BUK9"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:G8BUK9"
                     /translation="MRLDNFLNALYWNSNTLGQKPFDGILTTDVSCPIDLPLTCRNAT
                     EVTDSCCFEFPGGIFLQTQFWNYRPSRVGMNATEIENELGPLDAFTIHGLWPDNCDGG
                     FEQFCDKSLFIDDVYHLLKSDEFNGENSQDLEISGENLLNNLTSLWKSNNGNHESLWI
                     HEFNKHGSCINTLKPKCYKNWNNISNSKSIVSKEENDYYKKRAVYDYFRITYNLYNEN
                     NSFEKLAKFGIVPSNSTTYTKEQIENALGSTEGTDEVTAKIFINCDSNNVLNEVWYFY
                     LLKGSLLQEEFVPIDSFDNKRSRCKATGIKFYQKGYIPNNGGRQPPSNSKRGIVRISG
                     YNGNLIKNGRWMTKGTPANFEMIKSPFGSYYLKSRTGYCTVSVSKGLICNANINNAAQ
                     FDYDDKNGYIGYSNNFMWSAETYPRGNTQSVVYFNNKDNKYQFKLKFV"
     gene            complement(<689259..>690071)
                     /gene="TPHA0F03150"
                     /locus_tag="TPHA_0F03150"
                     /db_xref="GeneID:11535350"
     mRNA            complement(<689259..>690071)
                     /gene="TPHA0F03150"
                     /locus_tag="TPHA_0F03150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686182.1"
                     /db_xref="GeneID:11535350"
     CDS             complement(689259..690071)
                     /gene="TPHA0F03150"
                     /locus_tag="TPHA_0F03150"
                     /inference="similar to DNA sequence:INSDC:YPL124W"
                     /note="similar to Saccharomyces cerevisiae SPC29
                     (YPL124W); ancestral locus Anc_8.622"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686230.1"
                     /db_xref="GeneID:11535350"
                     /db_xref="UniProtKB/TrEMBL:G8BUL0"
                     /translation="MGDNFSKDFFDQKYSEDNSIMDIKRKFSEAKKLIYEKKNPSYSP
                     EKNVSFALQKDDSQNHSFMKNTKKYDPIKNNNKSEKYINSKYYEDQLRKELRESRNEN
                     IHPLPYSSSNDANNIRNESSELIILKQQIRTQNNSIQELRSMINNLLQDRNDQHYITG
                     QLESRIKDMNAQIQNLEWELSESKRMIISQSRIPSLNTENNKYSRFPSRNEDFNGRSK
                     KASYLDSPESITNRRYFSGNRTASMDSSTYNGYYPTPSDSTTQIIRMTDPNR"
     gene            complement(<690476..>693571)
                     /gene="TPHA0F03160"
                     /locus_tag="TPHA_0F03160"
                     /db_xref="GeneID:11535593"
     mRNA            complement(<690476..>693571)
                     /gene="TPHA0F03160"
                     /locus_tag="TPHA_0F03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686183.1"
                     /db_xref="GeneID:11535593"
     CDS             complement(690476..693571)
                     /gene="TPHA0F03160"
                     /locus_tag="TPHA_0F03160"
                     /inference="similar to DNA sequence:INSDC:YPL125W"
                     /note="similar to Saccharomyces cerevisiae KAP120
                     (YPL125W); ancestral locus Anc_8.624"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686231.1"
                     /db_xref="GeneID:11535593"
                     /db_xref="GOA:G8BUL1"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BUL1"
                     /translation="MGDLTEINLIQVLEQASDPKNIGSEIQKLAEAKLKEWEVQEGFH
                     YYLQSIYLNMDNSLQIRWISIIQFKNGIEKYWRSTRSNAINKNEKLKIRERLFNLVNE
                     KNNQLSIQNAQATAKIARFDFPGHWPDLFENLERLLDINSSNDTNIYNTLLHINQIIK
                     ILGAARIGRCRPAMQSKIPLILKYVIRIYLDNFVSWTDSSININEKFPLHIQISYLAL
                     KCTRRMIIEGVDNPAKDEIVIDFMRLSIQHFDILITNYNNFRTFDNYEKFIRCYGKLY
                     YSMITNSPATFILLPCSTDILIVYTKIIFEYAPNVYNEVADTTGDFWEQTVIRGLLVF
                     KRVINFIFKKGAITLKARSDKASIDKAIEKLNAEFLNEKLITDLVDTLMTWYLKLRPS
                     ELENWFMDQEEWINEQMSTSYEYQIRPCAENFFQDLINSFSEFLVPYLLNKIEKDASS
                     LSNSLEDFLMKDAIYAAFQLSANAICDMVDFDSLLVKIFLPEASDTTNNSTDQLKIIR
                     RRVAVIINEWSVVKCSEESKKICYGFFENILMNESDKVVLLTVVQSIRTMVDDWNFNK
                     DNFEPFLKDIVTILLRKILPSVSLTETRLYVLNTLSDIIIQTKPLISKDLLIEILQII
                     PELWEISTNNPSEGILSGALIRLLRNLVQSLGPQSYLTWDIAIPVVNIVCDPTSQHHH
                     LLSEDGFELWGILLQNYSSNETKFDDRFVDFLPFLESSIEKHSEILPTLLEIVKSYTL
                     ILSPQLFFASDSFSKIFSYLSNYLLKLRDDSFYLILEIWEILILSNEADYENILLQKF
                     YDMGILNSLFNSIFKQEALSNHQCGQLLQIIARIAYVNPTALMKFIEMYHQALPTTTS
                     NAQLDIEHKKVVYSDMPFDRLFSKLISSWEYCFKDIFDPKLKKIHVLGISSLLRTGLV
                     VVLSEIITIMQIWVDLLEEINETQSGDCEKYHLNDIVTEQTVEFYQLTPEQLRNHELL
                     KNNDPVHNISLREFIKQTLEFLESHLGPPAYQEFFNNINQSLRESLLLFLSIQQPKIS
                     N"
     gene            <694666..>696483
                     /gene="TPHA0F03170"
                     /locus_tag="TPHA_0F03170"
                     /db_xref="GeneID:11535594"
     mRNA            <694666..>696483
                     /gene="TPHA0F03170"
                     /locus_tag="TPHA_0F03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686184.1"
                     /db_xref="GeneID:11535594"
     CDS             694666..696483
                     /gene="TPHA0F03170"
                     /locus_tag="TPHA_0F03170"
                     /inference="similar to DNA sequence:INSDC:YPL128C"
                     /note="similar to Saccharomyces cerevisiae TBF1 (YPL128C);
                     ancestral locus Anc_8.630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686232.1"
                     /db_xref="GeneID:11535594"
                     /db_xref="GOA:G8BUL2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR013867"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G8BUL2"
                     /translation="MAKAYNTPMNADTLGDLIDDFPVDVRVSISTLSSLDNVSNQLLS
                     IISSDSFNSETYLLFNPRNVNSRIPMAIKSFHSLLTIFIEILRVYGIDNDVGEFKILE
                     PKHIVKDMWYQDSPTLVLLKTFEKDIITTIRKCNVLIYFLTVLGCLNFKIDKLQEDFL
                     DVFAPNTLFEESPFNINEQLLRKQWLLYLDLKTRIYIEKLKRVRYEKLRAERAENPNI
                     NLIFQNQEDSNKESGHEQATSNEISKFDHVSEDERSELLENNLFSNTFTNELVLRRTK
                     SSADPTLTTSFERVFVQRYITRKANLMSFSSLKKLEIEISEKSFITNLKDYCDRYMSL
                     IIWGTKHRNSKNPIQTADNSEFDEQVLKVTNAELLIGVVPYKTIFVDNEFEAKKARKV
                     ENEIESSQQNVDEIVAGIENDTDLLVNENFSNENVSNNSTQLSESNVFNNDVSVMENL
                     EQQTRSVISTPKTAKRDSTGKVMKLKSKWSKTEEDALVAGLKAFGPSWVKILDYHGSG
                     GKFSEDLKNRSQVQLKDKARNWKIQYLRNGHPLPQYLTKVTGNLNRKRKQLSIESTPE
                     KLPEIRRDNTVHNNQNDMFGNNVISNAASSDASSFDPNL"
     gene            complement(<696706..>697530)
                     /gene="TPHA0F03180"
                     /locus_tag="TPHA_0F03180"
                     /db_xref="GeneID:11535490"
     mRNA            complement(join(<696706..697410,697522..>697530))
                     /gene="TPHA0F03180"
                     /locus_tag="TPHA_0F03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686185.1"
                     /db_xref="GeneID:11535490"
     CDS             complement(join(696706..697410,697522..697530))
                     /gene="TPHA0F03180"
                     /locus_tag="TPHA_0F03180"
                     /inference="similar to DNA sequence:INSDC:YOR213C"
                     /note="similar to Saccharomyces cerevisiae SAS5 (YOR213C);
                     ancestral locus Anc_8.632"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686233.1"
                     /db_xref="GeneID:11535490"
                     /db_xref="GOA:G8BUL3"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:G8BUL3"
                     /translation="MEIPHINLTLRINTINTRIKGQYEGGLPLRHWTVSLTVLDDKRN
                     TIYPKIFDAITFYLHPSFSNHTRIIKNYPYTLSEVGWGEFDIRMKGTFLDDIGTFILD
                     HPLLFDNTEYYIDYEIQVPYHTKKLRNELIGFFAIEYNNTTREKLDDKKLVNLKRGLN
                     NLKLCTEDTLTEVMDLILSHPAVQNRVEQYPRTEDFYMDVAQFSDDLLIQLYAYLEEH
                     DIIKLDARVFKGTNKFNYL"
     gene            complement(<697972..>698831)
                     /gene="TPHA0F03190"
                     /locus_tag="TPHA_0F03190"
                     /db_xref="GeneID:11535474"
     mRNA            complement(join(<697972..698718,698823..>698831))
                     /gene="TPHA0F03190"
                     /locus_tag="TPHA_0F03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686186.1"
                     /db_xref="GeneID:11535474"
     CDS             complement(join(697972..698718,698823..698831))
                     /gene="TPHA0F03190"
                     /locus_tag="TPHA_0F03190"
                     /inference="similar to DNA sequence:INSDC:YPL129W"
                     /note="similar to Saccharomyces cerevisiae TAF14
                     (YPL129W); ancestral locus Anc_8.633"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686234.1"
                     /db_xref="GeneID:11535474"
                     /db_xref="GOA:G8BUL4"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:G8BUL4"
                     /translation="MVATVKRTVRITTRQHILTDLPPVDNFPMRKWSIEIHLLDADNK
                     EIPATIFDRVVYHLHPTFTNPNRTFKESPYTIEEQGWGGFPLHISLFLIEKAGERKIT
                     HDLNFLQDEYTADHVISIPLNKPLLTQELAKSGIVPETAVTTTQASTKRKAESTESLP
                     VTTATEPKAKKVKTATAPTVKGSIDLQQLAFGLTKLKEDDLVAIVQMVTDNKTPEMDV
                     VNNVEDGEFIIDLFSLPESLLKSIWEYVKENTK"
     gene            complement(<699301..>700503)
                     /gene="TPHA0F03200"
                     /locus_tag="TPHA_0F03200"
                     /db_xref="GeneID:11535633"
     mRNA            complement(<699301..>700503)
                     /gene="TPHA0F03200"
                     /locus_tag="TPHA_0F03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686187.1"
                     /db_xref="GeneID:11535633"
     CDS             complement(699301..700503)
                     /gene="TPHA0F03200"
                     /locus_tag="TPHA_0F03200"
                     /inference="similar to DNA sequence:INSDC:YPL130W,YOR214C"
                     /note="similar to Saccharomyces cerevisiae SPO19 (YPL130W)
                     and YOR214C; ancestral locus Anc_8.634"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686235.1"
                     /db_xref="GeneID:11535633"
                     /db_xref="UniProtKB/TrEMBL:G8BUL5"
                     /translation="MIFNKYVQAIVLAAFVSGAYAQDYLVTLNADSNSDTVGFEINSN
                     DDLGRNPLVVHLDKSNLSPEMLEKLGSVPNIVFADLPDLPQFVNLREYISKDDNGLQE
                     LLKGIVPESKNIDWNNVQNNQKYQELEGVFNEFLNDSVDSNKMKWRKKKYESSESSDY
                     EPTYTSKYKPSYSSEYETSKSTHYPTSHSSPHTKEKSSSTTYPHSSSKESSTSRHSSN
                     VNPTSHTSESYHSDKTHTTTSHVTTTHVSTEEKKTTEQKTITTAHTTKVPVTKTTEKE
                     TTLTKSITKNGTTKEIVVTTKVPVTTTYKSISTIHEQSNNTLTKTTTSCPEKSSSTGE
                     VISKTKKSTTATPTMINYPQPSIAINGNITNITGGGEEFNNSNSYFNLSISFLIASVI
                     VSLFVAIP"
     gene            complement(<701068..>701619)
                     /gene="TPHA0F03210"
                     /locus_tag="TPHA_0F03210"
                     /db_xref="GeneID:11535634"
     mRNA            complement(<701068..>701619)
                     /gene="TPHA0F03210"
                     /locus_tag="TPHA_0F03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686188.1"
                     /db_xref="GeneID:11535634"
     CDS             complement(701068..701619)
                     /gene="TPHA0F03210"
                     /locus_tag="TPHA_0F03210"
                     /inference="similar to DNA sequence:INSDC:YOR215C"
                     /note="similar to Saccharomyces cerevisiae YOR215C;
                     ancestral locus Anc_8.635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686236.1"
                     /db_xref="GeneID:11535634"
                     /db_xref="GOA:G8BUL6"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /db_xref="UniProtKB/TrEMBL:G8BUL6"
                     /translation="MLRTTTRVTYVSRSCIRTINSEAYTSTIIGLKKDLKQAMLAKDD
                     AKKTTIRNILSTVKNMELDNQGKDFNELTLFGIYSKLIKQRKDSIAEFIKNDRTDLAS
                     KEETELAIINSYLKLLPVASQEEVDKKVTELLTKVKSEQGDNVQLKEILRSLNFKILQ
                     VQWKTTQGVIVQSLTRHYREIFN"
     gene            complement(<702115..>703551)
                     /gene="TPHA0F03220"
                     /locus_tag="TPHA_0F03220"
                     /db_xref="GeneID:11535628"
     mRNA            complement(<702115..>703551)
                     /gene="TPHA0F03220"
                     /locus_tag="TPHA_0F03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686189.1"
                     /db_xref="GeneID:11535628"
     CDS             complement(702115..703551)
                     /gene="TPHA0F03220"
                     /locus_tag="TPHA_0F03220"
                     /inference="similar to DNA sequence:INSDC:YOR216C"
                     /note="similar to Saccharomyces cerevisiae RUD3 (YOR216C);
                     ancestral locus Anc_8.636"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686237.1"
                     /db_xref="GeneID:11535628"
                     /db_xref="GOA:G8BUL7"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:G8BUL7"
                     /translation="MGKNKKKSGNKNNNNNAHANDATVEDKEYVVAEVEPVVVDANEV
                     ESVKEEDGQDEVEESKKDNETEVELLKEQIKVLQNQLEQAKIRNDGDPESVPSETSEG
                     SNAELEKVKEERDKYESQYNSLLDRISSMKTIFSNMKASEKEHEATKQRLRELEKENE
                     SINQQLEEYESQNLKIKNKVETIEGEKKEMKETIAILNREFSSLENELEDAQSRIKEL
                     ESDIKISSSSSLHEISSIKKDKERLLTQIDELTLLLDNNKKDINDLEEERDNLANSVE
                     TLKNELQKQESIVENLENELTKLEAEHNSSAQSKKMEIASLTAQLETSVEELSKTNKE
                     SEALQKKIKDMEESIEANKKMEEKFKEQVVQLGKLRHENVIVNEQLTKALAMIKKSST
                     SNNVDIELISNLIISFVTLPRADTRKFEVLELISSCLTWDDEKKKQAGLIHSSMKDPD
                     QPARKSSRTQAFISRWTEYLEKESEKDV"
     gene            <704126..>706663
                     /gene="TPHA0F03230"
                     /locus_tag="TPHA_0F03230"
                     /db_xref="GeneID:11535435"
     mRNA            <704126..>706663
                     /gene="TPHA0F03230"
                     /locus_tag="TPHA_0F03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686190.1"
                     /db_xref="GeneID:11535435"
     CDS             704126..706663
                     /gene="TPHA0F03230"
                     /locus_tag="TPHA_0F03230"
                     /inference="similar to DNA sequence:INSDC:YOR217W"
                     /note="similar to Saccharomyces cerevisiae RFC1 (YOR217W);
                     ancestral locus Anc_8.637"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686238.1"
                     /db_xref="GeneID:11535435"
                     /db_xref="GOA:G8BUL8"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012178"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUL8"
                     /translation="MVSITDFFVKGNAKGAARKKKNDDGGDTKKTTIDIIDLDDSDLD
                     IAEVKSPVKRESIVIDTPPSVKKQIDKVIKKEEKPPSKVPVKNKSSNASVTAADVLAT
                     IPSVDLSEVHIKENVKFDFRAAAISGDSEVSTQGDFPEGQDNCLLGLTVVFTGVLPTM
                     ERGAAENIARRYGAKVTKSISGKTSFVVLGDEAGPKKVEKIRQLKVKAINEDGFRKLI
                     AGMPADGGDGDAAEKARLKKQQEEARVLKEANEMAEEAEEKELKIKQARLSGDFVKRE
                     DLIREQDKLWTVKYAPTNTNQICGNKSSVNKLKNWLINWEASKASNFKSPGRDGSGIF
                     RAAMLYGPPGIGKTTAAHLIAKDLGYDILEQNASDVRSKSLLNAGVKNALDNMSVVGY
                     FKNKDDVNDVNGKKFVIVMDEVDGMSGGDRGGVGILAQFCRKTSTPLILICNERNQPK
                     MRPFDRVCLDVQFRRPDANSLKARLMTIAVREKFKLDPNVIDKLVQATRGDIRQIINL
                     LSTISKTSKNIDHTNISEISKSWEKNIALKPFDIVHQMLSGRIYSDLGANTFTLNDKI
                     ALYFDDFDFTPLMVQENYLSTRPSVLKPNESHLEAVAQAADAISLGDLVERNIRSSEQ
                     LWGLLPLHAVLSSVLPSSKVAGQFAGRVNFTGWLGQNSKRNKYYRLLQELQYHTRLST
                     SSNKISLRLEYMSTFKHRLLDPILKDGSDGIPSVISLMDDYYLTKEDWDYIMEFMVGP
                     ESTDLLLKKIPSTVKSGFTRKYNSTTHPVAIYRAGVSTTGSTTTVKPDFEDVVDADDS
                     VPATDDTEDGKDDDLKKDKLIKQKKAPVKRKASSTATKKGAAKKKKA"
     gene            <707219..>707911
                     /gene="TPHA0F03240"
                     /locus_tag="TPHA_0F03240"
                     /db_xref="GeneID:11535529"
     mRNA            <707219..>707911
                     /gene="TPHA0F03240"
                     /locus_tag="TPHA_0F03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686191.1"
                     /db_xref="GeneID:11535529"
     CDS             707219..707911
                     /gene="TPHA0F03240"
                     /locus_tag="TPHA_0F03240"
                     /inference="similar to DNA sequence:INSDC:YOR220W"
                     /note="similar to Saccharomyces cerevisiae YOR220W;
                     ancestral locus Anc_8.640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686239.1"
                     /db_xref="GeneID:11535529"
                     /db_xref="UniProtKB/TrEMBL:G8BUL9"
                     /translation="MAVLKSQILITDIPKATFSSDWSAKLKSSIFEEHFPEAVRNLQY
                     YTPLQFLNRIVIILDDETVATKIYEYLRTEKLILNLNAKLYLTENLTKPRSKSSSQVG
                     LDMPLSDDFLNLRVDPNSSAKQPGEDGAFAKPLLSIDTDPSHTGISTASLQVGSPSLS
                     PDKSCIGSPTLLKFSDDDQKLHSYQEPLPKLNDINKLETATSNSSSNLNIRKNKDSSE
                     PMSPSITIKDYL"
     gene            complement(<708141..>709067)
                     /gene="TPHA0F03250"
                     /locus_tag="TPHA_0F03250"
                     /db_xref="GeneID:11535530"
     mRNA            complement(<708141..>709067)
                     /gene="TPHA0F03250"
                     /locus_tag="TPHA_0F03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686192.1"
                     /db_xref="GeneID:11535530"
     CDS             complement(708141..709067)
                     /gene="TPHA0F03250"
                     /locus_tag="TPHA_0F03250"
                     /inference="similar to DNA sequence:INSDC:YPL132W"
                     /note="similar to Saccharomyces cerevisiae COX11
                     (YPL132W); ancestral locus Anc_8.641"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686240.1"
                     /db_xref="GeneID:11535530"
                     /db_xref="GOA:G8BUM0"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:G8BUM0"
                     /translation="MLRVQSCSLKILRSQNLSKISRNYSFGRISVDNLLKGKCVLSTV
                     GNNHLYSKIRLYSSNVENTNSTPFDTSKLTREELMNLYRTQRAKKQKFRDRTVAYYAT
                     SIAVVFLGLAYAAVPLYRAICARTGFGGIPITDRRKFTDDKMVPVDSDKRIRISFTSE
                     VSKMLPWKFQPQQREVYVLPGETALAFYKAKNESDKDIIGMATYSITPGGAAPYFNKI
                     QCFCFEEQKLGKGEEVDMPVFFFIDPDFATDPQMRNIDDIVLHYSFFKAHYSDGGAVS
                     ENDEPMTEGQKAHATLIAPPTNLVIDSVVENE"
     gene            <709472..>710887
                     /gene="TPHA0F03260"
                     /locus_tag="TPHA_0F03260"
                     /db_xref="GeneID:11535543"
     mRNA            <709472..>710887
                     /gene="TPHA0F03260"
                     /locus_tag="TPHA_0F03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686193.1"
                     /db_xref="GeneID:11535543"
     CDS             709472..710887
                     /gene="TPHA0F03260"
                     /locus_tag="TPHA_0F03260"
                     /inference="similar to DNA sequence:INSDC:YPL133C"
                     /note="similar to Saccharomyces cerevisiae RDS2 (YPL133C);
                     ancestral locus Anc_8.642"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686241.1"
                     /db_xref="GeneID:11535543"
                     /db_xref="GOA:G8BUM1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BUM1"
                     /translation="MVKPKRRKRSHPSCMFCKRSHVTCDGERPCSRCVSRKISVLCVK
                     SDNDRVSESPSVNNNDTNMHDDNFNKSSINSGNVNNNLIPAGHGMQTNGGFDALPSDM
                     SNFEIQDSNLSANYLFKFLPTNQFASENAGSEFSSLNDFLNMLEDPIFLNDSNFQNID
                     NTTNYESNEIGISRSINAEIGPSNKEPVNQSTTSVSNSASNQNPRRSQKNTEEYRYPV
                     GVTKFRFHSGVDLDSSPNSNYNKNKATVNRRLGVNNTPNEHFFLTAADPVAEVSPEEK
                     LRLVINAKMEAGLLKPYDYAAGYKRLQLYMDRYMNQESKLRILKPLSIIRPAFRAIAK
                     SLKDMDLILIEERFERMLLSYDRVFTSMSIPACLWRRTGEIYRGNKEFASLVGCTVDQ
                     LREGNLAIYELMSEESAVNFWEKYGAIAFDKSQKAVLTSCNLRTLDTRKKRSCCFSFT
                     IRRDMYNMPTCIIGNFIPVSP"
     gene            <711645..>712490
                     /gene="TPHA0F03270"
                     /locus_tag="TPHA_0F03270"
                     /db_xref="GeneID:11535393"
     mRNA            <711645..>712490
                     /gene="TPHA0F03270"
                     /locus_tag="TPHA_0F03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686194.1"
                     /db_xref="GeneID:11535393"
     CDS             711645..712490
                     /gene="TPHA0F03270"
                     /locus_tag="TPHA_0F03270"
                     /inference="similar to DNA sequence:INSDC:YOR223W"
                     /note="similar to Saccharomyces cerevisiae YOR223W;
                     ancestral locus Anc_8.645"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686242.1"
                     /db_xref="GeneID:11535393"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:G8BUM2"
                     /translation="MSLEPLLPTTKADEIDHKYIVIRFSDESLRDLELDITNVPFTNI
                     STKWLRNMCRSRRPEKTERKRLKFIRNGVILNATSGIANDLARFFRNNSTENGDKFYV
                     HCMVGVDTLTDRELANEDELDERTQSANSTTSQAIGFDRLRAVGFSEEEIDMFREQFR
                     RTYGDLQNLDTDSSSTEVNGNGNNGTGNVDIRELEEQWMDTGVNRSPNGNGVNDPNAD
                     NLFNSVSTANLKHSTDILLGLTVGYTLGLFGLLLMKVDKIFNRRQKMAIVSGVFINMM
                     FTLAV"
     gene            complement(<712764..>713198)
                     /gene="TPHA0F03280"
                     /locus_tag="TPHA_0F03280"
                     /db_xref="GeneID:11535394"
     mRNA            complement(<712764..>713198)
                     /gene="TPHA0F03280"
                     /locus_tag="TPHA_0F03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686195.1"
                     /db_xref="GeneID:11535394"
     CDS             complement(712764..713198)
                     /gene="TPHA0F03280"
                     /locus_tag="TPHA_0F03280"
                     /inference="similar to DNA sequence:INSDC:YOR224C"
                     /note="similar to Saccharomyces cerevisiae RPB8 (YOR224C);
                     ancestral locus Anc_8.646"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686243.1"
                     /db_xref="GeneID:11535394"
                     /db_xref="GOA:G8BUM3"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BUM3"
                     /translation="MSSTLFDDIFVISDVDPGRYNKVSRIEASSTSQEQTKLTLDINT
                     DLFPVNLKDQLTIAIASSLSTDGSVNSSDNKSWRLPRPNERSLADDYDYVMYGTAYKF
                     EEVSKDMITIYYSFGGLLMRLEGNYRKLNNLKQENAYLLIRR"
     gene            complement(<713719..>714165)
                     /gene="TPHA0F03290"
                     /locus_tag="TPHA_0F03290"
                     /db_xref="GeneID:11535374"
     mRNA            complement(<713719..>714165)
                     /gene="TPHA0F03290"
                     /locus_tag="TPHA_0F03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686196.1"
                     /db_xref="GeneID:11535374"
     CDS             complement(713719..714165)
                     /gene="TPHA0F03290"
                     /locus_tag="TPHA_0F03290"
                     /inference="similar to DNA sequence:INSDC:YOR226C,YPL135W"
                     /note="similar to Saccharomyces cerevisiae ISU2 (YOR226C)
                     and ISU1 (YPL135W); ancestral locus Anc_8.647"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686244.1"
                     /db_xref="GeneID:11535374"
                     /db_xref="GOA:G8BUM4"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:G8BUM4"
                     /translation="MLKSLIVRNNLFTITKRLYHPNVIEHYTNPRNVGSLDKNQSNVG
                     TGLVGAPACGDVMKLQIEVDDKTGIIENVKFKTFGCGSAIASSSYVTELVRGITVDEA
                     AKIKNTEIAKKLSLPPVKLHCSMLAEDAIKAAIRDYKSKRNSTNLA"
     gene            complement(<715124..>715600)
                     /gene="TPHA0F03300"
                     /locus_tag="TPHA_0F03300"
                     /db_xref="GeneID:11535377"
     mRNA            complement(<715124..>715600)
                     /gene="TPHA0F03300"
                     /locus_tag="TPHA_0F03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686197.1"
                     /db_xref="GeneID:11535377"
     CDS             complement(715124..715600)
                     /gene="TPHA0F03300"
                     /locus_tag="TPHA_0F03300"
                     /inference="similar to DNA sequence:INSDC:YEL034W,YJR047C"
                     /note="similar to Saccharomyces cerevisiae HYP2 (YEL034W)
                     and ANB1 (YJR047C); ancestral locus Anc_1.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686245.1"
                     /db_xref="GeneID:11535377"
                     /db_xref="GOA:G8BUM5"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:G8BUM5"
                     /translation="MSDEEQHTFETADAGSSLTYPMQCSALRKSGFVVIKGRPCKIID
                     MSTSKTGKHGHAKVHLVATDIFTGKKLEDLSPSTHNMECPFVKRTEFQLLDIDDGFLS
                     LMTMEGDTKDDVKLPEGELGDKIQAAFDEGKDLMVTVISAMEEEAAISFKESAGAA"
     gene            complement(<715802..>716386)
                     /gene="TPHA0F03310"
                     /locus_tag="TPHA_0F03310"
                     /db_xref="GeneID:11535387"
     mRNA            complement(<715802..>716386)
                     /gene="TPHA0F03310"
                     /locus_tag="TPHA_0F03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686198.1"
                     /db_xref="GeneID:11535387"
     CDS             complement(715802..716386)
                     /gene="TPHA0F03310"
                     /locus_tag="TPHA_0F03310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686246.1"
                     /db_xref="GeneID:11535387"
                     /db_xref="UniProtKB/TrEMBL:G8BUM6"
                     /translation="MPHITVLGRRCSRQRYRAIKSSSGRSAWCVRACAWPLARDQSVT
                     ALPDGFAVVSPETANTKTQNHTKWSFIVLPSARTRAHAHARTHSAISRAVSRSCPQPT
                     PSPSRASSWTLLFLKNLCSLAFFGVTSQRSAICSLLAAAACQCLNYVVLPWTYPMSRR
                     VRDRDSLLSVKLIAVFCYDVVVQTNSTAIEKKKC"
     gene            complement(<716844..>717548)
                     /gene="TPHA0F03320"
                     /locus_tag="TPHA_0F03320"
                     /db_xref="GeneID:11535388"
     mRNA            complement(<716844..>717548)
                     /gene="TPHA0F03320"
                     /locus_tag="TPHA_0F03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686199.1"
                     /db_xref="GeneID:11535388"
     CDS             complement(716844..717548)
                     /gene="TPHA0F03320"
                     /locus_tag="TPHA_0F03320"
                     /inference="similar to DNA sequence:INSDC:YEL038W"
                     /note="similar to Saccharomyces cerevisiae UTR4 (YEL038W);
                     ancestral locus Anc_1.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686247.1"
                     /db_xref="GeneID:11535388"
                     /db_xref="GOA:G8BUM7"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="UniProtKB/TrEMBL:G8BUM7"
                     /translation="MTESRRYILDIEGTVCPISFVKSELFPYFLEQLADVILNVHKQD
                     ATIQGIVAKFGITDSTALLVHIRRLVEADVKDPVLKELQGYVWSRGYHSGDIKAPVYP
                     DAIGFIKDPRNKIYIYSSGSVKAQKLLFRFVKDADTGTVDLTPHILGYYDITTSGRKI
                     DPQSYRNIVSDINSIESTNNRESTFLFLSDNTLEIDAANEAGLSTRLVIREGNQPIPA
                     EKLSTYHTIHSCHELQ"
     gene            <718502..>718828
                     /gene="TPHA0F03330"
                     /locus_tag="TPHA_0F03330"
                     /db_xref="GeneID:11535646"
     mRNA            <718502..>718828
                     /gene="TPHA0F03330"
                     /locus_tag="TPHA_0F03330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686200.1"
                     /db_xref="GeneID:11535646"
     CDS             718502..718828
                     /gene="TPHA0F03330"
                     /locus_tag="TPHA_0F03330"
                     /inference="similar to DNA sequence:INSDC:YEL039C,YJR048W"
                     /note="similar to Saccharomyces cerevisiae CYC7 (YEL039C)
                     and CYC1 (YJR048W); ancestral locus Anc_1.482"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686248.1"
                     /db_xref="GeneID:11535646"
                     /db_xref="GOA:G8BUM8"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:G8BUM8"
                     /translation="MAYEKGSEKKGATLFKTRCLQCHTVEEGGPNKVGPNLHGIFGRH
                     SGQAPGFSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITY
                     LVKATK"
     gene            complement(<719086..>720387)
                     /gene="TPHA0F03340"
                     /locus_tag="TPHA_0F03340"
                     /db_xref="GeneID:11535479"
     mRNA            complement(<719086..>720387)
                     /gene="TPHA0F03340"
                     /locus_tag="TPHA_0F03340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686201.1"
                     /db_xref="GeneID:11535479"
     CDS             complement(719086..720387)
                     /gene="TPHA0F03340"
                     /locus_tag="TPHA_0F03340"
                     /inference="similar to DNA sequence:INSDC:YEL040W"
                     /note="similar to Saccharomyces cerevisiae UTR2 (YEL040W);
                     ancestral locus Anc_1.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686249.1"
                     /db_xref="GeneID:11535479"
                     /db_xref="GOA:G8BUM9"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:G8BUM9"
                     /translation="MKLSLFLLSFVALIQSLTIASDSIYCNTTAHCPESMPCCSFTGV
                     CGTGEYCLGSCNPAYSYSIDACLPVPVCKDMSTLFNKYSDKLVNAYSYLGNASEADWT
                     YTGYVMDYEDEESLVLAMPKNTTGTVLSTTRYMWYGKYSIRLKTSHLAGVITAIVLYS
                     QVEDEIDYEFVGTDLDTAQTNFYWQGTLNYSNSANISTTDTFSNFHTYEIDWQEDKTV
                     WSIDGVVGRTLYKNETYNATTGVYRYPQTPSRIQISIWPGGDSSQGQGTIEWAGGAID
                     WDAEDISDPGYYYMILNEANITCYDPPKGTTKNGTSSYKFVSSDSFLEKDVAIVDANM
                     ILKNLGDSGLTNYTSSSSSSSSSAKTSKTTSSKSSNNKSDSSFSTAESQITSSSSINA
                     EQKTKFFQDLSTTANSTGGAVSVLTNNWVSMVIGFIVTYIL"
     gene            complement(<720988..>722682)
                     /gene="TPHA0F03350"
                     /locus_tag="TPHA_0F03350"
                     /db_xref="GeneID:11535480"
     mRNA            complement(<720988..>722682)
                     /gene="TPHA0F03350"
                     /locus_tag="TPHA_0F03350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686202.1"
                     /db_xref="GeneID:11535480"
     CDS             complement(720988..722682)
                     /gene="TPHA0F03350"
                     /locus_tag="TPHA_0F03350"
                     /inference="similar to DNA sequence:INSDC:YEL041W,YJR049C"
                     /note="similar to Saccharomyces cerevisiae YEF1 (YEL041W)
                     and UTR1 (YJR049C); ancestral locus Anc_1.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686250.1"
                     /db_xref="GeneID:11535480"
                     /db_xref="GOA:G8BUN0"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:G8BUN0"
                     /translation="MKRPYQVDGVDRNKKNKKDVSKMKVHWKLYGSKDDLSEEFNSFS
                     STSSKDTDELKRDMESVSDDGKGKSRLTLSKDKNPYENSNDVDDDVALKQKNFGDDYE
                     GCIVINKKIEEHNSTAKETAKNSLSTSKSMPDVSKMKAAIKPHFKYASHAYGLRMMSK
                     KIFNTKVELDVENIMIVIKNNDVSLIYLLRELIEWLLAKYPALTVYIEDKVLQNKSFD
                     VESLISDIKCPARRIKFWNVKFLEENIGFFDLVITLGGDGTVLFVSSIFQTHVPPVLS
                     FSLGSLGFLTNYKFEHFKKDLSRILNNNKVKTNLRMRLECKVYRRREPVINPETGKKL
                     YVSELISEHHVLNELTVDRGPSPFISNLELYNDCSLLTVAQADGLIISTPTGSTAYSL
                     SAGGSLVYPSVNAIAVTPICPHTLNFRPIILPDSVNLRVKVSMKSRATAWAAFDGKNR
                     VELFSGDYISISASPYAFPTIESSPDEFINSINRTLNWNLREEQKSFTHMLSDKNKEK
                     YANDPIKLDQAEESCEEVELQEKIDGSKIDIAMVKHMMNPERKSMNRLEQEEHESS"
     gene            complement(<723915..>725666)
                     /gene="TPHA0F03360"
                     /locus_tag="TPHA_0F03360"
                     /db_xref="GeneID:11531551"
     mRNA            complement(<723915..>725666)
                     /gene="TPHA0F03360"
                     /locus_tag="TPHA_0F03360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686203.1"
                     /db_xref="GeneID:11531551"
     CDS             complement(723915..725666)
                     /gene="TPHA0F03360"
                     /locus_tag="TPHA_0F03360"
                     /inference="similar to DNA sequence:INSDC:YEL042W"
                     /note="similar to Saccharomyces cerevisiae GDA1 (YEL042W);
                     ancestral locus Anc_1.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686251.1"
                     /db_xref="GeneID:11531551"
                     /db_xref="GOA:G8BUN1"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:G8BUN1"
                     /translation="MKLQVRNYRYVVGAFAIVTMFMLLRSSDNLSDSVSSLQDFQYNI
                     QDTIQYGLQQSGLLPESDGSAESNEKSLSPGQVPGSAQNNDGAAAQNEAPLNDASQVN
                     SQPVSPKPGVIDDSTTDNNNPDVSNAVKENLKAQDKATSKPCDKENKFVIIIDAGSSG
                     SRMHLYKFDVCTSPATLIKEYFLGVSPGLSAFPDNAIEAANSLEPLLKRALEVIPEAQ
                     RACTPITVKATAGLRLTGDEVATEILAAVRNLLETKYPFPIIETNGIEIMSGTDEGIN
                     AWISTNYLLGNIGTSKKVGTSAVFDLGGGSTQIVFEPSYPKRGKLPNGVHRFDLPFSG
                     IYYTLYQYSHLGYGLSEARKKISVKLMEQYKLGGIVTEADVGRNLELNHPCIPSKMQF
                     LNQKVKVSSGEIYTVDFLGSTDSNPERCRNLITSVFDKSSCSTKPCSFDGVHQPSLEM
                     NFPEIDDLYIISFFFDRTYNLGLPKSFTLREMKEFADTICGGPETYHDSFAGVPSIIG
                     KARASSLNCLDLQYEVALLETGYGIPLDRELRTAQKISGSEVTWCLGAALPLLEEKNG
                     NAKLQQTQPHHHRNNNQ"
     gene            complement(<726379..>729012)
                     /gene="TPHA0F03370"
                     /locus_tag="TPHA_0F03370"
                     /db_xref="GeneID:11535549"
     mRNA            complement(<726379..>729012)
                     /gene="TPHA0F03370"
                     /locus_tag="TPHA_0F03370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686204.1"
                     /db_xref="GeneID:11535549"
     CDS             complement(726379..729012)
                     /gene="TPHA0F03370"
                     /locus_tag="TPHA_0F03370"
                     /inference="similar to DNA sequence:INSDC:YEL043W"
                     /note="similar to Saccharomyces cerevisiae YEL043W;
                     ancestral locus Anc_1.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686252.1"
                     /db_xref="GeneID:11535549"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:G8BUN2"
                     /translation="MELVYLLICSVLWLSYELYGYLTVPVLEIVNFLKVKTPYATKVS
                     IDRIGKHSITIHWENEPEFKRKDNTDGNAELDDGGKISHYLLYLNNKQLCIFSNASDA
                     MYTCCSINGLIANEEYRLDFITVNKLGFINRLPTIYCMTKDENFNDFSNKIEKTTNNN
                     WKRNATILIDSSPSGSASSENNNHENDNNDTNNPNSFQHLNENIPSYNRLMNLEDLED
                     LTIPELRRILISSQEDLHHITSQRTRILEDFHDTKMQLEQELESLRTNWHHEMELRKS
                     LKFNIKSLENSKALHELKLNKLHKNITISKEKSQKMEKDMLRWENDASNLDDLNKTYS
                     EKNLVIKNDIEQTIKKINLLENEIADYELINKNLNKSNNKMLNKKELKEILKELDASI
                     SDETGLLSSDGQIILSKLTNSSSFYNLITDQLNTDSKLNSIWNSKQKDYMKRLAILNL
                     NYKQVCLTNSQLRSKIMINPYSQNGNITSQQSRKSISSSNVNSNVNSNSNIALNNSEN
                     ESTKLTGLGIMENSDVTLQTAESFSNTISNTLGTDSQTQSKDSRREFLLSSQLNNSIN
                     GQFNQYSIPTTATITANATAVKSSSLSGIASDLLVDDLSNQRNTFVEETNNESKKDMV
                     NGQKFEYENNYHVITGLQDLVYEDTDNEDKISNYSKGFTTDQLDNYWFNAKDRPKEFM
                     RPSITNSFPMTPSPHQTAFAFSNANDFISPISSNTMPFNSYIRNVSSNSNTANNMYHP
                     ANNLSSGNLFMSGSMGDNISSQPYRDPMLLSNPNIFQGPSETAGLLSSSVPPISDMAM
                     FNPLQDKNSLMLNGDDNEFIDGYPLQSSNSITIGSRSRSQTNGQSSNNLIWNPSNESE
                     KSTTDKKNPSVKKKKKKFFKK"
     gene            <729876..>731714
                     /gene="TPHA0F03380"
                     /locus_tag="TPHA_0F03380"
                     /db_xref="GeneID:11535642"
     mRNA            <729876..>731714
                     /gene="TPHA0F03380"
                     /locus_tag="TPHA_0F03380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686205.1"
                     /db_xref="GeneID:11535642"
     CDS             729876..731714
                     /gene="TPHA0F03380"
                     /locus_tag="TPHA_0F03380"
                     /inference="similar to DNA sequence:INSDC:YOL122C"
                     /note="similar to Saccharomyces cerevisiae SMF1 (YOL122C);
                     ancestral locus Anc_3.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686253.1"
                     /db_xref="GeneID:11535642"
                     /db_xref="GOA:G8BUN3"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:G8BUN3"
                     /translation="MTRNSKDYSEASIEAEEIHRTGLKSLKDEMHDPSKQSTSEEFDS
                     EVIQMTVLASQQSLNNEVSSRVYIEENESKSKKIKNTIKKYLKFVGPGLLVSVAYIDP
                     GNYSTAVTSGAQNQYTLLCVVLLSNCIAIYLQCLCIKLASVTGLDLARACRTHLPRWA
                     NIILYCFGEACIISTDIAEVIGTAIALNILIKVPLPAGVAISIVDIFIIMLVYRPGVS
                     SMKLVRMFEIGIAGLVLAVFICFTVELSYIPFTVEQTRKIFRGFVPSREMFHNSGMYN
                     AISILGATVMPHSLFLGSGIVQPRLLDYDLKHNNYSINTDPDFEDTEEDHTKYNKEAM
                     KEEKFLNYAPSIGAIKYCMKYSMIELGSTLLTVAFFINCAILIVAGSTLYGTDQAIGA
                     DLYTIHSLLSSTISKGAGTIFMLALLLSGQSAGIVCTMAGQIVCEGHIKWSVVPWKRR
                     LLTRGISIIPCLIISICIGRSALSKALNSSQVVLSLLLPFIVAPLVYFTSSKKIMSLK
                     VPVMNKRNEETSKSCADAGKQNDLTDPSFQEARNDGTDIDCSVRSENITPNNSDVQGE
                     EDNEYTMVDMSNNWAMTIVSGIVWIFLSLLNVYAIVELGISHGDIS"
     gene            complement(<731898..>732320)
                     /gene="TPHA0F03390"
                     /locus_tag="TPHA_0F03390"
                     /db_xref="GeneID:11535643"
     mRNA            complement(<731898..>732320)
                     /gene="TPHA0F03390"
                     /locus_tag="TPHA_0F03390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686206.1"
                     /db_xref="GeneID:11535643"
     CDS             complement(731898..732320)
                     /gene="TPHA0F03390"
                     /locus_tag="TPHA_0F03390"
                     /inference="similar to DNA sequence:INSDC:YEL044W"
                     /note="similar to Saccharomyces cerevisiae IES6 (YEL044W);
                     ancestral locus Anc_1.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686254.1"
                     /db_xref="GeneID:11535643"
                     /db_xref="GOA:G8BUN4"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:G8BUN4"
                     /translation="MIGLNKSGPNPEQEARMEFLRSVSAQNAIQLPSPFKKANYKKPG
                     RRYKSSKQLTSEELKRLNNVEGNPPHKVTYFNVSAPPSLKPTKKYCDITGLPTSYKSP
                     TNSIRYYNSEIYQVIVKPMTTGVDQQYLKLRGDDFVLK"
     gene            <733567..>734733
                     /gene="TPHA0F03410"
                     /locus_tag="TPHA_0F03410"
                     /db_xref="GeneID:11535446"
     mRNA            <733567..>734733
                     /gene="TPHA0F03410"
                     /locus_tag="TPHA_0F03410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686207.1"
                     /db_xref="GeneID:11535446"
     CDS             733567..734733
                     /gene="TPHA0F03410"
                     /locus_tag="TPHA_0F03410"
                     /inference="similar to DNA sequence:INSDC:YEL046C"
                     /note="similar to Saccharomyces cerevisiae GLY1 (YEL046C);
                     ancestral locus Anc_1.489"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686255.1"
                     /db_xref="GeneID:11535446"
                     /db_xref="GOA:G8BUN5"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:G8BUN5"
                     /translation="MSEFELPPNYVSASNDFRSDTFTTPTSEMIQVALSATKGDAVYG
                     EDTDTVLLEKTIAKTFGYDAGLFCVSGTLSNQIALRTHLTQPPYSILCDYRAHVYTHE
                     AAGLAILSQSMVVPVIPSNGNYLTLEDIQSHYIPDDGDIHGAPTRVISLENTLHGILY
                     PLEELFRIRTWCKANNLLLHCDGARIFNACAESGVPSKQFAEIFDSISVCLSKSVGAP
                     IGSVLVGDVKFIKKANHFRKQQGGGIRQSGMISRMALYCVDGDWKEKIRYSHSLAHNL
                     AAFCKQEGIPLESPADTNFVFIDLQKAKMDPDVLVKKGLKYGVKLMGGRVSFHYQISN
                     ESLEKVKLAVKESFEYAKTHPYSQNGPTQIYRSESTEKMDVDGNAIRDIKTYKY"
     gene            <735814..>737223
                     /gene="TPHA0F03420"
                     /locus_tag="TPHA_0F03420"
                     /db_xref="GeneID:11535442"
     mRNA            <735814..>737223
                     /gene="TPHA0F03420"
                     /locus_tag="TPHA_0F03420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686208.1"
                     /db_xref="GeneID:11535442"
     CDS             735814..737223
                     /gene="TPHA0F03420"
                     /locus_tag="TPHA_0F03420"
                     /inference="similar to DNA sequence:INSDC:YEL047C,YJR051W"
                     /note="similar to Saccharomyces cerevisiae YEL047C and
                     OSM1 (YJR051W); ancestral locus Anc_1.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686256.1"
                     /db_xref="GeneID:11535442"
                     /db_xref="GOA:G8BUN6"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G8BUN6"
                     /translation="MSSRKPVVIIGTGLAGLSAGNQLVNKYKIPIVLLDKAANIGGNS
                     TKASSGINGAFTMTQKTLNVQDSPEYFTKIQLNPPNEGVDTLMNKLANDSSSAIEWLQ
                     NDFGIKLDLLAQLGGHSAPRTHRSSGKLPPGFEIVSTLSKNLQALAEKDPKLVSILLN
                     SNVVDVSVDTQGAISGVNYVDGDGNNKTIETKHVVFCSGGFGFSKEMLKEYAPEVVHL
                     PTTNGSQTTGDGQRILKKLGADLIDMDQIQVHPTGFIDPTDPEAGNKFLAAEALRGLG
                     GILLNPSTGKRFVNELTTRDEVTAAIQKECPSTKNNAYLVMSKNVYEAYKNNMDFYLF
                     KKLIKKTTVKEFVAESNFPISADELATSLLKYSTDASDEFGRTVTINSFGSDVNADTE
                     IFVGTVTPVVHFTMGGAKINTDAEVVKKDGSILAPGLYAAGEVSGGVHGANRLGGSSL
                     LECVVFGRTAANSIGANYN"
     gene            <737636..>738070
                     /gene="TPHA0F03430"
                     /locus_tag="TPHA_0F03430"
                     /db_xref="GeneID:11535443"
     mRNA            <737636..>738070
                     /gene="TPHA0F03430"
                     /locus_tag="TPHA_0F03430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686209.1"
                     /db_xref="GeneID:11535443"
     CDS             737636..738070
                     /gene="TPHA0F03430"
                     /locus_tag="TPHA_0F03430"
                     /inference="similar to DNA sequence:INSDC:YEL048C"
                     /note="similar to Saccharomyces cerevisiae YEL048C;
                     ancestral locus Anc_1.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686257.1"
                     /db_xref="GeneID:11535443"
                     /db_xref="GOA:G8BUN7"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:G8BUN7"
                     /translation="MSFLPCFASFIDENDTPILIHVLEDGKKDINDVLKFNVFSNIST
                     DYFNSNLYNSLAMESNATIKNLFQLEGISVYGSIIKATGLKLIIGFKSTDIDEERIQD
                     IVEKIKHIYMSVKLNPFIIADSNSGDQLLIEMLTKKLEEDLN"
     gene            <738544..>739749
                     /gene="TPHA0F03440"
                     /locus_tag="TPHA_0F03440"
                     /db_xref="GeneID:11535511"
     mRNA            <738544..>739749
                     /gene="TPHA0F03440"
                     /locus_tag="TPHA_0F03440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686210.1"
                     /db_xref="GeneID:11535511"
     CDS             738544..739749
                     /gene="TPHA0F03440"
                     /locus_tag="TPHA_0F03440"
                     /inference="similar to DNA sequence:INSDC:YJR053W"
                     /note="similar to Saccharomyces cerevisiae BFA1 (YJR053W);
                     ancestral locus Anc_1.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686258.1"
                     /db_xref="GeneID:11535511"
                     /db_xref="UniProtKB/TrEMBL:G8BUN8"
                     /translation="MIRRLTKNDMRELSIAEQNKSSLTVNDTHDKLPFLRKREDTFGY
                     REKGRGNATQHRLLDANSKIIQRAVNQNANFNSNRKMRSLKISPIKRTISTGLSQPDL
                     SNELLYAPKLNHITSSSYEHEPSNTSILVTDKQKSIKNSIGRVRFKEEFETQDLEVTL
                     QNITPIKNTSKDTFGLETETTKTVKKNGALSSQSSKLRLKELKREIALNCDLFYNSFI
                     EQHIKHNAQFPGNYLKHQNNRKDKYRCNLNSDSFTKDEYSFNNSSINIGRRSISFSSI
                     PSHSITSDTFDASADGLSNQISFNNEHNFTKEENITYVSSDGFKNDTNSPFNLSSESI
                     REFCKEEDYWKKSIGSWFIEPLLTDSATNDPVNHLNINPNSNSFHDTSHSYIIKEMVM
                     RSLKKTSKH"
     gene            <740660..>742303
                     /gene="TPHA0F03450"
                     /locus_tag="TPHA_0F03450"
                     /db_xref="GeneID:11535551"
     mRNA            <740660..>742303
                     /gene="TPHA0F03450"
                     /locus_tag="TPHA_0F03450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686211.1"
                     /db_xref="GeneID:11535551"
     CDS             740660..742303
                     /gene="TPHA0F03450"
                     /locus_tag="TPHA_0F03450"
                     /inference="similar to DNA sequence:INSDC:YJR054W,YML047C"
                     /note="similar to Saccharomyces cerevisiae YJR054W and
                     PRM6 (YML047C); ancestral locus Anc_1.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686259.1"
                     /db_xref="GeneID:11535551"
                     /db_xref="UniProtKB/TrEMBL:G8BUN9"
                     /translation="MLRFKWLYSLNPKTFADLNERKFKNYRFGTLASYLFFVIIMNIL
                     KVALFISDIYTCVKLLAFNSWGNNLIKPYLSFKISKWLFSGCIFFSIVLLIWEFIRSI
                     RVYKTKNIALSYINGFCKHYYSLKNYAIFCFFEELSVDSKFQQVAFFTFFEMKSCFRF
                     LFADTPRQVINGLTLWSVLISESNGKNLSDLESASNLLQKIKYIAQTNHEEAILLSFM
                     LFSFAIWCIFFIKFTIAVICLLYVYHKLITKQKYKGLREYVCISINNKVDYLIKENTD
                     KICDKNRMSYSDLGLQSRSRYNANPIHENNVKDKETYQQSAFNTSTEQLLEIEYLTRG
                     KYKDAEYEFDEFKVDPNVKILQDINDLEEYSDINNYEQYPTHDIDMENTDKPLRLSSM
                     IMDPALSYFRDEIYTFDVQKQFQPLQRQPTSSSGNSSESGVDNVRPDNLTHKIYNLSN
                     STVESYVCSSEKSCNIFNSANTANYNIRSSKVNLDPLDTTNVYKTKLLLNNNFNGSNL
                     EIMDKVYKTHHNFNIYTPSLAHFDQSKKDFHNEPDDLPI"
     gene            743550..743621
                     /gene="TPHA0Ftrna5R"
                     /locus_tag="TPHA_0Ftrna5R"
                     /db_xref="GeneID:11535612"
     tRNA            743550..743621
                     /gene="TPHA0Ftrna5R"
                     /locus_tag="TPHA_0Ftrna5R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGG"
                     /db_xref="GeneID:11535612"
     gene            <744202..>748206
                     /gene="TPHA0F03460"
                     /locus_tag="TPHA_0F03460"
                     /db_xref="GeneID:11535456"
     mRNA            <744202..>748206
                     /gene="TPHA0F03460"
                     /locus_tag="TPHA_0F03460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686212.1"
                     /db_xref="GeneID:11535456"
     CDS             744202..748206
                     /gene="TPHA0F03460"
                     /locus_tag="TPHA_0F03460"
                     /inference="similar to DNA sequence:INSDC:YML049C"
                     /note="similar to Saccharomyces cerevisiae RSE1 (YML049C);
                     ancestral locus Anc_1.497"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686260.1"
                     /db_xref="GeneID:11535456"
                     /db_xref="GOA:G8BUP0"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BUP0"
                     /translation="MIVRGEDNLYLYNLTLKKQSNYIHSCIGYFVDISVSNAVDISNT
                     EKKKLERKKQPHLQICIATESHIELYDVSEGNLTPLASIPIFAIITKIESIFFQNKEE
                     SVLAVLSDSGVLSIIQFINENGTIKLQTLYNQPLSRTGIRRLSPIYHLNVDPYGRCLL
                     ISAMERNKLCFLIDYQHDKFRISSPLEINRPDMIILEETVCDVLYNNPCFASIEIDTV
                     NNNDHRLVFYVLDLSLNHVIKKSDYKIRSTANFLMSLPELSRYDIRTLINEEDEADEN
                     INPFVIIGFENFILIKDMNGYYSLKVQIPRRENQQGVVTIISSSIQKLKKDFFILLQT
                     NHGDLLKLTVTADKNNRNRPMASISYFDSIYQSDKLHIFKNGYLFNNSEYFNCHLFQF
                     ESLGEDNSASNSCSSKTPEEHILFKPPTTLQNLSISHSLKCLNPLRDNTVSSSSPLTL
                     TYQRNNNICSIKASVEFTSLITTYISNNVKNLWPIRNPNSKFHKILILGYTNSTTMLN
                     IENDSIEELQLEDNPFITKGDNTILAELIGNRSIIQVCENEMHQITLGTENNFKLKLK
                     WYPPAGIRITSAACTASQIALALSNYEIAYFELNQFSDSDDINELQRRIEIGESISCL
                     SFENSLKSKYLAIGCQGSTVKIVSVYNGSSDDFLEIISMQAVMAPVSDIKLVRSNNLN
                     LHVGLSNGVYNTSKINDVDSQIYDTRTRYIGPSKVNLSIVSSILPDFDRNLQADSDDD
                     DDDYENDQNGEGDGEDNKGEESEINKITCVVIHNTQTWLSYEIDSFLYIRPITSESLS
                     EFMTMCNFYTNDIKMNGACGLNMRGELVIGQFQKLSKLDRWFNDASLTSLEIDTITDK
                     EKTIANNENSILEQNNKDSDDNDNDDDDDDEDDEGSILESPSYYTCATLKYDKNNDVK
                     VLISQHLHEKKCVISVTKNGKVLLNSKAKKKDKFAILNETQLLTATLVRFVPSSCHIV
                     LSTYDQKLITYSFSISNSKKGESKFSLSLVHITHIDDKIHSLTSFNDMLLAPIHGNIF
                     LFGLGKKQLLKKSITVTPPSITKVTTIKNWNNQRIVIGDIRESIMMFIFNKERNLFIP
                     VADDISGRATTTVEFLDESTVIGADKYGNIWTLRLSKKDNQIVNESNEEHWSINKKLL
                     LNKLPNIYECPFKFELKNHYFVNDIILKFHIIKSSSFSDRPVIIYTGLQGTIGCLIPL
                     ILEKQVSSLASIEMVLSDMDELFLFGNEEQREEKMLTHGEEEAYEDNNFLTDTKDHPS
                     SKMLEGAYSIVQRDHKSYRSYYAPVKNVIDGDLCESFLRLTYSEQALLSTKLEKMQPN
                     DIIMLLNEIRISCL"
     gene            <748482..>748961
                     /gene="TPHA0F03470"
                     /locus_tag="TPHA_0F03470"
                     /db_xref="GeneID:11535613"
     mRNA            <748482..>748961
                     /gene="TPHA0F03470"
                     /locus_tag="TPHA_0F03470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686213.1"
                     /db_xref="GeneID:11535613"
     CDS             748482..748961
                     /gene="TPHA0F03470"
                     /locus_tag="TPHA_0F03470"
                     /inference="similar to DNA sequence:INSDC:YJR055W"
                     /note="similar to Saccharomyces cerevisiae HIT1 (YJR055W);
                     ancestral locus Anc_1.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686261.1"
                     /db_xref="GeneID:11535613"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:G8BUP1"
                     /translation="MANEEKCAICHVADPNYKCPKCGVRYCSLKCYKNAEKHNHDTLI
                     ASEEKEKKQCSEIKSSIKDNEHGSLQTESYNSIYNGTPELQHLLKYNTVKFHLHKVYR
                     ILCTDISGNGGSSSNLNAESRKQLALDYLNTMLYGGIHYNEAIEEFCQIFLQKLNDM"
     gene            complement(<749082..>750473)
                     /gene="TPHA0F03480"
                     /locus_tag="TPHA_0F03480"
                     /db_xref="GeneID:11535533"
     mRNA            complement(<749082..>750473)
                     /gene="TPHA0F03480"
                     /locus_tag="TPHA_0F03480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686214.1"
                     /db_xref="GeneID:11535533"
     CDS             complement(749082..750473)
                     /gene="TPHA0F03480"
                     /locus_tag="TPHA_0F03480"
                     /inference="similar to DNA sequence:INSDC:YML051W"
                     /note="similar to Saccharomyces cerevisiae GAL80
                     (YML051W); ancestral locus Anc_1.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686262.1"
                     /db_xref="GeneID:11535533"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BUP2"
                     /translation="MRACQQFNNIEEKILHTQTLLKRNKKNTQRYMQNSDYFKRSAVS
                     TVPNSDPIRVGIIGLSSHKGWAFKAHYPAISQLPSQFQITALYNEKIETSLETIKKLK
                     LSEATAFPNLESFASSTNIDMFVVCNCVPDHYKTIIPLMEHSKKNPNLKYIFVEWAIG
                     SSIHQVEVIYKAVAERGLQSIVALQGRKSPYILRAKELISQGYIGEINSIEIAANGAW
                     YGYNRHMKSPMFIYEMENGVNLVTTTFAHTIDILQYITGSYFSRINSMLFNNIPEQEL
                     LDEYGKKTGKKVPKTVPDHLLFQGALMNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTK
                     GDIKLEGDAGFAEISNLVLYYNGFREEGIPAAPGQASYDTTKEFTEVYHLRNYNAILG
                     NIYRLYQSVADFHFNTQNLTNVPSQFIMQGFEFKGYPTLMDALILHRLIENVYRSNII
                     GSTVNVSNITQHV"
     gene            <751045..>751524
                     /gene="TPHA0F03490"
                     /locus_tag="TPHA_0F03490"
                     /db_xref="GeneID:11535438"
     mRNA            <751045..>751524
                     /gene="TPHA0F03490"
                     /locus_tag="TPHA_0F03490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686215.1"
                     /db_xref="GeneID:11535438"
     CDS             751045..751524
                     /gene="TPHA0F03490"
                     /locus_tag="TPHA_0F03490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686263.1"
                     /db_xref="GeneID:11535438"
                     /db_xref="UniProtKB/TrEMBL:G8BUP3"
                     /translation="MSMDHDRHVCVCISCTMNAAKIRITWPILLRSSLVPPAAFITLT
                     FCKSLYYHCPVQITSSCYERVSKKDQPHLPPPPTQARDYHMTCYYVQSHDKHVIAAPP
                     TRQSSSSHYLHAFYPAFLWFPPAHFVSANREAAIRSLPSPSLRLFLAKLFQKQICGF"
     gene            <752286..>752819
                     /gene="TPHA0F03500"
                     /locus_tag="TPHA_0F03500"
                     /db_xref="GeneID:11535439"
     mRNA            <752286..>752819
                     /gene="TPHA0F03500"
                     /locus_tag="TPHA_0F03500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686216.1"
                     /db_xref="GeneID:11535439"
     CDS             752286..752819
                     /gene="TPHA0F03500"
                     /locus_tag="TPHA_0F03500"
                     /inference="similar to DNA sequence:INSDC:YML053C"
                     /note="similar to Saccharomyces cerevisiae YML053C;
                     ancestral locus Anc_1.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686264.1"
                     /db_xref="GeneID:11535439"
                     /db_xref="UniProtKB/TrEMBL:G8BUP4"
                     /translation="MIQFPINTTGFSPFFNKSDKQNTEHDPNNYKSKRIKLNCNSEYT
                     QFSPQDFQAALAKNKQYNINETVNDDYLDRRRKTFTPTPAPTPAGPNYIRKVETQTKH
                     SFANHTYINDNLSLYSETEDYMVEGYFLHNHQSNSQVSFENSESIQNSLYDISQEEQH
                     QLQQFENMQDSMEIDFH"
     gene            <753272..>753946
                     /gene="TPHA0F03510"
                     /locus_tag="TPHA_0F03510"
                     /db_xref="GeneID:11535595"
     mRNA            <753272..>753946
                     /gene="TPHA0F03510"
                     /locus_tag="TPHA_0F03510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686217.1"
                     /db_xref="GeneID:11535595"
     CDS             753272..753946
                     /gene="TPHA0F03510"
                     /locus_tag="TPHA_0F03510"
                     /inference="similar to DNA sequence:INSDC:YJR057W"
                     /note="similar to Saccharomyces cerevisiae CDC8 (YJR057W);
                     ancestral locus Anc_1.504"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686265.1"
                     /db_xref="GeneID:11535595"
                     /db_xref="GOA:G8BUP5"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BUP5"
                     /translation="MAQRGKLILLEGLDRTGKTTQCERLVDILKETMKIEKVKQFKFP
                     NRENEIGKLINGYLTNSSNSLSDQAIHLLFSANRWESINEIKNLLNEGYYVILDRYVY
                     SGVAYSLAKEVEGMDIDWCLNCDKGLIKPDLTIFLTNDKTNKDREGFGDERYEKIAFQ
                     LKVKEKFFEIFTKIDNYNQETQHSSLAIVNVTNKTIEEVTDLIANASKNILTNKQYDV
                     NSFSYF"
     gene            <755480..>757756
                     /gene="TPHA0F03520"
                     /locus_tag="TPHA_0F03520"
                     /db_xref="GeneID:11535404"
     mRNA            <755480..>757756
                     /gene="TPHA0F03520"
                     /locus_tag="TPHA_0F03520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686218.1"
                     /db_xref="GeneID:11535404"
     CDS             755480..757756
                     /gene="TPHA0F03520"
                     /locus_tag="TPHA_0F03520"
                     /inference="similar to DNA sequence:INSDC:YJR059W,YKL198C"
                     /note="similar to Saccharomyces cerevisiae PTK2 (YJR059W)
                     and PTK1 (YKL198C); ancestral locus Anc_1.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686266.1"
                     /db_xref="GeneID:11535404"
                     /db_xref="GOA:G8BUP6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BUP6"
                     /translation="MSFLSSGNGNSAGSTKVSTPTSSNGLFSLKKKFFKSSTTSVISL
                     NSRDVRNVSGAPVTSMKTKKMMKQNSNPFINSNSNLPSPPRKGSNNVTPKRSNSMTNN
                     YNTATNNNSNSNTHNWESKEKPIVYNPYGMSNNSSMTNSGAPGSFSNPNDISFYMHDG
                     GAKIRLLPIPILDPNTFLPDNFAQRSVLLNDNFILDKENKTLGSGGSCEVRKIRSIYR
                     AKNVYALKKLNLIYQETPEQFYKRCSKEFIIAKSLSHNIHIINTFCIMKVPTTTYTTR
                     GWGVVMELGEGDLFQLIEKSGWKNVPLPEKFCLFKQIANGIKFCHENGIAHRDLKPEN
                     VLLSKDGVCKLTDFGISDWYHEIPNDFTSPVKTCQGMIGSPPYAPPEVMYFDSKKKYS
                     ENLQKPYNPLALDCYALGIILFTLVNGTTPFFESCNTDTRFRSFETSYDNFIAYQNKY
                     FRKGGVYKPGPGSEYSLSKNFRDEHASRVAWRLSDPKVETRYTLEDLYEDPWFKSIQT
                     CAEMHDDYNTEQPDIRPPKRTEEYTTSSANSIKSNVEEKHNNEHVIYMNNTLESFKEE
                     IKNGNDLLRDTLNNHSPVGHNGIIPSMTTTLKSKPRSMVDIAHSPQINKSGSKPSDSD
                     HAENEGQDANLFTLDEDSVKEKLEELLAENEVSPPAGSFSSNKITTPVPITSPVPNRI
                     LNNNALNSEPSIPSTISSPSQSYIPIVSTSSSSASSFRSNMSVSRGKLRNKQLIHNHM
                     NVVNSITSMSGSRSFSLK"
     gene            <758544..>759416
                     /gene="TPHA0F03530"
                     /locus_tag="TPHA_0F03530"
                     /db_xref="GeneID:11535666"
     mRNA            <758544..>759416
                     /gene="TPHA0F03530"
                     /locus_tag="TPHA_0F03530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686219.1"
                     /db_xref="GeneID:11535666"
     CDS             758544..759416
                     /gene="TPHA0F03530"
                     /locus_tag="TPHA_0F03530"
                     /inference="similar to DNA sequence:INSDC:YJR060W"
                     /note="similar to Saccharomyces cerevisiae CBF1 (YJR060W);
                     ancestral locus Anc_1.508"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686267.1"
                     /db_xref="GeneID:11535666"
                     /db_xref="GOA:G8BUP7"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8BUP7"
                     /translation="MSTKRDTSDTEDETTNVIKRHKHAFKKMSEGSASELPADYEDQN
                     IDDALLEQDNEKHDDLEDNDDELNNNEDAAVAAAVASAAANYDRLIHEDDSMKIVHED
                     DVEVTLSSGEKKETSTEYNDESKNEGSEDRGNEKVKSSTAPSRRGRKPMADAGTVEWK
                     QQRKDSHKEVERRRRENINTAISKLSELLPVKESSKATTLARAAEYIQKLKETESANI
                     EKWTLQKLVNDQNSNRLISTNEKLQEELGNAYKEIESLKKSVSKYKGRLKELGIKSEE
                     SRNKHKHKSENNED"
     gene            <762007..>764922
                     /gene="TPHA0F03540"
                     /locus_tag="TPHA_0F03540"
                     /db_xref="GeneID:11535667"
     mRNA            <762007..>764922
                     /gene="TPHA0F03540"
                     /locus_tag="TPHA_0F03540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686220.1"
                     /db_xref="GeneID:11535667"
     CDS             762007..764922
                     /gene="TPHA0F03540"
                     /locus_tag="TPHA_0F03540"
                     /inference="similar to DNA sequence:INSDC:YKL201C,YJR061W"
                     /note="similar to Saccharomyces cerevisiae MNN4 (YKL201C)
                     and YJR061W; ancestral locus Anc_1.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686268.1"
                     /db_xref="GeneID:11535667"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:G8BUP8"
                     /translation="MNLVEYYIKRFIRNIIKSKLIVQVLVTVVLINVLVITMKSTNKT
                     AQDLDKNFASIIKYKPASDNGVYTKPTANSISDILYDPISFLKDLYGTLRPLTNDELG
                     KILYRKLRFDTSYEWLDIYELQKDLLTIQVGPSKNTKVESINDLTFYESDPRLVWSVY
                     IDHLLNKESINAETKIPFSWYDWADFHEYNKIRSLEKTTIRCPFFFDAAFELEKLAEI
                     EKEIDSPLFHKDRMKYNDMKWYSKQRRMSETHVFSVMDKHCEASQNNLDSKSKDPKGH
                     SKQFEPQIKITQLYDKVRPEVYQLQARNYLLTNLTHPLSLTVLDGYKKSFRFYLDQRD
                     NAKNIIESEMLHDFFERNVDYEKNPIEKTENYDVRNNQTKYDYVFDHFTMYDRFVKSD
                     VANKLTVDVKGGEKTVFDKDLFELKEEDFDFDVLGKIKELKAKDKLDLHDQKYLDSLI
                     YSINTAPALATKYFTEASNVKSFNSMGWHRDKRFFNGDFRDDEQEYQQTLNAMIRTFQ
                     KFTRSNGIISWLSHGTAYGYMYNGMAFPWDNDFDLQLPIKHLHLLAQYFNQSLIIEDP
                     REGNGRYLLDIGSSITTRTNGNGKNNIDARFIDINSGLYIDLTGISVTASPLKGYMDN
                     YFKKNIGDKLEKVLSNQTISLLQRPESGLASMNIFELENYTKNENTGLTKDQISTIQD
                     MAKHERELVTKGKGIDSKYSETQRYTLHKLLGIFNCKNNHFSTLQHLSPLRLTDFHGV
                     ATLVPNGYLKLLKYEYSIPENYIYTTYKEMAYVPELRAWLRSDILKKAGSMFSWYPDF
                     PTLSSPLTNLTLPDLQLMYYNIVKGGYTELVGVLYNSFNMTSYRVKELEIQSSDLKVD
                     EKRDLLTKLYENVSPNIQNPCKDPYLFSHERRLWSQLSQELSNSTLQEIRQDIASSVL
                     KDLWSWSIDLYKRDYKFFEYFDVPYNMTVNLNEYGINLFSNATGNKASQIFKKDKPF"
     gene            <765311..>765685
                     /gene="TPHA0F03550"
                     /locus_tag="TPHA_0F03550"
                     /db_xref="GeneID:11535523"
     mRNA            <765311..>765685
                     /gene="TPHA0F03550"
                     /locus_tag="TPHA_0F03550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686221.1"
                     /db_xref="GeneID:11535523"
     CDS             765311..765685
                     /gene="TPHA0F03550"
                     /locus_tag="TPHA_0F03550"
                     /note="ancestral locus Anc_1.511"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686269.1"
                     /db_xref="GeneID:11535523"
                     /db_xref="UniProtKB/TrEMBL:G8BUP9"
                     /translation="MILFEEGHDRKKDELSYSEFQAPLIDPKQIAVDNIIPHGYDAGT
                     YKKEDKTTTNVANTKEIEQPLKFEVFKSYEADNARASEVHNPKNSLSALVKNAERNKK
                     TFEERNKRIKESNQASKRQYGW"
     gene            <766406..>768085
                     /gene="TPHA0F03560"
                     /locus_tag="TPHA_0F03560"
                     /db_xref="GeneID:11535344"
     mRNA            <766406..>768085
                     /gene="TPHA0F03560"
                     /locus_tag="TPHA_0F03560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686222.1"
                     /db_xref="GeneID:11535344"
     CDS             766406..768085
                     /gene="TPHA0F03560"
                     /locus_tag="TPHA_0F03560"
                     /inference="similar to DNA sequence:INSDC:YJR064W"
                     /note="similar to Saccharomyces cerevisiae CCT5 (YJR064W);
                     ancestral locus Anc_1.513"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686270.1"
                     /db_xref="GeneID:11535344"
                     /db_xref="GOA:G8BUQ0"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012718"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ0"
                     /translation="MAQPQAMQMPDMSNAIMAQDEMGRPFIIVRDQSNKKRQHGIEAK
                     KSHILAARSVASIIKTSLGPRGLDKILISPDGDITITNDGATILSQMELDNEVAKLLV
                     QLSKSQDDEIGDGTTGVVVLASALLDQALELIEKGIHPIKVASGFDEAAKLAIRKLES
                     TTDDMAPNKEYFNDYLFKAAKTSLGSKIVSKNHDKFAKMAVDAVTSVMDEERKDVHFD
                     LIKLEGRVGGSLKDSEMVRGVILDKDFSHPQMPKEVLPKEGKNGVKLAILTCPFEPPK
                     PKTKHKLDISSVEEYEKLQNYEQETFKKMIKDVKDAGTDIVICQWGFDDEANHLLLQN
                     DLPAVRWVGGQELEHIAIATQGRIVPRFQDLSEDKLGTCKRVYEMEFGTTKERMLVIE
                     QEGTVSKTVTCLIRGSNKMIVDEAKRALHDSLCVVRNLVRDSRVVYGGGAAEVTMSIA
                     VSEEADRQRGIDQYAFRAFAQALDTIPMTLAENSGLDPIETLTTLKSKQIKENSSLIG
                     VDCLGAGTNDMKELFVIDPFIGKKQQILLATQLCRMILKIDNVIISGKDEY"
     gene            <768648..>776030
                     /gene="TPHA0F03570"
                     /locus_tag="TPHA_0F03570"
                     /db_xref="GeneID:11535345"
     mRNA            <768648..>776030
                     /gene="TPHA0F03570"
                     /locus_tag="TPHA_0F03570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686223.1"
                     /db_xref="GeneID:11535345"
     CDS             768648..776030
                     /gene="TPHA0F03570"
                     /locus_tag="TPHA_0F03570"
                     /inference="similar to DNA sequence:INSDC:YJR066W,YKL203C"
                     /note="similar to Saccharomyces cerevisiae TOR1 (YJR066W)
                     and TOR2 (YKL203C); ancestral locus Anc_1.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686271.1"
                     /db_xref="GeneID:11535345"
                     /db_xref="GOA:G8BUQ1"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ1"
                     /translation="MLQLRRNVEARKAKKKLGSNRDSGNMSSSSTQNGVQSSAGNEST
                     LDITTGPDGKVFVDNDHSMVDLETNFGTINIIFDKLKSPSAQERTQASLELKASLISV
                     AREISTEQFQRFSNILNNKIFELIHGSDLNEKMGGILAVDTLIDFYVHTEELPNQTSR
                     LANYLRVLIPSNDTEVMRAAATTLGKLAIPGGTLTSDFVEFEVKTCIEWLTTSPGNNS
                     SSSKQEHRKHAALLIVTALANNSPYLLYPYVNSILDNIWRALRDSKLVIRLDAAITLG
                     KCLSIIQNRDSTLTKQWYERLFKGCIYGLSLSSNDATHATLLVYRELLALRGSYLNGK
                     YDEIYYSTIKYKEHKSDVIRNEVYAIIPLLASFNPHQFTTKYLDQIMIYYLMVLKNLN
                     ASSTNIADKPFILISIGNIASEVAGSITPFLDAILGNIRDGLKTKYKNRKTFERGLFY
                     CISKLASAVRGALAKHLNKDILDLILACQLSDYMQDTLMTLNKMIPALQPTINERLLN
                     LLCIYLSGEEFQQPGSPNVQKSFSLATARDWRDKTIFKKTGEINDDDNDARILTQTFR
                     MLQTIVHKYSLTEFVQIVTISYIEHQNPFVRKLAALTSCDLFVKEDICELTSLHALNS
                     VSEVLSKLLALAITDPVADIRFEILQHLNSKFDPHLAQPDNIRLLFMALNDEVFVIQM
                     EALKIIGRLTSVNPAYIIPSLRKTLLELLTQLKYSVKPRKNEESATLLCTLISSSKEV
                     TKAYIEPILDVLLPKSQDSSSVVASTALKTVGELSVVGGEEMKQYLDDLMPMIINTFQ
                     DQSNSFKRDAALKTLGQLASSSGYVIEPLLEYPELLGVLISILKSESSLNIRRETVRL
                     IGILGALDPYKHREVEVTLNTKISVEQNAPSIDIALLMQGMSPSNEEYYPTVVINTVL
                     KILRDPSLSTHHTAVIQAIMHIFQVLGLRCVSFLSQIVPAIINIMHTCPPSLLEFYFQ
                     QLGLLINVVKQHIRPHVNEIYGVIQKFIPIIKLQIPIIAVIEVISKSMEGEFKKFVPQ
                     TLTFFINILENDKSPKKAVSIRILKSIVVFNSNIEDFSHLIIPTIVRMSEFSHGNLKK
                     MSIVTIGKLAKSINISEMSSRIVQTLVRILNNGDNELTKCIMNTLSLLLLQLGTDFTV
                     FIPVINKSLIRNHIQHSIYDQLVNQLLNNEGLPTNIVFDKEYDTPSKDVAEIESPPAK
                     LPVNKQVLQNAWDCSQQRTREDWQEWIRRLSIQLLKESPSHALRACSNLAGIYNPLAR
                     DLFNASFSSVWTELYSQYQEDLVNSLCTALSSPHNPPEIHQTLLNLVEFMEHDDKSLP
                     IPIQVLGKYAQKCHAYAKALHYKEVEFIQEPSTSTIESLISINNQLHQTDAAIGILKH
                     AQQHHDLQLKETWYEKLQRWDDALKAYTKREEEGEDSLEVMMGKMRSLHALGAWEKLS
                     TLAESKWSGSKLDVKKIMAPLAAGAAWGLGEWERIEQYINVMKPQSPDKEFFDAVLAV
                     HKSNFNEAEKHIFNARDLLVTEISALINESYDRAYGVVVRAQIIAELEEIIKYKKLPP
                     DSENAIVIRNTWNKRLLGCQKNVDVWQRVLRVRSLVVKPKQDKQIWIKFANLCRKSGR
                     MGLARKALNSLLEDGGDPDHPNTARAPPPVIYAQLKYLWSTGSQKDTLLHLIGFTSRM
                     AHDLGLDPNNMIAQNVMKSSTIAPEHVDEYTKLLARCFLKQGEWRVQLQPNWRVENPD
                     AILGSYLLATHFDNKWYKAWHNWALANFEVISMISSSSLEKVNVSSEASTNMMYKIEN
                     NSKESDIKDIQKEAFPAELIQRHVVPAIKGFFHSISLSESSSLQDTLRLLTLWFTFGG
                     IPEATQAMHEGFRLIKIDNWLEVLPQLLSRIHQPNQVVSRSLLSLLSDLGKAHPQALI
                     YPLTVAIKAESISRQKAALSIIEKMRMHSPTLVDQAELVSGELIRVTVLWYELWYEGL
                     EDASRQFFGEHNTEKMFATLEPLHEMLRRGPETLREISFQNSFGRDLNDAYEWVMNYK
                     RSKDISNLNQAWDIYYNIFRRISRQLPQLQVLELQHVSPKLLAARDLELAVPGTYQAG
                     EPLVRISRFDPVLTVISSKQRPRKVTIKGSDGKDYLYALKGHEDIRQDKLVMQLFGLV
                     NTLLQHDPDCFQRHLDIQKFPVIPLSPRSGLIGWVSNSDTLHVLIREHREAKKVPLNI
                     EHWVMLQMAPDYDSLTLLQKVEVFTYALDNTRGQDLYKVLWLKSRSSESWLERRTTYT
                     RSLAVMSMVGYILGLGDRHPSNLLLDRITGKVVHIDFGDCFEAAILREKYPEKVPFRL
                     TRMLTYAMEVSGVEGSFRITCESVMRVLRANKDSLMAILEAFVYDPLIHWGFDLPTQT
                     IMESTGIEFPILNPSELLRKGAITAEEASKMELEQKTQIRNARSMLVLKRITDKLAGN
                     DIPRFTELDVPEQVDKLIQQATSVENLCQHYIGWCPFW"
     gene            complement(<776340..>777491)
                     /gene="TPHA0F03580"
                     /locus_tag="TPHA_0F03580"
                     /db_xref="GeneID:11535619"
     mRNA            complement(<776340..>777491)
                     /gene="TPHA0F03580"
                     /locus_tag="TPHA_0F03580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686224.1"
                     /db_xref="GeneID:11535619"
     CDS             complement(776340..777491)
                     /gene="TPHA0F03580"
                     /locus_tag="TPHA_0F03580"
                     /inference="similar to DNA sequence:INSDC:YKL204W"
                     /note="similar to Saccharomyces cerevisiae EAP1 (YKL204W);
                     ancestral locus Anc_1.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686272.1"
                     /db_xref="GeneID:11535619"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ2"
                     /translation="MKAQDESNYNDLFLELKNHQEDKNKTKNREEVLEPLTCVATLDD
                     EISLKESNKKIQYKPSELLEVFKSIPKHYLTKASLQLPNYSFWRIHHPGSNVKRSSMK
                     TKEENTLSTKNVSRKSSLWNKMPEEEYKVDKNISINQDSLNDYENTSPTSIFSKFFSI
                     SSGSTHSGQSSIETSPLNSPSSNIFDASNREEYFPQYMGFIEMNNDKRFTNPFLNDNK
                     QQNIPQVSWNNECYPMAYNGVTKSSKQYSTNLNNMPNHIFNNPENVIYPNMFRRNSTN
                     SNLIQNTFNQQPISTNANNFRSNVKNRSYSNPENNVFENFFCYYPNPFLPDNKLKSYP
                     VLDENNPPVYYNRTEKNDINYYQSEQTTLPNSSINKANYENQYFTQPHI"
     gene            complement(<778125..>779093)
                     /gene="TPHA0F03590"
                     /locus_tag="TPHA_0F03590"
                     /db_xref="GeneID:11535398"
     mRNA            complement(<778125..>779093)
                     /gene="TPHA0F03590"
                     /locus_tag="TPHA_0F03590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686225.1"
                     /db_xref="GeneID:11535398"
     CDS             complement(778125..779093)
                     /gene="TPHA0F03590"
                     /locus_tag="TPHA_0F03590"
                     /inference="similar to DNA sequence:INSDC:YJR070C"
                     /note="similar to Saccharomyces cerevisiae LIA1 (YJR070C);
                     ancestral locus Anc_1.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686273.1"
                     /db_xref="GeneID:11535398"
                     /db_xref="GOA:G8BUQ3"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027517"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ3"
                     /translation="MSTNFEKHFQELVDGSTMEELRDILINKSGNTELANRFRALFNL
                     KTLAEDFQAKPDVAKLAVYYIAECFNDESELLKHEVAYVLGQTKNMESCQILREVTLD
                     QNQQCMVRHEAAEALGALGDINSLELLEKAAVEDPALEVRQTCELAASRIKWQHGTEK
                     DAEHLQQSLYSSIDPAPPLALQQDYKIEELKSILNDQEKPMFERYRAMFRLRDVGTDE
                     ACFALASGFNDPSALFKHEIAYVFGQLGNPCIVPNLVEVLGRKEEAPMVRHEAAEALG
                     AIATDDVLPILKGYLNDEVDVVRESAIVALDMYEYENSAQLEYAPS"
     gene            781330..781401
                     /gene="TPHA0Ftrna3T"
                     /locus_tag="TPHA_0Ftrna3T"
                     /db_xref="GeneID:11535486"
     tRNA            781330..781401
                     /gene="TPHA0Ftrna3T"
                     /locus_tag="TPHA_0Ftrna3T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACG"
                     /db_xref="GeneID:11535486"
     gene            complement(<781595..>782314)
                     /gene="TPHA0F03600"
                     /locus_tag="TPHA_0F03600"
                     /db_xref="GeneID:11535637"
     mRNA            complement(<781595..>782314)
                     /gene="TPHA0F03600"
                     /locus_tag="TPHA_0F03600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686226.1"
                     /db_xref="GeneID:11535637"
     CDS             complement(781595..782314)
                     /gene="TPHA0F03600"
                     /locus_tag="TPHA_0F03600"
                     /inference="similar to DNA sequence:INSDC:YJR073C"
                     /note="similar to Saccharomyces cerevisiae OPI3 (YJR073C);
                     ancestral locus Anc_1.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686274.1"
                     /db_xref="GeneID:11535637"
                     /db_xref="GOA:G8BUQ4"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ4"
                     /translation="MSSVTNSAVSAVSSAITSAAKNTETINSLSSAFDYILDIYLDLF
                     ESINFDDQNLKISLLLVAFNPIFWNLVARLEFSTHFLTKLAGNAKRGCYILAFTIFSL
                     GIARDYFFEQALKNQFTSPYLEHTYVKIAGVVSFLIGQVLVISSMYQLGITGTYLGDY
                     FGILMDERVVSFPFNVSNNPMYQGSTLSFLGTSLVYGKAAGLLVTFTVYTMYSCALKL
                     EEPFTSHIYALRDEGKTKKNN"
     gene            complement(<783260..>786331)
                     /gene="TPHA0F03610"
                     /locus_tag="TPHA_0F03610"
                     /db_xref="GeneID:11535487"
     mRNA            complement(<783260..>786331)
                     /gene="TPHA0F03610"
                     /locus_tag="TPHA_0F03610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686227.1"
                     /db_xref="GeneID:11535487"
     CDS             complement(783260..786331)
                     /gene="TPHA0F03610"
                     /locus_tag="TPHA_0F03610"
                     /inference="similar to DNA sequence:INSDC:YKL210W"
                     /note="similar to Saccharomyces cerevisiae UBA1 (YKL210W);
                     ancestral locus Anc_1.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686275.1"
                     /db_xref="GeneID:11535487"
                     /db_xref="GOA:G8BUQ5"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ5"
                     /translation="MSNQVMNGEIDEGLYSRQLYVLGKEAMLKMQLSNILIIGMKGLG
                     IEIAKNVALAGVKSMKLYDPELIKIEDLSTQFFFSEENVGSKRDVVSINKLKELNAYV
                     PVDALENIDSDFENLKQFQVIVTTDTVSLEDKIKINEFCHKKGIKFISTETRGLFGNI
                     FVDFGEEFSVIDSTGEEPKSGIVSDIEADGTVTMLDDNRHGLEDGNYVKFSEVEGLEK
                     LNDNGIYKVEVLGPFAFRIGSVKELGTYIKGGIFTEVKVPVKLNFSTLRESLSNPEFL
                     FSDFAKFDRTPQLHLGFQALHQFQIRHQNQLPRPMNDEDANEMIKLVTDLAVQEPKVL
                     GLEDSNEDPQIDKELIKELSYQARGDIPGIVAFFGGLVAQEILKGCSGKFTPTKQFLY
                     FDSLESLPDSKNFPRTEENTKPINSRYDSQIAVFGLDFQKKLANSKVFLVGSGAIGCE
                     MLKNWALLGLGSGENGKIFVTDNDSIERSNLNRQFLFRPKDVGRNKSEVAADAVIAMN
                     PDLKNKIIPKIDKVGSETEDIFDDAFWQSLDFVTNALDNVDARTYVDRRCVFFGKPLL
                     ESGTLGTKGNTQVIIPRVTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQG
                     YFADAPENVNLFLSDPNFLENVLKQSGDVKGIFESISASFTERPKDFDECIKWARTEF
                     ETKFTNDIQQLLYNFPKDAKTSNGAPFWSGPKRAPTPLTFDINNNDHFHFVVAGANLR
                     AFNFGLKGDFNNPDIKHYKSVIDGMIIPDFSPSSNIKIQVNDDDPDPNAGNANDGIDI
                     LVKSLPDPSTLGSDSKLVPVEFEKDDDTNHHIEFITACSNCRALNYSIETADLQKTKF
                     IAGRIIPAIATTTALVTGLVNLELYKVVDGKTDIEQYKNGFVNLALPFFGFSEPIASP
                     KAKYNDTEYDKIWDRFNIQGDIKLKDLISHFEKEESLEITMLSYGVSLLYASFFPAKK
                     LKERMDLTITELVKFVTKKEIPSHVKTMILEICADDKEGEDVEVPYVVIQL"
     gene            <786888..>787469
                     /gene="TPHA0F03620"
                     /locus_tag="TPHA_0F03620"
                     /db_xref="GeneID:11535616"
     mRNA            <786888..>787469
                     /gene="TPHA0F03620"
                     /locus_tag="TPHA_0F03620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686228.1"
                     /db_xref="GeneID:11535616"
     CDS             786888..787469
                     /gene="TPHA0F03620"
                     /locus_tag="TPHA_0F03620"
                     /inference="similar to DNA sequence:INSDC:YJR074W"
                     /note="similar to Saccharomyces cerevisiae MOG1 (YJR074W);
                     ancestral locus Anc_1.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686276.1"
                     /db_xref="GeneID:11535616"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="InterPro:IPR016123"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ6"
                     /translation="MNTEKVQLYGGTISSTIPSGFLDVSMIREVPDTQEVYVNSRTDS
                     DHFDDGLGRNESIIFDLLERVDATDDKEALEVHIGEISELNDSDGWLKINWKQLDNTS
                     QTVILIESAKKWGKQSLEEVVVICMGLIRFKEFDTDVVITINVPLGTKLLDSENEQKL
                     KESVCENSNVKAAYRILQTTIKDFKIVDKTLFV"
     gene            <788346..>789569
                     /gene="TPHA0F03630"
                     /locus_tag="TPHA_0F03630"
                     /db_xref="GeneID:11535406"
     mRNA            <788346..>789569
                     /gene="TPHA0F03630"
                     /locus_tag="TPHA_0F03630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686229.1"
                     /db_xref="GeneID:11535406"
     CDS             788346..789569
                     /gene="TPHA0F03630"
                     /locus_tag="TPHA_0F03630"
                     /inference="similar to DNA sequence:INSDC:YJR075W"
                     /note="similar to Saccharomyces cerevisiae HOC1 (YJR075W);
                     ancestral locus Anc_1.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686277.1"
                     /db_xref="GeneID:11535406"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ7"
                     /translation="MSKRARKNSIRTKILLTSLFTTIITLIFVKVVFFMFSSDVDISF
                     KNLNAELSGNLQSTNLLTKNKGLNGELYDKIEELANQIIKEQSLQTKELDKQRRYLEK
                     KINSLKELPARSSQSLREKLTYQFEYDSSKKFPAYIWQIFTETSIGNKKTNEVKNEDT
                     LNLLWGDKNPGFVDEVFDNNEVIKAMIKYHYSNIPEILEAFESLPSEILKVDFFKFLL
                     LLARGGTYVDSDTIPLIPIPNWIPESINTKDVGLLIGIEHDSSPANWEQTFARRLQFG
                     TWIIQAKPGHPVIKEMVARITEFTLKRKSEDNLLVNVRNDVNVMNWTGAGIWTDILFS
                     YFNDYLKSGLSTKVSWKEFHLLENPKLLSDVLVFPAFSFNAPKEITNQDPNKSYYFCH
                     HEKKKSWKNIPKVEN"
     gene            complement(<789847..>791775)
                     /gene="TPHA0F03640"
                     /locus_tag="TPHA_0F03640"
                     /db_xref="GeneID:11535407"
     mRNA            complement(<789847..>791775)
                     /gene="TPHA0F03640"
                     /locus_tag="TPHA_0F03640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686230.1"
                     /db_xref="GeneID:11535407"
     CDS             complement(789847..791775)
                     /gene="TPHA0F03640"
                     /locus_tag="TPHA_0F03640"
                     /inference="similar to DNA sequence:INSDC:YKL212W"
                     /note="similar to Saccharomyces cerevisiae SAC1 (YKL212W);
                     ancestral locus Anc_1.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686278.1"
                     /db_xref="GeneID:11535407"
                     /db_xref="GOA:G8BUQ8"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ8"
                     /translation="MTTGPLLFASTPDGLLFKPAVTETITEDDIKKTFNDVLQFSNHD
                     QGVKVVGQEEFPTTGNITEIACLLGFIRLKLNRYAIVANSVEETARFNGEPVYKITQH
                     SIIPVQDSARIDADEQEYIKLLNLQLNNAQLYFSYTYDLVNTRQRSQKFRTSIEDKID
                     WRNADTRFFWNHYLTEDLQTLAREDPKVDYFIQPVIYGFCKAIRTVFNYNPITLGLIT
                     RRSRFRAGTRYFRRGIDEDGNVGNFNETEQVLFVEATACNAPLESFSFVQTRGSVPVY
                     WAEVNNLKYKPNLFLGDNDVASNYEATKKHFAEQEKIYGDNYLINLVNQSGYESPVKN
                     AYEQAINALNDPKLHYIYFDFHHECRNMKWNKVKILIDVLQKNGFKSSNTFHKVENAA
                     GETVRISSEQDAVIRTNCMDCLDRTNVVQSVIAHWVLQNAFEESNCILDQSQWADIDK
                     SLLEAFQNLWADNADAVSESYSGTGALKTDFTRTGKRTKMGAFNDLINSISRYYQNNL
                     TDGPRQDSYDLFLGNFKPYISSIQSAFPDRRPLYVQFIPIILIAAITVLFATILFPKG
                     YFTSSKNLTFFLIASITIVALTSFIFKHGMQFVNWPKLSDIGFLVVQETHDKEQQFKG
                     LKYVVSPRFSKPTNNKKD"
     gene            <793481..>795703
                     /gene="TPHA0F03650"
                     /locus_tag="TPHA_0F03650"
                     /db_xref="GeneID:11535569"
     mRNA            <793481..>795703
                     /gene="TPHA0F03650"
                     /locus_tag="TPHA_0F03650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686231.1"
                     /db_xref="GeneID:11535569"
     CDS             793481..795703
                     /gene="TPHA0F03650"
                     /locus_tag="TPHA_0F03650"
                     /inference="similar to DNA sequence:INSDC:YKL213C"
                     /note="similar to Saccharomyces cerevisiae DOA1 (YKL213C);
                     ancestral locus Anc_1.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686279.1"
                     /db_xref="GeneID:11535569"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR015155"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BUQ9"
                     /translation="MNYKLSATLKGHTQDVRDLVTIDDNRIASVSRDGTLRVWSKTNN
                     NQWDDGTIVYSDKNFLNSVTFDSTNNLIYFGGKDSLINAKYTNSSLDDDPIITLIGHE
                     GNVCSLNYDEKSNLVTSGSWDMTAKVWKNGEMKGDLKGHKGSVWDSVVLSSHADSNDA
                     HFITVSADKYVKIWNSKNVILNNFYNIHSDVIRKVLPLEDGKKFITASNDSFIKVVET
                     ETGKVLNTFSGHESFVYSIARNKHNDDELISCGEDRSVRIWSLSTGLVQQVIRLPAIS
                     IWCIDTLPNGDIIVGSSDNTIRIFTRDSTRAAEEEELQLFEESVSNSSLNANAMDFDE
                     SKLLPYDTLNLPGKKEGQLIVVKSPSTGVIEAHQYTQGKWAKIGDVVGSSNTGNDQKI
                     EFEGKKYDYVFDVDIQEGQPPLKLPVNANDNPYILADQFLMKYDLSSTYKDQIVNFII
                     TNTNGVALDNTAPPDPSPSAHIDDNTSRNDIINYLVLPVKEFLSISAFNPDTIFNGIV
                     KLNAGQEKKVQFEDDLLAELGTALNDIDNGWELLLSIANRIKEDWTTKIPSFDIMRII
                     VTKLPEPAYLMDYVKTGLDSADIRISMLTVRMLVNAFGNEKWGLDLMASKDIKENLFE
                     TIGTNFPTATMQQASNYALSVSTLIFNYSALLSRNNNENIDLIHILSEAINNKFAKLE
                     EYQDSEEACYRLIVAYGNMSLVEPALKSFASSVTWLNKAKSTYGTIPRFEQIFRDIGV
                     "
     gene            complement(<796023..>796979)
                     /gene="TPHA0F03660"
                     /locus_tag="TPHA_0F03660"
                     /db_xref="GeneID:11535475"
     mRNA            complement(<796023..>796979)
                     /gene="TPHA0F03660"
                     /locus_tag="TPHA_0F03660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686232.1"
                     /db_xref="GeneID:11535475"
     CDS             complement(796023..796979)
                     /gene="TPHA0F03660"
                     /locus_tag="TPHA_0F03660"
                     /inference="similar to DNA sequence:INSDC:YJR077C"
                     /note="similar to Saccharomyces cerevisiae MIR1 (YJR077C);
                     ancestral locus Anc_1.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686280.1"
                     /db_xref="GeneID:11535475"
                     /db_xref="GOA:G8BUR0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BUR0"
                     /translation="MSAPKSTLETNIQPVIPQYSVGDYAKFALAGAIGCGTTHSSMVP
                     IDVVKTRIQLEPTVYNTGMVGSFRKIISQEGSGALLTGFGPTLLGYSIQGAFKFGGYE
                     VFKKFFIDQLGYETATNYKNSIYMGSAAAAEFLADIALCPLEATRIRLVSQPQFANGL
                     VGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFGIVGEKETLSGS
                     VQTAVNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGS
                     FTGLPTRLVMVGTLTSLQFGIYGTLKKSLGCPPTIEIGGGGH"
     gene            <799232..>803125
                     /gene="TPHA0F03670"
                     /locus_tag="TPHA_0F03670"
                     /db_xref="GeneID:11535556"
     mRNA            <799232..>803125
                     /gene="TPHA0F03670"
                     /locus_tag="TPHA_0F03670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686233.1"
                     /db_xref="GeneID:11535556"
     CDS             799232..803125
                     /gene="TPHA0F03670"
                     /locus_tag="TPHA_0F03670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686281.1"
                     /db_xref="GeneID:11535556"
                     /db_xref="GOA:G8BUR1"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:G8BUR1"
                     /translation="MVSNYGNIRIAIDRGGTFTDCIGNIGTGKKEDDRIIKLLSVDPK
                     NYDDAPLEGIRRLLEIFENKTIPRNTKLDISNVQSIRMGTTLATNCALERNGEDCCFI
                     TTKGFKDTLLIGDQTRPNIFELNIARDKLKPLFNMCVEIDERITLEDFSEDPEKIITK
                     VDQDDDNLVIGKSGEAVRIIKKPDLNEIRSTLNLVYQSGIRSIAVAFVHSYTYPNHEL
                     LIKKIAEDIGFEHISLSSEISPMIKFLPRAYSAVADAYLTPVIKNYLKKISHGLFIKN
                     DSTAGSGNTLKNIQFMQSDGGLVEGDKFSGLKSILSGPAGGIVGYAETCYDPENSIPL
                     IGFDMGGTSTDVSRYGSGKLQHVFETVTAGITIQSPQLDIHTIAAGGSSILSWENGLF
                     KVGPKSASADPGPACYRKNGPLTITDANLYLGRLIPEMFPHIFGPNENEPLDLEITKD
                     KFEQLTTKINKDLKVKMTTDEVVYGFLKVACESMARPIRALTEAKGYEISKHRLVSFG
                     GAGGQHAVAVAESLGIDTVLIHRYSSVLSAYGIFLANVVEEQQKPSSLVLSDANSRRI
                     VEKEFKDLELICKSKLYNQNFFDEDINIERYLNLRYEGTETGLMILQEEENIWNFQKW
                     FSSAHHREFGFSFDNKRIIVDDIRVRAIGKSNIRAESSVDKQLAIYHQKVVDSMKNIF
                     MTKSIFFENKRIDTPIYQIEKMEYGTQIRGPAILADSTQTNVLPPNAIATVLESHIFI
                     KIDHDDNKSIVDREGAVNPVLLSIFSHRFMDIAEQMGTQLRKTSVSTNVKERLDFSCA
                     LFDNKGNLVANAPHVPVHLGSMSTCIKLQAKLWEGKLKPNDVLITNHPEAGGTHLPDI
                     TVISPTFSSDGDIIFYVASRAHHAEIGGILPGSIPPNSKELYEEGVAIYSELLVKEGI
                     FQEDMVYKWFVEEPGKYYGCSGSRKVSDNISDLKAQIAANTKGIHLINTLITDYSLDI
                     IIKYMKAIQQNACETIKKMLKQLTSHYGRNVFESEDRMDDGSLIKLKVTLNNEDDEYI
                     FNFSETSSQVYGNLNAPEAITNSAILYCLRCLVGEDIPLNQGCLEPLTIIIPKGSILS
                     PNKGAAVVGGNVLTSQRVTDVILKTFNVMADSQGDCNNFTFGTKCVVDSDGDTIDGFG
                     YYETICGGVGAGAPSWRGDGWDGASAVHTNMTNTRMTDPEVFEKRYPVLLREFSIREN
                     SGGNGHFRGGCGVIRKIEFRKPVIASILSERRVLPPNGLHGGMNGLRGENTWFRSDTS
                     AFINIGGKNTVNVQTGDVVIIKTPGGGGYGVKITY"
     gene            complement(<805238..>806563)
                     /gene="TPHA0F03680"
                     /locus_tag="TPHA_0F03680"
                     /db_xref="GeneID:11535557"
     mRNA            complement(<805238..>806563)
                     /gene="TPHA0F03680"
                     /locus_tag="TPHA_0F03680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686234.1"
                     /db_xref="GeneID:11535557"
     CDS             complement(805238..806563)
                     /gene="TPHA0F03680"
                     /locus_tag="TPHA_0F03680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686282.1"
                     /db_xref="GeneID:11535557"
                     /db_xref="UniProtKB/TrEMBL:G8BUR2"
                     /translation="MIDNSNEVAKLRRRLEEQETRIQELEDALEQKELTTPSQPTSQY
                     DLEVQASYNRLKGRGKYLQFYLPLFISSFFILLTIIHLFHLFWGMFQTIPFFKNGTSA
                     IVKSEHVRNLSAIARSSSVISVSQSTDFTFPVKRESWGEASVDGAIAVFGTVAAGASS
                     LYIAACQPTFLALLGITVPAGAGLLIGTCLWTGALLGTFIFAGTVLSSKGKSGDWIYD
                     SDSSVASDKGLKKRSDNSLPGYAHIMANAFIYVDGRKHHNVVSTIDKHDLTIHDMLVS
                     ANALYSNATGEMVHAGYHFVHSQEFHNVSTVTDIDGLDDAIETLARCGNSTYCPSLQI
                     NSTNSTFEKRSTDPFWMSYNDWGCNLGYLEDWVEWSEYTKAAQEYAYSNPFGLVTQVQ
                     NCNSAQCYASASKFCLSGGMSNTKGQDSAWVGEVYVKAYGGVDGECYNG"
     gap             807038..807057
                     /estimated_length=20
     gap             810122..810168
                     /estimated_length=47
     gene            complement(<810936..>811979)
                     /gene="TPHA0F03690"
                     /locus_tag="TPHA_0F03690"
                     /db_xref="GeneID:11535661"
     mRNA            complement(<810936..>811979)
                     /gene="TPHA0F03690"
                     /locus_tag="TPHA_0F03690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686235.1"
                     /db_xref="GeneID:11535661"
     CDS             complement(810936..811979)
                     /gene="TPHA0F03690"
                     /locus_tag="TPHA_0F03690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686283.1"
                     /db_xref="GeneID:11535661"
                     /db_xref="GOA:G8BUR3"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BUR3"
                     /translation="MSAFISGATGFIAQHIVDGLLKQNYKVIGTARSQEKANKLMKQF
                     SNNPNLSMEIVGDISDVNAFDEVMKKRGSEIKYVLHTASPFHFNVTDIEKELLVPAVN
                     GTRGILNSIKKYANDTVERVVITSSFAAILDLNRFNDNSLVLSEANWNPVTKEEALSN
                     PMAGYCASKTYAERAAWDFLKENEGSIKFKLTTVNPVYVFGPQLFAEDVKNVLNTSCE
                     VVNQVVQSTIDTTLPVDCSGQFVDVRDVAKAHIAGIQNDNCIGQRLLCSQAAFGVQDI
                     ANVLNDNFPQLKGKIAKSNPKTNAVENIGICQIDNSKTKELLGFEFIDLKTCLIDTVS
                     QIVEQKIIGLCEY"
     gene            complement(<813787..>814731)
                     /gene="TPHA0F03700"
                     /locus_tag="TPHA_0F03700"
                     /db_xref="GeneID:11535520"
     mRNA            complement(<813787..>814731)
                     /gene="TPHA0F03700"
                     /locus_tag="TPHA_0F03700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686236.1"
                     /db_xref="GeneID:11535520"
     CDS             complement(813787..814731)
                     /gene="TPHA0F03700"
                     /locus_tag="TPHA_0F03700"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686284.1"
                     /db_xref="GeneID:11535520"
                     /db_xref="UniProtKB/TrEMBL:G8BUR4"
                     /translation="MAKSTNTQQQYTMFIWKSRKNQTEAKEPRKFDVSFTVIKCEAIN
                     ELYDSIVIAGDGDSWDSPLYEQLEELADYTRPNAPALLAIGNDEVNTLYISSPFGMSK
                     CKNKVYERNYKTKKIDFEKLNQQIQARYLVEPLRRKTNTPKRMLDRRFADGTDHLNPI
                     KSVEYLPLYRNYYTPVIFLKCSYENAKRTAKLVALERKQWDDDIYLKFSPDIFYSYLK
                     YPIKFVMLRTKGSVYAQLKVCGGSDPNISATMFNYMRDQFLEFRGYKLVNHQGDSEVI
                     LIEPVERRKNKDLSKSIEEAPPSYDTISRCIHTRSSSI"
CONTIG      join(HE612861.1:1..815984)
//
DBGET integrated database retrieval system