GenomeNet

Database: RefSeq
Entry: NC_016527
LinkDB: NC_016527
Original site: NC_016527 
LOCUS       NC_016527             752451 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 8, complete genome.
ACCESSION   NC_016527
VERSION     NC_016527.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 752451)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 752451)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612863.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..752451
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="8"
     gene            <441..>1604
                     /gene="TPHA0G00095"
                     /locus_tag="TPHA_0G00095"
                     /db_xref="GeneID:11534203"
     mRNA            <441..>1604
                     /gene="TPHA0G00095"
                     /locus_tag="TPHA_0G00095"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686606.1"
                     /db_xref="GeneID:11534203"
     CDS             441..1604
                     /gene="TPHA0G00095"
                     /locus_tag="TPHA_0G00095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686654.1"
                     /db_xref="GeneID:11534203"
                     /db_xref="UniProtKB/TrEMBL:G8BWR6"
                     /translation="MVEVKKKKLVLILFAVAQILILVTIFRSSDSVYNSVTSAVGYYR
                     TSPVVNNTGEYIGKKIAYVSRHPGTTQDFKYIEENLQLENVDYFLHYGISMAERVINE
                     TQARYICSNYDTVVISDCLTDGWEFFRHDDLNCKNIVFVISNRYDVCAGGDREGFQQN
                     FTHALNRDDGYEATIVANNAFEIPYLKYKNIELKRDYPIIRPFGNTDIESQDIAIEEP
                     DIPCLIIDRFVSNQNILKNNIKNELNYDCKILKSKYGGPKTLSKYNSIVVHLPYQVSI
                     MKMWENIAYGVLMAVPTPEFYDKICSENACAEPEHLSDVKKVATDGNWSKYVDFYLPE
                     FEKCFTQFGSWKELGMILKTESYKNNINHCRNLMEDKRHASLKQWKELLKNLK"
     gene            complement(<8022..>9173)
                     /gene="TPHA0H00100"
                     /locus_tag="TPHA_0H00100"
                     /db_xref="GeneID:11534038"
     mRNA            complement(<8022..>9173)
                     /gene="TPHA0H00100"
                     /locus_tag="TPHA_0H00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686607.1"
                     /db_xref="GeneID:11534038"
     CDS             complement(8022..9173)
                     /gene="TPHA0H00100"
                     /locus_tag="TPHA_0H00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686655.1"
                     /db_xref="GeneID:11534038"
                     /db_xref="UniProtKB/TrEMBL:G8BWR7"
                     /translation="MNKIVAVRRVLYSIICMMLLCSLVVTVNYNYANVAYIAEPFGLN
                     LMGRPLMNTTRKIAFVSRHKGTVNDFQYVEKNLKLENVDYLLYYGIDFKEIGTNETMA
                     REICKEHDTVVVSDCLSDGWEFIKSKDIGCSNIVFIVSTRYDACIQPEDKEAFNKDFN
                     NALNREDGCKLTIIPNNAFEIPYMKYHKIQLKEDYPLIRPFGNAESDAIDIEKESDYP
                     PCLIINRFEANTNLLMRKMKENMDYVCKVMPRYYGGPGTLSKYDSIVVDLPYQVSVMK
                     MWENIAAGVLIAIPSPSFFKELRKDGDYRGARLSKAAEIGGQDWFKNIDLYLPDFEKC
                     FIQFDSWSALEIILTEQKYKNNIGFCKNLMKEQRAESLQKWRDLFNAMD"
     gene            <10204..>11241
                     /gene="TPHA0H00110"
                     /locus_tag="TPHA_0H00110"
                     /db_xref="GeneID:11534039"
     mRNA            <10204..>11241
                     /gene="TPHA0H00110"
                     /locus_tag="TPHA_0H00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686608.1"
                     /db_xref="GeneID:11534039"
     CDS             10204..11241
                     /gene="TPHA0H00110"
                     /locus_tag="TPHA_0H00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686656.1"
                     /db_xref="GeneID:11534039"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:G8BWR8"
                     /translation="MSLVQQVRFGNTGLKISPIIIGCMTFGKKEWSDWIVSDKEEVFR
                     LLKYCYDKGLRTYDTANTYSNGVSEQLLGEFLKRYNIRRETVVIMSKLFFPADDSLPD
                     FQLTNGFKDEEEKLHLINQFGLNRRNVIESAKQSVERLGTYMDVLQIHRCDRETPFEE
                     TMRALNDVVNAGYTKYIGASLMRATEFAEMQFIAEKHDWHKFVNVQSLHNLIYREDER
                     ELIPFTKKHGIALTPYSPLQKGYLAKPYGTKTVRNTTDKHMLRIKIDNMRDSDKEIIS
                     RVEKVSKDKKVSMAEVSLAWLIQQGCNPIVGVSSTERVDEAIRALDVKLTEEETKFLE
                     EPYQPQPQLLM"
     gene            complement(<11464..>13092)
                     /gene="TPHA0H00120"
                     /locus_tag="TPHA_0H00120"
                     /db_xref="GeneID:11534040"
     mRNA            complement(<11464..>13092)
                     /gene="TPHA0H00120"
                     /locus_tag="TPHA_0H00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686609.1"
                     /db_xref="GeneID:11534040"
     CDS             complement(11464..13092)
                     /gene="TPHA0H00120"
                     /locus_tag="TPHA_0H00120"
                     /inference="similar to DNA sequence:INSDC:YDR061W"
                     /note="similar to Saccharomyces cerevisiae YDR061W;
                     ancestral locus Anc_8.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686657.1"
                     /db_xref="GeneID:11534040"
                     /db_xref="GOA:G8BWR9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWR9"
                     /translation="MSNSNFVVKIHDALFKSSLVRSFKFVFAKKIGHLEILHGEKWVV
                     WGPSKTKMLNILGNKYLSVPSLSRTYGKSLNDGSANLTIEQLEFKGVIPTAHLGARYE
                     YFKDSFDQNCKKYILDNAIGSNSVAYDVKTSNRKINMKLYHYLVEKLKLTELQSRWTM
                     GLSNGQMRRARMARSLLKEPDLLLIDDPFLGLDPVTSDTISNFLRDLDSNNNNANRFF
                     TFTSTVIGLRIQDPIPTWCTHICYVNQDGVEFQGPINNFKGKIQEIKELHNKQLLEND
                     RSVSFRNGISAKDLIKDHFYKSSDHKKDNSIRNVFELKDVGIKYKGEAVFTGINWKVE
                     SGSRWHLRGANGTGKSTLLALIMAEHPQSWNSKVLDNGIPRKVGKSNYFDINSRIGFA
                     SPELHAIVSKDYGDKLTVTELIATGLHYGSPNNFTNNLNKIITIERSRIDAFLKYFNL
                     FDMKDIQFNKLSVTNQKLVLFIRSMIRLPELLLLDEAFSGMDAGIIRICHLFLKKHWP
                     GSIITISHLQQETLDCENYLQLIKRGEYIIGKNI"
     gene            <13669..>15018
                     /gene="TPHA0H00130"
                     /locus_tag="TPHA_0H00130"
                     /db_xref="GeneID:11534154"
     mRNA            <13669..>15018
                     /gene="TPHA0H00130"
                     /locus_tag="TPHA_0H00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686610.1"
                     /db_xref="GeneID:11534154"
     CDS             13669..15018
                     /gene="TPHA0H00130"
                     /locus_tag="TPHA_0H00130"
                     /inference="similar to DNA sequence:INSDC:YER136W"
                     /note="similar to Saccharomyces cerevisiae GDI1 (YER136W);
                     ancestral locus Anc_8.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686658.1"
                     /db_xref="GeneID:11534154"
                     /db_xref="GOA:G8BWS0"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:G8BWS0"
                     /translation="MNEETLDTDYDVIVLGTGLTECILSGLLSVDGKKVLHIDKQDHY
                     GGAGASVSLSQLYTKFKTGDQILSQDAREAKYGKDRDWNVDLIPKFLMTNGALTDILV
                     HTDVTKYVDFKQVDGSYVLIKGKINKVPATEMEAISSPLMGIFEKRRMKRFLEWIANY
                     REDDLGTQQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYIQQPARQTFER
                     VLLYSQSVAKFGKSPYVYPMYGLGELPQGFARLSAIYGGTYMLDTPINKVNYNSNGEF
                     EGVETKLGNFKAPLVIADPSYFAEKCKASGQKVVRVICVLNHPVSNTKDADSLQIIIP
                     QSQVGRKNDIYIAVVSSTHNVCAKGHYLAICSTIVETDKPELELEPAFKLLGDIEEKF
                     VDVVDIMEPIEDGSKDKVFLSKSNDASSHFESLTDDVKDLYKRVTGNDLILKPKESE"
     gene            complement(<15163..>15624)
                     /gene="TPHA0H00140"
                     /locus_tag="TPHA_0H00140"
                     /db_xref="GeneID:11534155"
     mRNA            complement(<15163..>15624)
                     /gene="TPHA0H00140"
                     /locus_tag="TPHA_0H00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686611.1"
                     /db_xref="GeneID:11534155"
     CDS             complement(15163..15624)
                     /gene="TPHA0H00140"
                     /locus_tag="TPHA_0H00140"
                     /inference="similar to DNA sequence:INSDC:YER137C"
                     /note="similar to Saccharomyces cerevisiae YER137C;
                     ancestral locus Anc_8.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686659.1"
                     /db_xref="GeneID:11534155"
                     /db_xref="GOA:G8BWS1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G8BWS1"
                     /translation="MANTLKNDDIVKFSYAMDQIAKLIAQNKKQSSVANSEYEKKMKE
                     LDKLINLLLGLSKSTSSKGYSLNTSKLDEILKEGFEVVTKGNDEKYIMLPIQEEPQGP
                     LEDIKKGEVHIKKSKNKKKNKIRCSYCNETGHTRAKCEMKLMTPIREHYNQ"
     gene            <15977..>17926
                     /gene="TPHA0H00150"
                     /locus_tag="TPHA_0H00150"
                     /db_xref="GeneID:11534051"
     mRNA            <15977..>17926
                     /gene="TPHA0H00150"
                     /locus_tag="TPHA_0H00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686612.1"
                     /db_xref="GeneID:11534051"
     CDS             15977..17926
                     /gene="TPHA0H00150"
                     /locus_tag="TPHA_0H00150"
                     /inference="similar to DNA sequence:INSDC:YBL024W"
                     /note="similar to Saccharomyces cerevisiae NCL1 (YBL024W);
                     ancestral locus Anc_8.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686660.1"
                     /db_xref="GeneID:11534051"
                     /db_xref="GOA:G8BWS2"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BWS2"
                     /translation="MARKRSSKKGGKKFQKPQADWVDLAKENANWEKYYENMLFGGDK
                     DEFAKFKKVCQEPLPITFRITGSRNHASEVLNLFKEKHLKFLNEVEYEGSKINPPIEL
                     PWYPNHFGWQLEVHKTVMRKNDNFAKTQRFLVVETDVGNISRQEAVSMLPPILLDVKP
                     HHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVIANDADNKRSHLLVHQLKRLSTSNV
                     LIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCSGDGTMRKNVNVWKNWNTQNA
                     LGLHNVQFNILDRGLTLLKETGKLVYSTCSLNPIENEAVVAAVLRKWGDKVRLVCCDD
                     KLKGLIRSKGLTTWPVINRDMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYP
                     HQQNTGGFFITMFEKVVDNKETDKPKRETKKQCIEAVGSKNTPKKVLQKNEEPVMFLP
                     SDHSVLKQCAKFYGIGDAFNMDSCLVRNTNGEPSKTIYYVSPSLKQVIQHNDHKLKII
                     YTGAKIFVCQRSDVECSWKIQSESLSYLKHHMKSDRILKSSMLLFKFLLGHPQTTMDE
                     IKMSNVDPNFARAETLSSGCIFVDVSRDNSEKLILPLWKGIKSINLMVRKEDIQEMLY
                     RYFDVETTLKEKVKEVESKNEDLSP"
     gene            complement(<18148..>20751)
                     /gene="TPHA0H00160"
                     /locus_tag="TPHA_0H00160"
                     /db_xref="GeneID:11534052"
     mRNA            complement(<18148..>20751)
                     /gene="TPHA0H00160"
                     /locus_tag="TPHA_0H00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686613.1"
                     /db_xref="GeneID:11534052"
     CDS             complement(18148..20751)
                     /gene="TPHA0H00160"
                     /locus_tag="TPHA_0H00160"
                     /inference="similar to DNA sequence:INSDC:YBL023C"
                     /note="similar to Saccharomyces cerevisiae MCM2 (YBL023C);
                     ancestral locus Anc_8.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686661.1"
                     /db_xref="GeneID:11534052"
                     /db_xref="GOA:G8BWS3"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8BWS3"
                     /translation="MSGNDNRRRRREEDEDEDGMLPPSSPQLGGARGYAEASSPLGAP
                     DGMMNPEGADDEIDEVPDLEDLEEQMNEVDLMGDDMLQDYGSDAEKDHYDMRQVDDRS
                     QRELSLSERRMIDKQMNERDRLLRQGAYIDDDDDDEADPSGGKLDDMGLPIQRRRRRR
                     QYESLNKSDDDLLSDLDMDPLAEELTLESLSNVKAASYSEWITQPNVARTIARELKLF
                     LLEYTDDTGRSVYGARIRTLGEVNSESLEVNYRHLSESKAILALFLATCPDEMLKIFD
                     LVAMEATELHYPDYSRIHSEIHVRISDFPAINYLRELRESHLGSLVRVVGVVTRRTGV
                     FPQLKYVKFNCLKCGIVLGPFFQDSTEEIKISFCTNCKSKGPFSMNGEKTVYRNYQRI
                     TLQESPGTVPAGRLPRHREVILLADLVDIAKPGEDIEVTGIYKNNYDGSLNAKNGFPV
                     FATNIEANSIKRIEGNITDGDEEGLDVFKWTEEEEREFRKMSRDRKIVDKIISSIAPS
                     IYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTANR
                     AVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSI
                     HEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVTLTEPILSRFD
                     ILCVVRDLVDEEADERLASFVVNSHVRSHPDSEIAEDNDDNDDMDEENAVPNHELSAR
                     QKKLERQRKKEQEISPIPQDFLMKYIHYARTKIHPKLHQMDMDKVSRVYADLRRESIT
                     TGSFPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVDAQKVSVRRQL
                     QRSFAIYTLGH"
     gene            <21183..>22352
                     /gene="TPHA0H00170"
                     /locus_tag="TPHA_0H00170"
                     /db_xref="GeneID:11534053"
     mRNA            <21183..>22352
                     /gene="TPHA0H00170"
                     /locus_tag="TPHA_0H00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686614.1"
                     /db_xref="GeneID:11534053"
     CDS             21183..22352
                     /gene="TPHA0H00170"
                     /locus_tag="TPHA_0H00170"
                     /note="ancestral locus Anc_8.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686662.1"
                     /db_xref="GeneID:11534053"
                     /db_xref="GOA:G8BWS4"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BWS4"
                     /translation="MLPRTIQSFEMNELSASEYLEEQERLQDEARNAMPWEPNTCTYE
                     LGALRQQLYACRDHGDIGICYSCSIQCHTSCDLVELFTKRHFTCDCGTERDQRGLAQA
                     IDDEDGNKNGEVYFCSLRKNREKDIASGDNVYGHNFKGLFCDCATEYDPDSDAVMLQC
                     VAGLECDEDWYHDYCIMNVDPADAKRSAADADDSGAENVLDGFPDVDSFDSYICWKCI
                     AKNEWFFNQLITSQGSEDFIAHKLPRCPPVSIPSSSSLNKNGKRTREDHMDVDYSLFL
                     KEGYSSALAKLKDSCEIDSKLRSFLTYKVPFLIEEVPVYEQHEDATLETDVYDVAMNS
                     IGSNLQHEPTVNTIIALQQLKAKLGNFFKTFVDKKDIVKEEDIREFFNKQKEDSF"
     gene            complement(<22551..>25937)
                     /gene="TPHA0H00180"
                     /locus_tag="TPHA_0H00180"
                     /db_xref="GeneID:11534054"
     mRNA            complement(<22551..>25937)
                     /gene="TPHA0H00180"
                     /locus_tag="TPHA_0H00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686615.1"
                     /db_xref="GeneID:11534054"
     CDS             complement(22551..25937)
                     /gene="TPHA0H00180"
                     /locus_tag="TPHA_0H00180"
                     /inference="similar to DNA sequence:INSDC:YBL022C"
                     /note="similar to Saccharomyces cerevisiae PIM1 (YBL022C);
                     ancestral locus Anc_8.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686663.1"
                     /db_xref="GeneID:11534054"
                     /db_xref="GOA:G8BWS5"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="UniProtKB/TrEMBL:G8BWS5"
                     /translation="MLNARGTRMLSASKWNSKVLARAAFQGSRTTTRYASTTITNGVG
                     TTLNDRNIINNEQSDWEQFQKQSKDYRLQNELKTLETQWLNGLIEKAAKNPPTKNEPL
                     PNEDSTETVEKNEEDIDSDKPVENDSTPVSEPLKNGNATDGKASISSTGGSSSVPPSN
                     NGNDSNGDGDVPNNSATKMNGIPKLYPQMLALPISKRPLFPGFYKAVVISDERVMKVI
                     KEMLERQQPYIGAFMLKDSKLDTDVIDNLDDVYKVGVFAQITSTFPSKDEQTGAETMT
                     ALIYPHRRIVIDELIPPNKNVSENTQISKVTDANANTLKKIDTGVDHSTEIHSEMVSD
                     IQSGSVDKKPLDESELVPDEDNDDLDEEVTNPTDFLKNYNVSLVNVSNIEDEVFDRKS
                     PVINALTSEILKVFKEISQLNTMFREQIATFSASIQSATTNIFEEPARLADFAAAVSA
                     GEEKELQLILESSNIEHRLEKSLLILKKELMNAELQNKISKDVETKIQKRQREYYLME
                     QLKGIKRELGIDNGRDKLIDSFKEKVEKLTLPDAVQKIFDDEITKLSTLETSMSEFGV
                     IRNYLDWIVSLPWGINSKDQYSISSARTILDEDHYGMKDVKDRILEFIAVGKLLGKVN
                     GKIICFVGPPGVGKTSIGKSIARSLNRQFFRFSVGGMTDVAEIKGHRRTYIGALPGRI
                     IQALKKTETQNPLILIDEIDKIGHGGIHGDPSSALLEVLDPEQNSSFLDNYLDIPIDL
                     SKVLFVCTANTLDTIPRPLLDRMEVIELSGYVAEEKIKIVEQYLAPAAKKSAGLEFTD
                     ITLTKDAISSLMKHYCRESGVRNLKKHIEKIYRKAALNVVKSLGSAETPSATGNQSAE
                     TDNSNKESQVSEKKVNKGKNSQAALEEKPLDVPKEIKIVVDEDNLKDYVGAPVFTTDR
                     IYEQPSPGVIMGLAWTSMGGCSLYVESVLEQPLERCKQSSLERTGQLGDVMKESSRLA
                     YSFAKMHLAQKFPENRFFEKASIHLHCPEGATPKDGPSAGVTMASSFLSLALNKPVEP
                     TIAMTGELTLTGKILRIGGLREKTVAAKRSGAKTVIFPKDNMNDWEELPDYVKDGLTP
                     VAADWYEDVFEVLFPSVTEKEGNEVWKSQFEKIDAKKEKE"
     STS             22918..23054
                     /standard_name="D1S3697"
                     /db_xref="UniSTS:474275"
     gene            complement(<26482..>26932)
                     /gene="TPHA0H00190"
                     /locus_tag="TPHA_0H00190"
                     /db_xref="GeneID:11534208"
     mRNA            complement(<26482..>26932)
                     /gene="TPHA0H00190"
                     /locus_tag="TPHA_0H00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686616.2"
                     /db_xref="GeneID:11534208"
     CDS             complement(26482..>26932)
                     /gene="TPHA0H00190"
                     /locus_tag="TPHA_0H00190"
                     /inference="similar to DNA sequence:INSDC:YBL021C"
                     /note="similar to Saccharomyces cerevisiae HAP3 (YBL021C);
                     ancestral locus Anc_8.167"
                     /codon_start=2
                     /product="hypothetical protein"
                     /protein_id="XP_003686664.2"
                     /db_xref="GeneID:11534208"
                     /db_xref="GOA:G8BWS6"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BWS6"
                     /translation="EESRKNQFISELREQDRWLPINNVSKLMKNALPMNAKISKDAKE
                     CMQECVSEFISFVTSEASDRCSSDKRKTINGEDILISLHALGFENYAEVLKIYLAKYR
                     QQLTLRNQLEQQSSTQNNSDDDNESIYNNDEDALEIVKDNQPTSDGY"
     gap             26933..27003
                     /estimated_length=71
     gene            <27518..>29221
                     /gene="TPHA0H00200"
                     /locus_tag="TPHA_0H00200"
                     /db_xref="GeneID:11534209"
     mRNA            <27518..>29221
                     /gene="TPHA0H00200"
                     /locus_tag="TPHA_0H00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686617.1"
                     /db_xref="GeneID:11534209"
     CDS             27518..29221
                     /gene="TPHA0H00200"
                     /locus_tag="TPHA_0H00200"
                     /inference="similar to DNA sequence:INSDC:YBL020W"
                     /note="similar to Saccharomyces cerevisiae RFT1 (YBL020W);
                     ancestral locus Anc_8.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686665.1"
                     /db_xref="GeneID:11534209"
                     /db_xref="GOA:G8BWS7"
                     /db_xref="InterPro:IPR007594"
                     /db_xref="UniProtKB/TrEMBL:G8BWS7"
                     /translation="MEKEHSNTDNALNSEVILEKSTKAATFLMMGQLFTKIVTFLLNN
                     LLVRYLSPRIFGITAFLEFLLGTVLFFSREAIRISTLRIKDNNGEMTLDVKKQKNSPN
                     NTLQIAVNFAMVPLMIGIPLSIVLTTWQYNNVNSFFVSLPYFTTSIFLIWISILIELL
                     SEPFYVVNQFMLNFGTRSKFETISTTVGCVVNFIVVYGLENNWYKINILAEDLEVSKE
                     GIAILAFSLGKLTHSVALLLCYYIDYLINFKPKNLFNVRLKKISQSPGKKPYYFQVDI
                     LEHFKKVYFQMCFKHLLTEGDKLIINSMCTVEEQGIYSLLSNYGSLVTRLLFSPIEES
                     LRLFLARLLTNTRTSKNLRLSMEVLVNLTKFYLYLSLLIIIFGPVNSSFLLQFLIGKK
                     WSTTILMDTMRVYCFYIPFLAINGIFEGFFQSTANGDQILRQSYVMMVYSGIFFFNCW
                     LLISFLDLSISGLILSNIINMILRISYCGWFIHKFYKELYTESSSFLFNFRNFGTILT
                     SGLLISVVNWWIIGYVRNFKQLAINITLALVLLGIILFKERRAIQQLMGRNKRSEAKL
                     I"
     gene            <29532..>31136
                     /gene="TPHA0H00210"
                     /locus_tag="TPHA_0H00210"
                     /db_xref="GeneID:11533726"
     mRNA            <29532..>31136
                     /gene="TPHA0H00210"
                     /locus_tag="TPHA_0H00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686618.1"
                     /db_xref="GeneID:11533726"
     CDS             29532..31136
                     /gene="TPHA0H00210"
                     /locus_tag="TPHA_0H00210"
                     /inference="similar to DNA sequence:INSDC:YBL019W"
                     /note="similar to Saccharomyces cerevisiae APN2 (YBL019W);
                     ancestral locus Anc_8.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686666.1"
                     /db_xref="GeneID:11533726"
                     /db_xref="GOA:G8BWS8"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="InterPro:IPR020848"
                     /db_xref="UniProtKB/TrEMBL:G8BWS8"
                     /translation="MSENTAARSRLEELPDKEDKVIRLVTFNVNGIRTLFHYQPFSQM
                     NQSLVNVFDYFNADIITFQELKTEKLSISKWGKVDGYYSFISLPTVKKGYSGVGCWVR
                     MFPDDHPLHDSMKVVKAEEGITGCLSVKNGQEEIRYKDDQNIGIGGYNSLGYDNESEA
                     LHLDSEGRCVIIELACNMVIISTYCPANSTLTDEGQQFRIKFLKVLFKRIRNLESMGK
                     KVVLMGDLNICRDLIDQAEALEVNGIRILPETTGNMIENEYPDLASSFILKPERVQRR
                     LLNQIITDSFIADLSKNGCMIDTTRFIQSKKRLKMYTVWNTLKNTRSINYGSRIDFIL
                     LSSGYQNLIQNANILPQVMGSDHCPVYLDMKLPTDIASNIEIKIPRFEARYKYQLTHK
                     NIFEMLKGTASNADESKVEMAPGFSESSNHSYKMTKGINKTSSIKSFFKVENKTAKKR
                     TSLQGREILKRYANINSKRVIVNGQTTLAKVYGLSDAPLCKHGEKCVLKTSRTSSNYG
                     KKFWACKRPKGESNNEDSSCDHFEWV"
     gene            complement(<31262..>31735)
                     /gene="TPHA0H00220"
                     /locus_tag="TPHA_0H00220"
                     /db_xref="GeneID:11533727"
     mRNA            complement(join(<31262..31616,31686..>31735))
                     /gene="TPHA0H00220"
                     /locus_tag="TPHA_0H00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686619.1"
                     /db_xref="GeneID:11533727"
     CDS             complement(join(31262..31616,31686..31735))
                     /gene="TPHA0H00220"
                     /locus_tag="TPHA_0H00220"
                     /inference="similar to DNA sequence:INSDC:YBL018C"
                     /note="similar to Saccharomyces cerevisiae POP8 (YBL018C);
                     ancestral locus Anc_8.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686667.1"
                     /db_xref="GeneID:11533727"
                     /db_xref="InterPro:IPR020347"
                     /db_xref="UniProtKB/TrEMBL:G8BWS9"
                     /translation="MSIKKVSPDWYYFKLKLTSQDPKFDVDVRFDELTWRRWLNAALV
                     KSYGIFGESIEYTFLNRENQVGYVRVGKKEKDMFITALFTYISTDELFEVPLVMNILQ
                     ETDSIRSLDIQEDDKLWLRRCIEEEENDQECE"
     gene            complement(<32089..>37020)
                     /gene="TPHA0H00230"
                     /locus_tag="TPHA_0H00230"
                     /db_xref="GeneID:11533736"
     mRNA            complement(<32089..>37020)
                     /gene="TPHA0H00230"
                     /locus_tag="TPHA_0H00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686620.1"
                     /db_xref="GeneID:11533736"
     CDS             complement(32089..37020)
                     /gene="TPHA0H00230"
                     /locus_tag="TPHA_0H00230"
                     /inference="similar to DNA sequence:INSDC:YBL017C"
                     /note="similar to Saccharomyces cerevisiae PEP1 (YBL017C);
                     ancestral locus Anc_8.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686668.1"
                     /db_xref="GeneID:11533736"
                     /db_xref="GOA:G8BWT0"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="UniProtKB/TrEMBL:G8BWT0"
                     /translation="MLLSNLIIPLLLLFSQLTIAASVDNAPVVNKVKSGFSYLLTSFD
                     DSSVLLRVEKNSLLRTEDNGKSWEKVKIDSKDSKVVYVHVDELYPGSRASLRTEYNET
                     YITNDKGKTWTKLNINVPKNMKGPSDTCWIKSHPLDNKILLASCRSLIKGDSSKNTSF
                     QNMYMAQLYFISTDTGKTFKQIDSKIDLSGKKNIRSLITDCKFGISSSKSMLTSLSDT
                     IVCKSNLVQGIEQKPKETQNKSDTGAKDKRDDYLYNVKRAAGTILFNNGKSNDPPMTS
                     VMTESKYFEISIKNPSNTKIIESLKEKTIESFFVFDQQLVAITIDDRYNKNSSKKVWI
                     SKDGKEYKEAHLPTQLRFYVAGGLREDAAGRLLLTINRKKGQKSKRNDYVTEILISDS
                     KGEKFSDLSFMDTTTLGNSFFQTFAHLPGTIIGTFTSMNSFHGGNRKDDSNERKKSSP
                     SKITKISIDNGNFWSNLKVVDPDNKKNFKCDIDDYENCSIQLLMGGFVSSEPSAGIIT
                     VIGVVSDGVSFNWDDAKTFISRDGGESWQVALDFPSITTSGDYGNIIVAVPFNPESDG
                     DPESELYYSLDQGRSWTEYQLEEQIIPIELISTTLDGSGSKFMLLGMVADQAVNVIIS
                     NPDDDDDEDGDNDTAYTFVYAIDFSKAFNGEKCKPSDFETYSLASGECINGAKYSVQR
                     RKAESKCLVGTTYKDLEWIQEDCSQCTEKDYECSFSFKKGENGKCVPDYKLLQLSGQC
                     NGAKNNKITLSPVQKLNNNKCQKELTFDNVELSCEEIGSPVKSGDKIKVTENSINSKI
                     EYYKYFDTVSDEALLIATSDRQVYVSNDGGETIKKVEIDSEIIEITFNPYFDSTAYLF
                     GDDGTLYTTHDRGQTFSSTKLPKSRQLGLGLNFNALDVNQFIYYGGKDCKSIFDTKCH
                     SVAYLTKDGGETFEEMLRDGIHCDFANTIFTDPSVKNMITCMTLTENRTGRSLVRSND
                     YFKTQSVVFDSIIGTMGTGEFYVVAVPHGENELRAYVTADGITYAEAQFPADLNDIRQ
                     ESFTVLGSEFGSIFMHLAVNIGAGEDYGPLLKSNYNGTSFVSLERAVNRNSQGFVDFE
                     KIQGLEGIIIINTIGNVKKMEDHLENKQLKSKITFNDGSDWVYIKPPAKDSEGKKYTC
                     SGKSLDKCSLHLHGYTERKDVRDTFASGSAFGVMFGVGNVGPYLLPENESSTYLTTDG
                     GVTWSEVKKGNYQWEYGDHGGILVLVASNVATDTISYSIDSGKTWLDYKFTGEKVIIE
                     DIITVPRDSSMRFLLLGKSSSFKGGTSKIYTIDFAGSFDRQCVYDIENENNDDFDYIS
                     FNPLKDNCLFGHQLEYLKKNKNNCFVGSAPLSDSFRIVKNCSCTRNDFECDYNYYKAN
                     DGTCKLVEGLSPIDPSGVCKTDNVFEYFASTGYRKIPLSTCNGGLNLEGKSTPRPCPG
                     KKNEFNKHHNLNGYSFSALFIIPFIIIAFLTWVIYDRGIRRNGGFSRFGEIRLGDTLI
                     EDNEFDRVVNSVVRSGFIASTSLYSGFEKVKYFIKNHIDRLRSRSSDRRGPSYTTLFN
                     DQFLDDADDLLEGHDEDANDLNSLLNQDNDFDIDEDPHDPPEFSTPFRDEEEAPVENV
                     DDENQKSTELTSDDNNQQNDDNNHSPVDSDNNN"
     gene            complement(37638..37711)
                     /gene="TPHA0Htrna6I"
                     /locus_tag="TPHA_0Htrna6I"
                     /db_xref="GeneID:11533737"
     tRNA            complement(37638..37711)
                     /gene="TPHA0Htrna6I"
                     /locus_tag="TPHA_0Htrna6I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11533737"
     gene            <40339..>42828
                     /gene="TPHA0H00240"
                     /locus_tag="TPHA_0H00240"
                     /db_xref="GeneID:11534199"
     mRNA            <40339..>42828
                     /gene="TPHA0H00240"
                     /locus_tag="TPHA_0H00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686621.1"
                     /db_xref="GeneID:11534199"
     CDS             40339..42828
                     /gene="TPHA0H00240"
                     /locus_tag="TPHA_0H00240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686669.1"
                     /db_xref="GeneID:11534199"
                     /db_xref="GOA:G8BWT1"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BWT1"
                     /translation="MRVSIIRILKSRKGIRTSFKLLGLLVVLLIIVGISHHDKSSAEL
                     LKNIDFFTFTIGNNLFEAGHFKYFANNKDWNPHYEDYFPELRQSIAEKQFLSSSENIN
                     EFNEDPISPFDSIPDYDNYIHDQAEKSSSFRSLFSGSYFRDLDAFTKCQFYFNNLYQT
                     KPDWNNDVHEHGLVLNTIRVDKQGQKKEVKVDEKTKMTMRKKDLNLVNERLRIYDFCF
                     IKNKFDITKMFGSIEHNPVVSILESQLGRKSDRNKINPLEFQQRMFPYLQKFESAKDF
                     NKIMPRYSRGDGVWYEKGSFPTAFTSFSTYSDYESNPSETAFVDFTYDVKKSIWTNWN
                     SISDLIPSWKRGIIISMSDHQLVTALKWLAAARHAKVTLPIFFMFKNDDVSKETMHKL
                     HRVARSYDVDIPNSKNYPKLDIWFIDLKPSIETSKVNEFTKYKNKWLALLLNPLKEVL
                     FLDTDTVNYMDPNFYFETEQFKNTGTLFFRDRFLNIGKSEVCSQISETLSPNFQESFY
                     FGKLPLFDNNYILKNLTETDLTTEELVFKSYFDNNIQHELESGLMALDKENHIIPLLI
                     SRNLNLYKPFAGCSHGDKEFFWLGFVASGAPFSIYPVRAGTVGEVLTETDTRERVQKR
                     ICNLQLVHFAEDKSILWMNGGANNCKFPGFAAADWQNPKLKGYISKFESFESFRDYYE
                     YLPIKTDYGIIADGTMRSSWDKKFNHCKNINWCAVYVKTSNKLNFEEDEVHGELFRLD
                     PEVKRTVDDLNFVWATFNVTQVITDQDIKSIKKAARELSGLDKALKEEAEKKAKEEAE
                     KKAKEEAEKKAEKEAEKKAKAAAEKKAEEEN"
     gene            <43951..>44490
                     /gene="TPHA0H00260"
                     /locus_tag="TPHA_0H00260"
                     /db_xref="GeneID:11533881"
     mRNA            <43951..>44490
                     /gene="TPHA0H00260"
                     /locus_tag="TPHA_0H00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686622.1"
                     /db_xref="GeneID:11533881"
     CDS             43951..44490
                     /gene="TPHA0H00260"
                     /locus_tag="TPHA_0H00260"
                     /inference="similar to DNA sequence:INSDC:YER134C"
                     /note="similar to Saccharomyces cerevisiae YER134C;
                     ancestral locus Anc_8.160a"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686670.1"
                     /db_xref="GeneID:11533881"
                     /db_xref="GOA:G8BWT2"
                     /db_xref="InterPro:IPR010033"
                     /db_xref="InterPro:IPR010036"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR024734"
                     /db_xref="UniProtKB/TrEMBL:G8BWT2"
                     /translation="MTVVYPDVAAFDLDYTVWPCYCDTHLYPPFKPVENPNGEVYELI
                     DSMGYSVKFFKDIPLLFRDLKDNGVKIVAASRTWAPEIAQELLKGFRIEYDGKVQSMY
                     DFFDAAAWGDRSKVGHITENVKQIYNHDNIKNLKICLFDDESRNKDVERHGIKFVYIR
                     NTETGPTWKLYQDYLNGKI"
     gene            complement(<44741..>45343)
                     /gene="TPHA0H00270"
                     /locus_tag="TPHA_0H00270"
                     /db_xref="GeneID:11533882"
     mRNA            complement(<44741..>45343)
                     /gene="TPHA0H00270"
                     /locus_tag="TPHA_0H00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686623.1"
                     /db_xref="GeneID:11533882"
     CDS             complement(44741..45343)
                     /gene="TPHA0H00270"
                     /locus_tag="TPHA_0H00270"
                     /inference="similar to DNA sequence:INSDC:YGL200C"
                     /note="similar to Saccharomyces cerevisiae EMP24
                     (YGL200C); ancestral locus Anc_8.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686671.1"
                     /db_xref="GeneID:11533882"
                     /db_xref="GOA:G8BWT3"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8BWT3"
                     /translation="MLFNLLQLLLLVISVTAHNVLLPAYGKRCFIETLHKGDILGISF
                     QFGDRFPESSAQLTGDLIMYGSTKNEILKSVRDVTHGDESITAMKSGTYEFCFSNEAS
                     GITTKDVTFNVHGTKYVDADGDDTDTLEGSVNALMKLVHEVRNEQEYLILRERTHRNT
                     AESTNERVKWWSIFQLVFVIFNALFQIFYLKRFFEVTSVV"
     gene            complement(<45965..>46903)
                     /gene="TPHA0H00280"
                     /locus_tag="TPHA_0H00280"
                     /db_xref="GeneID:11534034"
     mRNA            complement(<45965..>46903)
                     /gene="TPHA0H00280"
                     /locus_tag="TPHA_0H00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686624.1"
                     /db_xref="GeneID:11534034"
     CDS             complement(45965..46903)
                     /gene="TPHA0H00280"
                     /locus_tag="TPHA_0H00280"
                     /inference="similar to DNA sequence:INSDC:YER133W"
                     /note="similar to Saccharomyces cerevisiae GLC7 (YER133W);
                     ancestral locus Anc_8.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686672.1"
                     /db_xref="GeneID:11534034"
                     /db_xref="GOA:G8BWT4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8BWT4"
                     /translation="MDNQTVDVDNIIDRLLEVRGSKPGQQVDLQEHEIRFLCSKARSI
                     FIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLET
                     ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
                     AAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSEN
                     DRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFD
                     NAGAMMSVDESLLCSFQILKPAQKSLPRQQQGRKKK"
     gene            <48215..>52654
                     /gene="TPHA0H00290"
                     /locus_tag="TPHA_0H00290"
                     /db_xref="GeneID:11534035"
     mRNA            <48215..>52654
                     /gene="TPHA0H00290"
                     /locus_tag="TPHA_0H00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686625.1"
                     /db_xref="GeneID:11534035"
     CDS             48215..52654
                     /gene="TPHA0H00290"
                     /locus_tag="TPHA_0H00290"
                     /inference="similar to DNA sequence:INSDC:YER132C,YGL197W"
                     /note="similar to Saccharomyces cerevisiae PMD1 (YER132C)
                     and MDS3 (YGL197W); ancestral locus Anc_8.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686673.1"
                     /db_xref="GeneID:11534035"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G8BWT5"
                     /translation="MLLQPTLSECHRVRNSSVLRCRGGKGAASTLFRSSIIMHGGIIA
                     AEDNDGDGDDDALFDNNMYMLDLISRKWRVLDQIDTATAAPRSRCRHSIVGCGSSFFF
                     FGGITKHQTTNENIITNELWELQFSATNKVSWKKHNVPSFVEKKFDCKIIALNDSEEA
                     FDSKLLIVGGKLHRHANTHNSSNKIDIFNVTRKKWEKPILLATIDARFASAGGLFVNT
                     ENSVIFENMLCFYDCESSSIFKIRLDHCSKTEAQVSEQLVETVNLPIHLAGNTSGTIY
                     KNSFLLAGHDKITNGFICLALDLVTNRLLQINTHCPCNLNDHDYLKIFMWTSHFQIVC
                     LGRGKSDVEKTRHRDDINKNNDAKQNTKKNLNVLLTLTLPFLQRSMLYRKTIKPVNNT
                     IVKENLMDDNKTINENDDETTTNNTYQEGEEINKYFDLNINRKQIPDKKEHIASTIPA
                     SQFAKYVQYIESPASIELNEPALNENNDSFNQWFHPRQKSRANTITKSRSSDVEMNVN
                     TIYNTTPVKNNSVFPVYAMVLGKDMFDVFGRSLADFELISKDGDTILAPTELLRKRWG
                     RYFDFLLTTGISGVTKQYQKFNSNDNEGMIHSSNSNAVTITSLDKNNPIANRAAEENF
                     ESNPVDITNSCKSDGSMKLKSNYSIQSLSNKLESNIEEPVNIETMETNGMVFRVPFQD
                     NITKKDPPLKSSEGMFLTGAFSLSSPSRYKGKVENNYINGHVFSDDNGKMKSRSASSL
                     SNHSNLSPEVKSLGRPSNSQNTSNFMRTPGFSYAGQNNDECNLVDSLTVKLPDASEPP
                     TIPLVPVPTVPPRASIQSSLPKLNSDAGPLTFCDWFKQGSISSNHSINGLKEIVADYS
                     PRGSRCISSGQFGLADHSDTMSSSTGNNSSRRNTFSSRTNLMDRRSSIRTNQSRSIGS
                     ASSIVSSGASASSESSLGDATDYTLDLDPLFTPRGLYLPWSTATVESFTEFFFTGRVN
                     ANCPVRTVILDLLVVSKLYEVPLLYSLTVEALFTILIEKKANLKWQCHLYKSTFENVV
                     NKYCERDVERSSNVLRNNKLYQSILKILESAEELDDGFYSNEISRRLSSIVSQNNNHK
                     EELESSVNSQSSVQNPTSSNDQNDLEERSSLKTASNLSSRRTSSCNREPFDTASESNV
                     NNVENADISDQQSHDPILSESKANDDVDQLTKYLKRVPDASISDKETQKLNEQLFSLS
                     SEFSQIDFEDLDDTDSFLSDLELDIQNQPDIKIDDLLDDDQESEIVSQQNKLTDLDEL
                     DPLLQVKTTHSEVNLETIHNDNAKPSMESKYIKKQPKQYNNSHLLSLDYFICNNAVPA
                     DDSLIFQIYKKAVLVNDLRLMISCVDCLDISKRLNVVSKSIDEEIKQIDSTMKVFEDP
                     LSWRQYPRKTKSSDSGYILKKDYKYGMRRSTQPDSSEFSTSKNTRKDNSRSTMSNLYS
                     QKEKDNDTKFNEAKKHPFLKPSEKKHTRKRPVTSPFSFFSKNK"
     gene            <53718..>61814
                     /gene="TPHA0H00300"
                     /locus_tag="TPHA_0H00300"
                     /db_xref="GeneID:11533883"
     mRNA            <53718..>61814
                     /gene="TPHA0H00300"
                     /locus_tag="TPHA_0H00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686626.1"
                     /db_xref="GeneID:11533883"
     CDS             53718..61814
                     /gene="TPHA0H00300"
                     /locus_tag="TPHA_0H00300"
                     /inference="similar to DNA sequence:INSDC:YGL195W"
                     /note="similar to Saccharomyces cerevisiae GCN1 (YGL195W);
                     ancestral locus Anc_8.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686674.1"
                     /db_xref="GeneID:11533883"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022716"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:G8BWT6"
                     /translation="MSSDTPTSSELQDKSLAVSWETLYSQLERYCYDSILNNRIPFLK
                     KIKQLLDTQEKDKNVEIDQLKDISVTLLNTYSIYNDSKSKALVIEIFEKIIKLQSNLL
                     SVYIKFIYEHTHKKIGSKATVDYLNLLEWVNAFYKIIYFSNDSTLFNENYKALIQAHT
                     TVTNGIELSLSNHETSNKKSKEKQNQHRRRIRYCSLQSTTKTLTECFKSKIFSNDIAS
                     ERLSLMLEVLISDYTSLSLSSTGTIFLLGSITKSCVQLQISKPVLFNNLKENYVEKFC
                     DFIGKEVILGKNVPSDFCVDVSLRSFFNEFMTDDLVIKYIVPSLEKINLRAPALGFSL
                     LRELYNSLNSQKVNILNIHKSTKLITQCFSSLKSSKETVRLVALEAILSLLNSISKDN
                     YNADDLHFLINELFKNIKSNLNADYKIVASKIFINVPTFEKSSSDNIVNGLLPYISKE
                     SNEAALKYLLGAFFTHYFSLNENVDVVNKTITTGFNEKKINLKKIWFIEFMLSSQNMS
                     SDMINNFIEPLLEFIKDTFEHSNKNNQSAILGCFTFINQVYKLNLEDTIMSINNIFEN
                     LDDKLSIGNAILQITLTTALSSVERLLAVQLTHDLFIRCPGLVGLSIIKSLEARLITS
                     EIEEDDHLTYKFVTPLFNIISSELEDKAISSTLLIKALLISQYDQFRLRNGWAELVLH
                     AKLSPSDIIMENTNEIIDSVFNILGNKELVNTNLATCALKAISYAAFVNPTAIVPPLS
                     EKLSADLQTEALSKLTHQDIHIANGTEGEMIIDILDKDMAKKLADKNTKDYETLQWEM
                     SIRKEQAKKANKKFTKEEQALIKEQIAKESEIRKNVNDIKFSLNRSIVIINQLSKDAT
                     LVDNGRDVWFPIAVSCLLELTQEANSYLLVGQRAIDAFLSLSNVVSERFGLIRLFIGV
                     ATLRVCNVQNIPENYLEEKLDELLSRVLFRIKFVCDQMPLDATSLTYLLPLLTHSLEE
                     GKKVAVRNADKPVSRSDFVEEETEEEHLMLSMEIIGVHAEVFEDPSIPRVPIMKVLFS
                     LLSLASKAKLARECLNALSQSISVSPTPEDLELLLSSLLSANPFVRSTLLEAIDNEYE
                     LAPYMKYSTEIFICRFDSESNNRELANFIWEFNKFEITEEMMNGYFNYFSQTDSGLRL
                     FTAQSYTAASHLYAKDDKGIFEDCLRKLMEFYKEKAKPLKDIIDAFGLVEIPASERKD
                     PWEARSTTAIALKEFSNLITEDGNTVIEVIEFLANDGPLGDRNSLVRQEMKETSIEVI
                     TMHGAEKVEELIPIFEIAIQNAKESSVKENVIISYGSLARHLESTDGRIHTIVKQLLD
                     TLDTPSKQVQQAVAECLSTLVFLFRSQVKEYVNVLMEKNLDSSLPKAIRQGSAWGIAG
                     LVKGYGIAALSEFDIIRYLIEAAENKKDPIKRESTAYSFEYLSKILGKFFEPYVIEVL
                     PIILKNLGDSVPEVRDATADATRAIMANTTGFGVKKLIPVAVSNLEDMAWRTKRGSVE
                     LLGNMAYLDPAQLSSSLSIIVPEIVAVLNDSHKEVRKSADESLKRFGEVIRNPEIQKL
                     VPTLLKAIGDPTKYTDEALDALIQTQFVHYIDGPSLALIIHIIHRGMHERSANTKRKA
                     CKIVGNMSILVDTKDLIPYLQQLINEVEIAMVDPVPNTRATAARALGALVERLGEEQF
                     PGLIPRLLGTLSDEAKSGDRLGSAQALSEVISGLGISKLEELLPTIIDGATSFRPYVR
                     EGFMPMLLFLPVCFGAQFASYINQIIQPILAGLADTDENIQDTALKAGKLIVKNYATK
                     AIDLLLPELEIGMFDENERIRLSSVQLTGELLFQVTGISSKNEFDEDEGDYSGEVSKK
                     MVDVLGEDRRNRILSALFVCRNDTSGVVRASTVDIWKAIVPNTPRAVKEILPVLTNMI
                     VANLASSSKSLRNIAANTLGDLSRRVGGNAMAQLLPTLENSLDESASEDSRQGVCVAL
                     TALIEPSSPESLEQYQDAIVTILRKTLTDNCDTVRQSAASTFDVYQDVVGNVAVDEVI
                     PYLLHMLKSEEYSKYALSGLQEVMSSKSEVIFPVLIPTLLASPMDAFRASALGSLAEV
                     AGTALYRRLSTIINTLVDNLVELGDSSSDLVLALQSALDKIFISVSDEDGLHPLLQQI
                     MALLKSETEAKKIVVLERLPYFFENTVLDYEVYTPDIVSNCILSLDDKNPRVVKGNYE
                     TLTTLLKKQQKSMLEKLVKPAKQALLMIGTPGQDLAAFSLPRGPNCVLPIFLHGLMYG
                     SNDEREASALVIADIVSKTPAANLKPFVSVITGPLIRVVGERFNSDIKAAILYALNIL
                     FAKIPQFLRPFIPQLQRTFVKSLSDPSNETLRLRAAKALGTLIEYQPRVDPLVIELVT
                     GAKQTDDEGVKTAMLKALLEVVDKASSKLNETSKKNIMDLIEEEVLSSNEKLAVTYAK
                     LIGSLSEILSTDEARNILKEKVLSSTFENETGKFGILTLNSFLKDAPNHIFETGLVIE
                     FVQFIVDAMNSSNVYFSENGLKAAGKIMLLNGETKSPTSKIESSTPFVLGEDNIKLLI
                     DELCKNMLKPNCNSSDCRRLSLVITRTLARFKYDDYVAPYFGELGKSVFSCLRDPVIP
                     IKLAAEKAYLAVFKLVEEENMETFNAWYTTVSATGADLIDANGTTIQLRSIGDYTKRV
                     SKRLATVERERIAAGGDAETMFSDRYEDETEIWAVGGVELNNDL"
     gene            complement(<61986..>62198)
                     /gene="TPHA0H00310"
                     /locus_tag="TPHA_0H00310"
                     /db_xref="GeneID:11533884"
     mRNA            complement(<61986..>62198)
                     /gene="TPHA0H00310"
                     /locus_tag="TPHA_0H00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686627.1"
                     /db_xref="GeneID:11533884"
     CDS             complement(61986..62198)
                     /gene="TPHA0H00310"
                     /locus_tag="TPHA_0H00310"
                     /inference="similar to DNA sequence:INSDC:YGL194C-A"
                     /note="similar to Saccharomyces cerevisiae YGL194C-A;
                     ancestral locus Anc_8.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686675.1"
                     /db_xref="GeneID:11533884"
                     /db_xref="UniProtKB/TrEMBL:G8BWT7"
                     /translation="MRTTQILKRITLGLVLLSFVNLTTKLLVSKVFPAFLLWMTSCPN
                     NECTELHWWQKSPTLERIVWKLIDNI"
     gene            complement(<62605..>63957)
                     /gene="TPHA0H00320"
                     /locus_tag="TPHA_0H00320"
                     /db_xref="GeneID:11534162"
     mRNA            complement(<62605..>63957)
                     /gene="TPHA0H00320"
                     /locus_tag="TPHA_0H00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686628.1"
                     /db_xref="GeneID:11534162"
     CDS             complement(62605..63957)
                     /gene="TPHA0H00320"
                     /locus_tag="TPHA_0H00320"
                     /inference="similar to DNA sequence:INSDC:YGL194C"
                     /note="similar to Saccharomyces cerevisiae HOS2 (YGL194C);
                     ancestral locus Anc_8.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686676.1"
                     /db_xref="GeneID:11534162"
                     /db_xref="GOA:G8BWT8"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G8BWT8"
                     /translation="MSSSTFSYDIKTKDSQPMFEFGSTYSPRVSYHYNPKVSNYHYGV
                     KHPMKPFRFMLTDHLVSSYGLHNIMDLYETREATKEELLQFHSEDYVEFLSKVSPDNI
                     SKMPRGTFDKYNIGDDCPIFQNIYEYCKLYAGASLDASRKLINDQSDIAINWSGGLHH
                     AKKSNPSGFCYVNDIVLATLNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTVSFH
                     KYNGEFFPGTGNYDEIGCAEGKHFAMNVPLNDGIDDDSYINLFKSVMEPIITSFKPTA
                     IIQQCGADSLGHDRLGCFNLNIKAHGECVKFIRSFGIPMVVVGGGGYTPRNVSRLYAY
                     ETGILNNVLLQSELPEDMPFRNQFGPDYSLYPVLDDLYENMNSKKYLEDLRIRCLEHI
                     RYLQGAPSVRMDAELIPTQDITGLTVEEEEMIKELNQDDEQQRLMQIEKENAKLGEFM
                     "
     gene            <64839..>66416
                     /gene="TPHA0H00330"
                     /locus_tag="TPHA_0H00330"
                     /db_xref="GeneID:11534163"
     mRNA            <64839..>66416
                     /gene="TPHA0H00330"
                     /locus_tag="TPHA_0H00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686629.1"
                     /db_xref="GeneID:11534163"
     CDS             64839..66416
                     /gene="TPHA0H00330"
                     /locus_tag="TPHA_0H00330"
                     /inference="similar to DNA sequence:INSDC:YGL192W"
                     /note="similar to Saccharomyces cerevisiae IME4 (YGL192W);
                     ancestral locus Anc_8.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686677.1"
                     /db_xref="GeneID:11534163"
                     /db_xref="GOA:G8BWT9"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BWT9"
                     /translation="MVNLELLDFLIESHAQLVAEPVMGNMEDLFVLYKGIYIASGDDS
                     YSLERFVEDIDSIANTSKGSIVFEENRLLSIEKSSHITKYIKLIDVYLLNLLHEQLVP
                     SSRVNRTKNSKTDAVECAPASSSNLMDRLMVALDSAIEIKSDIESRKEKVWNHYLFSK
                     LDELLTTNVGSNILGKERAMHNTPVAEFIPICANTEHSSLLSTLLYIVNNKIVSMQTT
                     KLSKCEAQCPGFKECLLNNIHYVSNLKPQTDLTLGDCSYLDTCHKLSTCRYVHYLQYI
                     PQSLKERVSKESQEMNKIMETKNSKISYYTHGECCSSSFKTLLPPQWICCDVRKFDFR
                     VLGKFSAVIADPAWNIHMNLPYGTCNDIELLELPLDQLQEEGVLFLWVTGRAIELGKE
                     SLTNWGYEVVNEIAWIKTNQLSRTIVTGRTGHWLNHSKEHLLVGIKGKPEWINRNIDL
                     DLIVSITRETSRKPDELYGMVERMVGTHARKLEIFGRNHNVRPGWLTIGNQLTGNCIH
                     EMDVQERYDSFLNSASA"
     gene            <67032..>67418
                     /gene="TPHA0H00340"
                     /locus_tag="TPHA_0H00340"
                     /db_xref="GeneID:11534170"
     mRNA            <67032..>67418
                     /gene="TPHA0H00340"
                     /locus_tag="TPHA_0H00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686630.1"
                     /db_xref="GeneID:11534170"
     CDS             67032..67418
                     /gene="TPHA0H00340"
                     /locus_tag="TPHA_0H00340"
                     /inference="similar to DNA sequence:INSDC:YGL191W"
                     /note="similar to Saccharomyces cerevisiae COX13
                     (YGL191W); ancestral locus Anc_8.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686678.1"
                     /db_xref="GeneID:11534170"
                     /db_xref="GOA:G8BWU0"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="InterPro:IPR018507"
                     /db_xref="UniProtKB/TrEMBL:G8BWU0"
                     /translation="MFRQAIKRSYATLPPWAMKPAFGAPNKVAAEAYKKELKAVRDHA
                     AGTSNFWKKISIMVAVPAIGLATINTYYVEVEHAEHRKHLSHVKDSDWPKDYEFQNIR
                     SKPFFWGDGDKTLFWNPVVNRHIKDE"
     gene            complement(<67735..>69354)
                     /gene="TPHA0H00350"
                     /locus_tag="TPHA_0H00350"
                     /db_xref="GeneID:11534171"
     mRNA            complement(<67735..>69354)
                     /gene="TPHA0H00350"
                     /locus_tag="TPHA_0H00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686631.1"
                     /db_xref="GeneID:11534171"
     CDS             complement(67735..69354)
                     /gene="TPHA0H00350"
                     /locus_tag="TPHA_0H00350"
                     /inference="similar to DNA sequence:INSDC:YGL190C"
                     /note="similar to Saccharomyces cerevisiae CDC55
                     (YGL190C); ancestral locus Anc_8.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686679.1"
                     /db_xref="GeneID:11534171"
                     /db_xref="GOA:G8BWU1"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BWU1"
                     /translation="MMSDEEFDFKFSQCFGDKADIVVTEADIITSVEFDHSGDYLATG
                     DRGGRVVLFERSNKDKIKKSAGDVGGGGNAEYKFLTEFQSHDAEFDYLKSLEIEEKIN
                     QIKWLKPTQKSHFLLTTNDKTIKLWKIYEKNIKVVSENNLLNSNGSGNHSASSNSSAS
                     LTSSNSASKSKSLHSNSNNINDKNNDNENNSSTTNNNLKSNKISASAKAVQNLFLPKL
                     IDHEKIITAMPRRIYSNAHTYHIHSISVNSDQETFLSADDLRINLWNLDIPDQSFNIV
                     DIKPTNMEELTEVITSADFHPQHCNYFIYSSSKGTIRLCDMRQNAICDYQTKIFEEYI
                     DPTSHNFFTEITSSISDVKFSPNGRYIASRDYLTIKIWDVNMDNKPLKTINIHEQLKD
                     RLSDTYENDSIFDKFELSFSGDSSSIMTGSYNNNFMIYPNVIQSNIEDTKPTIVKTFD
                     NNPKKKKPAANNDILLKNDDGIGQIVLQADKTSFKNRRVGTTAQRSAKIKDWSDDIDF
                     KKSILHFSWHPKENSIALAATNNLFIFSAHP"
     gene            complement(<70200..>70559)
                     /gene="TPHA0H00360"
                     /locus_tag="TPHA_0H00360"
                     /db_xref="GeneID:11534045"
     mRNA            complement(<70200..>70559)
                     /gene="TPHA0H00360"
                     /locus_tag="TPHA_0H00360"
                     /product="40S ribosomal protein S26"
                     /transcript_id="XM_003686632.1"
                     /db_xref="GeneID:11534045"
     CDS             complement(70200..70559)
                     /gene="TPHA0H00360"
                     /locus_tag="TPHA_0H00360"
                     /inference="similar to DNA sequence:INSDC:YER131W,YGL189C"
                     /note="similar to Saccharomyces cerevisiae RPS26B
                     (YER131W) and RPS26A (YGL189C); ancestral locus Anc_8.149"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="XP_003686680.1"
                     /db_xref="GeneID:11534045"
                     /db_xref="GOA:G8BWU2"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:G8BWU2"
                     /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSKSIPKDKAIKRMAIRNI
                     VEAAAVRDLSEASVYPEYALPKTYNKLHYCVSCAIHARIVRVRSRTDRRIRAPPQRQR
                     FNRENRVSPADAAKKAL"
     gene            complement(<71962..>72438)
                     /gene="TPHA0H00370"
                     /locus_tag="TPHA_0H00370"
                     /db_xref="GeneID:11534046"
     mRNA            complement(<71962..>72438)
                     /gene="TPHA0H00370"
                     /locus_tag="TPHA_0H00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686633.1"
                     /db_xref="GeneID:11534046"
     CDS             complement(71962..72438)
                     /gene="TPHA0H00370"
                     /locus_tag="TPHA_0H00370"
                     /inference="similar to DNA sequence:INSDC:YGL187C"
                     /note="similar to Saccharomyces cerevisiae COX4 (YGL187C);
                     ancestral locus Anc_8.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686681.1"
                     /db_xref="GeneID:11534046"
                     /db_xref="GOA:G8BWU3"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="UniProtKB/TrEMBL:G8BWU3"
                     /translation="MFTLRTSSRAIRPVSRAFSTSRVFFTEKNVTSYTTAKTLADVKG
                     PETLIGPGAKENTIPTELDQATGLARLELLGKLEGVDVFDSKPLESSRTGTMADPIIV
                     NSYDDYRYVGCTGSPAGSHTTMWLKPSVGKVARCWECGSVYKLNPLGVHTDDGHSH"
     gene            complement(<73038..>74798)
                     /gene="TPHA0H00380"
                     /locus_tag="TPHA_0H00380"
                     /db_xref="GeneID:11534178"
     mRNA            complement(<73038..>74798)
                     /gene="TPHA0H00380"
                     /locus_tag="TPHA_0H00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686634.1"
                     /db_xref="GeneID:11534178"
     CDS             complement(73038..74798)
                     /gene="TPHA0H00380"
                     /locus_tag="TPHA_0H00380"
                     /inference="similar to DNA sequence:INSDC:YGL186C"
                     /note="similar to Saccharomyces cerevisiae TPN1 (YGL186C);
                     ancestral locus Anc_8.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686682.1"
                     /db_xref="GeneID:11534178"
                     /db_xref="GOA:G8BWU4"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:G8BWU4"
                     /translation="MDDFTTQNKTKKNDDVFEYIVTDIRNDEFEEGEFIIAPQESEDK
                     EYQQKRAGGVFKNVQHFLVNVSKKVDSLGVESTGIDRISPDARGSYRKQLLHVSGLWL
                     SATGGLSSMSTFLLGPLLFELTLKQSLVAGILGMFIGCLVAAYCSIMGPQSGCRQMVT
                     ARFLFGWWFVKFVALAAITGVMGWSVVNAVVGGEMLASISDDKVQLWVGIVIVSVLSF
                     VVATFGIKQVLKVETYFAIPVLTCFLLLYISSSDKYYMLNTFKNDDVDPLTIKGNYMS
                     FFSLCYSITATWGSITSDYYILFPEDTPKKAVFSITFFGIFLPTLFVGVLGMLLAAIA
                     ASYEPWYVMYEKYGMGGLLHAGFQRWNGFGKFCVVILIFSLVSNNIVNTYSAAFSIQL
                     ASVRLAKIPRWVWAIVCTVVYVVCALVGREHFSTILSNFLPMIGYWISMYFILLFLEN
                     ELFRRFFLHLYTKEFPPASQQEDEQEDAVEEEGTKQKRYYRKHILDYKREHRRQHHRY
                     NWDDWDNYNVLTHGYAATASFLVGIIGVVIGMAQTYWVGPVAKHFGAYGGDLAMWLCM
                     GFSGIAFPLLRYWELKRYGR"
     gene            complement(<75480..>76223)
                     /gene="TPHA0H00390"
                     /locus_tag="TPHA_0H00390"
                     /db_xref="GeneID:11534179"
     mRNA            complement(join(<75480..76148,76221..>76223))
                     /gene="TPHA0H00390"
                     /locus_tag="TPHA_0H00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686635.1"
                     /db_xref="GeneID:11534179"
     CDS             complement(join(75480..76148,76221..76223))
                     /gene="TPHA0H00390"
                     /locus_tag="TPHA_0H00390"
                     /inference="similar to DNA sequence:INSDC:YGL183C"
                     /note="similar to Saccharomyces cerevisiae MND1 (YGL183C);
                     ancestral locus Anc_8.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686683.1"
                     /db_xref="GeneID:11534179"
                     /db_xref="InterPro:IPR005647"
                     /db_xref="UniProtKB/TrEMBL:G8BWU5"
                     /translation="MGTKKGCSIDEKKQSILNFFQNEYSFYTIKELEKLIPKKCPSIS
                     SMVVKELLQAMIDEDGLISVEKCGNINVYWCFKNQINQKIYENCTRLQKDIEEKTIVV
                     SDLELRVASTVKNERAPNFTYDNKKYKRLVELDKLKKLDMQCKTLQNEYDSLMENLWD
                     EQTLVKKIHLLEKKNDDLNILSDNIDSIISYLVNKYLVDANDIRKEYGIQEEYKEYSK
                     EVSGV"
     gene            <77122..>78522
                     /gene="TPHA0H00400"
                     /locus_tag="TPHA_0H00400"
                     /db_xref="GeneID:11534308"
     mRNA            <77122..>78522
                     /gene="TPHA0H00400"
                     /locus_tag="TPHA_0H00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686636.1"
                     /db_xref="GeneID:11534308"
     CDS             77122..78522
                     /gene="TPHA0H00400"
                     /locus_tag="TPHA_0H00400"
                     /inference="similar to DNA sequence:INSDC:YGL181W"
                     /note="similar to Saccharomyces cerevisiae GTS1 (YGL181W);
                     ancestral locus Anc_8.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686684.1"
                     /db_xref="GeneID:11534308"
                     /db_xref="GOA:G8BWU6"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:G8BWU6"
                     /translation="MGRFSRNNNHQASGEQRELTDLINLPENSNRCGECGNSFPTWAS
                     VNLGVFLCGRCASVHRNMLNNRDDYVFSHVKSLTIDRWNSRDVDTLGNSGGNKRNASI
                     WNPKKEPFPFDADEDKSKVEEFIRNKYILGTYRYNAIEPQDYGEQRQNKERDGPRDRY
                     DNRRDRYDDRRERRYGDGDEDRYDDYKRSSRGRNRSGTSSGRRDGRGGSTRDVSLTNR
                     KARDFELSKYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDILESNNKRNGPSRD
                     NNEPTPSLPKRPAEAGPTPAVFDGSGAPASNAAAPTDVIFDGTVQQYIDPSTGIIYVD
                     QQHYAAALQNTQQNMQLQQQLQMQQQQQALQQQQALQQQQALQQQMMTGMYMQQPQQT
                     GIDKNAIMGLYNNPASYTSPVEVKPDHPQYQQLQAQAQAQAQAQQQLQMQQQQQMQQQ
                     QMQQPYNPGYPGYFIQ"
     gene            <79426..>82197
                     /gene="TPHA0H00410"
                     /locus_tag="TPHA_0H00410"
                     /db_xref="GeneID:11534309"
     mRNA            <79426..>82197
                     /gene="TPHA0H00410"
                     /locus_tag="TPHA_0H00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686637.1"
                     /db_xref="GeneID:11534309"
     CDS             79426..82197
                     /gene="TPHA0H00410"
                     /locus_tag="TPHA_0H00410"
                     /inference="similar to DNA sequence:INSDC:YGL180W"
                     /note="similar to Saccharomyces cerevisiae ATG1 (YGL180W);
                     ancestral locus Anc_8.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686685.1"
                     /db_xref="GeneID:11534309"
                     /db_xref="GOA:G8BWU7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022708"
                     /db_xref="UniProtKB/TrEMBL:G8BWU7"
                     /translation="MVMENKQNNHQLLCDKYIIDKEIGKGSFATVYKGTCISYNEQHN
                     GDDNDDRTDTNGGGNDSFESAVAIKAVSKSKLKNKKLLENLEIEIAILKKIQHPHIVR
                     LIDCQRTSTDFYLIMEYCSLGDLTFLIKKKNELIKTHPIIKLIFKKFPSPSEKHNGLN
                     RILIVNYLQQLSSSLKFLRSKNLVHRDIKPQNLLLSTPLVAIDDILKHKQQDGFVGLT
                     SLPILKIADFGFARFLPNTALAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLYEM
                     CCGRPPFKASNHLELYKKIKKANDIIQFPIDVEIEDELKNLICSLLTFDPVDRLNFNE
                     FFNNKLVNEDLSMYDLDDKSSVDGLKKSKEITNNNLFISEYIENNQKKIMPIDKTNSS
                     EKKKIMNPQINNSEIILEKDYVVIEKKTVEVNAFADEVADNNTKYLTKLQTNKTGHSP
                     KNITSAATNNIMLNNQILPQANQRSPRNSIPNTTTIATANNSPPNPLTNTNSSRRASL
                     IERRISISSLNPSNALSKAIGTASTKLFGSNTNNTLSNNAHHKNTAFLNPQLYHDLTE
                     NIVLRAEQYNSNNGLVSDTLKTSDLNSIVHQIESLSAKAFVVYSYAEIKYSQVMPARL
                     SLSSMSSNSEKVTIPETNADNSFKNNNTIKLNVSPNSHEYKYEDNDDMAVDLIEHTIN
                     KQSAVTNNLSTNIGTSDGVQRHNSFTFTNDLSQKEIQLLSTEAIVLYMKALSILAEAM
                     SITSKWWYESNDKNCSLRLNLLVQWIRDTFNESLGKADFLRLKLLQFTEHSNSISDND
                     VTTDNQSKIEHNENYLDDKIYLEKLLYDRALDISKTAAKMELQGENLSNCELAYATSI
                     WMLQVLLEEGATGPETNIPGEDNFSMKSSSLTNSQALLDEKDREIIKKYIESIANRLK
                     SLRNKMNQN"
     gene            complement(<82575..>85691)
                     /gene="TPHA0H00420"
                     /locus_tag="TPHA_0H00420"
                     /db_xref="GeneID:11534152"
     mRNA            complement(<82575..>85691)
                     /gene="TPHA0H00420"
                     /locus_tag="TPHA_0H00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686638.1"
                     /db_xref="GeneID:11534152"
     CDS             complement(82575..85691)
                     /gene="TPHA0H00420"
                     /locus_tag="TPHA_0H00420"
                     /inference="similar to DNA sequence:INSDC:YER129W,YGL179C"
                     /note="similar to Saccharomyces cerevisiae SAK1 (YER129W)
                     and TOS3 (YGL179C); ancestral locus Anc_8.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686686.1"
                     /db_xref="GeneID:11534152"
                     /db_xref="GOA:G8BWU8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G8BWU8"
                     /translation="MTSHSGNGEALDVPSDLQCTLTSSMNIYCSSMKNDNNSGSTSRV
                     RTHSGSTTGREPTFISPGATSTSDDVGELQSVSSSSMESLNMLLERQHIRQLNHPLHQ
                     EHINDAQSFAPLKVKETNSISLKFDPVLKRKILNNYEVISELGSGQHGKVKLGKDIVT
                     DTLVAIKIVDRQAKKERKIFSFKKPSNVTNYKIKREINIMKRCNNEHIVKLLEVLDDL
                     KSKKIYLILEYCSRGEVKWCPGDVMETEARGPPLLSFQRVRKILRDVTLGLEYLHSRG
                     IIHRDIKPANLLLSEDGSVKISDFGVSVISHNKEENGTNSIDELELAKTAGTPAFFAP
                     EICLGSEAKSKFNLKKDPSKDSKLIYMVDVWALGTTLYCLLFGMLPFISDYELKLFEK
                     IVNDPLIFPDYEIMQKNGTSNIFSEEEYEAAKNILKELLTKNPAKRMSIKDIKIHRFT
                     CWDFDNNLGSDLYSKEKAIADKSSFLSVQDVRSDNTSSISSDLRSLDSYNIQKHSSKQ
                     SFGSSASQMRGNESWSHTNSSSPGDCSDNVRHDSSGRHINNNRDSPSQLDVRNSGNYS
                     KNGSDENEKSEQLSEREIFERELSNFDNRQSHGVVNLPINSSFASLDSFYIDNYAMSK
                     MGMDSILLNEQLPNSSGGSNKPPTFGSLVQLQRRNDDSRNSSSRLNLFTYGLSSTTND
                     RAPRISTFGEQQNRGFRGSGVGISNMNQHTKQRQYSRGMTPAEGTSVKRPGSPPNVRQ
                     PIQPQSSNHKSPPSNERNRNDYNNNNQNSKHIHKQNRHSPAFTIKRGNFFSKFNGQDE
                     NSSSSPEISESEESQTTQACSISSRSNTESLPFEFGPEQVNEAITPLGDLHKAHKQHT
                     QYDRNNSKTLNSDDSSDEEDGLMLNMGGSKPSRSKSVNHPTIPNANHKKSSSDTNYDL
                     SKVMVMGSDESRVSSTGSSQVEIYRSITNNESDIEDIPLDVLQSMQLFQGSSTAAGVN
                     TNYSATPASLDHSQRSNSGLSLLAPTQNQFLNESNAYSQHNNLPNGEFYSMLKSSLDP
                     VSRNKQKP"
     gene            complement(<86587..>87216)
                     /gene="TPHA0H00430"
                     /locus_tag="TPHA_0H00430"
                     /db_xref="GeneID:11534153"
     mRNA            complement(<86587..>87216)
                     /gene="TPHA0H00430"
                     /locus_tag="TPHA_0H00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686639.1"
                     /db_xref="GeneID:11534153"
     CDS             complement(86587..87216)
                     /gene="TPHA0H00430"
                     /locus_tag="TPHA_0H00430"
                     /inference="similar to DNA sequence:INSDC:YER128W"
                     /note="similar to Saccharomyces cerevisiae YER128W;
                     ancestral locus Anc_8.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686687.1"
                     /db_xref="GeneID:11534153"
                     /db_xref="InterPro:IPR013640"
                     /db_xref="UniProtKB/TrEMBL:G8BWU9"
                     /translation="MINKYKANKVALKDAKSCIVCHRLSQVCLFNETGPDWFYSCPVH
                     LENNAMLARPIYSKEYNDALSEMKQLKQQIGVLESKGRESWDGWVANIFSKKKVDANV
                     TNSGTEVDNGKEGSSEESAETSQNDSTLDLSALKKKYDGMLDQIAQMQKNNKLYELSN
                     LMFQNRVEIKRRQDNLLAQKKQEEKNFTNTQPEEILQNFSFPSVPKDIK"
     gene            complement(<87657..>88754)
                     /gene="TPHA0H00440"
                     /locus_tag="TPHA_0H00440"
                     /db_xref="GeneID:11534180"
     mRNA            complement(<87657..>88754)
                     /gene="TPHA0H00440"
                     /locus_tag="TPHA_0H00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686640.1"
                     /db_xref="GeneID:11534180"
     CDS             complement(87657..88754)
                     /gene="TPHA0H00440"
                     /locus_tag="TPHA_0H00440"
                     /inference="similar to DNA sequence:INSDC:YER127W"
                     /note="similar to Saccharomyces cerevisiae LCP5 (YER127W);
                     ancestral locus Anc_8.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686688.1"
                     /db_xref="GeneID:11534180"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="UniProtKB/TrEMBL:G8BWV0"
                     /translation="MSELESILKQINESLDSTSESIDKLKAVYGDGTTGAGDEVRSKI
                     ERNILNGAASENVSLLSLKNGSMLGYVSSLLMVIGNKLDVNTEDETCGAAREKAIESR
                     VVLERGVKPLEKKLGYQLDKLTRAYTRIEKEYLDAEARTLEKSHSKKGSDGSDKDAQS
                     ESDSSSDEELSYRPNAAGLTKSTKTSSRGSKAPINEESLSAAEESEGEDKKGGVYKPP
                     KITAMLPPQQRHFEDKFNAQEHKDRSNRSRMQAMEEYVKESSEQPDWESSIGANIVNH
                     GRGGIKSLRDTEKERKVTTYEEDNFTRLNTVGNKLERRKQKQRERMAKVNMIGGEDFS
                     IFNSKRKFEDSTSRRGNKKSHTAWDRAKRKI"
     gene            <89233..>90018
                     /gene="TPHA0H00450"
                     /locus_tag="TPHA_0H00450"
                     /db_xref="GeneID:11534181"
     mRNA            <89233..>90018
                     /gene="TPHA0H00450"
                     /locus_tag="TPHA_0H00450"
                     /product="ribosome biogenesis protein NSA2"
                     /transcript_id="XM_003686641.1"
                     /db_xref="GeneID:11534181"
     CDS             89233..90018
                     /gene="TPHA0H00450"
                     /locus_tag="TPHA_0H00450"
                     /inference="similar to DNA sequence:INSDC:YER126C"
                     /note="similar to Saccharomyces cerevisiae NSA2 (YER126C);
                     ancestral locus Anc_8.137"
                     /codon_start=1
                     /product="ribosome biogenesis protein NSA2"
                     /protein_id="XP_003686689.1"
                     /db_xref="GeneID:11534181"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:G8BWV1"
                     /translation="MPQNEYIEQHIKQHGRRLDHAERLRKREAREVHKVAQRAQKLTG
                     WKGKQFAKKRYAEKVAMRKKIKAHEQSKVKGASKPLDENGDALPTYLLDREQTNTAKA
                     ISTSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKAKTKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQRKANVTHPELGVTVFLPILAVKKNPQSPMYTQLGVLTKG
                     TIIEVNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAVLLV"
     gene            <90491..>91171
                     /gene="TPHA0H00460"
                     /locus_tag="TPHA_0H00460"
                     /db_xref="GeneID:11533697"
     mRNA            <90491..>91171
                     /gene="TPHA0H00460"
                     /locus_tag="TPHA_0H00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686642.1"
                     /db_xref="GeneID:11533697"
     CDS             90491..91171
                     /gene="TPHA0H00460"
                     /locus_tag="TPHA_0H00460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686690.1"
                     /db_xref="GeneID:11533697"
                     /db_xref="UniProtKB/TrEMBL:G8BWV2"
                     /translation="MKKEEGFPSFPSWGRSIRSRSRTIAPPVLLVHETLFQSAISGKW
                     KHLEYLKPSSGNCCSGHLQIGTAMITIFLIYQVMYVCCFFSFHAQPHTLSYSSGRTIA
                     RPKQPVLTHSIGETRHSLHQASTYQIPHPIHIYGHHCPGLHLCIQELTSLSSPPPGTE
                     LNENFNQAAVRPSPVFSRCNQRVPQLWKASKSARLLSFFIWQGRNHLILSQCPLQETT
                     DSDLGTAG"
     gene            <91477..>93918
                     /gene="TPHA0H00470"
                     /locus_tag="TPHA_0H00470"
                     /db_xref="GeneID:11533698"
     mRNA            <91477..>93918
                     /gene="TPHA0H00470"
                     /locus_tag="TPHA_0H00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686643.1"
                     /db_xref="GeneID:11533698"
     CDS             91477..93918
                     /gene="TPHA0H00470"
                     /locus_tag="TPHA_0H00470"
                     /inference="similar to DNA sequence:INSDC:YGL178W"
                     /note="similar to Saccharomyces cerevisiae MPT5 (YGL178W);
                     ancestral locus Anc_8.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686691.1"
                     /db_xref="GeneID:11533698"
                     /db_xref="GOA:G8BWV3"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BWV3"
                     /translation="MGYNSGQNAEEMRNQFPVLDSQDGVRTGDMIGNSHSNGSSVPFP
                     YNHQSTVSINSIQSIVEPITPPSVVQMDVKKNHHKTRSLDSSNFTPSVNMFDRGADIN
                     SIKNSQVGSHFPIYNFDDSINGNSNMIVAPTLSSNTPLPMINEFDTLSNGTINNTQSA
                     SYSMGRQMHKQRIPSSNKARQSENSKNFQNQSALSSSLASSSMHTSNQPSSMAELSLL
                     PLDKINYASLATDQFGCRFLQKKLEYPAESNIVRDLLYEDIKSIFLELVLDPFGNYLI
                     QKLCDYFTTDQKTSLIKSIYPHVFQISINQYGTRSLQKIIDTVENDAQIDLIIRGFSR
                     ECASINQIVTLINDLNGNHVIQKCIFKFPTTKFDFIVDAIIHKNNIVLISTHKHGCCV
                     LQKLLGISTLQHIFKLSTKIIEYLHFLINDQFGNYIVQFLFDIEELDFYLLSEIYNKL
                     VGDICNLACSKFSSNVIEKFIEKLFRLLIKLITNDKKQNIKPADKDLIQVCIDIILTI
                     VNIFTRNLNGLIKDKFANYTLQTLLDVKNYTPFLMYDGNKQFILQENYQEFGIEFNKR
                     INNLIYLTKNVLPSIKTTSYAKKIKLKVKVFAELKGTAFTDFVQNNDLQKQNSESTEH
                     ISQNKKFTKKKLHERYSSLPNIINKTTNPSLQSSISNILANQSHVKPGDAININSRLL
                     STSNNITYSNPNQTGGSGYNFEENNRPSNLLEIGLKSLTLENQQLQPQPTIVQKRLSI
                     FSTNETALNNGMGHSQVDMSTNSSSYPLPNPLLQSYTSLSISALTDIDDNSMTQSAMN
                     DPFQKDQLLKNQMYP"
     gene            complement(<94308..>95795)
                     /gene="TPHA0H00480"
                     /locus_tag="TPHA_0H00480"
                     /db_xref="GeneID:11533701"
     mRNA            complement(<94308..>95795)
                     /gene="TPHA0H00480"
                     /locus_tag="TPHA_0H00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686644.1"
                     /db_xref="GeneID:11533701"
     CDS             complement(94308..95795)
                     /gene="TPHA0H00480"
                     /locus_tag="TPHA_0H00480"
                     /inference="similar to DNA sequence:INSDC:YGL176C"
                     /note="similar to Saccharomyces cerevisiae YGL176C;
                     ancestral locus Anc_8.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686692.1"
                     /db_xref="GeneID:11533701"
                     /db_xref="UniProtKB/TrEMBL:G8BWV4"
                     /translation="MSNQREPPVIPGFYFDPIRKRYFPANNVANAIDSQKKFKKPKKD
                     PAPDHSDIKQNKKNYHEMCKKYLSLTQDPVECLYNGALSVPAEGLDNLRLHGFTVNTV
                     DEIAPFKSFAGPIFNLNLNILHQKTILSNGYMYLITENGLLFKYKYGTDQPELLYVRS
                     SNPLSSNIVYKCVSFLEYKNFLFLHTVSPTNEHILEYFDLEKSISYKEYKHQETANDI
                     NDSCCIGPYVCMASKNKLILLKFEGDITEKKVVRIGTIKSDIICIQTYEVTEQFFRLY
                     LGCRNGEIHTKLVDINCLFNSLRESFDKIKLSTIRSIVSLHKGISDGIIYISGLSSNQ
                     GLSAHMGNTLLRLDIFLFNEDETTGLTYFDNYLQNLVKDQELFAISNDDRFLIYGTNK
                     ELDEQNLRTVNIYSTSLSDNSVSYILNKANNKSTKILSTFYPLPISETLIPMENNFSV
                     KSVNFIDRNKFIYTSELKRNKSTSTEFLINNPNDLKYIVSKILTP"
     gene            complement(<96129..>97172)
                     /gene="TPHA0H00490"
                     /locus_tag="TPHA_0H00490"
                     /db_xref="GeneID:11533702"
     mRNA            complement(<96129..>97172)
                     /gene="TPHA0H00490"
                     /locus_tag="TPHA_0H00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686645.1"
                     /db_xref="GeneID:11533702"
     CDS             complement(96129..97172)
                     /gene="TPHA0H00490"
                     /locus_tag="TPHA_0H00490"
                     /inference="similar to DNA sequence:INSDC:YGL175C"
                     /note="similar to Saccharomyces cerevisiae SAE2 (YGL175C);
                     ancestral locus Anc_8.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686693.1"
                     /db_xref="GeneID:11533702"
                     /db_xref="UniProtKB/TrEMBL:G8BWV5"
                     /translation="MVLELALKDQLEDLNLEQLLEVQRIVTDLVTRKVHRFSEVAQVN
                     VKNTRVADTDSSPLKDSTNMLIKTENDSDDNDFTLTQFNQINKENLFQSASSMQKRME
                     ISKLDNKNTKEMSYLSQEVKLEDQSSPLKESQIINDSQESHLRIRLIDHNTPLNNKKI
                     KQEAVSEDKTPQTAAVENYLDLSRNPINNKPWILEDFKPNEYAISRGKARHSKEQFME
                     QFVKGLGNLIEEKKIEGLPNSKEYEVELALKKNARQNEHEFDNLRDRSHSPPGFGRMD
                     FPTTQERTDDKKKSQELIFQKTKYRFLMATRKDVPFKDREYHFKNVKFNRVIDSGEFT
                     WTPSTLMIFSRDS"
     gene            <97469..>98326
                     /gene="TPHA0H00500"
                     /locus_tag="TPHA_0H00500"
                     /db_xref="GeneID:11533710"
     mRNA            <97469..>98326
                     /gene="TPHA0H00500"
                     /locus_tag="TPHA_0H00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686646.1"
                     /db_xref="GeneID:11533710"
     CDS             97469..98326
                     /gene="TPHA0H00500"
                     /locus_tag="TPHA_0H00500"
                     /inference="similar to DNA sequence:INSDC:YGL174W"
                     /note="similar to Saccharomyces cerevisiae BUD13
                     (YGL174W); ancestral locus Anc_8.127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686694.1"
                     /db_xref="GeneID:11533710"
                     /db_xref="InterPro:IPR018609"
                     /db_xref="UniProtKB/TrEMBL:G8BWV6"
                     /translation="MSLYSYLEKTYGSKPKKSKSKKNKQEEGSGRKSEVRAAIKVVDR
                     SEGIRSQTALKGATLSEQSSNAVPKSLWKNLETNEVTTIENIQKPLKSGLNGETLSSG
                     ALAGLQTAEMVKRQVKEKDMEKRQNISSMSNKEVIYRDLSGRKIKNIDLKLKVDENEK
                     NNKQLLDMQKLIDMNKGDVQLSMAKKSMTLEQLTSKSKQLEILQEDPAQQFGFSKDQD
                     ILDTYNNTSITGYKLYTKIFPDNRFGIQPGYRWDGVDRSNGFEKRWFKKKNELEEQKI
                     QKYTMSDDM"
     gene            complement(<98545..>103023)
                     /gene="TPHA0H00510"
                     /locus_tag="TPHA_0H00510"
                     /db_xref="GeneID:11533711"
     mRNA            complement(<98545..>103023)
                     /gene="TPHA0H00510"
                     /locus_tag="TPHA_0H00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686647.1"
                     /db_xref="GeneID:11533711"
     CDS             complement(98545..103023)
                     /gene="TPHA0H00510"
                     /locus_tag="TPHA_0H00510"
                     /inference="similar to DNA sequence:INSDC:YGL173C"
                     /note="similar to Saccharomyces cerevisiae KEM1 (YGL173C);
                     ancestral locus Anc_8.126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686695.1"
                     /db_xref="GeneID:11533711"
                     /db_xref="GOA:G8BWV7"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR016494"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:G8BWV7"
                     /translation="MGIPKFFRYISERWPLILQLIENDQIPEFDNLYLDMNSILHNCT
                     HGNDMDNTRQRLSEEEVYAKIFAYIDHLLNTIKPKKVFYMAIDGVAPRAKMNQQRSRR
                     FRTAMDAETALKKAIANGDELPKGEPFDSNSITPGTEFMAKLTRNLKYFIHDKISNDL
                     NWQNIEVVFSGHEVPGEGEHKIMDFIRNLRSQKDYEQNTRHCIYGLDADLIMLGLSTH
                     DPHFSLLREEVKFGGRRNNSGSLPLEKQNFYLLHLSLLREYMNLEFIEISTNLQFKYE
                     FDRILDDFILIMFVIGNDFLPNLPDLHLNKGAFPVILQTFKEALLHLDGYINENGKIN
                     LKRLGVWLNYLSQFELMNFEKDDIDVDWFNKQLENISLEGEKKRLRQGKKLLLKQQKK
                     IVGAIKPWLLNLAQKPIKELSNLSKDNESALSLELSDSNIVENLEFLKNFAFDLGLFV
                     SHSKSKDSYSLNLDIDSINPVETEEEHQERIKSIKSNLKKYQNAILVEDKEELDNEQE
                     IYDARFEAWKREYYQDKFNLFGSEKVVTEEEIKFDENDDTTNNTEIKRTVEYVNINSE
                     EDVAEIARNYVEGLQWVLYYYYRGCPSWSWYYKGHYAPRISDLAKGLDQTFVFEKRHP
                     FTPFQQLMAVLPERSKNLIPAVLRPLMFDEKSPILDFYPNEVQLDKNGKSADWEAVVL
                     LSFVDEDRLVTAMQPYLEKLTPEEKERNSFGIDLTFRFNPQVDEVYKSPLNGVFSDIK
                     HNHCMEIKFEMEKLDLHEIRYGLLPEAKDGKYLSAGFPSFDTIPFDAKLEYNETAVFQ
                     QPSKQQSMVIYINNVYEGDDVTIDEISNRFMKSIVYTKWPYLRESKLIGVSNGIETIG
                     ADEMTGKITKRNLSDLEKKEYNNLKNSMYRNYGKQQAVKIGDIKSIIKVVPVTGLARD
                     STGAYVKTFGSQIEYYPVQLMVDSIINVDKRFVEKPPQPIDQEFPEGSKVVFLGDYAY
                     GGTATIDGYSSGSRLKLSVEKRSIRSEPTIGKIRHDIDKKLIKYQPSYIVSKTLKFHP
                     LFLSKITSKYLVAGIDGRRVDVGIPIKFEGRRQKVLGYARRSVKGWEYSNLTIDLLNH
                     YKKTFPEFIDKLARLKTNDIPNIGELYPELTNVKAAELLDRVKTWLKNATENFVTVSL
                     ESDSLSKASINAIEEAIIPYSTFAEQSEIKQLAKVPREAILDPKESLTKLRSQRFDLG
                     DRVIYIQSSGKVPLFSKGTVVGYTTLPHSISVQVLFDNEIVAGNRFGGRLRTNRGLGL
                     DASYLLNISNRQFIYHSKASKKTGGEQKNTAASIEAKKERVAKIRTARAQDLLTHIND
                     NKSNTSAANDANIAPAAALPPIRHAANHIYSAVLNQYSNEGPATGNPQPISESNGDNQ
                     AGLPYHLPPGFVPPNPMMFSPPPHGPTGLPLPMGNFMHPPQGMFPPPVPMPMNGAMQH
                     PPVDQKGSAELKSFIKNKKPQDDNKKNTSHKKHPQQNKNRNNGKKTAKNPSNKDTN"
     gene            <103738..>104721
                     /gene="TPHA0H00520"
                     /locus_tag="TPHA_0H00520"
                     /db_xref="GeneID:11534049"
     mRNA            <103738..>104721
                     /gene="TPHA0H00520"
                     /locus_tag="TPHA_0H00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686648.1"
                     /db_xref="GeneID:11534049"
     CDS             103738..104721
                     /gene="TPHA0H00520"
                     /locus_tag="TPHA_0H00520"
                     /inference="similar to DNA sequence:INSDC:YPR011C"
                     /note="similar to Saccharomyces cerevisiae YPR011C;
                     ancestral locus Anc_8.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686696.1"
                     /db_xref="GeneID:11534049"
                     /db_xref="GOA:G8BWV8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BWV8"
                     /translation="MSQELYKKLKSEGSVNFIGGGLAGAVSRTVVSPFERIKIILQVQ
                     KKTAIDQKFNAGIYASLKHIFDTEGWKGMFRGNGINCIRIFPYSAIQFIVYQNSMVHL
                     FNNGISTSVNANRELARDYQRLICGSLCGFASVFLTYPIDLIRTRLSIQTSNLSVMGP
                     TSTAINVHNPPGFAELSKRIWQTEGKVWGLYRGVVPTCLGVVPYVALNFTIYEKLKDF
                     TILSRGDPSDASSSNLLKVSIGAVSGGVAQTIVYPFDLLRRRFQVINMGQHQMGFRYT
                     GIANALYTIGKHEGGFKAYYNGLTINLFKVVPSTAVSWLVYELVCDFMREI"
     gene            <105306..>105518
                     /gene="TPHA0H00530"
                     /locus_tag="TPHA_0H00530"
                     /db_xref="GeneID:11534050"
     mRNA            <105306..>105518
                     /gene="TPHA0H00530"
                     /locus_tag="TPHA_0H00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686649.1"
                     /db_xref="GeneID:11534050"
     CDS             105306..105518
                     /gene="TPHA0H00530"
                     /locus_tag="TPHA_0H00530"
                     /inference="similar to DNA sequence:INSDC:YPR010C-A"
                     /note="similar to Saccharomyces cerevisiae YPR010C-A;
                     ancestral locus Anc_8.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686697.1"
                     /db_xref="GeneID:11534050"
                     /db_xref="UniProtKB/TrEMBL:G8BWV9"
                     /translation="MRPAQLLLEAAKKQSGSKIPVELTPLFVAMGVALCSGTYFTYKK
                     FCYDDSLRVSKNPEQSGLAHILEEKK"
     gene            complement(105787..105859)
                     /gene="TPHA0Htrna9K"
                     /locus_tag="TPHA_0Htrna9K"
                     /db_xref="GeneID:11533728"
     tRNA            complement(105787..105859)
                     /gene="TPHA0Htrna9K"
                     /locus_tag="TPHA_0Htrna9K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11533728"
     gene            <106370..>109981
                     /gene="TPHA0H00540"
                     /locus_tag="TPHA_0H00540"
                     /db_xref="GeneID:11533709"
     mRNA            <106370..>109981
                     /gene="TPHA0H00540"
                     /locus_tag="TPHA_0H00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686650.1"
                     /db_xref="GeneID:11533709"
     CDS             106370..109981
                     /gene="TPHA0H00540"
                     /locus_tag="TPHA_0H00540"
                     /inference="similar to DNA sequence:INSDC:YPR010C"
                     /note="similar to Saccharomyces cerevisiae RPA135
                     (YPR010C); ancestral locus Anc_8.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686698.1"
                     /db_xref="GeneID:11533709"
                     /db_xref="GOA:G8BWW0"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:G8BWW0"
                     /translation="MSKIIKPVNNSRTAHFRTVERESRFINPPKDKSAYPLLEEAVKP
                     HVGSFNALTEGEDGGLLNQGVKDIGEKIIFDGKNTGADSETANSGYLGNKLAISVESV
                     SISKPMANDGVTSAVERKFYPSEARQRLTSYKGKLLVKLKWSVNDGDDTFTDMRDCGG
                     LPVMLQSNRCHLNNLSPYELVKQKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAII
                     RPSFSNRGASYSQYGVQLRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPAVMI
                     LKALIDTSDREIFDGIIGSDIKNSFLTDRLELLLRGFKKRFPLLQNRTQVLQYIGDKF
                     RVVFQASPDKSDLEVGQEVIDRIVLVHLGKGNNEDKSRMLLFMIRKLYSLVAGECCPD
                     NPDATQHQEVLLGGFLYGMIIKEKIDEYLQNIVAQIRTDINRGIAINFKDRKYMSRVL
                     MRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSF
                     FAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCQISTVQSDVSKIPSLLY
                     SLGVTPASQAFAAGPSLCCVQIDGKIVGWTTHEQGKIIADTLRLWKVEGKTAGLPLDL
                     EIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQ
                     NNVHSHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALVHRSDNK
                     LYRLQSGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTGYDMDDAMIINKSADERGF
                     GYGTMYKVEKHDLSMNRSRGDPITQHFGFGPDEWPKEWLEKLDDDGLPMIGTYVEEGD
                     PVCAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIG
                     DKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAG
                     ALHGIAQDATPWMFSEDDTPADYFGDQLLKAGYNYHGNEPMYSGATGEELRCDIYVGV
                     VYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSYLL
                     QDRLLNSSDYTQTSVCRECGSILTTQQSVPRIGTQSTVRCRRCAVTFDAAKKMISKYE
                     GDEDIFIDDSEIWEDGQGNKFVGGGETTTVAIPFVLKYLDSELNAMGIRLRYNVSPK"
     gene            111456..111526
                     /gene="TPHA0Htrna4G"
                     /locus_tag="TPHA_0Htrna4G"
                     /db_xref="GeneID:11533729"
     tRNA            111456..111526
                     /gene="TPHA0Htrna4G"
                     /locus_tag="TPHA_0Htrna4G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11533729"
     gene            <111970..>112902
                     /gene="TPHA0H00550"
                     /locus_tag="TPHA_0H00550"
                     /db_xref="GeneID:11534197"
     mRNA            <111970..>112902
                     /gene="TPHA0H00550"
                     /locus_tag="TPHA_0H00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686651.1"
                     /db_xref="GeneID:11534197"
     CDS             111970..112902
                     /gene="TPHA0H00550"
                     /locus_tag="TPHA_0H00550"
                     /inference="similar to DNA sequence:INSDC:YGL161C"
                     /note="similar to Saccharomyces cerevisiae YIP5 (YGL161C);
                     ancestral locus Anc_8.110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686699.1"
                     /db_xref="GeneID:11534197"
                     /db_xref="UniProtKB/TrEMBL:G8BWW1"
                     /translation="MTERHNNSFEIDDDLDGVDDFTNDNNPFETVRNSKITNNNISSD
                     RIENDSDFDIEVPKVLDPEPISNIPPLLYDQVRVDEQDQNDELPPGFLNYYSKYFQLS
                     DQEFKRRLYNAARFTKSEEIIPDSESNNDNNSNKQTDLYAAIWVTASVIMVQFFTNNL
                     FNLILNDIAQGIKSTTNIDRKDVYSNLLHSIWLFFGYTFIVPFISYQILKKDENTKFK
                     STIDLISVYGYSNLNWIPILFAENVLSKFGASLYVLIIKWVFFPFGLFKSALYLFYAT
                     QNNNNSTSRFPLSVIIILSIHVLFSSLMMFILFY"
     gene            complement(<113055..>114092)
                     /gene="TPHA0H00560"
                     /locus_tag="TPHA_0H00560"
                     /db_xref="GeneID:11533730"
     mRNA            complement(<113055..>114092)
                     /gene="TPHA0H00560"
                     /locus_tag="TPHA_0H00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686652.1"
                     /db_xref="GeneID:11533730"
     CDS             complement(113055..114092)
                     /gene="TPHA0H00560"
                     /locus_tag="TPHA_0H00560"
                     /inference="similar to DNA sequence:INSDC:YGL162W,YPR009W"
                     /note="similar to Saccharomyces cerevisiae SUT1 (YGL162W)
                     and SUT2 (YPR009W); ancestral locus Anc_8.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686700.1"
                     /db_xref="GeneID:11533730"
                     /db_xref="GOA:G8BWW2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BWW2"
                     /translation="MSSKNFVISNNNNSLPILLVPYLHHGEGKVNYHLNPICKIDETF
                     KNMGRLKALNNSNNKENMNLITFPNRLPTPPHSPERFCGENMNCDNITLSRCLANLDS
                     KASTQIRLPEVQFPKSSFCEKTYAYNSTPRNYQWKTARKEIFNRNSDNNVSRLVESVQ
                     DYQLRSNRLSKSTTTKVHKRQRRGRSCDNCRMNKTRCDARFEVLLQNKYVMRSISKKL
                     HYILKKRDIIKYSKHGMILEHIKIPEDLLKDNDHGVKLIKSLDKIILFHPCSSCHRTY
                     TYNKKNVDKTHGRECIYSTGYIKSDMHIYNVMIHNISKELPLSGGNGLSKKLYDLTIS
                     DYKKYFVNGET"
     gene            <115263..>116432
                     /gene="TPHA0H00570"
                     /locus_tag="TPHA_0H00570"
                     /db_xref="GeneID:11533731"
     mRNA            <115263..>116432
                     /gene="TPHA0H00570"
                     /locus_tag="TPHA_0H00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686653.1"
                     /db_xref="GeneID:11533731"
     CDS             115263..116432
                     /gene="TPHA0H00570"
                     /locus_tag="TPHA_0H00570"
                     /inference="similar to DNA sequence:INSDC:YGL164C"
                     /note="similar to Saccharomyces cerevisiae YRB30
                     (YGL164C); ancestral locus Anc_8.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686701.1"
                     /db_xref="GeneID:11533731"
                     /db_xref="InterPro:IPR008812"
                     /db_xref="UniProtKB/TrEMBL:G8BWW3"
                     /translation="MDEILSKAGSQVVSFAIRSSITLASSYVLKKVSNFVQELPTENR
                     EDEVKVKKINRLKRQLENKIIIVSNAIDLIKIVAFNGNNNLNGIIQLTQDIKLEIDSI
                     DDKLNDLQEKNSARNEYDKNKSVLDKVIEYIEDVIERLDEITPFINLSLNTSGINLNS
                     AIPNNISPNLLLNASNLISINNEEYRKDDKDAKKCSLKKIFEFTIYTVFYKIQLKKVV
                     WKEDYNKSQAEIIRYSEKDDEENTYKYNIVFKESFDDDRYHDEEEEEREITINLNNVI
                     KIFYSYSGNLLNLESDFDEPVLILKVDNNGMKKTSTQDIVYYGLGNFNKADNSIKLFE
                     IVTRLLSLQVNEGKDIFDITDEKLALYLNDENKMMNNDNSVDEDETLGKLREVSI"
     gene            complement(<116506..>117576)
                     /gene="TPHA0H00580"
                     /locus_tag="TPHA_0H00580"
                     /db_xref="GeneID:11533996"
     mRNA            complement(<116506..>117576)
                     /gene="TPHA0H00580"
                     /locus_tag="TPHA_0H00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686654.1"
                     /db_xref="GeneID:11533996"
     CDS             complement(116506..117576)
                     /gene="TPHA0H00580"
                     /locus_tag="TPHA_0H00580"
                     /inference="similar to DNA sequence:INSDC:YGL166W,YPR008W"
                     /note="similar to Saccharomyces cerevisiae CUP2 (YGL166W)
                     and HAA1 (YPR008W); ancestral locus Anc_8.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686702.1"
                     /db_xref="GeneID:11533996"
                     /db_xref="GOA:G8BWW4"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:G8BWW4"
                     /translation="MIIDGKKYACQKCIRGHRVTTCNHSGVELVLIKPKGRPSTTCEH
                     CKAVRHNTNFNPMGKCQCGKNVKPIRVRRRSKASISSISNNTTPMVTPASSLMNDCDC
                     LSGSICKCNVTKRKASVVSLTGHGSGFVNSNLNRKSISSYISSPNLVHREDSFSNLFP
                     TESVNNDLSLEFTDNFNKNNREKVDDSGVSLMDFFLNTDKSVDQKIDFNNYPNTSPVS
                     PTTTSFIDNVVGEMNIAMALSNNSSFLNNDDIGLPSDMEYIGKRSSTSESISPKFVSQ
                     PFKNDSNNNNINNSSLNTTQKKHFDTVTNNALVTDNGGTNVSDIFDLNNIFNILESND
                     VPATANDFEFQRNNINWNISNI"
     gene            complement(<118748..>119386)
                     /gene="TPHA0H00590"
                     /locus_tag="TPHA_0H00590"
                     /db_xref="GeneID:11533997"
     mRNA            complement(<118748..>119386)
                     /gene="TPHA0H00590"
                     /locus_tag="TPHA_0H00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686655.1"
                     /db_xref="GeneID:11533997"
     CDS             complement(118748..119386)
                     /gene="TPHA0H00590"
                     /locus_tag="TPHA_0H00590"
                     /inference="similar to DNA sequence:INSDC:YFR008W"
                     /note="similar to Saccharomyces cerevisiae FAR7 (YFR008W);
                     ancestral locus Anc_8.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686703.1"
                     /db_xref="GeneID:11533997"
                     /db_xref="UniProtKB/TrEMBL:G8BWW5"
                     /translation="MEVSTEKNCDPTKGGHQLYVSPQNENLGELYRLINTLVDTLQEN
                     KDVKNRIVSRIDNLDRVMRRGSEETNGMELEHSTNDEDNMIFHNFISSRTTTSKDGDK
                     YSDTNAFLKLKEHNGKLKLLLKEKQNENKQLLAQDLPESESLLAYITRCLRDHVAASN
                     SEKLEAIKVAVGKMHSSLDSEMHQYKQNVDGIDELMEISKCYRYLLQNSNKL"
     gene            <119607..>121391
                     /gene="TPHA0H00600"
                     /locus_tag="TPHA_0H00600"
                     /db_xref="GeneID:11534000"
     mRNA            <119607..>121391
                     /gene="TPHA0H00600"
                     /locus_tag="TPHA_0H00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686656.1"
                     /db_xref="GeneID:11534000"
     CDS             119607..121391
                     /gene="TPHA0H00600"
                     /locus_tag="TPHA_0H00600"
                     /inference="similar to DNA sequence:INSDC:YPR006C"
                     /note="similar to Saccharomyces cerevisiae ICL2 (YPR006C);
                     ancestral locus Anc_8.103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686704.1"
                     /db_xref="GeneID:11534000"
                     /db_xref="GOA:G8BWW6"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:G8BWW6"
                     /translation="MTAGPSDVSGASRPGQVLSTSAAKILCVYKPHVLTGWLIIFSLN
                     LGPQNNNSKAGFQTMSQVKGVQQFFNKARFRDVKRIYTPEDVLRHRGSLVGDTTIPLS
                     CLTARKLFGLLEDRFQHRAPLHTLGVLDPVQMSQLARCKDLKVGYVSGWACSSNASDN
                     VSPDLGDYPYDTVPNQVGRIFNAQLLHDKKLQLSRYNNNNNDNADEVDYMKPLIADAD
                     MGHGGVGTVMKVARLFAEKGAAAIHLEDQLVGSKKCGHLAGTVVVPVETHLTTLHATR
                     FQWDLMNTENLIIARTDSCNSKLISSAVDPRDHQFIKGIIVNDTKESKFNKPLNEMLL
                     DLQNGDKISPNNVKSFEKEWYEANKLMTFDEMVKLVLNDMDYHQYLKEKALLKSSKNK
                     RYLSLIEMKQILTKVNNKNTVEFNWDYPLTKEGYYMYNGCLESAIERSLIYAPYSDMI
                     WLETKTPDLAQAKMFAKKIHEIHPHVKLVYNLSPSFNWQKYNIDIKNFIWNLAKEGFI
                     LQLVSLAGLHISGLAYWSIAKEFQYEGMKTYVEKVQKMEKQEGSDMLLHQKWSGIEYV
                     ESITNTIQNGTNSISSSVSSDSFTESQF"
     gene            <122796..>123779
                     /gene="TPHA0H00610"
                     /locus_tag="TPHA_0H00610"
                     /db_xref="GeneID:11534001"
     mRNA            <122796..>123779
                     /gene="TPHA0H00610"
                     /locus_tag="TPHA_0H00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686657.1"
                     /db_xref="GeneID:11534001"
     CDS             122796..123779
                     /gene="TPHA0H00610"
                     /locus_tag="TPHA_0H00610"
                     /inference="similar to DNA sequence:INSDC:YPR005C"
                     /note="similar to Saccharomyces cerevisiae HAL1 (YPR005C);
                     ancestral locus Anc_8.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686705.1"
                     /db_xref="GeneID:11534001"
                     /db_xref="UniProtKB/TrEMBL:G8BWW7"
                     /translation="MNSMIPEFSDSLSKTGYSLGPFLCNDNNYSIYYIYDTANENAKY
                     LLKIMNKNAFDMNDTSAVDSISLCDNKIGLVYLLSNNSLQEEGPDYFSYYNDNGKSEN
                     DCDDVDVKINERKKSCLIFKDAERIRTSSTSRGCKELIRTPMPCQTENITSKVDQEKL
                     LVFKKKNIIRTPIPKSMEFSENSDDEDEDDDSNDEPLESSDENTSSDSDSDSDSSEDE
                     EDDNDEDEKLPQIGIRKYDVENNETLDIEQSVRSVSIACQGQENQGVKSILSHCHEHP
                     CVDVPKSGILTPPYTCSHMKPNEHITIQSPHIFIPHQQKMDNVLKTPIPKV"
     gene            complement(<124152..>125210)
                     /gene="TPHA0H00620"
                     /locus_tag="TPHA_0H00620"
                     /db_xref="GeneID:11534176"
     mRNA            complement(<124152..>125210)
                     /gene="TPHA0H00620"
                     /locus_tag="TPHA_0H00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686658.1"
                     /db_xref="GeneID:11534176"
     CDS             complement(124152..125210)
                     /gene="TPHA0H00620"
                     /locus_tag="TPHA_0H00620"
                     /inference="similar to DNA sequence:INSDC:YFR007W"
                     /note="similar to Saccharomyces cerevisiae YFR007W;
                     ancestral locus Anc_8.101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686706.1"
                     /db_xref="GeneID:11534176"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWW8"
                     /translation="MVDLDRIVDDTIQLLGKNMAKNYRVIVLLVGPPGSGKSTVAQSL
                     CDAINAKYTSYLSNFTGKHGESPIKYQQVHEDEVNILKNVNEISVPLQKYLVENDGIM
                     PQCVEDVKFEPVKIQANDGSTVVIGRGGLPNSVKIAANESELFSNIELSQVVPMDGFH
                     LSRNCLDNFTDPVEAHKRRGSPMTFDSNNFLQLCKALCETAKITARNNVGTIEQNNSI
                     ETVFDAVSSTFISNIPCICIPGFNHALKDPSTAALTIPSQSRILILEGLYLLYDKENW
                     ANIHKIVEGTASYLIYNIDISESVLQDRVAKRHLKSGLVSSYEEGVKKFQGNDLLNAR
                     DIKSNTIKAHSVITITND"
     gene            <125748..>126323
                     /gene="TPHA0H00630"
                     /locus_tag="TPHA_0H00630"
                     /db_xref="GeneID:11534177"
     mRNA            <125748..>126323
                     /gene="TPHA0H00630"
                     /locus_tag="TPHA_0H00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686659.1"
                     /db_xref="GeneID:11534177"
     CDS             125748..126323
                     /gene="TPHA0H00630"
                     /locus_tag="TPHA_0H00630"
                     /inference="similar to DNA sequence:INSDC:YBR014C,YDL010W"
                     /note="similar to Saccharomyces cerevisiae YBR014C and
                     YDL010W; ancestral locus Anc_3.189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686707.1"
                     /db_xref="GeneID:11534177"
                     /db_xref="GOA:G8BWW9"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:G8BWW9"
                     /translation="MSLMNKRNVRILSITGLLLFVVFLFVQNDNWLLESVVSDSSASA
                     PSRTAERVRNNEAPRPIVGGSSSGKFDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKL
                     LADNYRFSPDIKIIELDKHPNGDELFSYIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQ
                     DDKLVEQTIQKDSDFSVIVSSKDAAPKPNKK"
     gene            <126792..>127334
                     /gene="TPHA0H00640"
                     /locus_tag="TPHA_0H00640"
                     /db_xref="GeneID:11534213"
     mRNA            <126792..>127334
                     /gene="TPHA0H00640"
                     /locus_tag="TPHA_0H00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686660.1"
                     /db_xref="GeneID:11534213"
     CDS             126792..127334
                     /gene="TPHA0H00640"
                     /locus_tag="TPHA_0H00640"
                     /inference="similar to DNA sequence:INSDC:YDL008W"
                     /note="similar to Saccharomyces cerevisiae APC11
                     (YDL008W); ancestral locus Anc_3.190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686708.1"
                     /db_xref="GeneID:11534213"
                     /db_xref="GOA:G8BWX0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024991"
                     /db_xref="UniProtKB/TrEMBL:G8BWX0"
                     /translation="MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQ
                     NSDDEDDEEDFCGICRASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEAS
                     RGLCPMCRQVFELRKGVVINDLHYVTFKELILKRQKEQNEFEATAEDDEALARMIAAQ
                     EGNNGDVPVDDILDQDMVVR"
     gene            complement(<127510..>128199)
                     /gene="TPHA0H00650"
                     /locus_tag="TPHA_0H00650"
                     /db_xref="GeneID:11534214"
     mRNA            complement(<127510..>128199)
                     /gene="TPHA0H00650"
                     /locus_tag="TPHA_0H00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686661.1"
                     /db_xref="GeneID:11534214"
     CDS             complement(127510..128199)
                     /gene="TPHA0H00650"
                     /locus_tag="TPHA_0H00650"
                     /inference="similar to DNA sequence:INSDC:YDR007W"
                     /note="similar to Saccharomyces cerevisiae TRP1 (YDR007W);
                     ancestral locus Anc_3.192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686709.1"
                     /db_xref="GeneID:11534214"
                     /db_xref="GOA:G8BWX1"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BWX1"
                     /translation="MSSKIFDDVLANLPVVKTCGLSDVNSAQVAIDSGAALLGVICVP
                     GRKRTVLKDVATEIANRVQESRNSGNSVYLVGVFRNQPKEEVLKIVEDYHLDIIQLHG
                     DEDWKEYYDYIKKPVIKRVLFPRDNELVLDMNRNYMQSGHKENICLPLFDSEAGGTGE
                     LLNWSDISHWARSHDDDVRFLLAGGLNPSNVSQAVRLDGLIGVDVSGGTETDGKKDHE
                     KIRSFIKNANT"
     gene            <129018..>131288
                     /gene="TPHA0H00660"
                     /locus_tag="TPHA_0H00660"
                     /db_xref="GeneID:11534057"
     mRNA            <129018..>131288
                     /gene="TPHA0H00660"
                     /locus_tag="TPHA_0H00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686662.1"
                     /db_xref="GeneID:11534057"
     CDS             129018..131288
                     /gene="TPHA0H00660"
                     /locus_tag="TPHA_0H00660"
                     /inference="similar to DNA sequence:INSDC:YDR006C"
                     /note="similar to Saccharomyces cerevisiae SOK1 (YDR006C);
                     ancestral locus Anc_3.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686710.1"
                     /db_xref="GeneID:11534057"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:G8BWX2"
                     /translation="MVNNEDSKKDTGVPHSNIAGDNQSNSMNNEKLSRRTHRIIFKPL
                     SVDDNMITNNNVQCLNIPDGNKIKKVYIPTNLKDPHEIARIFNAAVSVNKSGTGKTTM
                     TTTTRTIANQQESAPITSTTIVELDQRNNEAVAEVKIDGINIVEEGLENAQQQQQTGA
                     TGLNKNKQEPVEKHKVEPTVSKKKLLDSRVLNSTKPPNKPFCTMTMEERVERLNSTVG
                     EDQIPLPAINIFHLKELEVNEIIKNAQLRHDIVFDPNLQFRPNLDGNIGVKKRELSQL
                     YWNDLENEIIIYRNDISLFNLKKSRLYPLFDNIRKIMMTIVTPNDYQMVKDVLNPEMN
                     VQNLIRDTLDVNNLSSWIYDILKKYCAPMRDSLVEKLNTAFEKAIELKSLHEFIGCIA
                     LFLEIMELMRLDMANHQIRLIRPALISNSIEFERQYNQTILSKPNNIYVSSFHWFKKT
                     YDEEVSNGNLIVGQTLPRQIYRLVIKDILNLTSCSNMVDEFPIILSTDKALLLSLRSK
                     IRQIVCLMICKLLFDQLVMHHEAVRIDNKLKTFIKSSYSNEEMIADIIAIIKDESGNF
                     KWTRNTSAVSLHLYYKIQQLINRYNIEQNEPGENRQESKTSTPAFVNLAEENIAFAKQ
                     WLAKQIQSNTPVYQLLEKRVYKIIENVIYNISDCTLGGEINQSYMKVFNKNEKKIDLK
                     TLISLSKSSHYNNNANNEDENNNTLFLLSDEQKFLPISLKHFENEILLATTLINFHWS
                     VVGYHYVQFLGNNISK"
     gene            <131960..>133234
                     /gene="TPHA0H00670"
                     /locus_tag="TPHA_0H00670"
                     /db_xref="GeneID:11534058"
     mRNA            <131960..>133234
                     /gene="TPHA0H00670"
                     /locus_tag="TPHA_0H00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686663.1"
                     /db_xref="GeneID:11534058"
     CDS             131960..133234
                     /gene="TPHA0H00670"
                     /locus_tag="TPHA_0H00670"
                     /inference="similar to DNA sequence:INSDC:YDR005C"
                     /note="similar to Saccharomyces cerevisiae MAF1 (YDR005C);
                     ancestral locus Anc_3.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686711.1"
                     /db_xref="GeneID:11534058"
                     /db_xref="GOA:G8BWX3"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="UniProtKB/TrEMBL:G8BWX3"
                     /translation="MKFIDELDVERVNQSLNFETADCKITGSCDIFTTKAVASDKKLY
                     KTIDNHLNELLQENENYNLVIQQRKNSVIDIASESEDAIVNTSSNSLNIENGQNSPAD
                     KQYGKQNINSFWEQKRRLSVNDNDDQAKPNFFVRTNKLNDQNLKELVSENDYVSSSSV
                     ESVNLTKRSRHASNSSISSNISNNTSSNNNSNNNNNNNNNNNDLKSDDSKVNTFNDTT
                     LQNNNKFKVTKTHPNRRRSSIQDAPPNISIGPFGPISETASRRTFAYLIAILNASYPD
                     HDFSSLEPTNFVKSTIKQMVSKIENSLYSLGKKPDESMWEIINSHMDFSDSVIYEYDP
                     SKLLLDDEPGYLWSLNWFIFNKKRKRVAYIYLTCVRLQNNLGELNKDNIPLMSKKEYV
                     IDHDSNNFEGEYDLAVEENAIEDDSDMDVAVN"
     gene            complement(<134250..>134972)
                     /gene="TPHA0H00680"
                     /locus_tag="TPHA_0H00680"
                     /db_xref="GeneID:11534210"
     mRNA            complement(<134250..>134972)
                     /gene="TPHA0H00680"
                     /locus_tag="TPHA_0H00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686664.1"
                     /db_xref="GeneID:11534210"
     CDS             complement(134250..134972)
                     /gene="TPHA0H00680"
                     /locus_tag="TPHA_0H00680"
                     /inference="similar to DNA sequence:INSDC:YBR005W,YDR003W"
                     /note="similar to Saccharomyces cerevisiae RCR1 (YBR005W)
                     and RCR2 (YDR003W); ancestral locus Anc_3.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686712.1"
                     /db_xref="GeneID:11534210"
                     /db_xref="InterPro:IPR020999"
                     /db_xref="UniProtKB/TrEMBL:G8BWX4"
                     /translation="MYILNDYDLNKITVAKFEKTLELNTRETVDDSWGSSSWVWGRWI
                     LFVIFVVFLLVIFLGTIRANKRRRTLGQAPIRGTAWMTPPTYRQSERDYNANGSAANG
                     HDFVPKYTAEANDQDLGYYDARGEFHPNSKSEYLPPPPLVHEVDSNASTTSNSHERPN
                     IPPPQSVVTMSRSANNSATADSPIPQYQRGNIAISDDASVDNLDFSRYNYIDANSTSN
                     TARSNQPTSDNNNDLPRPPKAA"
     gene            <136158..>137600
                     /gene="TPHA0H00690"
                     /locus_tag="TPHA_0H00690"
                     /db_xref="GeneID:11534211"
     mRNA            <136158..>137600
                     /gene="TPHA0H00690"
                     /locus_tag="TPHA_0H00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686665.1"
                     /db_xref="GeneID:11534211"
     CDS             136158..137600
                     /gene="TPHA0H00690"
                     /locus_tag="TPHA_0H00690"
                     /inference="similar to DNA sequence:INSDC:YBR004C"
                     /note="similar to Saccharomyces cerevisiae GPI18
                     (YBR004C); ancestral locus Anc_3.201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686713.1"
                     /db_xref="GeneID:11534211"
                     /db_xref="GOA:G8BWX5"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="UniProtKB/TrEMBL:G8BWX5"
                     /translation="MVFIVKLTWFFLLIKALQYSLVYFSPSQFDTSTELLLKQLTNDT
                     DHQLIDTYWNSNFYNKLLSWDSVFFLKAIVHEKSPNDIIKFEHEYAFSNIWSKLIYVI
                     DLYIHGPLSITGKDMDINYVYRVIKVGLVVGNIIFYLSSILLYYLTILTFSNHSTDLK
                     SKKIAEKTAFLFIISSVSGFIISIYSEPLSFMFAFIGLITRELSLNNRDTDKNGNTTE
                     LFDLKLYCWPLYVIATSLSFIIAMWNRTNCIFLGIYFLFDVFQLLYSRKFYKMIFFPL
                     LSGILLFTAFIYKEYYVAYYQFCPERGEWCTTSIIDKVPFLTKQSFYNFIQTKYWNIG
                     FLNYWTLNNIPNFLFALPNIIILITATIYFTKKYPTRHITPTIWITRCFLLVLIFFAH
                     VQIINRVFSFIPIHLWFISDKLYRNEYLMFTKKTDVCHEKLEVERDGIKNMNRFTSDS
                     DDKIIKFYLYWLLFWVPLQTIFFASFLPPA"
     gene            complement(<137762..>138373)
                     /gene="TPHA0H00700"
                     /locus_tag="TPHA_0H00700"
                     /db_xref="GeneID:11534148"
     mRNA            complement(<137762..>138373)
                     /gene="TPHA0H00700"
                     /locus_tag="TPHA_0H00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686666.1"
                     /db_xref="GeneID:11534148"
     CDS             complement(137762..138373)
                     /gene="TPHA0H00700"
                     /locus_tag="TPHA_0H00700"
                     /inference="similar to DNA sequence:INSDC:YDR002W"
                     /note="similar to Saccharomyces cerevisiae YRB1 (YDR002W);
                     ancestral locus Anc_3.204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686714.1"
                     /db_xref="GeneID:11534148"
                     /db_xref="GOA:G8BWX6"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BWX6"
                     /translation="MSDSAAPTNASGKEETASKPPTSAVFSMFGGKKATPAKEEKKDD
                     EDKEDKDEKKKEGDAENEEEPDVHFEPVVHLEKVDIKTLEEDEEQLFKVRAKLFRFDG
                     DAKEWKERGTGDCKFLKNKATQKVRLLMRRDKTLKICANHIIAPEYELKANVGSDRSW
                     VYTCTADIAEGPAEAFTFAIRFGSKDNADKFKEEFESAQKLNK"
     gene            <139894..>142476
                     /gene="TPHA0H00710"
                     /locus_tag="TPHA_0H00710"
                     /db_xref="GeneID:11534149"
     mRNA            <139894..>142476
                     /gene="TPHA0H00710"
                     /locus_tag="TPHA_0H00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686667.1"
                     /db_xref="GeneID:11534149"
     CDS             139894..142476
                     /gene="TPHA0H00710"
                     /locus_tag="TPHA_0H00710"
                     /inference="similar to DNA sequence:INSDC:YBR001C,YDR001C"
                     /note="similar to Saccharomyces cerevisiae NTH2 (YBR001C)
                     and NTH1 (YDR001C); ancestral locus Anc_3.205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686715.1"
                     /db_xref="GeneID:11534149"
                     /db_xref="GOA:G8BWX7"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:G8BWX7"
                     /translation="MSEIGSRLPTFEINKETDTDSDNKDNSGLDPKSNTTVNIEKKNG
                     TSEGHHIDGFETIDNTLPKYHRRRLSSLNEFHDPFSNAEIYYGPEVDPSKLKNTGNTT
                     FNDGNILQSPLGRVSTAKRFATNPKFNRTRTMSVIDNVSHFKTNLDRYSFGQQHKEPA
                     TINTTEDVSDQVKPQHEVEKTTHLLQRRGSEDDIIISSQGNRRFFIEDVDRTLHELLQ
                     NEDTDANCQITIEDTGPKVLKVGSANSFGFQKISIRGTYMLSNLLQELTIAKSFGRSQ
                     IYLDEARINENPVNRLSRLIEHQFWNSLTRHIDLHTIGKIAQDSKVQTKNVKSNPRIY
                     VPYNNEDQYEFFLQASQMDPSLKLEVEYLPKHITPTYVKSLNDTPGLLSLAMEKHFDP
                     STGEMTLSGYPYAVPGGRFNELYGWDSYLMALGLVENGKVDVAKGMVEHFIFEIDNYG
                     KILNANRSYYLCRSQPPFLTDMALIVFNKIGGENNPQAINFLRRAFKAAIKEYKNVWT
                     ASPRYDEETGLSCYHPDGEGIPPETEPGHFNTILAPYAAKYNVTIEEFRSLYNDKKVK
                     EPALDEFFLHDRGVRESGHDTTYRFEGVCAYLATIDLNALLYKYETDIAKVIEKYFDD
                     SYFDPSDNTDSSSSYWRQRARKRKATIEEKLWDEEKGFYFDYNIKLKQRTTFESATTF
                     WALWAGLATPEKAQRMVEKALPKLEVLGGLVASSEESRGPLSVDRPSRQWDYPYGWAP
                     HQIFAWEGLTKYGYRGISTRLSYRWLYMMTKAFVDYNGIVVEKYDVTRGIDPHKVDAE
                     YGNQGADFKGVATEGFGWVNSSYILGLKYMNNYARRALGACIAPSSFFKRLKDSEKKL
                     YSLK"
     gene            complement(<143103..>145466)
                     /gene="TPHA0H00720"
                     /locus_tag="TPHA_0H00720"
                     /db_xref="GeneID:11534221"
     mRNA            complement(<143103..>145466)
                     /gene="TPHA0H00720"
                     /locus_tag="TPHA_0H00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686668.1"
                     /db_xref="GeneID:11534221"
     CDS             complement(143103..145466)
                     /gene="TPHA0H00720"
                     /locus_tag="TPHA_0H00720"
                     /inference="similar to DNA sequence:INSDC:YPR003C"
                     /note="similar to Saccharomyces cerevisiae YPR003C;
                     ancestral locus Anc_8.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686716.1"
                     /db_xref="GeneID:11534221"
                     /db_xref="GOA:G8BWX8"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018045"
                     /db_xref="UniProtKB/TrEMBL:G8BWX8"
                     /translation="MTLISPKSPLRNDIQTNTNSQYGTIRRQSINSTNSNSNQLKNVL
                     NNNNNKNNNINQNTNSKNKISNKYIDSVFDPNTMDDHDMNQNITITHRIRKTYDDGEN
                     ELTFYQLIQYYLPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLC
                     GLYSLAITPVIYGILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMN
                     ISVTITFLSGLVLFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCI
                     LIDNDRHYHTAFEKIMFIIKYAPNNFHKPTTVLSVVCFSILYFVRYCKKKYIIKHKSL
                     IFLPEILIVVISTGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELF
                     PILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSF
                     GGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLI
                     EEAPGEVKFHWRCKGYNELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRI
                     QILGRIPGSRNFVNIDDYFEDTDNYRSGTSITKCSSSTMLHTIDDSPLSILEEIEGCI
                     IVKVPEPLTFTNTEDLKERLSRLERFGSTNAHPASAGKRSPHPTKYVIFDLNGMTYLD
                     SSASQILIEIIENYHKHNVDVLLCRISNDKHVREMLEKSNIIKLVLPNTPNNNRLQIG
                     SVNFSSFLSLESALTYIEMKDNALSSMDEVSESESFMSSTYVNANLV"
     gap             145807..145826
                     /estimated_length=20
     gene            complement(<145987..>147051)
                     /gene="TPHA0H00730"
                     /locus_tag="TPHA_0H00730"
                     /db_xref="GeneID:11534222"
     mRNA            complement(<145987..>147051)
                     /gene="TPHA0H00730"
                     /locus_tag="TPHA_0H00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686669.1"
                     /db_xref="GeneID:11534222"
     CDS             complement(145987..147051)
                     /gene="TPHA0H00730"
                     /locus_tag="TPHA_0H00730"
                     /inference="similar to DNA sequence:INSDC:YPR004C"
                     /note="similar to Saccharomyces cerevisiae YPR004C;
                     ancestral locus Anc_8.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686717.1"
                     /db_xref="GeneID:11534222"
                     /db_xref="GOA:G8BWX9"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR018206"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8BWX9"
                     /translation="MFRFTNKHNILKKNFQTFLKVHKSTFAFIETSNDGKLLPQSLST
                     LSAAQQLNKPIVALILGKNSSKIAESLIKDYKIQQLNEIIYSQDEIFDSKLPEIFTPN
                     LIKILDENNGDNFSNFIISSSNFGKNILPRISSIFNYQPINDVIEIDASDKNIFKRPI
                     FAGNLIETIDSSKQAKKFISIRSSAFPNTLDVTENADSSNSNTEIKELEEIINPENLT
                     ITWEGNKIVESKRPDLNGAKIVVAGGRALKDKETFDKLLDPLADKLNAAIGGTRAAVD
                     NNLLDNSLQIGQTGKIVAPDLYVAVGISGAIQHIAGMKNSKKIVAINNDPDAPIFKVA
                     DYYIVGDLNAVVPELTEKLP"
     gene            <149750..>150670
                     /gene="TPHA0H00740"
                     /locus_tag="TPHA_0H00740"
                     /db_xref="GeneID:11534168"
     mRNA            <149750..>150670
                     /gene="TPHA0H00740"
                     /locus_tag="TPHA_0H00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686670.1"
                     /db_xref="GeneID:11534168"
     CDS             149750..150670
                     /gene="TPHA0H00740"
                     /locus_tag="TPHA_0H00740"
                     /inference="similar to DNA sequence:INSDC:YAR015W"
                     /note="similar to Saccharomyces cerevisiae ADE1 (YAR015W);
                     ancestral locus Anc_3.179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686718.1"
                     /db_xref="GeneID:11534168"
                     /db_xref="GOA:G8BWY0"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="UniProtKB/TrEMBL:G8BWY0"
                     /translation="MSLTATDLGNILPLINRGKVRDIYQVDSNTLLFIATDRISAYDV
                     IMENAIPNKGILLTKLSEFWFEFLKDDVRNHLVEIPKGKSIFDFLPKELGEPKYRSQI
                     ENRSMLINKFKLIPLEVIVRGYITGSAWSEYQKSRTVHGLQQPDGLLESQKFPKPIFT
                     PSTKAEQGEHDENISIEQASKLIGKDLVNRVDELAVKLYSKCRDYAAKKGILIADTKF
                     EFGIDEKTNEIILVDEVLTPDSSRFWNSATYELGKSQNSYDKQFLRDWLTTNKLKGVN
                     GVKMPEDIVMKTRAKYIEAYERITGKTYTL"
     gene            complement(<150811..>152043)
                     /gene="TPHA0H00750"
                     /locus_tag="TPHA_0H00750"
                     /db_xref="GeneID:11534169"
     mRNA            complement(<150811..>152043)
                     /gene="TPHA0H00750"
                     /locus_tag="TPHA_0H00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686671.1"
                     /db_xref="GeneID:11534169"
     CDS             complement(150811..152043)
                     /gene="TPHA0H00750"
                     /locus_tag="TPHA_0H00750"
                     /inference="similar to DNA sequence:INSDC:YAR018C"
                     /note="similar to Saccharomyces cerevisiae KIN3 (YAR018C);
                     ancestral locus Anc_3.178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686719.1"
                     /db_xref="GeneID:11534169"
                     /db_xref="GOA:G8BWY1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BWY1"
                     /translation="MQRRTNNIDYQNFVHQTPKHNEYQVLEEIGRGSFGSVRKVIHIP
                     TKKLMVRKDIKYGHMNSKERQQLIAECAILSQLKQENIVEFYNWDFDEQKEVLYLYME
                     YCSRGDLSKMIKHYKQDHKYTPEKIVWGILAQILMALYKCHYGEDLPSLVSIYDRMRP
                     PGKGKNIVIHRDLKPGNIFLSSHDGNNESGGKATVDYSEVIVKLGDFGLAKSLETSIQ
                     FATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEICSLHPPFQAKNYTELQNKIK
                     AGKFDRIPDYYSNGLNAIIHSMIDINLKTRPSTFELLQDIQIRTARKSLQLERFEKNL
                     LDYEKELVNIEKLLEKQAVDYEREVHRLKEHFEIALEQGIRDAMDGKKMSKVPDSIQG
                     YYGKTLSKPAFNWETRYQ"
     gene            complement(<152442..>155384)
                     /gene="TPHA0H00760"
                     /locus_tag="TPHA_0H00760"
                     /db_xref="GeneID:11534190"
     mRNA            complement(<152442..>155384)
                     /gene="TPHA0H00760"
                     /locus_tag="TPHA_0H00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686672.1"
                     /db_xref="GeneID:11534190"
     CDS             complement(152442..155384)
                     /gene="TPHA0H00760"
                     /locus_tag="TPHA_0H00760"
                     /inference="similar to DNA sequence:INSDC:YAR019C"
                     /note="similar to Saccharomyces cerevisiae CDC15
                     (YAR019C); ancestral locus Anc_3.177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686720.1"
                     /db_xref="GeneID:11534190"
                     /db_xref="GOA:G8BWY2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BWY2"
                     /translation="MEKADVSAGRVCLTPAQELESVLVDSTNHENVLPNLPKNRYLET
                     SKQDNQPANERTRVQYQLKGVIGKGSFGVVYKAINKKTAQIVAIKEVNYDNDEELNDI
                     MSEIHLLKNLNNRNIVKYHGFIQKMDTLYIILEYCSKGSLKKLISSNKGISEADAKMF
                     IRQTLHGLVYLHEQGVIHRDIKAANLLLDSDNVVKLADFGVSTKVSNATMAMTLAGSL
                     NWMAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNLIDVNIYYAIENDIYFPPED
                     LVSKLGLDFLSKCFQKNMYLRPTARQLLQHEWLNVEDDLPPLKANYATDDSDSKLNKF
                     KEKFANDWDDDFRENGSDVSPKRRTNMSPIKRTASKLNIMTLERMNSNMKLPESATKN
                     EDYLLKKVAKGQMVGNLSVLFNDGDPISISDALFTLLESKNNEKSYDIIYSIFDYDCR
                     YNNSIVKKKFIAMGGLSYLLDKPNILKNSFLDCNDSVFPSSTVYHYLIQMGIMKKEYL
                     DLIMDDQFKLELILKYLECTATKYWVEWCLKYLDVVTLFQGGNVHTRISHIIILKLSS
                     HATWFADKFITYLIKNIPPEQLLSDSQTFYTIFKCINIMLSDTFDSPDSITRPISNIN
                     ISPYKTLSRQASTITNSDFRNISPQPINPEIRISRRLIPEFINWHVSIMNIPSKNIKL
                     ASWKYYIKSTHKLMHHGVPFLSELINTTYFLPLILSMIPQYGDKLVGPILDQESFILV
                     QLLTELKSNRIPPQLFNTAVEFTKIDKYVATGMKIILICFQQLLHQNIKITQISPDLL
                     SIDFKYNENKSNILVKSSDLIDPFYNLDDDYQSFGNYINTFTKITSFQSLAFVSYGLV
                     NNPKFYDKLCSFFSTCRNSVLLQIDLLKFTKNVLTRALQFTDDEMTLIKIDKIVAFLN
                     NNWQHTAGSKSPSNLISSTNQVGFDSILIHQLCKDIELLSQAEFPFNSESTINYDKDG
                     FAIPKWTS"
     gene            <156886..>160623
                     /gene="TPHA0H00770"
                     /locus_tag="TPHA_0H00770"
                     /db_xref="GeneID:11534191"
     mRNA            <156886..>160623
                     /gene="TPHA0H00770"
                     /locus_tag="TPHA_0H00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686673.1"
                     /db_xref="GeneID:11534191"
     CDS             156886..160623
                     /gene="TPHA0H00770"
                     /locus_tag="TPHA_0H00770"
                     /inference="similar to DNA sequence:INSDC:YDL019C,YAR042W"
                     /note="similar to Saccharomyces cerevisiae OSH2 (YDL019C)
                     and SWH1 (YAR042W); ancestral locus Anc_3.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686721.1"
                     /db_xref="GeneID:11534191"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BWY3"
                     /translation="MSVVANNSIESTSTQVVSRPLLKLKLLDSLRQGNFEQLKLLIES
                     KQFQPLDDPTISGVLSLMLNYAIQVSPMSLIKDIVNHSVNNSNNETDTSSSDTFKKLH
                     LNINQQDSNGNTPLHLACLQSRGDVVSFFMDQSQINDCVLNNQRLQPIEVCKNLNIAQ
                     MMQYKRSTYVGEIAQEFRTAFNNRDFGHLETILGNPRNAELLDINGTDPQTGDTVLHE
                     FVKKRDIIMCRWLLEHGADPFKRDITGVLPIEILGTVADNTATTTTKAAIDLELKKLL
                     TDAAKEQSVVDVNANFYEPPSMRGYLSKWTNFAQGYRLRWFVLSGDGILSYYKDQADT
                     KNACRGSLNLSKCSLHLDSSEKLKFEIYSGKVDEVRWHLKGNHSVETNKWVWAIQGAI
                     RYAKDRERMLQSNHVIPSVISSPSNGANLKPHEMTSETSQQYFSMKHKRNISKVTTPI
                     AGEDIVTLSGSMPETNDIALSISDSIALPMSRMSSSTKVTEIITHSVSTDAMNEFPND
                     KNVDKIEETTTPVLATTNDDIESYNSSDDEEKVYEQNVDITYDGEDIKNNYGPFAEKL
                     EILQNTISMELLTLSEFLKDMCANSDDWHTLEKSLNTLISTSADLNTLTKKRDDKLLK
                     ILSKQKNVNNIWIQSVKELELELFEKTERLDSLENERKQFKKMITTKMNDSGSLILPN
                     LAKEKTDETGVDISTESDQETSVIHNDLAINTALEEVSKYIKATTTEDQSSDGDEFYD
                     AEDLVEASENIPDDVVLEEEKEEFKKHDELKNVVSSTEEVTEESSISTVVAVKEISSE
                     IQQLEKQNSYKTIGPKTKIQRDTELKLLKESSFVGYEDGVRTKLELDSDNRPSVSLWS
                     VMKSMVGKDLSRIALPVTFNEPSSMLQRVAEDLEYSELLDQAAKFEDSTLRLLYVAVF
                     STTPYSSTIKRVAKPFNPLLGETFEYSRPDKNYRFLSEQVSHHPVISAFWAESPKWDM
                     WGSLDVESNFNGRTFAFKQKDFWHLKIRPDCSEVEDIYTWKKPENILVGILIGSPEID
                     SVGDVKITNHVTGDYCILHYKARGWRSSGAYEVRGEVYNASGEKKWVLGGHWNEACFA
                     KKVTLQNLDDITLDRNASKNNSNTNNIFEPKDDGSKFLVWKVNKRPEGPFNLTSFAIS
                     LNALQPNLKHWLSPTDTRLRPDQRAMEDGKYDYAAEEKHRLEEKQRAVRKLREENSEV
                     YEPRWFKREFDPYTNAMNWKFVGDYWSKRKEHQLTDEYDIF"
     gene            <162043..>163785
                     /gene="TPHA0H00790"
                     /locus_tag="TPHA_0H00790"
                     /db_xref="GeneID:11533718"
     mRNA            <162043..>163785
                     /gene="TPHA0H00790"
                     /locus_tag="TPHA_0H00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686674.1"
                     /db_xref="GeneID:11533718"
     CDS             162043..163785
                     /gene="TPHA0H00790"
                     /locus_tag="TPHA_0H00790"
                     /inference="similar to DNA sequence:INSDC:YDL020C"
                     /note="similar to Saccharomyces cerevisiae RPN4 (YDL020C);
                     ancestral locus Anc_3.173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686722.1"
                     /db_xref="GeneID:11533718"
                     /db_xref="GOA:G8BWY4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BWY4"
                     /translation="MYSTSAKLSLHRTFSDILEDQLLVNYNDTMNSNSIDHATSYDSV
                     PNSSLDYSMPNTMLLDNSTPNSNSSKSNTDNTILNNVFNQYADPSLTTQTNISNKINE
                     NSNTGSPIVQTISLSKLLKSSSNNKSTSKQSQLYSKINFNSNSSNNNSSPKNNEFDTF
                     EENNNILFTQNNSLYDDEFNLFLAEQHQILLNNSKENLLTNSDSILQDNNVLLDNENA
                     KTSFNNEFYKENNNNIDDDILSDDEFEEEEVDGDDDDENFKNNRYFENADLNDINTNS
                     QNTFSNLISNDNAFALQSFVDSNVKDLNSPSFITDSDSNSFATKKSSIGDDDLNDTDI
                     YDFSRLQNITPNLNTIVTQNKNNKRRKSFVKKNTASLTNVNSSTVLTNVKQNKINLNG
                     RINLDNLPNNKIENNNKNSNNNNNNILSPESSNISSSPLSSPSRPLASYSSSNSKTIT
                     AIAALAQTPIKKDTKAQTTSVRSTHTHVAGEDHEVFKCMIMNLITNEPCSAEFSRPYD
                     LTRHQNTIHAKRKIVFRCSECIRSLGDDGFKKTFSRLDALTRHIKSKHEDLSMEEKKQ
                     VTKYAKQNIAYAVA"
     gene            complement(<163973..>165235)
                     /gene="TPHA0H00800"
                     /locus_tag="TPHA_0H00800"
                     /db_xref="GeneID:11533719"
     mRNA            complement(<163973..>165235)
                     /gene="TPHA0H00800"
                     /locus_tag="TPHA_0H00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686675.1"
                     /db_xref="GeneID:11533719"
     CDS             complement(163973..165235)
                     /gene="TPHA0H00800"
                     /locus_tag="TPHA_0H00800"
                     /inference="similar to DNA sequence:INSDC:YOL058W"
                     /note="similar to Saccharomyces cerevisiae ARG1 (YOL058W);
                     ancestral locus Anc_3.170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686723.1"
                     /db_xref="GeneID:11533719"
                     /db_xref="GOA:G8BWY5"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:G8BWY5"
                     /translation="MSKGKVCLAYSGGLDTSVILAWLLEQGYEVVAFMANVGQEEDFK
                     AAEEKALKIGATKFVVVDCKEEFVTDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQI
                     DVAEQEGCFAVSHGCTGKGNDQIRFELSFYALKPDIKCITPWRLPEFFNKFAGRKDLL
                     DYAASKGIPVSQTKAKPWSTDENEAHISYEAGILEDPNNTPPKDMWKLITDPMDAPDV
                     PQDLSIDFVKGLPVKLSYKDNKTGQEKSVTSPLDIFLTASSLGRANGVGRIDIVENRY
                     INLKSRGCYEQAPLTILRKAHVDLEGLTLDKEVRQIRDQFVTPTYSKLLYNGSYFSPE
                     CEYIRSMIKPSQETVNGTVRLSLYKGNVITLGRYSETENLYDATESSMDELTGFLPTD
                     TTGFIEIQAIRIKKYGQAKKNNNQELTL"
     gene            complement(<166321..>167505)
                     /gene="TPHA0H00810"
                     /locus_tag="TPHA_0H00810"
                     /db_xref="GeneID:11534067"
     mRNA            complement(<166321..>167505)
                     /gene="TPHA0H00810"
                     /locus_tag="TPHA_0H00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686676.1"
                     /db_xref="GeneID:11534067"
     CDS             complement(166321..167505)
                     /gene="TPHA0H00810"
                     /locus_tag="TPHA_0H00810"
                     /inference="similar to DNA sequence:INSDC:YDL022W,YOL059W"
                     /note="similar to Saccharomyces cerevisiae GPD1 (YDL022W)
                     and GPD2 (YOL059W); ancestral locus Anc_3.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686724.1"
                     /db_xref="GeneID:11534067"
                     /db_xref="GOA:G8BWY6"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:G8BWY6"
                     /translation="MAATDRLMQTNNTLQQSNNAPIRRNTSALNLTLKTDPFKVTVIG
                     SGNWGTTIAKVVAENTELNPHLFVRRVDMWVFEETIDGSKLTEIINTKHENVKYLPNI
                     KLPANLVANPDIIDAAKDADIIIFNIPHQFLPRIIDQLKGNVKPTARAISCLKGFEVG
                     PDGVELLSSYVTKHLGIACGALSGANLAPEVAKENWSETTVAYQIPQDFRGEGYDADH
                     KILKVLFHRPYFHVNVIEDVAGISIAGALKNVVALGCGFVEGLGWGNNAAAAIQRVGL
                     SEIIKFGQMFFPESKVETYYRESAGVADLITTCSGGRNVRVAKNMAVTGRSAVEVEKE
                     LLNGQSAQGVITCKEVHEWLHHCNKLEEFPLFEAVYQIVYNNVPMNQLPDMIEELECL
                     GV"
     gene            complement(<168538..>169872)
                     /gene="TPHA0H00820"
                     /locus_tag="TPHA_0H00820"
                     /db_xref="GeneID:11534068"
     mRNA            complement(<168538..>169872)
                     /gene="TPHA0H00820"
                     /locus_tag="TPHA_0H00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686677.1"
                     /db_xref="GeneID:11534068"
     CDS             complement(168538..169872)
                     /gene="TPHA0H00820"
                     /locus_tag="TPHA_0H00820"
                     /inference="similar to DNA sequence:INSDC:YNL193W"
                     /note="similar to Saccharomyces cerevisiae YNL193W;
                     ancestral locus Anc_2.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686725.1"
                     /db_xref="GeneID:11534068"
                     /db_xref="UniProtKB/TrEMBL:G8BWY7"
                     /translation="MFNINSKKNKKRRELTTQQDYYLEGIDYEQQGERWIHSDIRKSL
                     TNYLSAFMTYEKGISLFKGNGDRKCEYDIKFNMTRISLVIYSEYICNDYGMNLLKYID
                     LENSTLDLNKIVIPLPDIIKNFENVYTEYHDVKTWDFDYNLITSYLSYIENEEMYENI
                     SMEELDSITEKMLMILNELIVTIQQETIQYNEAIASIEQKSNEEEMNDNSFKKEEKIE
                     DESDEYMEVSDTVTNDTLPEVLCIGYKYIIGVFERGIFNNEKVNQLYSALNTIEVHDA
                     KVAESESMIELSKLKEQINGMGLYSHAFETQEEYLNRLSKVDITTTTLVIEFFISTIG
                     DDDVSNKWKLCTQLNKIYNEQLKNNGLQIMYKLLLMLNLLENEIERCKLSAFLKMNEK
                     TTHILEKNCLTMKNNIIKLCDMPSSVDKLNENIIKKLQRQYIKDQATELLSM"
     gene            <170246..>172693
                     /gene="TPHA0H00840"
                     /locus_tag="TPHA_0H00840"
                     /db_xref="GeneID:11534225"
     mRNA            <170246..>172693
                     /gene="TPHA0H00840"
                     /locus_tag="TPHA_0H00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686678.1"
                     /db_xref="GeneID:11534225"
     CDS             170246..172693
                     /gene="TPHA0H00840"
                     /locus_tag="TPHA_0H00840"
                     /inference="similar to DNA sequence:INSDC:YDL220C"
                     /note="similar to Saccharomyces cerevisiae CDC13
                     (YDL220C); ancestral locus Anc_2.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686726.1"
                     /db_xref="GeneID:11534225"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BWY8"
                     /translation="MDSIALLSRITLVNDKFTLYFHDGHVLSHIVLNKSNEKIDFYNS
                     KIIVTLLFKNFNIDLLLDKQPFDYNNIHHRKLIFVSYLFKDNILQELFPLNLTMLKNL
                     IKTRNEDLLNIFKYLISSSLNQNDPFTLEMIIDDMPEELIDMLGSIETNKLAPTRKRQ
                     LSQELENNIEDDDINELIETSSDSDNNSTDNSVYTTPKQYQRKVRKLNANEVAIENME
                     PPKTFLPYPQINTKETKTGKLIAMFPTYFNSMELLKNTKIHLFFIPEEMENEHQRTLP
                     NYELKPNINCIEFVMSVKEMQQVFGKIEDSKSLKTIAFNKDSIIDFQLMKIAYKNNLY
                     SAIWKLKRFRVNTKKKVKKTNSRKNASFLNNVISNFVPSSDPDNAANVNSYNGKPSSP
                     QSDPILQFSGLVLKPGETKYFQLYCILLACSDESHSFLKLTVTDFTKNTMIQQKYLID
                     KFLIDYNNKIDDNEGIRLIMYPNVFKPFNEKVKKLYNKEIKDMFIGTSKNLSDKGILC
                     KMTIKANLYSDKLNAIVRECEPIPVDEFTSLTDHEKFYVEKLYSNTFPRITHYSQRFV
                     LDYYKICFPFEWNNLKLVLTLPVKKNVPILNPHLLNNRERYGNKSIESDFEEDSESED
                     DSESESQEENGEDWKDDFDPENDANETDYTLFDDTSSEMLSSRFTEENDFYKLNQVPL
                     SDRQIYTVKTEIVNVDCNKFYFEYFLRSQDNKDNFVDPRKTINAIINPTRRLKRFFNL
                     TEAESKPDKILQSINSRYASDIKRIINQNFTLKLNRNYILLSKNVKLLTWSLVGVTME
                     ELNPLNTNNTIEVKLEI"
     gene            <173677..>174315
                     /gene="TPHA0H00850"
                     /locus_tag="TPHA_0H00850"
                     /db_xref="GeneID:11534305"
     mRNA            <173677..>174315
                     /gene="TPHA0H00850"
                     /locus_tag="TPHA_0H00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686679.1"
                     /db_xref="GeneID:11534305"
     CDS             173677..174315
                     /gene="TPHA0H00850"
                     /locus_tag="TPHA_0H00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686727.1"
                     /db_xref="GeneID:11534305"
                     /db_xref="UniProtKB/TrEMBL:G8BWY9"
                     /translation="MVRDAKGKEKCKTEPEKGNGFSNLKAGKMKRRNPKQKMLEKNCS
                     SNTENTKKNGRTEKNPTKQKDASNMVDVTTQTLQLYQLQLDNTFGLHNISDHYKVSSS
                     AHEPLEINEKQFSIKSSSSLCSIGDSEPTSKIFEDSNIAHDGLNGFESSLSTDEDPEM
                     DGGDNDINLILVDIDKLIQKMTITANKLLPVMPADDKSCRWKKVPSCCFGLD"
     gene            <176257..>178023
                     /gene="TPHA0H00860"
                     /locus_tag="TPHA_0H00860"
                     /db_xref="GeneID:11534219"
     mRNA            <176257..>178023
                     /gene="TPHA0H00860"
                     /locus_tag="TPHA_0H00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686680.1"
                     /db_xref="GeneID:11534219"
     CDS             176257..178023
                     /gene="TPHA0H00860"
                     /locus_tag="TPHA_0H00860"
                     /inference="similar to DNA sequence:INSDC:YDL224C,YNL197C"
                     /note="similar to Saccharomyces cerevisiae WHI4 (YDL224C)
                     and WHI3 (YNL197C); ancestral locus Anc_2.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686728.1"
                     /db_xref="GeneID:11534219"
                     /db_xref="GOA:G8BWZ0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ0"
                     /translation="MSVISGNSPSMQHTQDISFQEQHTSLSSDLPNPLQLDSMLQTLN
                     LGNTGMSAMNNEFSLPTKRKMIFILRLSGLPSDITSREAHALFALATGTISIELKKES
                     NGNGTEEEHVVIAKFDSFPLVSQYAATINSKTSIFGSDFASKINVEIIDESTNERLSI
                     PNIYHSPNEIKSNNLHAEFMNSFSVPQKSRFSFSNTYSNENENHLPTSQNLSQPDLNI
                     HSGISQSDAGKNFLLQGNDEINDSIWGSNSISSLMNGFSNGGSSAGQLDWASPPAKSA
                     NPMMYMPSGLGSNIAPSHSMDSLSQGQGVPLLHQTNSNILSSSQPQGNFGMRMQVPNN
                     ANTHPMTTNPIPVKGVDMNTPTKNAQYKTTISSTSLTPINNDSKVINNNPANATTPQK
                     SSVRSSGIKDVNSSKVSGSATPSVPNNGTGIVGISQADLSLLARVPPPANPADQNPPC
                     NTLYVGNLPPDATEQELRQLFSSQPGFRRLSFRNKNNNGNGHGPMCFVEFDDVSFATV
                     ALAELYGRQLPRPVISNKGGIRLSFSKNPLGVRGPKSRRSGNAGMTSNNNSTTSFNNA
                     PSNTSDSNSGGNYSYILGYTKN"
     gene            <178973..>180844
                     /gene="TPHA0H00870"
                     /locus_tag="TPHA_0H00870"
                     /db_xref="GeneID:11534220"
     mRNA            <178973..>180844
                     /gene="TPHA0H00870"
                     /locus_tag="TPHA_0H00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686681.1"
                     /db_xref="GeneID:11534220"
     CDS             178973..180844
                     /gene="TPHA0H00870"
                     /locus_tag="TPHA_0H00870"
                     /inference="similar to DNA sequence:INSDC:YNL199C"
                     /note="similar to Saccharomyces cerevisiae GCR2 (YNL199C);
                     ancestral locus Anc_2.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686729.1"
                     /db_xref="GeneID:11534220"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ1"
                     /translation="MDDLDFTSLTGQLKNSNGVIHHQFRSDIFIIRAYKLISQSSVVN
                     GHNMQSVINSPQTSTTTPASTTSSLNNVGSKGMTVSDADNNHSTHSNNSNNNNNNNGG
                     VTSSINNISAQYTTIFVKLAKLYNIIISMGSISDRSSSPKSSMELYQRFKQIIKELDL
                     SYDVSPYAQYFKRIDDGIWQIKEDRELTNDQLWQSITVAILSIYDPRTGQIIYQNRNN
                     FGGKNDINNNDSPNNNFSNNNGIKTNNSPNNIGMNNNGNNGNNNNNNNNNANNNNENN
                     NERNGINSLRTATTNNSPTNFNNDNDNDTQGNDNINKNGNNNINNNDNDITNKGVGNP
                     TINSMLMDASLPQQLQKRLQSISQGMNSRSVNGYYTQPTSPGAYAGFSFNQTEVDPNS
                     QLNYHDPGNVNIWKRKSLSSLDVDTLDDVAVEELLQLTSVNKKQKPNYANGNPNNSNS
                     NAVNVMNFTDGSGNPIFVNSIGSNDFDNSNPVNGNQSMNNHDTKSNFNTATKQPKSKG
                     KARNSRAGVGSRKGKNAKNNSNNNNNNSNSNNNISNSQMNEMNNMASNIMHSDAVSDN
                     MAKQVVSTYNALILEKDQRIIQLERELELQRQETQWLRKMLIEDMGCIRSMLTNIRK"
     gene            <181280..>182008
                     /gene="TPHA0H00880"
                     /locus_tag="TPHA_0H00880"
                     /db_xref="GeneID:11533699"
     mRNA            <181280..>182008
                     /gene="TPHA0H00880"
                     /locus_tag="TPHA_0H00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686682.1"
                     /db_xref="GeneID:11533699"
     CDS             181280..182008
                     /gene="TPHA0H00880"
                     /locus_tag="TPHA_0H00880"
                     /inference="similar to DNA sequence:INSDC:YNL200C"
                     /note="similar to Saccharomyces cerevisiae YNL200C;
                     ancestral locus Anc_2.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686730.1"
                     /db_xref="GeneID:11533699"
                     /db_xref="GOA:G8BWZ2"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ2"
                     /translation="MSNLFTLSSKLAAQLDQELMGPKVGFTLQQLMELAGFSVAQAVQ
                     KEYAIDDLNKNKKVLVIAGPGNNGGDGLVCARHLKLFGYNPVVYYPKRSSRTEFYGQL
                     VKQLDFFNIPILEESDDWLQYLKPEQTICIIDAIFGFSFKSPMREPFGKIVDEVSKID
                     NTIPVVAVDVPSGWDVDEGPTSETYITPSLLVSLTVPKPCSKHIDTAKTSHYVGGRFI
                     PNHFAEKYGFKTFKYQSTEQVMKL"
     gene            <182538..>185018
                     /gene="TPHA0H00890"
                     /locus_tag="TPHA_0H00890"
                     /db_xref="GeneID:11533700"
     mRNA            <182538..>185018
                     /gene="TPHA0H00890"
                     /locus_tag="TPHA_0H00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686683.1"
                     /db_xref="GeneID:11533700"
     CDS             182538..185018
                     /gene="TPHA0H00890"
                     /locus_tag="TPHA_0H00890"
                     /inference="similar to DNA sequence:INSDC:YNL201C"
                     /note="similar to Saccharomyces cerevisiae PSY2 (YNL201C);
                     ancestral locus Anc_2.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686731.1"
                     /db_xref="GeneID:11533700"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ3"
                     /translation="MTVTASTVSFDSDIVVMKDDVDVNGSNNNSNQNVSPSTIKNTEP
                     KRVKVYILENSEWKDTGTGFCMGTLTVEMKNVNNNETKSENRIVSKGDNDEEKSMVKS
                     AYLVVNNEEIPDSLLLKSKLEGTIEYQRQEETLIVWKDVSGKDIALSFEESIGCDALC
                     EFIVQVQRNVEPKISLVAVKTNLDGMGSVHEMIAGPVPLPSNEQQQNESTLLESLKIL
                     NENTSFDFLKNQTVEFILQNNYISTLINIFDNAEKEKLTFDILIVSNIIKTLILYNQR
                     DIIEQLVGDDHIMGVVGILEYDTEFSTLKANHRGYLKENGPTFKEVIAFENEELKSII
                     KKCFRLQFLKDVVLVRFLDGHHLDLILDIIMDLEICIIEFLQADVFLDELVGLYSEES
                     IRTHNSEEDKIRRKDGIKLLHQCVQMTVNLEKISKYAFYKALVEKGLFKVMNYAFNNE
                     TDDNIRIISTDMIITIIEHDILLIHYVQNKQNQCSTGDNKLNDSDAPESDITLLLILS
                     KILLNDKSPGLKEQVMQALYTLLHPEEYMGDNRDLMDEGYNNDDGDDDHNMMNKLNYN
                     VETSALGSDDKYEELHEKNALTETTTFQIKEYFKHFYQQVAPALFKPLLDPTHVLKIN
                     DFQSELLLIHLIKLLCFLCTEHDRGISRQFVLENGILNNISKLMDGNYSIQLKLAVLR
                     CFKNIIYLDDAFYHRYMITNSLYDPVIRLLMNTLDEDNIINSSLRDFFKIIYTSCKTA
                     EPLNSLNDDDTTLDCDTKFKKTNFILLNNHLFQKYPEELTEAKESIQLIKKLELIREA
                     YVTNEVEEPTTELDTSDNDITSYEDKYK"
     gene            <185684..>186733
                     /gene="TPHA0H00900"
                     /locus_tag="TPHA_0H00900"
                     /db_xref="GeneID:11533703"
     mRNA            <185684..>186733
                     /gene="TPHA0H00900"
                     /locus_tag="TPHA_0H00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686684.1"
                     /db_xref="GeneID:11533703"
     CDS             185684..186733
                     /gene="TPHA0H00900"
                     /locus_tag="TPHA_0H00900"
                     /inference="similar to DNA sequence:INSDC:YDL226C,YNL204C"
                     /note="similar to Saccharomyces cerevisiae GCS1 (YDL226C)
                     and SPS18 (YNL204C); ancestral locus Anc_2.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686732.1"
                     /db_xref="GeneID:11533703"
                     /db_xref="GOA:G8BWZ4"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ4"
                     /translation="MSEWKVDPDNRRRLLQLQKIGANKKCVDCNAPNPQWASPKFGIF
                     ICLECAGTHRSLGVHISFVRSITMDQFKPEELVRMEKGGNEPFIEYMKSHGIDLTLPP
                     KIKYDNPIAQDYKDKLTCLVEGTEFVEPEHPDFDASTLTANANSASNGNGNASESENI
                     PLENRRGNTPKLPADQKEKNEAYFNELGNKNQSKPDHLPPSQGGRYQGFGSAPVNNNR
                     GGNADAVSFETLQTDPLGTLSKGWGLFSTAVHKSFDEVTESVIKPSYEQWQSGEMADE
                     TKRAAAQFGQKFQETTSYGFSAFSNFAKTLQDQYSDSFVNMDTTEPSFNNNVPERSKS
                     PVKNVTKDEEDWEQF"
     gene            <187222..>188682
                     /gene="TPHA0H00910"
                     /locus_tag="TPHA_0H00910"
                     /db_xref="GeneID:11533704"
     mRNA            <187222..>188682
                     /gene="TPHA0H00910"
                     /locus_tag="TPHA_0H00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686685.1"
                     /db_xref="GeneID:11533704"
     CDS             187222..188682
                     /gene="TPHA0H00910"
                     /locus_tag="TPHA_0H00910"
                     /inference="similar to DNA sequence:INSDC:YNL206C"
                     /note="similar to Saccharomyces cerevisiae RTT106
                     (YNL206C); ancestral locus Anc_2.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686733.1"
                     /db_xref="GeneID:11533704"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ5"
                     /translation="MSQDLLDKLPATLRGKVEQITRALPNSKEIFDELYTFALAEANE
                     ISKRKVQKPASVPVETAGVDVKEEEIIFNLKDVTVLSPLRKKLNLILHLSTSSRKPVL
                     SLAKDTKIEMTIEDLKTNVKMATFLPVPEKSNIFYIFINYQKAADDVYTEPILATINK
                     AAILDQFKTSGLVEIGEEDFTKCIEFMRKQAIMTGFRISDPFFKVNPDQDVSFHVECH
                     RGTKEGTLYFLPDHIIFGFKKPILLFESADIESITYSSITRLTFNVTLITKDDRKFEF
                     SMIDQAEYSKIDEYVKRKQVKDRSMSEELKAKTSHKNQASQENQVSSLQEAAQQLAEG
                     ENLKDMNLDSDDEEGDVNFEAESELSDGSDDGEDDYGDDDEDEEEGADEGADEGEYNE
                     KTFEEAEKAYQEENDDEGDSEDNDEREDDENDEYMHDFEKREEHGEELESNISPQEGF
                     PVDLGLDDIPIEIDDDEDGDNNNEEDDGENSGVEYD"
     gene            complement(<188834..>190123)
                     /gene="TPHA0H00920"
                     /locus_tag="TPHA_0H00920"
                     /db_xref="GeneID:11534192"
     mRNA            complement(<188834..>190123)
                     /gene="TPHA0H00920"
                     /locus_tag="TPHA_0H00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686686.1"
                     /db_xref="GeneID:11534192"
     CDS             complement(188834..190123)
                     /gene="TPHA0H00920"
                     /locus_tag="TPHA_0H00920"
                     /inference="similar to DNA sequence:INSDC:YNL207W"
                     /note="similar to Saccharomyces cerevisiae RIO2 (YNL207W);
                     ancestral locus Anc_2.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686734.1"
                     /db_xref="GeneID:11534192"
                     /db_xref="GOA:G8BWZ6"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ6"
                     /translation="MKLDTSHMRYLAPDDFRTLQAVEQGSRNHEVVPIQLIFQLSGLK
                     SQSGTNRSLGDLAKLKLVSRLRNAKYDGFRLTYNGIDYLALKSLLNKDTVYSIGGTIG
                     VGKESDIYEGSDKNGNKRVLKIHRLGRTSFHTVKNNRDYLRRSNQGTNWMNLSKLAAN
                     KEYQFMSLLYTKGFKVPEPFDNSRHVIVMELIRGYPMRRLRKHKDIPKLYSDLMKFIL
                     QLANSGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHKDADFYFKRDVDGI
                     RRFFKKKLKYEPECDSTMFDTDGFGTGYKYPYPVFSRDVKRSDNLDELVQASGFSKKH
                     PGDRDLEEAVGSMRKHDYNLEEEDEQSENEEVEDEESEDEEEEYYYTESDEGSGDEDY
                     DSSADSLESENERIIEALSTGVGNLKMDKLGNYILED"
     gene            complement(<192292..>194943)
                     /gene="TPHA0H00930"
                     /locus_tag="TPHA_0H00930"
                     /db_xref="GeneID:11534193"
     mRNA            complement(<192292..>194943)
                     /gene="TPHA0H00930"
                     /locus_tag="TPHA_0H00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686687.1"
                     /db_xref="GeneID:11534193"
     CDS             complement(192292..194943)
                     /gene="TPHA0H00930"
                     /locus_tag="TPHA_0H00930"
                     /inference="similar to DNA sequence:INSDC:YLR045C"
                     /note="similar to Saccharomyces cerevisiae STU2 (YLR045C);
                     ancestral locus Anc_5.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686735.1"
                     /db_xref="GeneID:11534193"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ7"
                     /translation="MSNNDEVDFSTLPLEQKLDNKVWKARLLGYEELTSKFDNKNIKI
                     KEFNIYLKDVSLFQIYLSDPNVIALEKAIGALLSLLQKYYTGHTADVQKLISIESLIE
                     NWIPLLIEKGITSSRLLTKKNSIKCILLITSFDISIEKIMEFTIINFLKVKKLPKVIL
                     SSLITITNLINNFKFDHIELNKIFNNPNSFLIELLEVLPTFTSNADKNIRSQSIDLIL
                     QIYDKIGRNKLLIQDILLDKLKSIQQRDLDKLFDKLNSGEELKAISNSSANLDDEIIY
                     FYTDYKNNVAKQDFQVDDDGDTNMDINATLNSAKNTKLGNSNNNNYNITKNKVDVDPF
                     TLLKEETILDKLPENFNERIASVKWKDRVEVLQELHDNLLVKVKKLKNSGQDYSNLIS
                     ILSSIIHKDANVQAVTIASQSICIILEKLRLPGFNKALVNICFVPLLERTKEKKPSVI
                     EAIRSTLYILVKYYNPISNGSKSMNLNNEDMLQEILKFMKNKIPQIRFETTNLFNHIL
                     KHYFRNDSERILSAYLDSDILPIVIKIVNDTQPTIRASGFEAFALISKIFSNNDEIRD
                     SYEKFDSMKKKKITELINTLPNILENIPESREKTGTTTSSSMNNSNSNSLLPSKRGPS
                     SPLKKLSNKANSPLHMTQSPVIALPNITLKNGNLSNNNLNGNIPNNMNSNLFSINNKR
                     SNTEDNQIENEEKRIKLEIEVENLKKEKHVWLKEKHELIDQLNNVQNKYNVLMNEIEV
                     LKEQLKNSQTTLHDKNLQLRQKDLQLNKLQDRMSHMAELNGNTPTNRRSSLLAHSQAP
                     SRTMSARPTLSSERSHINENHEHNNHTRKDSTSSEDLPHRVDLLKIDSNANVNDTFVN
                     EESWKRAAEVTSQLKARIERMRAKTRE"
     gene            <197104..>197424
                     /gene="TPHA0H00940"
                     /locus_tag="TPHA_0H00940"
                     /db_xref="GeneID:11533715"
     mRNA            <197104..>197424
                     /gene="TPHA0H00940"
                     /locus_tag="TPHA_0H00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686688.1"
                     /db_xref="GeneID:11533715"
     CDS             197104..197424
                     /gene="TPHA0H00940"
                     /locus_tag="TPHA_0H00940"
                     /inference="similar to DNA sequence:INSDC:YGR209C,YLR043C"
                     /note="similar to Saccharomyces cerevisiae TRX2 (YGR209C)
                     and TRX1 (YLR043C); ancestral locus Anc_5.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686736.1"
                     /db_xref="GeneID:11533715"
                     /db_xref="GOA:G8BWZ8"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ8"
                     /translation="MVAQIANAQEFEQKVANAPAGKLVVVDFFATWCGPCKMISPMVD
                     KFAVEYDAAEYYKVDVDEVGDIAQKYDVTAMPTFLYFKDGKEIARVVGANPAGIKQTI
                     ASNL"
     gene            <199181..>200872
                     /gene="TPHA0H00950"
                     /locus_tag="TPHA_0H00950"
                     /db_xref="GeneID:11533716"
     mRNA            <199181..>200872
                     /gene="TPHA0H00950"
                     /locus_tag="TPHA_0H00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686689.1"
                     /db_xref="GeneID:11533716"
     CDS             199181..200872
                     /gene="TPHA0H00950"
                     /locus_tag="TPHA_0H00950"
                     /inference="similar to DNA sequence:INSDC:YLR044C"
                     /note="similar to Saccharomyces cerevisiae PDC1 (YLR044C);
                     ancestral locus Anc_5.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686737.1"
                     /db_xref="GeneID:11533716"
                     /db_xref="GOA:G8BWZ9"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8BWZ9"
                     /translation="MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMR
                     WAGNCNELNAAYAADGYARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP
                     SLSAQAKQLLLHHTLGNGDFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQ
                     RTVYLGLPANMVDLMVPADVLNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILA
                     DACASRHDVKAETKALIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAV
                     ESADLILSVGALLSDFNTGSFSYSYNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLV
                     AQVGSVVKGYKPVAIPAPVPANPATPAETPLKQEWLWNQVGKFLKEGDIVLTETGTSA
                     FGINQTHFPTNTYGISQVLWGSIGFTGGATLGAAFAAEEIDPKKRTIVFIGDGSLQLT
                     VQEISTMIRWNLKPYIFVLNNNGYTIEKLIHGPTAQYNEIQNWKHLDILPTFGAKDYE
                     TIRVATTGEWDKLASDKAFNENSKIRMIEIMLPVMDAPSNLIAQAKLTAATNAKQ"
     gene            <201187..>202617
                     /gene="TPHA0H00960"
                     /locus_tag="TPHA_0H00960"
                     /db_xref="GeneID:11534201"
     mRNA            <201187..>202617
                     /gene="TPHA0H00960"
                     /locus_tag="TPHA_0H00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686690.1"
                     /db_xref="GeneID:11534201"
     CDS             201187..202617
                     /gene="TPHA0H00960"
                     /locus_tag="TPHA_0H00960"
                     /inference="similar to DNA sequence:INSDC:YGR212W"
                     /note="similar to Saccharomyces cerevisiae SLI1 (YGR212W);
                     ancestral locus Anc_5.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686738.1"
                     /db_xref="GeneID:11534201"
                     /db_xref="GOA:G8BX00"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:G8BX00"
                     /translation="MKLRELSGTEKFFFSRSVLNLHTCFYVTVKLNKLPTENELCSSL
                     RKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIEYRDWNKFEEDEQNSVFQE
                     INFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSATLFWKALLLELSSIDRDQLED
                     TDVVFSKANIDDNYITALDISSNNLLDDCPISFASKIKRFIASKIFQYFPYTIIAPNS
                     ELLQFDDYSFPSSIFEDGCDKPASYKLKNNSRRAIINIKPAQISNVLKYCRSKNIALT
                     SYLSALISYYVNIYKDKSVNHGSAIKVEIPINLRGILKEKLEMDIAPDFGCYISSTDL
                     VIDSQLNGSTIDKLASTFQKQISNSVKENVDETIENIKITEVIDSFKFFEYKVTPKPS
                     EDKIFPGATFEVTNLGRVSFETKNDNFFVEDALFGGSQSLTTIFTCYVISTDFGGMNL
                     AITYSDSIKDFMEPVIEKCKAELLSL"
     gene            complement(<202736..>204895)
                     /gene="TPHA0H00970"
                     /locus_tag="TPHA_0H00970"
                     /db_xref="GeneID:11534202"
     mRNA            complement(<202736..>204895)
                     /gene="TPHA0H00970"
                     /locus_tag="TPHA_0H00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686691.1"
                     /db_xref="GeneID:11534202"
     CDS             complement(202736..204895)
                     /gene="TPHA0H00970"
                     /locus_tag="TPHA_0H00970"
                     /inference="similar to DNA sequence:INSDC:YLR047C"
                     /note="similar to Saccharomyces cerevisiae FRE8 (YLR047C);
                     ancestral locus Anc_5.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686739.1"
                     /db_xref="GeneID:11534202"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:G8BX01"
                     /translation="MFNRHWDFNWNNVYSSLYNAQDCLKIRCAARTTFLVSLTFVCIL
                     LPLFHSLALTKKFYKLNHNFNHHFVYQHLNWLHDLTLYHNKSVHITLFWSCFVGFATF
                     YNTNGELNHIAKRSGRISIALLPAILILTLRPSPLPNLLYLSLLPYHKWISRILIVES
                     FLHCGLYVWWFASCNTMSKLWKFTNICGILAFIAFFVIGITSVNKFRRMNFKLFYCIH
                     YVCTWTSIVLLYLHSKPSILYYFCFCVVILLYQVYYRLSHTKKTKITITCISPTISLL
                     EFPKEYLSNKPILPATHVRLNLVRRNPFANLVNNFIIPFQHPFTIASLPNDDAVQLIV
                     RNGRTLPLETNSSYYITGCFEPMIDFISKRRENNLWATIINYFDNNSNTGNNDTYLTY
                     SSNIQDANTLNIMSQALPSLPFQVNSLPLLSSPLRYKINATRVFMVVGGTAISFALPV
                     LRILNFNGVHTRLIWVTRDYQDLQVLNHFKNNFEGLEVYVSGKNSIDYVEEYNRLQEN
                     KKAPNTETMANGNLVETESENDPLLSGNVKTTFGAIADKDDEIDFTETFSRKKSIKDL
                     KKLAKRKKANENVFREQTVIEPPNSTYATDEDFDSSNHSYSNVSPNKDTEANTVASSN
                     VTRSILRKIRIPAGIKVSFGRPVLNNSHYNWCLEKECIGPSEHNLCCHPNSENSSHVD
                     DLANVWVVAAGPNSLIENTNRWATDGGLHFYAEAFAV"
     gene            <205748..>206509
                     /gene="TPHA0H00980"
                     /locus_tag="TPHA_0H00980"
                     /db_xref="GeneID:11533753"
     mRNA            <205748..>206509
                     /gene="TPHA0H00980"
                     /locus_tag="TPHA_0H00980"
                     /product="40S ribosomal protein S0"
                     /transcript_id="XM_003686692.1"
                     /db_xref="GeneID:11533753"
     CDS             205748..206509
                     /gene="TPHA0H00980"
                     /locus_tag="TPHA_0H00980"
                     /inference="similar to DNA sequence:INSDC:YGR214W,YLR048W"
                     /note="similar to Saccharomyces cerevisiae RPS0A (YGR214W)
                     and RPS0B (YLR048W); ancestral locus Anc_5.116"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="XP_003686740.1"
                     /db_xref="GeneID:11533753"
                     /db_xref="GOA:G8BX02"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /db_xref="UniProtKB/TrEMBL:G8BX02"
                     /translation="MSLPATFDLTPEDAQLLLAANVHLGARNVQVHQEPYVFNTRPDG
                     VNVINVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKYAAHTGATPIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDFQAIKESSYVNIPVIALTDLDSPSEFVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWTIMPDLYFYRNPEEVEQQATEEA
                     SAVAEGEEADVAEEVAEDQAEASEWAEETTENANW"
     gene            <206980..>207294
                     /gene="TPHA0H00990"
                     /locus_tag="TPHA_0H00990"
                     /db_xref="GeneID:11533754"
     mRNA            <206980..>207294
                     /gene="TPHA0H00990"
                     /locus_tag="TPHA_0H00990"
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /transcript_id="XM_003686693.1"
                     /db_xref="GeneID:11533754"
     CDS             206980..207294
                     /gene="TPHA0H00990"
                     /locus_tag="TPHA_0H00990"
                     /inference="similar to DNA sequence:INSDC:YGR215W"
                     /note="similar to Saccharomyces cerevisiae RSM27
                     (YGR215W); ancestral locus Anc_5.115"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /protein_id="XP_003686741.1"
                     /db_xref="GeneID:11533754"
                     /db_xref="InterPro:IPR013219"
                     /db_xref="UniProtKB/TrEMBL:G8BX03"
                     /translation="MSVSRGKLQKVAELSAKIFDQVYNPTNVRTGNKILSKRLKGPSI
                     KQYYGNPDVLKFKHMKTLYPDMKFTDPDEEYRLSMVELRKRRGKGTPAKAKAPSDKKK
                     KK"
     gene            <207941..>213319
                     /gene="TPHA0H01000"
                     /locus_tag="TPHA_0H01000"
                     /db_xref="GeneID:11533732"
     mRNA            <207941..>213319
                     /gene="TPHA0H01000"
                     /locus_tag="TPHA_0H01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686694.1"
                     /db_xref="GeneID:11533732"
     CDS             207941..213319
                     /gene="TPHA0H01000"
                     /locus_tag="TPHA_0H01000"
                     /inference="similar to DNA sequence:INSDC:YGR217W"
                     /note="similar to Saccharomyces cerevisiae CCH1 (YGR217W);
                     ancestral locus Anc_5.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686742.1"
                     /db_xref="GeneID:11533732"
                     /db_xref="GOA:G8BX04"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="UniProtKB/TrEMBL:G8BX04"
                     /translation="MDNKSKRLNNGDRSHIPSIFLESNDDATVIEGRSDWRRPIHSSP
                     SNDQYKIDDDSNSNSIDIYASGYTIAEVDTSEFGVSFQENGRRRAGSSSEYNEKFSEL
                     MKTAKIALSKNVNRFSWLPNDSASSIEYNKKLSGFSVDNSREYKEFSDSHNPFQRDHG
                     LKDELFEEIREVVSETDSKYTTKSLYGNSLFLFAPGSRIRRFLFRLHNNSKYRNFITT
                     LTFVLMVFLAVRVTNPSDFHFLYSKKSGIDWFVGLMYVVFTFNDFTAVITYGFWNDSE
                     LCMENNIQYVTLLRQLGIISLFNSIKQRYRIQSDKFRWMKIMNFADKPIYISKQNDNL
                     EQSLSIKRAFLRYPRGILQLISTTAFWLGLFFSGSKNIGAIAFFRSLATIRILLLLSL
                     DNGIYAILGRLITIFPQLTKILFIWIYFWVYFSILGTSFFSGSLRRTCVWTNPDDSND
                     IYKNDSCFCGGYMNLLNGTTESFEYSNGILSGVAKGFICPQNSKCISDTNPYNNKISF
                     DNIANSMELIFVIFSANTFTDLMYDLIGSDTLAIAIFFMASILILNVWLLNILIAQLV
                     SSFELFEWKKRHVGVNKSIKKRIFSTQTITRLKKYIENKKIKGRLPNWSLRCEYFYKK
                     VERIFILLIVFNLSIRSTVDESSTESYLEYVLKYELSFNYILLFESLYRLIIYSPNIW
                     IFLSKIDYVIDLIIALITTISSTVHLYHNIGQVYNWLLFFNVLRFYRVVTIQFLFGSI
                     WKDMLPYLNDIFNLSKLYYGATFLLSITASYLFLGIIPDSVSDDIQFGSYTLRNSFVS
                     LLTVSSTENWTEVLYEFQGNSPTSFHAFLTAIFFIVFFVIIHIIIINTAVAIISSGLA
                     SRESEKRQLQLKHFLHTELPNQLQALRNVSLLEKLKQKVFKQDKEEQNEFQNLIFTGE
                     AISLISSQIYLNENTDQAEDANKVNQDSIFTNIWQTLKSKVLSNQFFLILYDYYKGPR
                     LKNNFDYLNFNVSDILSYDSRNNYNFSEIKNFMSRYPNYDNSYFLFGPKNFIRKVCQW
                     LVPSSSGIRWNLQSNKTFADSFNKKPNIAITLCRDTFSVIVFIASISLVILNVISPVI
                     SSDPSFSEKFTWQNIIYIAVAICFSFEFLIRTVADGFIFGPNAYMNNNWNKFDFVIFV
                     YIVSDVITIFYGDAGIASAFKTFTILRIIRYISISSHAREIFSIVLFDGLKVICKAAF
                     ISFCFLYPFSVWGLNLFRGKLNTCTDLSVDMTNCINEYKSKVFKFDIVAPRVYAEPYL
                     NFNSIADSLRSLFEIISLEGWTDLLTNLMNSSGKGTVPYKFATPVNALFLLPYNMIST
                     IFIVTLFISLILNNLSRTTGIDYESVDQKSWSGTRKLLTRTSPLYEPDINKKNKRRQF
                     FYMLTIEKKSMPYNIFMDSVMLIHIVLLTAQYYEDFLTNANSLVVGFFLTSLTLLIDQ
                     LLFIYSFGFKKYFKNKWKGCKFTIIYTSWILSAIDLNINNQQYITKSFSRFCYSNIYL
                     LLIPRIDILLQICEIALASFSQILSLTYCWFILLLSYSIALHQFFGYTKFGANTTYNV
                     NFRTIPKAMILLFRMSFGEGWNYIMDDMKLEPPYCSYVDGTSDCGSVVYAYLILISWN
                     ILSMYIFLNMYTSLIVNNFNYTYSRDTLRTGIQLSDIRKFQRGWAKFDKAGCGTISFM
                     LLPALMHSFDGSLSFKIWDDHLSIKRIVNECMTLVDSDPYNVKFHYKKTKDLLNGIDC
                     KNIIKTKRRYNEFIYYIKIKCSYDNTLKFKDLINIIPLFTTYDPNKCLSIKNYVQYLS
                     ILAEVEKK"
     gene            <213903..>217121
                     /gene="TPHA0H01010"
                     /locus_tag="TPHA_0H01010"
                     /db_xref="GeneID:11533733"
     mRNA            <213903..>217121
                     /gene="TPHA0H01010"
                     /locus_tag="TPHA_0H01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686695.1"
                     /db_xref="GeneID:11533733"
     CDS             213903..217121
                     /gene="TPHA0H01010"
                     /locus_tag="TPHA_0H01010"
                     /inference="similar to DNA sequence:INSDC:YGR218W"
                     /note="similar to Saccharomyces cerevisiae CRM1 (YGR218W);
                     ancestral locus Anc_5.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686743.1"
                     /db_xref="GeneID:11533733"
                     /db_xref="GOA:G8BX05"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BX05"
                     /translation="MESILDSNKDFDIQLFDRVVEAFYKGHGKEQNDAQTILTKFQAD
                     NNSWQRTDQILQYSENIQSKFIALSILDNLIVSRWNMLPNDQKINIRTFIVGMILSVC
                     NDDSLFNSNRELINKANLVLVQIIKKDWPARWSNFLPELIDSSKYSENICQNNLEILK
                     VLAEEIFEYSSEKLTQAKVIKLKVSMTSEFPLIYEFCHDILANTDSSRLINSSLNTLL
                     CYINCFPINYIFDSNILDLLSLQYFPEPETRLVALKFLTEVSMLNLNGNKTYLEKIIK
                     SIENVMNITASNLIQPDCDLSVIYNEFNISDQRFFRNFTIYLTTFLQNYREFCDENRS
                     FDDLMIALHICLMKLSYINEKENFKIVLDYWHNFVADLYHEIQRLPIFDLATAASSGA
                     VNPSFYKNFPLTKHRYDDICSQLRVLIVEKMARPEEVFIVENDEGVIIREYMKDSDII
                     QTYNTERSTLVYLTHLDVRDTEKIMLDKLLKQVDQSEWSRQTLNTLCWAIGSISGTMV
                     IDEERDFIISIIKYLLELHDKIEGGDNKRIVSSNIMYVVGQYPRFLKSHWSFLKTIID
                     KLFEFMHDKNSGVRDMACDTFIKISQKCKGSFLTTQPYQSDPLIETIISDIINITCDL
                     EPQQVLIFYHACGIIVAVQGKQATRRQLLSNLLELPNTTWSLITKKHGLNTNEFWDME
                     KIKIVANIIRINTVVCSELHTSFCTQLIHIYPYLLKIYDSITAIISEKISTNGDSVIK
                     TPFLRGLRTIKKEILKLVLSYVSEATNLNDVVEDLIDPLLPLVLRNYIDSTPNARDYE
                     VLSCMAGIVKRIGHENPKISLIIFRNIFETTLDMINKELVEYPEYRIEFYKFLHSVTA
                     VAFSIFAELPAFEFNLFMNSIFWSFKHKILEVELEGLQITIELLHNFENMEGNEQFKS
                     YFYRTYYCTILSEVFYVITNLEHKSSFSKHCILLMKLFKLVENNLIKVSLSDDNLTII
                     SNQEYVHNFLRNLFTNNFPQLSQKQIELFLSALIKNVNEHIRFKGILRDFLVQIKEYG
                     GDPVDFLLEEDNEETNQNLLLNADMFLIAGMQRPYEIDDVEM"
     gene            complement(<217352..>219346)
                     /gene="TPHA0H01020"
                     /locus_tag="TPHA_0H01020"
                     /db_xref="GeneID:11533845"
     mRNA            complement(<217352..>219346)
                     /gene="TPHA0H01020"
                     /locus_tag="TPHA_0H01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686696.1"
                     /db_xref="GeneID:11533845"
     CDS             complement(217352..219346)
                     /gene="TPHA0H01020"
                     /locus_tag="TPHA_0H01020"
                     /inference="similar to DNA sequence:INSDC:YGR221C,YHR149C"
                     /note="similar to Saccharomyces cerevisiae TOS2 (YGR221C)
                     and SKG6 (YHR149C); ancestral locus Anc_5.107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686744.1"
                     /db_xref="GeneID:11533845"
                     /db_xref="UniProtKB/TrEMBL:G8BX06"
                     /translation="MLDLDTYESTLNGYDKTEAMTTVYVTLIERAITSSAASTTVTTS
                     STKSKASATCTGSRAECTHKKNNSQALTVGLAVGIPVGVTFLLLCVILYFVFKRYKKE
                     DEKHEQEFEGDITYLSNHIGSRPYSSNSSSNSREFKEKDGSITDTNDNTPNPFLNSGD
                     VLQVPHGIERGSIISYAKQLPDSNIGGWKIATKSNISSNSLYGSRKNSSTSILKTLSE
                     NNNYRPPIGKNSSTLSLGAHQSELLREKEGSTKLSNTSTYVNSKDISIEMGQHALDVE
                     AINDYSDIVSNSTELEHINRIRSIYEIYLENFEDENSESHLSFNNEARVIHSDTNSSN
                     SINELSSVTISSSDSLMRPEILQNDNSQSTLDTSSSNTIDNKKDIHELKAPLGKIQFT
                     NESNETNHLQTPNNSTQSRVASSVYSGTYILPPNDEALLYKPINFEEVGSANNEQVSI
                     KGLEENSQQKIDKQQYHQLYYQQGPQQYHHPQTMEAYEQLPTPSKLLYSDSIQSFTSF
                     KGRKKYQPLVKLKAARLQGTSLNPMDHPDMFYNHTLDSQSIAQDQASCYSGLSKSTVP
                     LPYQLRQSIVMTDPSVLTIASKYKAAGSFRKIQDMNSRNNSLVSQGHPLHIYKPRVSG
                     LLDNFDVLQPQSIGQVLPHHGSNEDLRKQLGTSQNYNIDI"
     gene            complement(<220884..>222269)
                     /gene="TPHA0H01030"
                     /locus_tag="TPHA_0H01030"
                     /db_xref="GeneID:11533846"
     mRNA            complement(<220884..>222269)
                     /gene="TPHA0H01030"
                     /locus_tag="TPHA_0H01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686697.1"
                     /db_xref="GeneID:11533846"
     CDS             complement(220884..222269)
                     /gene="TPHA0H01030"
                     /locus_tag="TPHA_0H01030"
                     /inference="similar to DNA sequence:INSDC:YGR229C"
                     /note="similar to Saccharomyces cerevisiae SMI1 (YGR229C);
                     ancestral locus Anc_5.100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686745.1"
                     /db_xref="GeneID:11533846"
                     /db_xref="GOA:G8BX07"
                     /db_xref="InterPro:IPR009203"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="UniProtKB/TrEMBL:G8BX07"
                     /translation="MDLFKKKVKELFYTYSTSDHYAEYDPNSTPNFNMNSRSGNRNQS
                     KVYLNSNNTYSNSGVDEEMGYHDNAEAIDIENFNANDNEGVSEVILAWTHIDKWSSEN
                     NPDLNATLDDPCTHNDVLRAEEDLDIIFPPSVRASLKIHNGQEDLESITGTSGLVYGL
                     QLMKLDEIVHMTQTWRNVAASLKRRQEQQQSRQRAQEGSSSTQGQSQSQFKLANIPEQ
                     KSIPPHAIQPVYANAGWIPLLTDLAGNHVGVDLAPGELGKYGQVIIFGRDFDTKYVVA
                     NNWGIFLLSFANDLEVGNWYLVDDSDDYLNGDGELAFRDKSRNGPIKEYLDVLKDRAI
                     GSYKVLIQAAQHAQETTQNTNVPTEKAPSRVVSESVNNFNDEEMIMTEDEEEPAKEEP
                     VEEEPVEEEPVKKGPVKKEPVKKDPVKEEPVEEEEAEEEAVKEEVIKDEKSKETEDID
                     NLKKDLENVAL"
     gene            <223391..>223765
                     /gene="TPHA0H01040"
                     /locus_tag="TPHA_0H01040"
                     /db_xref="GeneID:11534043"
     mRNA            <223391..>223765
                     /gene="TPHA0H01040"
                     /locus_tag="TPHA_0H01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686698.1"
                     /db_xref="GeneID:11534043"
     CDS             223391..223765
                     /gene="TPHA0H01040"
                     /locus_tag="TPHA_0H01040"
                     /inference="similar to DNA sequence:INSDC:YGR230W,YHR152W"
                     /note="similar to Saccharomyces cerevisiae BNS1 (YGR230W)
                     and SPO12 (YHR152W); ancestral locus Anc_5.99"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686746.1"
                     /db_xref="GeneID:11534043"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:G8BX08"
                     /translation="MGAAKFIEKESSSNVATKNTNENSNKNNEIKSILVKKPFSLQKA
                     LFDKKHPSHAIKKYNSKSEKQNKNNLRDKFASPTDRLLSPCSKKLNDHKSKLFKVNSV
                     PTKLTFNQKNESDDYDSDLSDS"
     gene            complement(<224052..>227420)
                     /gene="TPHA0H01050"
                     /locus_tag="TPHA_0H01050"
                     /db_xref="GeneID:11534044"
     mRNA            complement(<224052..>227420)
                     /gene="TPHA0H01050"
                     /locus_tag="TPHA_0H01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686699.1"
                     /db_xref="GeneID:11534044"
     CDS             complement(224052..227420)
                     /gene="TPHA0H01050"
                     /locus_tag="TPHA_0H01050"
                     /inference="similar to DNA sequence:INSDC:YGR233C"
                     /note="similar to Saccharomyces cerevisiae PHO81
                     (YGR233C); ancestral locus Anc_5.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686747.1"
                     /db_xref="GeneID:11534044"
                     /db_xref="GOA:G8BX09"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BX09"
                     /translation="MKFGKHLEARQIEIPEHNGYFIDYKSLKKLIKQLAFTSVKPTDE
                     SNAVDELADTEDNNIDGMNSFDESIIYKRLQENQSSFFFKLERELEKVNSYYLEKELN
                     LHIKYDILQKKFDKYKNRGKLTSKDTTSYKIFLGGIKKFQKDLDNLEQYVKLNRTGFL
                     KVLKKWDKRSHSQQKEFYFATVISVQPIFTKNDISVLNDSILTLLITLDEICSQSYAN
                     PNGSNMTRNSIRGSVDHEGIASLMRDTKKNDTVNTVHDELTDRHSPINVVNNQITDDT
                     NNLQLANFDYEMEIESEIEDWYKELIYIDKIKDETRKKNMLTSFFDNKIKYNVEQLNK
                     NNEVDLNIKFRDSTSKLFSLLIDSELSDDALQTFYESVKLHIDLAYFDESDVVFSRRN
                     ILHESARCMAHSRHFILQEAFKRLPTEVFRKLLNAKDSHLRIPLHYASEFGKLEFVKL
                     IIASQLLNSVDDLDNNSHTPMSLAIINNHNDIVKTLLLEGNAKPSPESDESSNPQFAP
                     LIIACESNNYDAAKLLLQIGSIEVNKTTDYIGLGCLHIVAKRGGSKELIKLLISNGAD
                     ANGIDEFNKWTPLIYAVQEGHSHVVTELLDNGADAEITDENDRGPLFYAIWEGHINVL
                     NLILKKLNSSDIRKRVPSTNGTVASNTIKLDDDFDEIPDFALPPPIIPLRKYGHNFLE
                     KKTFVKIILKSNQDFIKFNQDDGVLSLQPGRITLTSNSPESFPRNIILPIKEEEDSEI
                     IFQVDSFEKFNVDFEIYPSYGTRLLAKTTVIPNMLNLQSLDGTGTASMPLFDYKLKYI
                     GTLTVDYQIIFPCNIVKPLDISKYETYWKSTTSDNTINNSIHEFVTSSSLKGSYLSVK
                     VSSLRDGTVVVTPSVYLLVGGVNIFMLDLDKEQLERIIGYDIEKIPEFNNSNDLKHYL
                     KDKVVTLEKLLATSSSSIQLDIQVAYPTEQEFGKVLLSGTKVVDLNSYIDTVLLTTFE
                     HIRDLRHSGKSLRSIMFSSCNIQACSIINWKQPNFAVIFIINSLYKLNNEFIMDTAHR
                     LRTIMPKFDTVLDKDDGYYCIHEKIKLSANNNLLGIVIPNEILQISPQLAEIIRANGL
                     LLISSNVDHSESVSIDDNINGVLVDSELEFSRIN"
     gene            complement(<228531..>229085)
                     /gene="TPHA0H01060"
                     /locus_tag="TPHA_0H01060"
                     /db_xref="GeneID:11534014"
     mRNA            complement(<228531..>229085)
                     /gene="TPHA0H01060"
                     /locus_tag="TPHA_0H01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686700.1"
                     /db_xref="GeneID:11534014"
     CDS             complement(228531..229085)
                     /gene="TPHA0H01060"
                     /locus_tag="TPHA_0H01060"
                     /inference="similar to DNA sequence:INSDC:YHR153C"
                     /note="similar to Saccharomyces cerevisiae SPO16
                     (YHR153C); ancestral locus Anc_5.95"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686748.1"
                     /db_xref="GeneID:11534014"
                     /db_xref="UniProtKB/TrEMBL:G8BX10"
                     /translation="MNIINENFISTESVHLCIVTIDCSKLFENQNNVNTKTFQETLLS
                     ELIELVIYLISKNVVPKQSKYKQLISLNFKKLFIPLSLWNDILSIALERVNLSNAYDI
                     FITESTTQNKEKYISKNSRLMNFINSNKTEADLFKDIDYENILKLSLLEAFKENNITE
                     DDEMNQILEEFHNLEEIILFQQEN"
     gene            <229632..>232679
                     /gene="TPHA0H01070"
                     /locus_tag="TPHA_0H01070"
                     /db_xref="GeneID:11534015"
     mRNA            <229632..>232679
                     /gene="TPHA0H01070"
                     /locus_tag="TPHA_0H01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686701.1"
                     /db_xref="GeneID:11534015"
     CDS             229632..232679
                     /gene="TPHA0H01070"
                     /locus_tag="TPHA_0H01070"
                     /inference="similar to DNA sequence:INSDC:YHR154W"
                     /note="similar to Saccharomyces cerevisiae RTT107
                     (YHR154W); ancestral locus Anc_5.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686749.1"
                     /db_xref="GeneID:11534015"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:G8BX11"
                     /translation="MSRLFEHISFLVVNTQKENTTKNEKLKTLLHDHGCLSCKAVSNI
                     EISSIGVINQKSQFMQFMNNKKIHFIVADSIDFSFYKIATFDYLIPVVTEDWVYKCIE
                     VNKLVKTNSFSPDEKLIFKNYQIFLSLNSFNKTEVLFYSELINALGGTTVDHISTLTT
                     HLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNESDHLINIQSSAEDS
                     KNRLQDLWNMVEESQPLRTLNILNQHKFYLGMDLLFEKNLYNYLISYIEWSGGEIVRH
                     INENDFYSKKADCYIGFSTKSREYKVAESLQILTMSIPWLFHTWEMETFVDATSKIFL
                     KPFKKKIFERSQLILAYTNYFGPQRYYIQRLTRLMGGIASTDLSKKNTHLIFGSPHGK
                     KYDFAMRRPNILVTTNHSWLEDCYISGEKLDANVAKYKSNECNELLSASLGQSVNCTY
                     GKSPLSFNLQPSSMVSDSCKEKSPIENKSEENFVNAETYKADDVQNHFLKYSDKFLDS
                     NLEDDKNDKNDKNDKNETVNECLSDPDIEDNMETSIKHDGNFVFISEDVNELSQNNSQ
                     LATQVSTQALSPIKKNLNNSDFVDQPPVTSEITSSIALHVSKLNPEEKLEQEKGKSTI
                     EVASGRPGNDSSLNPSRLEVIYTENHISNTKLANGSHLDEEFRKKENPIDNEHKIEVN
                     FDENDNEVNYRLLSGSRAAKAKAAKRLHTDIESLNQFQKNSKKKRTGDLLPEELSLLE
                     KEKALDQEAKSILLKVLPTELGNIISSITSSNPLRSKLVYNIDAICTGCLDYISDLDK
                     KLLYYLGVRIYDEIENDNYNHLNTIIAPKRMRTAKYLKALSFRPLKYALMPDFITLIL
                     KEIHSGKIDLNLKVDLTKYYIAGVSPEVLRKTHLHKKIFDRSNMKCINVMNDIQGGTD
                     VISSILHAHGIEKVKTIKNNFTINDLIKNDLSNASSNKNLEKNNEFEYIILTTKSSQV
                     KRFKKLLNDVKSNGLAVNWEWCAKSILDLEVDFKDKKIHLVSK"
     gene            complement(<232804..>235290)
                     /gene="TPHA0H01080"
                     /locus_tag="TPHA_0H01080"
                     /db_xref="GeneID:11534059"
     mRNA            complement(<232804..>235290)
                     /gene="TPHA0H01080"
                     /locus_tag="TPHA_0H01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686702.1"
                     /db_xref="GeneID:11534059"
     CDS             complement(232804..235290)
                     /gene="TPHA0H01080"
                     /locus_tag="TPHA_0H01080"
                     /inference="similar to DNA sequence:INSDC:YGR238C,YHR158C"
                     /note="similar to Saccharomyces cerevisiae KEL2 (YGR238C)
                     and KEL1 (YHR158C); ancestral locus Anc_5.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686750.1"
                     /db_xref="GeneID:11534059"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G8BX12"
                     /translation="MKTEQKIASSLNHSIEEDYSPWSKINVKGTPFPRYRHITSSYIY
                     PSNDLYINGGLFESDVYGDTWKLNIKENYNENDLERWHYSCNIIDIMGTTPPPRVGHA
                     ATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLNLDTTKWTIPSPKGIRPLGRYGHKIS
                     VINSNLYLFGGQFDETYFNDLVKFDLLNFKDANSQWEFIKPKGFIPPPLSNFSMCTFE
                     NKLYVFGGDTYQVLTNETFVYDPELNEWSILETFGQEDTNKPPPIQEHAGIIYKHLMC
                     VVGGKDSNDNYLNSVYFLNLISKKWFKLPEFNDTAMLGRSGHSVSLLKNNKLLILGGD
                     KSDWVKQTESGELEISNTDNNEGVFIHILDIAKLNKLCPGIYDHSNLDIENVSKSTLI
                     NEIHNESTFPNIFTPIINSEKETSTEQFEEPNNSISRTSLPSSTITPSTNNTNTATIK
                     KHQRALSDLTKITSPIPNSPVPQLAHDRKFGSPNGAIDSTDIPLNNTEMPKVVMISKQ
                     FKENGNSFRESQYSGHSMRTSMLRLSSNIEEEIDFDAYMESTNHSQDVLTFPAIGDEN
                     HPPSSDNRNAYYSNEQLTEEVLQENLNLKVSPKLNNIESSKDLLEVRSEAVSQNDANI
                     SQSSEIDETPKERELKQLLRSKLLDAKELNKIIELQNKKLLEASKLKAKINLLKVENQ
                     TLKYENDTLKNAINSDVQDKELFTHTKAYSEQLENLENFISNTKASPISLLEPRTSIV
                     KSSDFETPKLPTSSVLNNQPSSAISKLSDRLDDILLESQELKNRTSLYNEDINIQLTN
                     VNDLETELELVRKERDYYKNELSHLQGQHH"
     gene            <237134..>237757
                     /gene="TPHA0H01090"
                     /locus_tag="TPHA_0H01090"
                     /db_xref="GeneID:11534060"
     mRNA            <237134..>237757
                     /gene="TPHA0H01090"
                     /locus_tag="TPHA_0H01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686703.1"
                     /db_xref="GeneID:11534060"
     CDS             237134..237757
                     /gene="TPHA0H01090"
                     /locus_tag="TPHA_0H01090"
                     /inference="similar to DNA sequence:INSDC:YHR159W"
                     /note="similar to Saccharomyces cerevisiae YHR159W;
                     ancestral locus Anc_5.87"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686751.1"
                     /db_xref="GeneID:11534060"
                     /db_xref="UniProtKB/TrEMBL:G8BX13"
                     /translation="MKGKQWKIKTVSRQKNEINKVKNKIYLVNSPANKNYRSAIVYDN
                     AYKDDVKDYGQQEQGKLRHLTDNDDSKANNVNIWEFMNEIKNGILGLEIDLNLNYGDT
                     SSTGSENDTDSDKENDNTNILNFTSDFIHSSRTRQVRTATTVTHHGHNRNGNSKALKA
                     NGDNATLDNNTDTSARNNGTGKDRDADAMKYLGIKEFNTTRKQEKKD"
     gene            <239253..>239642
                     /gene="TPHA0H01100"
                     /locus_tag="TPHA_0H01100"
                     /db_xref="GeneID:11534055"
     mRNA            <239253..>239642
                     /gene="TPHA0H01100"
                     /locus_tag="TPHA_0H01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686704.1"
                     /db_xref="GeneID:11534055"
     CDS             239253..239642
                     /gene="TPHA0H01100"
                     /locus_tag="TPHA_0H01100"
                     /inference="similar to DNA sequence:INSDC:YGR243W,YHR162W"
                     /note="similar to Saccharomyces cerevisiae YGR243W and
                     YHR162W; ancestral locus Anc_5.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686752.1"
                     /db_xref="GeneID:11534055"
                     /db_xref="GOA:G8BX14"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:G8BX14"
                     /translation="MSTAFNIALKRFWLSETGPKTVHFWAPTLKWGLVIAGISDISRP
                     VDKVSGAQNLSLLATAVIWTRWSFVIKPKNMLLASVNFFLGCTAGYQIGRIVNYRLKN
                     GDSVKQVAGYIINGEQKGTLAKQEVTQ"
     gene            complement(<240016..>242310)
                     /gene="TPHA0H01110"
                     /locus_tag="TPHA_0H01110"
                     /db_xref="GeneID:11534056"
     mRNA            complement(<240016..>242310)
                     /gene="TPHA0H01110"
                     /locus_tag="TPHA_0H01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686705.1"
                     /db_xref="GeneID:11534056"
     CDS             complement(240016..242310)
                     /gene="TPHA0H01110"
                     /locus_tag="TPHA_0H01110"
                     /inference="similar to DNA sequence:INSDC:YGR245C"
                     /note="similar to Saccharomyces cerevisiae SDA1 (YGR245C);
                     ancestral locus Anc_5.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686753.1"
                     /db_xref="GeneID:11534056"
                     /db_xref="GOA:G8BX15"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:G8BX15"
                     /translation="MAKRGRAAILPTNIILLQNLVKRDPQSYYEEFLQQYNHYESLRD
                     IFMLNGMGSELVGNTGDESAGASTSGTSTTTSTSQLLELIGFVSQVCSCFPKETANFP
                     NELQQLVLEHHSSLPFELKEKIITSLMMLRNKGVITPEQLIQTLFPLLIAYSSTGASL
                     NANSHARELRKLLYNAAVALLKSCNTGSKNQKLNKSTQAVCFNLLEQPDSQGIWAARL
                     TRELWKRGIWDDSRAVEIMTQSALHADVKVALSGVLFFLDADKEREENFEEKSDDDDD
                     IDLESLKHKMKINKKSSKRGKKLENAIKTVKKNNNNKNNGNKQLYLNFSAIHLLRDPQ
                     GFAEKLFARHLSGKSANKFTLEQKISLMQLISRLIGTHKLMVLGIYTYFLKYLTPKQR
                     DVTKIMAASAQACHDLVPPETINIMVRKIANEFVSDGVASEVAAAGINIIREICSRAP
                     LAIDETLLQDLVEYRGSKAKGVNIAAKSLVSLYRELAPDMLKKKDRGKTVSLKLQEAK
                     REGVDYKGKLQFGVETDNVDKIEGIELLAKWKRDQNANNEMEENDNANWEVDDIEDNE
                     SDVDGEWVTIDSDKEYDVDMDDSDDENEKAKKNDSDLELSDDEEGEEEENSEKTKEVP
                     MTAEDAFRELASTRILTPADFLKLQELRNEDNVTKIMNMGKKNNEELVDSDRLTGPIK
                     YKQTREERLQKVMEGREGREKFGSRRGKRDTVRSTTNKEKARRKNFVMMIHKRSVTGK
                     QKMSLKDKQKVLRAHITKQKKKGF"
     gene            complement(<242779..>244587)
                     /gene="TPHA0H01120"
                     /locus_tag="TPHA_0H01120"
                     /db_xref="GeneID:11534188"
     mRNA            complement(<242779..>244587)
                     /gene="TPHA0H01120"
                     /locus_tag="TPHA_0H01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686706.1"
                     /db_xref="GeneID:11534188"
     CDS             complement(242779..244587)
                     /gene="TPHA0H01120"
                     /locus_tag="TPHA_0H01120"
                     /inference="similar to DNA sequence:INSDC:YGR246C"
                     /note="similar to Saccharomyces cerevisiae BRF1 (YGR246C);
                     ancestral locus Anc_5.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686754.1"
                     /db_xref="GeneID:11534188"
                     /db_xref="GOA:G8BX16"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:G8BX16"
                     /translation="MALACKLCGETNFVRDLSNANNDLVCVGCGTVSEENPIVSEVTF
                     GETSAGAAVVQGSFISGDQAHAAFTSHGGSSAMESREATLNNARRKLRAVSHALRIQD
                     YITDAAFQWYKLALHHNFVQGRRSQNVIAACLYVACRKEKTHHMLIDFSSRLQVSVYS
                     IGATFLKMVKRLHITNLPLADPSLFIQHFAEKLDLGEKKIKVIKDAVKLAQRMSKDWM
                     YEGRRPAGIAGACILLACRMNNLRRTHSEIVAISHVAEETLQQRLNEFKNTNTGKLSI
                     KEFRENTDETEGSKPPSFLKNRINERKIKKQLEKEELTQTSEQAIQKNPILSQLLGEQ
                     ELSSREVLFYLEKFSKEREKVRHRIKTTYGIDDTDTLLDAKKNIDATKFKKIDVEDEV
                     KENDDHPRKRRLRSNAEVIKIEVDTDDEQEEEEEKFDATVSRHFQDQIDGYSLNNDPY
                     RPRNLHLLPTTESLLSKVEDDPDNLDDVDDEELDAQLLDEEASKLKERIWIGLNGDFL
                     LEQESKRLKQEADIATGNTSGKKRRKQRSKSAKQENEEENMLAQLKNESGFQAALNVV
                     DAGGDPTTASSVKSMLQKASFSKKINYDAIDGLFNS"
     gene            <250116..>251435
                     /gene="TPHA0H01130"
                     /locus_tag="TPHA_0H01130"
                     /db_xref="GeneID:11534189"
     mRNA            <250116..>251435
                     /gene="TPHA0H01130"
                     /locus_tag="TPHA_0H01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686707.1"
                     /db_xref="GeneID:11534189"
     CDS             250116..251435
                     /gene="TPHA0H01130"
                     /locus_tag="TPHA_0H01130"
                     /inference="similar to DNA sequence:INSDC:YGR249W"
                     /note="similar to Saccharomyces cerevisiae MGA1 (YGR249W);
                     ancestral locus Anc_5.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686755.1"
                     /db_xref="GeneID:11534189"
                     /db_xref="GOA:G8BX17"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:G8BX17"
                     /translation="MPTRTFLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSA
                     KILKGYFKHGNVSSFVRQLHMYGFHKLSNSNNRSKCQVSFLGVDNSLTASDPKIEPES
                     PEFGKYKEKMSRPALPQDRAKTIWYFTHPSGVFHKNAETSDLDKIHRKSNSAKDTKRK
                     AGLTALTYNYYDTASMKNNKLGSGMYDQGYVQHHQQLQPPQKSFVYGDQYNAGKSTCS
                     AASCWPSLQVITNPNSTTIFSSCYRCSTKRRVPSSNGRSKHGTTGIWTTNLLRGKKLP
                     ASQQLQGINTVNSSVQVAPSNVVEIPNISTSPLNPASVGSASSKASNNTNLPSLHGAT
                     TTTGTPLSQPLPTRPPIVAPLPNIIQTSHVVAPMNHAQAYPQKDINVDYKYNTLAKAV
                     LTLTDIIDSISQSNMQDASTGRASQHIDYYKISQTLQLIRDDIIHYE"
     gene            complement(<251773..>254277)
                     /gene="TPHA0H01140"
                     /locus_tag="TPHA_0H01140"
                     /db_xref="GeneID:11533994"
     mRNA            complement(<251773..>254277)
                     /gene="TPHA0H01140"
                     /locus_tag="TPHA_0H01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686708.1"
                     /db_xref="GeneID:11533994"
     CDS             complement(251773..254277)
                     /gene="TPHA0H01140"
                     /locus_tag="TPHA_0H01140"
                     /inference="similar to DNA sequence:INSDC:YGR250C"
                     /note="similar to Saccharomyces cerevisiae YGR250C;
                     ancestral locus Anc_5.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686756.1"
                     /db_xref="GeneID:11533994"
                     /db_xref="GOA:G8BX18"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BX18"
                     /translation="MSSSNNSSDNNNILINSELEQLANINQLTIRIGWLALDNSFLYD
                     LEKLIFDNKGNIIPLLSIENYEFLNDEQRLRILKENSDIFLFEKGLKEIENSFAKSLK
                     INQDEEDGDEGCVKEEEEEEEEEDWEYDYVVQSHFKNLNNLNAVVGIVTGLLKENKNI
                     SKWSISSNEHALSHPGNLYIKGIPKEMTIDDILPVFLNFGKVISLKIKTDQSGNSLGY
                     GFLSFQLGSQASLCKNELNGTNLNGSKLFINYHVERKERERIYWDNLRERNFNDKKFK
                     GIFIGNLPIYDEDKNLVSPEKVFEKFCMVLKDVTPIDSIVSYYFPKENSNSNIDYGDD
                     DNADTEQPKGKINVETCPLQNEEIPLKGYGFIKFISHDHALAAVEILKDFQWLGNKII
                     VNKAIQSRPHHTSFNGSPPNVNNNNLAYGYDNDVNDNYYGDNIPISLSSSSLSSANNK
                     TNSTKNKNGNGMKYYHPGKKQINNAIPNYYNYNPHPTTGMFQRNFQTSPYVQYIPYSP
                     VNSFDSSESDIYNLSSSPRAVSRSSITATSPENVNDLFENHEYSYNANPSTVANLNHG
                     SSFNRNTFHYNYNYSPFYNHNGNYKFVSGGSKNVLFPRPLNDQQESNLYIKHIPLSWS
                     DSDLYDFYKVFGEVISAKIITVGGSKNKVTKSERTDLEIPVGSSKGYGFVYFKNTLDA
                     SKAIIETNRYKIDKDHILHVSFAQKRSKLSDYEDCVSSNIDKKNFTKVANGPNPKSNR
                     AIFVDYSNLEYSDQRFMYNNVMNQSMHPMNIYQIGASNYIPQMNNWNFHMMPSPLHGG
                     MPAHNFGQRMSVPYIIRAPVSAASDFDVGNSKYSRD"
     gene            complement(<256494..>257264)
                     /gene="TPHA0H01150"
                     /locus_tag="TPHA_0H01150"
                     /db_xref="GeneID:11533995"
     mRNA            complement(<256494..>257264)
                     /gene="TPHA0H01150"
                     /locus_tag="TPHA_0H01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686709.1"
                     /db_xref="GeneID:11533995"
     CDS             complement(256494..257264)
                     /gene="TPHA0H01150"
                     /locus_tag="TPHA_0H01150"
                     /note="ancestral locus Anc_5.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686757.1"
                     /db_xref="GeneID:11533995"
                     /db_xref="UniProtKB/TrEMBL:G8BX19"
                     /translation="MAPKQSNKERNGAFNHEVLDRLPLKGPDTVKFKIFDCLAILYRL
                     SYTNDDIIEESQINHKFLKQIFQQYGNEYNEYATEMETVPPKLENDDKKDHVKDNNDN
                     VDDIRIINDVAENAIISITRELCEAHKKSVSDALQKMEMMANDDKRKLKRKDMETLDL
                     LRQQMRSEVEAFFQRVPTGGMKPTSTARASNSSTITIGSTTKHKKHKESRSKNKKRRI
                     EDRTNADGNYQNIVDYSFVDLKKSKIDRYEPYQSYLNK"
     gene            <257728..>259029
                     /gene="TPHA0H01160"
                     /locus_tag="TPHA_0H01160"
                     /db_xref="GeneID:11533746"
     mRNA            <257728..>259029
                     /gene="TPHA0H01160"
                     /locus_tag="TPHA_0H01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686710.1"
                     /db_xref="GeneID:11533746"
     CDS             257728..259029
                     /gene="TPHA0H01160"
                     /locus_tag="TPHA_0H01160"
                     /inference="similar to DNA sequence:INSDC:YHR169W"
                     /note="similar to Saccharomyces cerevisiae DBP8 (YHR169W);
                     ancestral locus Anc_5.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686758.1"
                     /db_xref="GeneID:11533746"
                     /db_xref="GOA:G8BX20"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BX20"
                     /translation="MSDKSFKSLGLSKWLVEALNAMRISTPTAIQSNCIPAILNGRDC
                     IGGAKTGSGKTVAFAAPMLTKWSEDPSGMFGVILTPTRELAMQIAEQFTALGASMNIR
                     ICLVVGGESIVKQALELQKKPHFIIATPGRLAHHIMASGEDTVGGLIRTKFLVLDEAD
                     ILLTSTFSKDLAVCIQKLPAKDKRQTLLFTATITDQVRALQNAPTQEYKPPLYCYEVG
                     TVDTVAIPSTLKVEYLLVPDYVKEAYLYQLLTCETYKDSSAIVFVNRTATAEVLRRTL
                     RELEIRVTSLHSQLPQQERTNSLQRFRANAARVLIATDVAARGLDIPIVELVINYDIP
                     QDPDTFIHRSGRTARAGRKGDAISFVTPRDITRIQSIEERINKKMEKCDKVHDTAVIR
                     KALTKVTKAKRESLMAMEKENFGEKRRLQKQRNIDQKSFRN"
     gene            <259532..>261112
                     /gene="TPHA0H01170"
                     /locus_tag="TPHA_0H01170"
                     /db_xref="GeneID:11533747"
     mRNA            <259532..>261112
                     /gene="TPHA0H01170"
                     /locus_tag="TPHA_0H01170"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_003686711.1"
                     /db_xref="GeneID:11533747"
     CDS             259532..261112
                     /gene="TPHA0H01170"
                     /locus_tag="TPHA_0H01170"
                     /inference="similar to DNA sequence:INSDC:YHR170W"
                     /note="similar to Saccharomyces cerevisiae NMD3 (YHR170W);
                     ancestral locus Anc_5.67"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_003686759.1"
                     /db_xref="GeneID:11533747"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:G8BX21"
                     /translation="MNYTPMDESQLQHQHQNQVATVLCCNCGTPIDGSQGLVMCYDCI
                     KLTVDITEGIPREANVSFCRNCERFLQPPGQWIRAELESRELLALCLRRLKGLNKVRL
                     VDASFIWTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYIVVAMQCADCARSYTTNTW
                     RATVQIRQKVAHKRTFLYLEQLILKHNAHIDTISITETKDGLDFFYSQKNHAAKMIDF
                     LNSVVPIKCKKSEELISQDVHTGSSTYKFSFSVEIVPVCRDDLVVLPKKLAKSLGDIS
                     QFVLCSKISNSVQFLDPTTLQTADLSANVYWRTPFNTLADASQLVEFIVLDVEPIGVT
                     KGKKVLADITVARATDLGVNDLTYYTRSHLGAICHAGDTVMGYYVANSNYNSDLFETL
                     KFEYVPDVVLVKKLYQRKSRKNRNWKLKRMAKEHKDIEASQDYSSRAQKQDIERAERD
                     YELFLQELEEDQELRQTINLYKSQKQEQEEHEMEEEEDADAPAIDIDELLDELDEMTL
                     DDNQGDEGMATKANMESM"
     gene            <261522..>263354
                     /gene="TPHA0H01180"
                     /locus_tag="TPHA_0H01180"
                     /db_xref="GeneID:11533863"
     mRNA            <261522..>263354
                     /gene="TPHA0H01180"
                     /locus_tag="TPHA_0H01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686712.1"
                     /db_xref="GeneID:11533863"
     CDS             261522..263354
                     /gene="TPHA0H01180"
                     /locus_tag="TPHA_0H01180"
                     /inference="similar to DNA sequence:INSDC:YGR252W"
                     /note="similar to Saccharomyces cerevisiae GCN5 (YGR252W);
                     ancestral locus Anc_5.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686760.1"
                     /db_xref="GeneID:11533863"
                     /db_xref="GOA:G8BX22"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:G8BX22"
                     /translation="MVGRRRGRRNTAKGSPLKKAKIEKEPEVKENIQDEKEDTLKTII
                     NEKEKSDEKVIADKDEDAHSKSDQVTEEVGKEDRVSENKQTNNNKDEHVIPQMEEKSN
                     YIETKVDGNEKDGVADEEPKGPKGPEELEELEEPEEPEEPEEPEKPEKPEKTIEDKTG
                     ETTGSKTRDESNKNSIDLKEENREINESAGLEPANDIDDATVDHKSVEVSEIDNGLVK
                     IESIENVENVETMPTINLESETEKGVTTFMFDGVKYTFKERVSVLEEKENKIEFRVVN
                     CDNSKESMMILTGLKNIFQKQLPKMPKEYIARLVYDRSHVSIAVVRHPLTVVGGITFR
                     PFEAKEFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNSSPIKHFLTYADNYAIGYFK
                     KQGFTKEITLDKKIWMGYIKDYEGGTLMQCSMLPRIRYLDAPKILLLQEAALMRKIRT
                     ISQSHIIRAGLDHFKDLKNITPIDPMTIPGLKEAGWTTEMDELAQRPKRGPHYAAMQN
                     ILTELQNHAAAWPFLQPVNKEEVPDYYEFIKEPMDLSTMEVKLENNRYEKMENYIYDA
                     RLIFENCRKYNGDNTSYFKYANRLEKFFNSKVKDYPEYSQLVDN"
     gene            complement(<263603..>264385)
                     /gene="TPHA0H01190"
                     /locus_tag="TPHA_0H01190"
                     /db_xref="GeneID:11533864"
     mRNA            complement(<263603..>264385)
                     /gene="TPHA0H01190"
                     /locus_tag="TPHA_0H01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686713.1"
                     /db_xref="GeneID:11533864"
     CDS             complement(263603..264385)
                     /gene="TPHA0H01190"
                     /locus_tag="TPHA_0H01190"
                     /inference="similar to DNA sequence:INSDC:YGR253C"
                     /note="similar to Saccharomyces cerevisiae PUP2 (YGR253C);
                     ancestral locus Anc_5.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686761.1"
                     /db_xref="GeneID:11533864"
                     /db_xref="GOA:G8BX23"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BX23"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKE
                     GVVLGVEKRATSPLLESDSIEKILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLY
                     YDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEP
                     SGTFYRYNAKAIGAGSEGAQSELQNEWHSSLTLKEAELLVLKVLKQVMEEKLDENNTQ
                     LSSITKDEGFKIYTNERTAELVKQVKEKEAEENPEQHDVEMS"
     gene            <265242..>267767
                     /gene="TPHA0H01200"
                     /locus_tag="TPHA_0H01200"
                     /db_xref="GeneID:11533751"
     mRNA            <265242..>267767
                     /gene="TPHA0H01200"
                     /locus_tag="TPHA_0H01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686714.1"
                     /db_xref="GeneID:11533751"
     CDS             265242..267767
                     /gene="TPHA0H01200"
                     /locus_tag="TPHA_0H01200"
                     /inference="similar to DNA sequence:INSDC:YHR172W"
                     /note="similar to Saccharomyces cerevisiae SPC97
                     (YHR172W); ancestral locus Anc_5.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686762.1"
                     /db_xref="GeneID:11533751"
                     /db_xref="GOA:G8BX24"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:G8BX24"
                     /translation="MEIKDVEDNVKLLESINDLDLSGDFLDPPFLGRQVNYQPLSNTD
                     SKIKTYPLNLLSDPKQSRIQESLVVHDLLNIILGLEGAYIRYNNAYSPYSDNTIPEFK
                     IAKMMDSSLKSICHRIIKLGQLYIILTKLSEKWSDLKYGKTLQRLSFEIRHFLHETYL
                     KFVVDTLENEYKNNPTFTIRDFEQLTNAHDISKKMRLLYDICSKIQKEMEERQAMDHM
                     QEDFNNFMNDLKEQSQFKNGMILVTDTSLQSIAKGGIILKILKNLIQENLGDRVSIEF
                     LKTILNSVAIDYYKMLNSWLIQGELEDPYEEFMIMDTMKNEDTISSTLKFGDRVWDTQ
                     YIIRKDGLLDEFSLSDGSDRLFKVLMTGKLLNVVKMSYNIVQLPIDETEPIETPTFVD
                     LMESTNLDIYIDKWYKRANKMCLDMYLENYDLIHFIRLLQKHYFGYQNGNHLHKFLSK
                     NMFDLTRYYSSKNHEHLELRFQGNLEAEKLSRQDEDDIVLKLLNLQLDTQSFEKVVSQ
                     YINESNFVNSSESAFGNNNMKKDSIFEASNFQTLREMLVEDVESDKLTEKSIKSTIHY
                     IQHEVIIPFPLNVIVTRTSMVQFQIISRYTYLLQYYSKLLDDTWYEINKNLIWRYNGF
                     SMEIKRNIIQKCRITHNKMNKFVKVILEYYSQNVIEAEMTNFINFSNLNGTNIIDWQL
                     NLQECLTNIMTNCCLSQMFQMQLQIFEIIYKFCKFITSMRRTLCKIDPILFDRYLSHK
                     NESDYNDIKEHDETKSYIFNEEEAISKIIPELLYYTNGMSNSFEQHRAAFMEGLNHYY
                     HRNRTATKSAKNINPSFFNSSNTTTTTTNSNYNTERLINALGQ"
     gene            <269391..>270704
                     /gene="TPHA0H01210"
                     /locus_tag="TPHA_0H01210"
                     /db_xref="GeneID:11533752"
     mRNA            <269391..>270704
                     /gene="TPHA0H01210"
                     /locus_tag="TPHA_0H01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686715.1"
                     /db_xref="GeneID:11533752"
     CDS             269391..270704
                     /gene="TPHA0H01210"
                     /locus_tag="TPHA_0H01210"
                     /inference="similar to DNA sequence:INSDC:YGR254W,YHR174W"
                     /note="similar to Saccharomyces cerevisiae ENO1 (YGR254W)
                     and ENO2 (YHR174W); ancestral locus Anc_5.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686763.1"
                     /db_xref="GeneID:11533752"
                     /db_xref="GOA:G8BX25"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="UniProtKB/TrEMBL:G8BX25"
                     /translation="MAISKVFGRYVYDSRGNPTVEVELTTEKGVFRAIVPSGASTGIH
                     EALEMRDEDKSKWMGKGVLNAVNNVNNVIAPALIKANLDVTNQQAVDDFLLSLDGTPN
                     KSKLGANAILGVSLAAARAAAAQKNVPLYQHIADISSAKTSPFVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGASSFSEALRMGSEVYHNLKSLTKKRYGSSAGNVGDEGGVAPD
                     IQTAEEALDLIVDAIKAAGHDGKIKIGLDCASSEFFKDGKYDLDFKNPESDKSKWLSG
                     PQLADLYHSLMKKYPIISIEDPFAEDDWEAWSHFFKTAGIQIVADDLTVTNPARIATA
                     IEKKAADALLLKVNQIGTLSESIKAANDSFAAGWGVMVSHRSGETEDVFIADLVVGLR
                     TGQIKTGAPARSERLAKLNQILRIEEELGDKAVFAGAKFHHGDKI"
     gene            <271230..>271718
                     /gene="TPHA0H01220"
                     /locus_tag="TPHA_0H01220"
                     /db_xref="GeneID:11533865"
     mRNA            <271230..>271718
                     /gene="TPHA0H01220"
                     /locus_tag="TPHA_0H01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686716.1"
                     /db_xref="GeneID:11533865"
     CDS             271230..271718
                     /gene="TPHA0H01220"
                     /locus_tag="TPHA_0H01220"
                     /inference="similar to DNA sequence:INSDC:YHR175W"
                     /note="similar to Saccharomyces cerevisiae CTR2 (YHR175W);
                     ancestral locus Anc_5.61"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686764.1"
                     /db_xref="GeneID:11533865"
                     /db_xref="GOA:G8BX26"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:G8BX26"
                     /translation="MDHSSHLISNVPDHSNHDHMDMGDETCSMNMIFTWDYKNVCVVF
                     KWWHIRTTLDLVLSILAIAFLCYVYEFLKQFIHKKQLYYNSTLNLNVNNTGSKLEKRI
                     KLMNSCYYGLQVTFSFMIMLIFMTYNGWLMLAILFGTIWGNYSWGFLLNGSTSDNSLA
                     CH"
     gene            <272199..>273569
                     /gene="TPHA0H01230"
                     /locus_tag="TPHA_0H01230"
                     /db_xref="GeneID:11533866"
     mRNA            <272199..>273569
                     /gene="TPHA0H01230"
                     /locus_tag="TPHA_0H01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686717.1"
                     /db_xref="GeneID:11533866"
     CDS             272199..273569
                     /gene="TPHA0H01230"
                     /locus_tag="TPHA_0H01230"
                     /inference="similar to DNA sequence:INSDC:YHR176W"
                     /note="similar to Saccharomyces cerevisiae FMO1 (YHR176W);
                     ancestral locus Anc_5.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686765.1"
                     /db_xref="GeneID:11533866"
                     /db_xref="GOA:G8BX27"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:G8BX27"
                     /translation="MTYINNTKKLAIIGAGPGGLATARVFLRNCPQYRIDLFEKQSSI
                     GGVWNYDDNNKDGKVMYDHLETNICKQLMQFSDFPFPEDVSTFPKRKDVLHYLKSYYE
                     KFLKNKDNLVMHLETKVENIEKVETESKWRITTINLSNKETKTELYDYVIVSNGHYEY
                     CNFPTNILGMKESLEEKMVFHSKDFQNCQFAKDKTVVVIGNGSSGQDIVVQLATVAKK
                     VYNSVNELSKNDMIHDLLWEMGCVEFVPKIVECDAKTHTVSLLDGRVINDIDYIICAT
                     GYKYNFPFMEKRLKNILLTNNPNGDIASDSGSGRVYNLWEQILYTNDHSIGFILLSQM
                     IIPFPLAELQAAVLSQVFENKIHIPHTFKPDNNSESYHSFPELTDIEYYRHLQKLLDD
                     TNYDPTSNFKPVKWDTYHRELRSTSKDNKTERNKMLIKHAKILREKGLPYKLIPIEED
                     ELEKLA"
     gene            <274496..>277129
                     /gene="TPHA0H01240"
                     /locus_tag="TPHA_0H01240"
                     /db_xref="GeneID:11533855"
     mRNA            <274496..>277129
                     /gene="TPHA0H01240"
                     /locus_tag="TPHA_0H01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686718.1"
                     /db_xref="GeneID:11533855"
     CDS             274496..277129
                     /gene="TPHA0H01240"
                     /locus_tag="TPHA_0H01240"
                     /inference="similar to DNA sequence:INSDC:YHR178W"
                     /note="similar to Saccharomyces cerevisiae STB5 (YHR178W);
                     ancestral locus Anc_5.59"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686766.1"
                     /db_xref="GeneID:11533855"
                     /db_xref="GOA:G8BX28"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BX28"
                     /translation="MDTGTSNDSNSGSMTSNKADLMVNQSSTITPDNEIDEIKNIKNL
                     EMKSVENSTDDHINDIPIESPTDVMKCYENIDSDNADLKDTISFGGQQLQSYSCSRCR
                     RLKKKCLRQMPKCSNCVASHYACEYIGRLPRRSKKELKAAMLRGEFNPKKKKLTITND
                     KKDRKMIRKNDNMTLSKNNSSSNLQSDSTPFSDMHANQPANNMNNPEHSYTPNSMSDN
                     MLDTSIKTLSGTNLQNQMEGISSLISALNSDFIPKNTSSSNTLMTAAGNIEKGLSNIF
                     SVENMDNLNNDNSNVKNNTFLYANSGNTISKFSKDNPNLPLDQLSTLPVPSFTNLISN
                     NNDNNGSTTKLTNPLVLNFGTRAGSGIRNQLSNNKINNNKAYNEKISTFNVEMIDSTP
                     ITDSAIQVETISSVFQGAKDTPWVTEDHSFRAVDRSLYDRFIAAYFNHNHRTFPMIDK
                     IAFLNSVSTIRDFTQMDGQYSETFIFKLNMIMAIGCTTLHRAGMLSKDQELLSEHFAY
                     LAMKKFSAVVKLQNIDTVICLLLLGVYSFFEPKGVSSWTISGIIMRLVIALGLNRSLT
                     QTKLRQMSVADVEIRNRIFWSAYCYERLVSTSLGKMSAISDDSINVPPPRALIQEEES
                     DIEVTLMTITLRRLSGRIYNKIHSVAAVKHDYSPQEKLQLIADLRKEIDDTYTEQRAK
                     IQQKKTANYSMAYFNSEMIGDDHDMISFNSSDIWLAMRYSQFQIMLYRPSALIPKPSL
                     ESLTILGEFCLKALKFTYILYKKKMLPLNWITLFRALSICNTMLYCLCQWSIDITESK
                     KEIQQCVDILQHFGEKWVFAKNCAEVFQNISNTIIDISLSNGQVPNMDKLTRELFGAS
                     DEYKDILDENNVDIAWNDRFP"
     gene            278061..278132
                     /gene="TPHA0Htrna7T"
                     /locus_tag="TPHA_0Htrna7T"
                     /db_xref="GeneID:11533856"
     tRNA            278061..278132
                     /gene="TPHA0Htrna7T"
                     /locus_tag="TPHA_0Htrna7T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:11533856"
     gene            <278379..>280088
                     /gene="TPHA0H01250"
                     /locus_tag="TPHA_0H01250"
                     /db_xref="GeneID:11533707"
     mRNA            <278379..>280088
                     /gene="TPHA0H01250"
                     /locus_tag="TPHA_0H01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686719.1"
                     /db_xref="GeneID:11533707"
     CDS             278379..280088
                     /gene="TPHA0H01250"
                     /locus_tag="TPHA_0H01250"
                     /inference="similar to DNA sequence:INSDC:YHR184W"
                     /note="similar to Saccharomyces cerevisiae SSP1 (YHR184W);
                     ancestral locus Anc_5.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686767.1"
                     /db_xref="GeneID:11533707"
                     /db_xref="UniProtKB/TrEMBL:G8BX29"
                     /translation="MPQIKVINNAYHSNHNNMNYNNFKPQSPPDLPYSYISPLTDDLN
                     IKEIAKGKTKPWYNKKQSHLFRKASNFDIDKDSTYSKDNHSARNLLDENPHKMNKNFR
                     RHIYPKKNNEFPSNEIGEATSLNNITNTDSSSNDTFINGNVTNKETKPIFPNINKDKS
                     YITSDQPDKKKYLKNIEGKYTTSSLSEDLYSVIPKNIQNWKRHDMKQIKKILADLKKN
                     KEKVVKTLTKLTVEFSKWEETLDTLDPDVSELTREFKFLFHDEMMSERLLTNSYNTME
                     IAFTNVMNRESEYNNFAKQITEANKNLQKIINKEGYNSEEYIFEKEKRESMNNSLLVK
                     RNHYQESILCNMRKNLMDHTQIKLNCFSKSKEIGTEILMNSLIKLKNSETDNYHNLLK
                     QIKNNYSANNESKNNDNLEIFLNKLEVKVSKDYKDTDASNNENKKAFQDEYYLANLSY
                     NDSRLKTLEQSPITGNKFLRGGFNNRESNENGTTPTKNPNKDVIISKKKSIEDPVGNS
                     KNIVVKNEILASSNENLESFIDGFSNLRDKENASGILFNIGDDQNKVDLEDESEVENN
                     KWA"
     gene            complement(<280250..>283405)
                     /gene="TPHA0H01260"
                     /locus_tag="TPHA_0H01260"
                     /db_xref="GeneID:11534010"
     mRNA            complement(<280250..>283405)
                     /gene="TPHA0H01260"
                     /locus_tag="TPHA_0H01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686720.1"
                     /db_xref="GeneID:11534010"
     CDS             complement(280250..283405)
                     /gene="TPHA0H01260"
                     /locus_tag="TPHA_0H01260"
                     /inference="similar to DNA sequence:INSDC:YGR258C"
                     /note="similar to Saccharomyces cerevisiae RAD2 (YGR258C);
                     ancestral locus Anc_5.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686768.1"
                     /db_xref="GeneID:11534010"
                     /db_xref="GOA:G8BX30"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:G8BX30"
                     /translation="MGVHSFWDIVGPTAKPVRLESLEDKVMAVDASIWIYQFLKAVRD
                     NEGNSVNNAHIVGFFRRICKLLYFGVKPVFVFDGGVPVLKRETIRQRKERRQGQRENA
                     VLTARKLLAIQLQKQLHEDKHSKNGDSNKLSTLEDNFDRMTNFSSMSFKPHDEWDLPD
                     IAGFKVDKDDTRILSTEKYDDILNSIEDGFGGVDLETINPASKEFEELPVATQYMILT
                     NLRLKSRLRLGYTKEQLENIFPTSMQFSKFQIDMVRRRNFFTQKLLATTDAPDGGASK
                     FNDEKLRTRIAGQLNKEYSLSKTDQGWALGLQDVEGLRSDKPLELISEEDLYSNQDDF
                     SIKKDKEIPKKTNTFPGDHMATIEDDEDDFEWEEVDTKVVKDNKIEDFSLKAAKLSQF
                     NKPANNVGSRAFLDAKHNIKLSPVKKPSISKLPKVYQISSDSEEESFKYIAGNKGYNE
                     NSEEDDDDFNQQIKEIEMMETIKKKITSPAFITKANQGRDRATLSTRGTALKNNDFLK
                     PSNLNQIASTSVQSNKIEQTEYILPEPTTERKLDYIMSRIPGFDQVNPTNSMFFNNSK
                     VTINENKEINKDDSTEKSAKEVVETPVWFQEKSDMPVNPYSSTEFVHDKTNRKDTANK
                     NSKGDGYVLYSGVAADEFLNDHIVDSQTPIKNPNNNDDDDIIIISSKEKGNNNTDKDS
                     VTVDAQDDFSTKINCVSESSESDNESQIASSHQDSNKISNKIPAVFEYDFSEDEQNDI
                     VENIIKEGQEFNEFKTNLNETDVSKTFMEDDLFEQQVKSKRDSDEVTQDMIKSVQELL
                     TRFGIPYIVAPMEAEAQCAELLKLKLVDGIITDDSDVFLFGGSKVYKNMFHEKNYVEF
                     YDQDKLTVQLGLERSNLIDLALLLGSDYTSGIKGIGPVSGIEIIAEFGSLENFRDWYM
                     DGQFDKNNQKTESKFQKDLRKKLVKNEIILDSNFPSAAVRNAYLYPEVDSDKTNFTWG
                     VPDLDMLRTFMLKEVRWTQEKSDEVLIPLIKDINKRKRKPKQKRLTDFFPTELISTEK
                     MLNMGKRVLTATNKLKKGNFK"
     gene            complement(283705..283777)
                     /gene="TPHA0Htrna10V"
                     /locus_tag="TPHA_0Htrna10V"
                     /db_xref="GeneID:11534011"
     tRNA            complement(283705..283777)
                     /gene="TPHA0Htrna10V"
                     /locus_tag="TPHA_0Htrna10V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:11534011"
     gene            <284616..>288713
                     /gene="TPHA0H01270"
                     /locus_tag="TPHA_0H01270"
                     /db_xref="GeneID:11534205"
     mRNA            <284616..>288713
                     /gene="TPHA0H01270"
                     /locus_tag="TPHA_0H01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686721.1"
                     /db_xref="GeneID:11534205"
     CDS             284616..288713
                     /gene="TPHA0H01270"
                     /locus_tag="TPHA_0H01270"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686769.1"
                     /db_xref="GeneID:11534205"
                     /db_xref="GOA:G8BX31"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8BX31"
                     /translation="MNTTIEHGSAAKNPIDSTNLEGSPRSSVNEDIRVKQDLNPNEFN
                     FSPYGNDANGFYHGYPQHHPYVIHGGFPWYPPNYPYQYGPGPHTHRYPPVPPSNIKVQ
                     GNASNVPDQSSEISDPTINVGESTRSNNDSFQDLRKNDIDSSSETLEQISHPSEFDNW
                     LYGFMNKLKSQDMSHCIPDMYGRYLKIVTNNEKKYITDMFKYYVPITAYPKWLIDIYD
                     KHTNTKYALISYAMKRYVAKRNPETIIKELNSLKYHPNMDSILFTDKVNKLIDEAELM
                     DVHISEKNICENFIKSLPPSLSSILHLYVHTPKPMTLSEVLFQVEKIQPYLSNLETKS
                     PNGRTVEKTAVKHHQHSTTIDKKKFPNAKKVHHLKNTSTLSSHEQLRPASSENLDADD
                     YLIIDSGAEITVVKDETLLQNIHPNTKHVLYGAGNQKLSAPVSGTLQFTFTKNKRYQV
                     HSLVSSEVDYNLISLYQLEKTGLVVDTKHRTLEDKNNNVLCSLTDIDKYVAIPISCLT
                     SQIKKIQQLSTEFTKPFTMQFIHDLLGHINIRDIKRTIDRKLIRGIEPDKVNWSGIDK
                     FQCKYCLQGKSTKRRHTIDSRIKYQINYEPFEYIHTDIFGPLHHLPASTPDSFITFTD
                     ENTRFRWVFAINNKSSNTITAIFRKLINLIHTQFGTKIKCFQMDRGSEYTNHEIDDLF
                     CKYGIRKIYNTVGDSASNGVAERTNLTFLNDCRTLLHATNLPNTVWFHAVKFAVLMRN
                     AICTATKNSPRASAGLLGLDIKTILPFGTPVIVHEPNAKSKLAIRGRDGYALCPSEVS
                     YGYLIYIPSLHRIVDSSSYKLVSRTDSLSTPDKNIFDELLLTAHEDKPYSPPDIIDLP
                     EPIIEIEKHEEPPEDISQSTRDKSVSESPSSDDERIDTNTTSLEIKPIIDGSDSSDKS
                     DDGIVSHEDIFIRTNAQLAKSGKNADLRRAFHAITTMKKKKNSSTSLSHNPIIKRSGG
                     LEKITRLKDSDDLPSLSIFRDRKRKHTQPSLQDQLNAISGDDEDDEDLTLSSYSKSKR
                     KRIHYLHAIKYQTNITPTRDSLSYSEAISKNRDVKQRNLYIAAYRKELDRLYKMQTWD
                     ESTLHDVENIPKHQIINSMFIFTEKRDGTHKYRYVARGDQQKAGTYDENAISNTVHNS
                     ALMTCMAIALETKQFITQLDISSAHLYADLDEELYIRPPPHINLQNKVYRLQKSLYGL
                     KQSGANWYNNIKTFLTHECNLQEVKLWPCVFYNGTFRVCLFVDDMVVFADDITQTESF
                     IELLQTKYDTKVINLGNEVKSIIRYDMLGLNIEYHFGSSISFGMEKVLTEKLEKMNIA
                     IRKAGKLAWVAGQPGLYISDEDIEMEEEHYLQDVEWLQRITGLAS"
     gene            complement(289779..289874)
                     /gene="TPHA0Htrna10K"
                     /locus_tag="TPHA_0Htrna10K"
                     /db_xref="GeneID:11533712"
     tRNA            complement(join(289779..289815,289837..289874))
                     /gene="TPHA0Htrna10K"
                     /locus_tag="TPHA_0Htrna10K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11533712"
     gap             291267..291533
                     /estimated_length=267
     gene            complement(<291755..>292636)
                     /gene="TPHA0H01290"
                     /locus_tag="TPHA_0H01290"
                     /db_xref="GeneID:11534204"
     mRNA            complement(<291755..>292636)
                     /gene="TPHA0H01290"
                     /locus_tag="TPHA_0H01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686722.1"
                     /db_xref="GeneID:11534204"
     CDS             complement(291755..292636)
                     /gene="TPHA0H01290"
                     /locus_tag="TPHA_0H01290"
                     /inference="similar to DNA sequence:INSDC:YOR060C"
                     /note="similar to Saccharomyces cerevisiae YOR060C;
                     ancestral locus Anc_5.661"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686770.1"
                     /db_xref="GeneID:11534204"
                     /db_xref="UniProtKB/TrEMBL:G8BX32"
                     /translation="MFNKLAVLKLDLGHRHNDITLRDIQLWNKSNLEQQHVDKKSQAK
                     VITMNAKFLTYVDISCLPIWLINDSNSSHDSELYCFTTSNTSLSFFKSKLKYNNRGIV
                     IEISKDKNNRNLSSRDNTNPLIFSDHIVFYQANNFIQYFYLNIDRKTEIEYKINKLEK
                     LKSDTELVINTVTKLDEYSKLNEDPRNKIDKILKKSYEQNRMNTNKVMRSLQISDKRL
                     QFNDTLSKVILGGLRLRGIPNTQIGFQKLYKITFEASEFALRDELTQLLHNKIQEISF
                     EKLQETVEVLLNLFLKS"
     gene            <293254..>294282
                     /gene="TPHA0H01300"
                     /locus_tag="TPHA_0H01300"
                     /db_xref="GeneID:11533902"
     mRNA            <293254..>294282
                     /gene="TPHA0H01300"
                     /locus_tag="TPHA_0H01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686723.1"
                     /db_xref="GeneID:11533902"
     CDS             293254..294282
                     /gene="TPHA0H01300"
                     /locus_tag="TPHA_0H01300"
                     /inference="similar to DNA sequence:INSDC:YOR061W"
                     /note="similar to Saccharomyces cerevisiae CKA2 (YOR061W);
                     ancestral locus Anc_5.662"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686771.1"
                     /db_xref="GeneID:11533902"
                     /db_xref="GOA:G8BX33"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BX33"
                     /translation="MILPPSTLNQKSGRVYSVARVYKEECEKRPQEYWDYEQGVTIDW
                     GEISNYEIINKIGRGKYSEVFSGRCITNNHSCVIKVLKPVKMKKIYRELKILTNLTGG
                     PNVIGLLDIVKDSGSKIPALIFEEVKNVDFRTLYPTFTLTDIQYYFTQLLIALNYCHS
                     MGIMHRDVKPQNVMIDPTEKKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLN
                     QYDYSLDLWSVGCMLAAIIFKKEPFFKGSTNADQLVKIAAVLGTKELLEYLGKYGLKL
                     PFEYDNIMRDFSRKPWQMFIKDDEKSKKLCAPEVIDLIDNLLRYDHQERLTATEAMNH
                     PFFKTKYD"
     gene            complement(<294761..>295507)
                     /gene="TPHA0H01310"
                     /locus_tag="TPHA_0H01310"
                     /db_xref="GeneID:11533903"
     mRNA            complement(<294761..>295507)
                     /gene="TPHA0H01310"
                     /locus_tag="TPHA_0H01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686724.1"
                     /db_xref="GeneID:11533903"
     CDS             complement(294761..295507)
                     /gene="TPHA0H01310"
                     /locus_tag="TPHA_0H01310"
                     /inference="similar to DNA sequence:INSDC:YKR075C,YOR062C"
                     /note="similar to Saccharomyces cerevisiae YKR075C and
                     YOR062C; ancestral locus Anc_5.663"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686772.1"
                     /db_xref="GeneID:11533903"
                     /db_xref="UniProtKB/TrEMBL:G8BX34"
                     /translation="MVPQSYDDIIITPKNVKILNNLSDYSQTALDYFSYDFKTIEFEQ
                     CWSLLKNYSSFNFETKLIDGKRIRLPSCSLEDKFDYDLYLKRLHHCVWRRWSMSLKNS
                     NNNLIDPLSINWNKENDLTVLYGPDFYSTEKDSLLKKNTPPLKNITNKHLEAVMTHIQ
                     HLHLKSKGKLFTEDIPEELEYSSDSRSSISSGSSSGSGAIFDNSHEQQQSRLNKKSKL
                     LNFNDFVVRWDIDENGLCYESHNYINDLRF"
     gene            <297922..>298434
                     /gene="TPHA0H01320"
                     /locus_tag="TPHA_0H01320"
                     /db_xref="GeneID:11533879"
     mRNA            <297922..>298434
                     /gene="TPHA0H01320"
                     /locus_tag="TPHA_0H01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686725.1"
                     /db_xref="GeneID:11533879"
     CDS             297922..298434
                     /gene="TPHA0H01320"
                     /locus_tag="TPHA_0H01320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686773.1"
                     /db_xref="GeneID:11533879"
                     /db_xref="UniProtKB/TrEMBL:G8BX35"
                     /translation="MQDRYIFLSILISSEGNFTNTYYLMSPHWYPVHIAFQMSQSLSK
                     ESPWFISEWGRIFVNSDISCSFIMNSTFGIHTVSNFFHVPPCCYRGLETIENLKIFKF
                     FKLYFSGGLSHRNVCGGSLNVFSFSDFDVYFCTAALPIRELLCKRRVIMGTDPILSHP
                     LLLNGRYKIS"
     gene            <300165..>301034
                     /gene="TPHA0H01330"
                     /locus_tag="TPHA_0H01330"
                     /db_xref="GeneID:11533880"
     mRNA            <300165..>301034
                     /gene="TPHA0H01330"
                     /locus_tag="TPHA_0H01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686726.1"
                     /db_xref="GeneID:11533880"
     CDS             300165..301034
                     /gene="TPHA0H01330"
                     /locus_tag="TPHA_0H01330"
                     /inference="similar to DNA sequence:INSDC:YOR065W"
                     /note="similar to Saccharomyces cerevisiae CYT1 (YOR065W);
                     ancestral locus Anc_5.666"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686774.1"
                     /db_xref="GeneID:11533880"
                     /db_xref="GOA:G8BX36"
                     /db_xref="InterPro:IPR002326"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR021157"
                     /db_xref="UniProtKB/TrEMBL:G8BX36"
                     /translation="MFAQFRNRLGSKLGQRIFIGGAATAGLTSSAMLYADSLTANAMT
                     AAEHGLHAPAYEWSHNGPLETFDHGSIRRGYQVYREVCAACHSLDRVSWRTMIGVAFT
                     NAEVRDMAAEFEYDDEPDEQGNPKKRPGKVADMIPGPYPNEQAARAANQGALPPDLSL
                     IVKARHGGCDYIFSLLTGYPEEPPAGVVLPPGANYNPYFPGGSIAMGRVLFDDLVEYE
                     DGTPATTSQMAKDVTTFLNWCAEPEHDERKKLGLKAVIILSSLFLLSVWVKKFKWAGL
                     KTRQFKFNPPKKN"
     gene            <302714..>304630
                     /gene="TPHA0H01340"
                     /locus_tag="TPHA_0H01340"
                     /db_xref="GeneID:11534184"
     mRNA            <302714..>304630
                     /gene="TPHA0H01340"
                     /locus_tag="TPHA_0H01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686727.1"
                     /db_xref="GeneID:11534184"
     CDS             302714..304630
                     /gene="TPHA0H01340"
                     /locus_tag="TPHA_0H01340"
                     /inference="similar to DNA sequence:INSDC:YKR077W,YOR066W"
                     /note="similar to Saccharomyces cerevisiae YKR077W and
                     YOR066W; ancestral locus Anc_5.668"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686775.1"
                     /db_xref="GeneID:11534184"
                     /db_xref="UniProtKB/TrEMBL:G8BX37"
                     /translation="MQATNTPEKVAKRRGRPPITKHYANPLQSPMAHSSKQVQKQGLT
                     GQNTSKPLMKVGSMTPSPKKRKRSQSITSNNSFTSASELNGSNSQSSSNLDYKSKRSN
                     YRGVILITPQRQCISTPNKSKSEGNIASESALSTPNSTNSNIFSSTSRATALRSSPPT
                     ASPLIYHNKKSNLTNPISKIACFDTTSIPKSIKRPFSDFKLSFSINPDGRASIQGSKA
                     QLTTPTSASDMAEKTKDVFEDPLLSNAYSINKNNSNNNDTNNNSNDIEGVVNKDHVLS
                     LLRNLRNNKIVSNTNNVLTSTNRSNQKVTTATNLPVIIETSTSISSSPKVKKLTSPKQ
                     NDATNSLLPPTTPKSHFQFTTGFTPIGIDQILLDEAILDTPRKIFNSFDSKFQNITGS
                     TSILLSPKAKLSTKTANIGSSSQELVFKLSSGDPLLLTDKYITNPSNTNTNINENPAQ
                     THLLLATPSKKRHFNTPPSWINFGSPKTSDANSSNNILLPTQSNQLTMTDIKEESMTA
                     IKDTTKIISSPKFNLLSSPRIDLSNLSQQFDFSFDTSQGNKRSILLTATPKRVDNTTS
                     NQELQLSTVIECTPLIQQTMNGSLNSKILGTLNMDDIQHESGMQDCSVVPITSIAVEQ
                     DDARNALRKLMNNR"
     gene            <305160..>307220
                     /gene="TPHA0H01360"
                     /locus_tag="TPHA_0H01360"
                     /db_xref="GeneID:11534185"
     mRNA            <305160..>307220
                     /gene="TPHA0H01360"
                     /locus_tag="TPHA_0H01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686728.1"
                     /db_xref="GeneID:11534185"
     CDS             305160..307220
                     /gene="TPHA0H01360"
                     /locus_tag="TPHA_0H01360"
                     /inference="similar to DNA sequence:INSDC:YKR078W,YOR069W"
                     /note="similar to Saccharomyces cerevisiae YKR078W and
                     VPS5 (YOR069W); ancestral locus Anc_5.670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686776.1"
                     /db_xref="GeneID:11534185"
                     /db_xref="GOA:G8BX38"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="InterPro:IPR028648"
                     /db_xref="UniProtKB/TrEMBL:G8BX38"
                     /translation="MNYEENLDAPVWDELDTQNVKNNARNVFNNDDLKQDLNDTFENL
                     AIVNEEEKIGTNSDGFNNPLSEVINNENGLLKADAHPWSGGHFSDNTNNRHLIDVLAP
                     EDNNLLSGLQDEGKNKDVNEAIKNGALFQNALISPIKVDESEFEGNSHKEEMKFNGSK
                     KLNVLFSSARLRRMPIQNGSQNNTTNTVEVEHSDPLNQFLKKNEPESKIVINDRTDSD
                     KNIQTRTQNLVSELENPLFNLQNYDNDSDDLPTSITTGRPNTEDIDTNSSSNKEKSEI
                     PDNDVKGDKAFPFTIEVKDPIKIGELTAMHVEYSVASQSELIKGNFAQVNRRYSDFRW
                     LYRQLQNNHWGKIIPPPPEKQIVGRYKTDFMENRRFQMERMLNKIAADPVLQKDEDFL
                     LFLSSVDFISESKMREQFSGSKASNDSNDLSEVHISDIKLLGADEAEIVAQTGGLDGE
                     LNRGFISMTFSSQQKYEELDEYFINNLQMLEVLEDQLRQIDKSLELLYSERNDLVFII
                     QEYINSIKKTADLEVIKSVSDLLLNFADVHEKLKESLEQVSSQEHLTLGVTLDEYIRS
                     ITSVRAIFDQRHKLGSILLLAESGYSKAKAQLHKFDGNQNARNIDKFKNAKANYLVTK
                     KRYQTIRNKWQEVGNKVKTEVELFDKEKVVEFRNAIEIFLEASIESQKANIDLWETFY
                     KNNI"
     gene            complement(<307316..>309823)
                     /gene="TPHA0H01370"
                     /locus_tag="TPHA_0H01370"
                     /db_xref="GeneID:11533873"
     mRNA            complement(<307316..>309823)
                     /gene="TPHA0H01370"
                     /locus_tag="TPHA_0H01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686729.1"
                     /db_xref="GeneID:11533873"
     CDS             complement(307316..309823)
                     /gene="TPHA0H01370"
                     /locus_tag="TPHA_0H01370"
                     /inference="similar to DNA sequence:INSDC:YKR079C"
                     /note="similar to Saccharomyces cerevisiae TRZ1 (YKR079C);
                     ancestral locus Anc_5.671"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686777.1"
                     /db_xref="GeneID:11533873"
                     /db_xref="GOA:G8BX39"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR027794"
                     /db_xref="UniProtKB/TrEMBL:G8BX39"
                     /translation="MFNLSTISYPTSDTAHPLLLLQSIHGEKYFFGKISEGSQRCLTE
                     KRIRVSKLENLFLTGELNWSSIGGLPGMILTIADQGRDKLNLVYGDPIINYIVSSWRY
                     FVFRFGINLRTTVLKNDEIFKDNLLTVKSIVIGRKFYMDREKSLFNSVSNITLNSIVS
                     NMFPKHAPTEKYDPTSDPHLNVELPKDINIKDIASTTSYEINFNPIRGKFKVDEALKL
                     GVPKGPLFAKLTKGETITLENGSIITPDKVLEKERVFSKILVLDIPNDEYFSNFISHF
                     QHNYNSTNLGSVYYFLGDDVTISNELIQLMESFPEETQHFISHSKVSPNNIVFSGAAS
                     TILKLKSLQIENYNLPRTDRVFSKEFYDLFKDKTDLLPSGSTLSQHQELPLTSTKLLS
                     KNIHVFSDRNGLDIIPYTNSDNINDSIAGTEKVKILEQHQSSFSWDLIYHNSLANKDV
                     EVYSKTKVITDQLNINNFNNTFEKKKGVEVITLGTGSALPSKYRNVVSTLVKIPYENI
                     NKEFEQRCILLDAGENTLGTIKRMFSSIEINDLFKNLKMIYLSHLHADHHLGIISILN
                     EWYLHNKFDPDSKIYLITPWQYNKFMDEWLRYENPEILDKIRYISGEHLISSPYVRKE
                     TLAIKTEEYNDIINGSNMKKRKLELDDNSSFRDLKGIREMYKDLNINRFETCKAIHCN
                     WAYSNSISFFMNHYSKNSFKVSYSGDTRPNFKYFANGIGQGSDLLIHEATLDNELVED
                     AIQKRHCTINEAIEVSNTMNARKLILTHFSQRYPKLPQMDRNIEIKANEYCFAFDGFI
                     VSYDKIGEQQKIFTILNKLFDDEKQEETAITDTDGEN"
     gene            <310919..>311881
                     /gene="TPHA0H01380"
                     /locus_tag="TPHA_0H01380"
                     /db_xref="GeneID:11533874"
     mRNA            <310919..>311881
                     /gene="TPHA0H01380"
                     /locus_tag="TPHA_0H01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686730.1"
                     /db_xref="GeneID:11533874"
     CDS             310919..311881
                     /gene="TPHA0H01380"
                     /locus_tag="TPHA_0H01380"
                     /inference="similar to DNA sequence:INSDC:YKR080W"
                     /note="similar to Saccharomyces cerevisiae MTD1 (YKR080W);
                     ancestral locus Anc_5.673"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686778.1"
                     /db_xref="GeneID:11533874"
                     /db_xref="GOA:G8BX40"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="UniProtKB/TrEMBL:G8BX40"
                     /translation="MSSAVNPGRTILASNIAKTFIDEIQNKVLNVKKIKPEGPLLVGF
                     LSNDDPAAEMYANWTKKTCESMGIRYELRRIDDSDFLEEAIIEANRDDDVNGIMVYFP
                     VFGNAQDQYLQQVVAKEKDVEGLNHLYYQNLYHNVRYLDANKKLKSILPCTPLAIIKI
                     LEYLKIYNSLLVEGNRLYGKKIVVVNRSEIVGRPLAALLANDGAIVYSVDVNNIQKFT
                     RGEGLKFTKHQVEDLGNFSNSLLKDISGEADVIITGVPSETYKFPTEYIKDGAVCINF
                     SSSKNFEDSVKEIASLYVPSTGKVTISMLLRNMFRLMENVEITK"
     gene            <312444..>313118
                     /gene="TPHA0H01390"
                     /locus_tag="TPHA_0H01390"
                     /db_xref="GeneID:11533857"
     mRNA            <312444..>313118
                     /gene="TPHA0H01390"
                     /locus_tag="TPHA_0H01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686731.1"
                     /db_xref="GeneID:11533857"
     CDS             312444..313118
                     /gene="TPHA0H01390"
                     /locus_tag="TPHA_0H01390"
                     /inference="similar to DNA sequence:INSDC:YOR078W"
                     /note="similar to Saccharomyces cerevisiae BUD21
                     (YOR078W); ancestral locus Anc_5.687"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686779.1"
                     /db_xref="GeneID:11533857"
                     /db_xref="InterPro:IPR013268"
                     /db_xref="UniProtKB/TrEMBL:G8BX41"
                     /translation="MAVTTKSHMKFDDIDEDLSMPSKPMSETTKSTDKYAVSDSDDSD
                     MDEDAPEEGAMDESKESVDQFMKMAEDARRLEEVMLKEKRRNQNKIFSKQQQDRRERK
                     GDTLDSANTEATKQLEQLPEDFFDKLEAAESNIETITEIPKHINFNSIEHDDKYVSEV
                     KEQIKKKKKKTLRKLRAVSTKKGPVTVSLLSAIGNSSTMAPKKEVQVMSTRDRWLKRK
                     SVNRLK"
     gene            complement(<313405..>316272)
                     /gene="TPHA0H01400"
                     /locus_tag="TPHA_0H01400"
                     /db_xref="GeneID:11533858"
     mRNA            complement(<313405..>316272)
                     /gene="TPHA0H01400"
                     /locus_tag="TPHA_0H01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686732.1"
                     /db_xref="GeneID:11533858"
     CDS             complement(313405..316272)
                     /gene="TPHA0H01400"
                     /locus_tag="TPHA_0H01400"
                     /inference="similar to DNA sequence:INSDC:YKR089C,YOR081C"
                     /note="similar to Saccharomyces cerevisiae TGL4 (YKR089C)
                     and TGL5 (YOR081C); ancestral locus Anc_5.690"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686780.1"
                     /db_xref="GeneID:11533858"
                     /db_xref="GOA:G8BX42"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:G8BX42"
                     /translation="MQVGENPSFHVTQHLIEKYYQHLLKDKNANILPNKNVVSVEFKA
                     DNAKDDIPLNVESTSEFQRNSSSSVISTDSVEIENSINGISKKAPSKSDLEFNLSKVE
                     SLTEEELKDQEFLEQMKNGTENHGYPINLDSECENSITTNLTKWNLNILNYKHLFSKL
                     FTSFDYERDLLVQRLLSERRHAMSFHEWKEASLKLDNVTNKIQWKQKAESELYDYKLI
                     EEITNKLKVARLEKDYPKLLYIIRTQWVRNLGNMGNVNLYIQSHIGTKYIIDDYIKES
                     KICIEALLEQNELDDSYLLAIFQQSRRNIGRTALVLSGGGTFGLFHIGVLATLFELDL
                     IPRVISGSSAGAIVASILSVHTKDEIPELLEKVLDSEFNIFKDDNDKSDSENLLIKIS
                     RFFKNGTWFDNKNLVNTMISFLGDLTFREAYNRTGRILNITVSPASTFEQPRLLNNLT
                     APNVLIWSAVCASCSLPGIFPPTNLYEKDPKTGKRREWNGSKSVKFVDGSVDNDLPIT
                     RLSEMFNVDHIIACQVNLHVFPLLKMSLSCVGGNIQDEISAKFKKNLSNIYNFMSNEL
                     IHLLEIGSELGIAKNAMMKFRSVLSQQYSGDVTILPDLQMILRFNELLSNPSQEFLLR
                     ETTNGARATWPKVSIIENHLSQELALDRAITILKGKLIVSSSIGNPLQFNDMAYGLIK
                     TAINNKGNEQGESYDSSVSNNNHLSTVLDDNLIDMESSKTLLLFRENTGTLRRATNYK
                     LTTPTKTKKIRRMSDFSETPARNTSHSFSFSTSPTSKHSRVSHKYGTGIRPGLRKMNS
                     AYRNYQIRDADFYPHSRNIKEIDSAPVSKQETSIIIPIPSSAKIGNVDSFNYDRIENN
                     LKNSTMKILSNTRTEFQNKIIDETLDLSKVFTSESEVDESSNNEKSEKSDKSDKSDKS
                     DKNNITSPDRKTTSHSHGLRNTFSSPLKKIGSLSYKSRKSP"
     gene            complement(<316871..>317854)
                     /gene="TPHA0H01410"
                     /locus_tag="TPHA_0H01410"
                     /db_xref="GeneID:11534032"
     mRNA            complement(<316871..>317854)
                     /gene="TPHA0H01410"
                     /locus_tag="TPHA_0H01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686733.1"
                     /db_xref="GeneID:11534032"
     CDS             complement(316871..317854)
                     /gene="TPHA0H01410"
                     /locus_tag="TPHA_0H01410"
                     /inference="similar to DNA sequence:INSDC:YKR092C"
                     /note="similar to Saccharomyces cerevisiae SRP40
                     (YKR092C); ancestral locus Anc_5.694"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686781.1"
                     /db_xref="GeneID:11534032"
                     /db_xref="InterPro:IPR007718"
                     /db_xref="UniProtKB/TrEMBL:G8BX43"
                     /translation="MGSNPPKLSEKAKKEELSTSGSSSSSSSSSSSSSSSSSSSSSSS
                     SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSDSDSSSSSSSSSSSSSSSSSSSSN
                     SSDSSSSDSSSSSSSDSTSDSSSSSSSDSDSDSSSSSSSSSGSSSSSSDSDSDSSSSS
                     SSSSSSSSSSSSSDSSGSDSDSSSSSSSESENEDKDSKKRAIEDETTKESDKKQKTEQ
                     ASDNSSEATTSVSECNKREKLKISAGTDELKEGQRNHFSRIEREKISFESWDLTDNTY
                     KGAAGTWGEMANEKLGRVRGKDFTKNKNKMKRGSYRGGSITLETGSYKFTD"
     gene            complement(<318539..>320650)
                     /gene="TPHA0H01420"
                     /locus_tag="TPHA_0H01420"
                     /db_xref="GeneID:11534033"
     mRNA            complement(<318539..>320650)
                     /gene="TPHA0H01420"
                     /locus_tag="TPHA_0H01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686734.1"
                     /db_xref="GeneID:11534033"
     CDS             complement(318539..320650)
                     /gene="TPHA0H01420"
                     /locus_tag="TPHA_0H01420"
                     /inference="similar to DNA sequence:INSDC:YIL144W"
                     /note="similar to Saccharomyces cerevisiae TID3 (YIL144W);
                     ancestral locus Anc_5.696"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686782.1"
                     /db_xref="GeneID:11534033"
                     /db_xref="InterPro:IPR005550"
                     /db_xref="UniProtKB/TrEMBL:G8BX44"
                     /translation="MQNIQQPILNNLNPQLFTSQIPAPSTGIKRRQSVSNVALTDMIN
                     SSIAKNAHSNKSDPNNRKKLRSTVSSVNQLYNQKRTSYIRDNEPSGMQRHSMLPYPTN
                     NNNDNNNNDLNTNNVSTRDPRPLRDKNFQNAMQQDIINYLTSNKFEIETNLPITNKTL
                     KQPTQKGFIITFQWLYQRLDPGYQFKSNNSNNVNSNTNKSVELEIYQILKFLQYPYLD
                     TINKSQISAVGGNSWHKFLGMLHWMVKTNISLDKSLKILDKSLIDENTQDLKSINEQN
                     KLPLTQEEQDSKQDKYEVLIEQICINYIIECYKKYLKNDDNFEPILKDLNEEFKKFNH
                     IFDIDLNSLRSKTEALSVECDGLVKIYENLKLSRDKNIALKSDLSKFQNYVDGMKNKS
                     NEWSQKLEKMNNEKALREDDIRDISEEISSIKKFLKDKNISIDVISNKNLEFEKLSKD
                     LDQKKDEVNKFVSSTQSLKIEFESIMKALNDTLRQYDLSTETLINERISLGHSTIKKS
                     DFELLIDDSIKQNYNSYLNNGKAIDFNKMFKNDLNTMKIKNNIIKLNNEIQERIEGVE
                     KNNSVLEQKLISLKQEVMDKNKMTENVELKLSEANSTYELNKQESDNKLLKQKIEIEK
                     LERKINDANKILKEKLLETQQLINSTRLKKEELQLQLDREKNNISKKILEIIDFSGNI
                     MERIQNKLESSQSIINKELEN"
     gene            <321562..>322344
                     /gene="TPHA0H01430"
                     /locus_tag="TPHA_0H01430"
                     /db_xref="GeneID:11533843"
     mRNA            <321562..>322344
                     /gene="TPHA0H01430"
                     /locus_tag="TPHA_0H01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686735.1"
                     /db_xref="GeneID:11533843"
     CDS             321562..322344
                     /gene="TPHA0H01430"
                     /locus_tag="TPHA_0H01430"
                     /inference="similar to DNA sequence:INSDC:YLR192C"
                     /note="similar to Saccharomyces cerevisiae HCR1 (YLR192C);
                     ancestral locus Anc_7.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686783.1"
                     /db_xref="GeneID:11533843"
                     /db_xref="GOA:G8BX45"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="InterPro:IPR023194"
                     /db_xref="UniProtKB/TrEMBL:G8BX45"
                     /translation="MSWDDDFVAGNDDDTVLMESWDAEETIEEKKQKEAELKRQEQLL
                     KTQETANKKNKNKSSTDQVLMEIDTLDDATRKELIKKAELESDLNNAAELFGSLGVAE
                     EHPRALAARKEKELEAMMKPASLTRDTPLESHPIFNAESKKEFQDLRKAISAAVTPLN
                     EVSSLNYSSSLAIDLIRDVANPMSVESIRQTIATLNVLMKDKERQERQARLARVKGGT
                     ATGGAGKKKIKGKTNLGGAFKKDQDFSLETEDFGDFGDDDFM"
     gene            complement(<322547..>325174)
                     /gene="TPHA0H01440"
                     /locus_tag="TPHA_0H01440"
                     /db_xref="GeneID:11533844"
     mRNA            complement(<322547..>325174)
                     /gene="TPHA0H01440"
                     /locus_tag="TPHA_0H01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686736.1"
                     /db_xref="GeneID:11533844"
     CDS             complement(322547..325174)
                     /gene="TPHA0H01440"
                     /locus_tag="TPHA_0H01440"
                     /note="ancestral locus Anc_5.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686784.1"
                     /db_xref="GeneID:11533844"
                     /db_xref="GOA:G8BX46"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:G8BX46"
                     /translation="MSNQFLLPKVFHPELYTIWIRDLNINTNTFKGAVCINLKSLSST
                     NVIQLHTRDLVINEAWIEFGGNEKYVMVSQSYDKITEIVSMEFPIEITKDVQLFINYD
                     GILQTNMSGFYRSDYKDVSTGEDRWMLSTQFEATDARRAFPCMDEPNLKSHFKVNITC
                     DKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYLVAWAIGHYDYIEDSTEKKIYPT
                     LDGYDIRDGSSGTKGSLPIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPLPKL
                     DIVCVESYSHNAMENFSLITFRPSAILYDGKDEDIPISEAAKKVAGVVCHEVAHQWFG
                     NLVTMNWWDELWLNEGFATWVGNYAVAHLFPEWNISSLNMLDAREVALSLDSLEESHP
                     IRVNVHDPKDIDQVFDTISYLKGCSVLQMLSGFLGEANFLKGVALYLRRNKFSNATMV
                     DLFESISEVNDIDVLTRIKPWILELGYPVINVNSTSSLLNLTQERYTQRKDNNKKETS
                     WWVPLMMTKDKVTEGKLEFDSSSLDIGNDGKFNFFNTDGYGFYRVNYQSAELLQNIID
                     NVANISSKSQIVLISDVASVNSFGDFFKLSSAIIKLGDLTDHCIWRLIIDKLSHMRTL
                     IYNSSSVTTIEKFDNNVINLFEPFIDAAIAYLKNPSIVLQEDSTTKLDKAKIFDMILA
                     FTGSLSHPRVVKAASEIYNSNKIHESNRLIILGTLLSQLDTEASLFEKITSKLSTATL
                     SELETILTCLGKVRNEKLFKHVFDLLFKIETMNVQFLATAFGKNPYVQKSLIEYVEQN
                     KDELLTRLKVNGIVISRFVSFSLPNISDVELFQKIQNIFEGEDVSLYDRNLRQIIEKI
                     ELNIALLKSFLPQVEEYFK"
     gene            <326082..>327158
                     /gene="TPHA0H01450"
                     /locus_tag="TPHA_0H01450"
                     /db_xref="GeneID:11533722"
     mRNA            <326082..>327158
                     /gene="TPHA0H01450"
                     /locus_tag="TPHA_0H01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686737.1"
                     /db_xref="GeneID:11533722"
     CDS             326082..327158
                     /gene="TPHA0H01450"
                     /locus_tag="TPHA_0H01450"
                     /inference="similar to DNA sequence:INSDC:YHR076W"
                     /note="similar to Saccharomyces cerevisiae PTC7 (YHR076W);
                     ancestral locus Anc_5.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686785.1"
                     /db_xref="GeneID:11533722"
                     /db_xref="GOA:G8BX47"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:G8BX47"
                     /translation="MYSQLLASILVLIFAVWILIPISSVSLIAHVQYLKGNFYNLSKR
                     CFTSTGTFNDQSGNYSSYNYYTTSSQPQDTGLSYKLAVAYQPKDRDDPIYKNLKSSLD
                     SPTGEDNYFVRKNANNDVYVGVADGVGGWASYGYDSSAISRELCKAMSDYSTIKNQKN
                     SLPFYEINPKTLIDISYNKIKDEKIVNVGGTTAIVGHFPPSGKLQLANLGDSWCGVFR
                     DYKLVFKTNFQTVGFNAPYQLAIIPKELLSGKENSYIQNKPSDADEYTFQLEKDDIIL
                     LATDGVTDNIATGDMENFFRDNEASTEEELQTITKKFVKEVVAISIDPDFPSVFAQEI
                     SKLTGKDYRGGKEDDITVVVVKAE"
     STS             327158..327668
                     /standard_name="ha2604"
                     /db_xref="UniSTS:515572"
     gene            <327663..>329270
                     /gene="TPHA0H01460"
                     /locus_tag="TPHA_0H01460"
                     /db_xref="GeneID:11533723"
     mRNA            <327663..>329270
                     /gene="TPHA0H01460"
                     /locus_tag="TPHA_0H01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686738.1"
                     /db_xref="GeneID:11533723"
     CDS             327663..329270
                     /gene="TPHA0H01460"
                     /locus_tag="TPHA_0H01460"
                     /inference="similar to DNA sequence:INSDC:YHR078W"
                     /note="similar to Saccharomyces cerevisiae YHR078W;
                     ancestral locus Anc_5.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686786.1"
                     /db_xref="GeneID:11533723"
                     /db_xref="InterPro:IPR015672"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="UniProtKB/TrEMBL:G8BX48"
                     /translation="MGELLILIVIVTSSVFAYSWSYRVLWFKTNLLYQSLSPTVNNDK
                     FSELDTWSTDSNGFVHKFYTEYSVSSHTLHEMIRILFAASMVCYLVLIEVVLWQITAS
                     APDGKEGFVTSFIWPLLLFCLTILLTTVQPFLMLISILDKFFNDKLGIEKLAMITAGT
                     VFVLNLTLYYIEFGPFIFTNSLLTKLSVAGVSMLSILSAIATVSTIYYTFLMVWKRGN
                     LSGIQNINTIGDRLSLWASDYSVRERINDYKRNIDGNIEILKRLESETGGSQSILRDK
                     LIEKIGWYQLEVNKLETQQNESQFIRNSKKVFHIMFLIYCIHKVVTTFVSRIPYLIIH
                     ALYYPDDYNYEYFDQDKRSNFGSDPLSVTMASLLNFFLFRFNYAQDIDDLARQISLLM
                     SISLFGASFSTVITTISYISALLPIKLQILALYAIKDNEESSLPSIKSNKKRSRINRN
                     PSLIKNLFISELTGIYVISTVLTIRSNLPYEVSRKLNELLGERFSVPNVVIDVWFYEV
                     YACFCIIVFVATKVAEKTIFSQSTYNN"
     gene            complement(<329451..>333578)
                     /gene="TPHA0H01470"
                     /locus_tag="TPHA_0H01470"
                     /db_xref="GeneID:11533897"
     mRNA            complement(<329451..>333578)
                     /gene="TPHA0H01470"
                     /locus_tag="TPHA_0H01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686739.1"
                     /db_xref="GeneID:11533897"
     CDS             complement(329451..333578)
                     /gene="TPHA0H01470"
                     /locus_tag="TPHA_0H01470"
                     /inference="similar to DNA sequence:INSDC:YHR079C"
                     /note="similar to Saccharomyces cerevisiae IRE1 (YHR079C);
                     ancestral locus Anc_5.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686787.1"
                     /db_xref="GeneID:11533897"
                     /db_xref="GOA:G8BX49"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006567"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR010513"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR018391"
                     /db_xref="InterPro:IPR027295"
                     /db_xref="UniProtKB/TrEMBL:G8BX49"
                     /translation="MIHYYTSNLLINIYIFIFLLIYGKNLIEAYEYHGNRDNVIKSVE
                     PLTHTTILNENFENRNHFELPIDLLDSTSLLEDDDYDNEDDADQEQDEDGHVDDKYMK
                     FLNQKLKRNFDVKTASPLNPNIDTNTITNAYANKYKKPSMIIPYNTDNSLSDYELSDI
                     VLVSDLKDGLYGLNRYTGEIIWSLNHVDIEHSILTITDDENDMIIKDSTGSKTNETLI
                     IEPFGDGNIYFFNVFQGVTKLPISIHQLIMSSPMHLKTNFIIDEIGTVVEEEKTYTGS
                     RQTSMFTIDIRTGTILSAFGFSTENKKYYDESDETNIIDPSNIIKIGKTTYRLEIHSN
                     DSPSYDVTYTTWQRNSLDLHFATGNNFSKDGIYISPLKSTTSDDNSVMAIDLNNNEIK
                     WISDKFSSGIITNIFDVFQNKITGDNVLAQHPVHQFNVNYNGNNSKELYEKVYLDQLD
                     NKSWIALSEINFPSFVNSAKLSRYQQKEDKLGESYTYDLKLKFLKNKKLFKSTIIGVH
                     YLNKEKKNHYYNYNLNEKHNLIMLPYDDKDYFTYGDEDSGFTKTEYVPVDENGKILDT
                     LATSIFKTNMYSNSYYKNTDNNGLNSNNNKNSQNNNDNSNDAFNPEENYKLFSPEELQ
                     AYRLKLHEEIAREMNTNNKEFMLDNNSYISIIKNFAKRILETLTVFIVTTVLLILLHR
                     YEIIRPSADLLKSIGVLKETEFYRRDSFYVKRFSQNIRRLSFFDKIGTENKRESAETL
                     TINNKLKNSNSSASPGGKEPTTINFKNNDIFSVETQPMDRQISTFSVASNIDPIQEFG
                     QDTSNNDIAYNDDSLTRIGNTTMDTSVDSDAFTLVTNEKKKKKKNKKNKKKANTNTNT
                     TKTTSDANVTATTDSNSKSNATTVATSLLKKGNQDYNLSSMPLIRSNSQNPIPIDDDH
                     DKNLKNLTVSKEVLGFGSLGTVVYKGKFEGRPVAIKRMLIDFCDIASTEIDLLSESDD
                     HPNVIRYYCSEETGRFLYIALELCNSNLEDLVEKRRLVVKKMLLETADVWSRDWESLT
                     ILNQIASGVNHLHLLKIIHRDIKPQNILVATAKKFIAGQISADKYDNSNIRILISDFG
                     LCKKLESDKSSFQTNVNNAAGTTGWRAPELLDVSKRALLQTIKEVSENDKSASQLSNS
                     DAVHDDGSKMRLTRAIDIFSMGCVFYYILSNGEHPFGDRYIREANIIKGSFNLSKISA
                     TLTDESLQLEAKDLISRMISNDPLSRPPALDVLKHPLFWSVSKKLQFLLKVSDRFEGE
                     RRDPPSALLLELEANAKFVILNGNWTTTLDSEFISSLGKYRKYSGASFLDLLRAFRNK
                     YHHYQDTPASISKKIGILPDGFYFYFIEKFPNLLLELYKLIEENLNDDPSFIEYL"
     gene            <334442..>334981
                     /gene="TPHA0H01480"
                     /locus_tag="TPHA_0H01480"
                     /db_xref="GeneID:11533898"
     mRNA            <334442..>334981
                     /gene="TPHA0H01480"
                     /locus_tag="TPHA_0H01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686740.1"
                     /db_xref="GeneID:11533898"
     CDS             334442..334981
                     /gene="TPHA0H01480"
                     /locus_tag="TPHA_0H01480"
                     /inference="similar to DNA sequence:INSDC:YHR081W"
                     /note="similar to Saccharomyces cerevisiae LRP1 (YHR081W);
                     ancestral locus Anc_5.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686788.1"
                     /db_xref="GeneID:11533898"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="UniProtKB/TrEMBL:G8BX50"
                     /translation="MLNTRFHTYIYMYMYIDGHSAIDYTLTTDQHSITMDNDIKKFKL
                     YLNHLNKQLNALKPQLEKLISHGSLDDMLINLNSSNNIELEKLKLVNHMAYILTSLLF
                     INTKLYNVKDNSRIMGELNKVKEYMGRYDTFKNKAIRSKDEKSQAKEQIAGVLQNSAI
                     SYKNFERKGKINKYKVSKK"
     gene            <335249..>336496
                     /gene="TPHA0H01490"
                     /locus_tag="TPHA_0H01490"
                     /db_xref="GeneID:11533841"
     mRNA            <335249..>336496
                     /gene="TPHA0H01490"
                     /locus_tag="TPHA_0H01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686741.1"
                     /db_xref="GeneID:11533841"
     CDS             335249..336496
                     /gene="TPHA0H01490"
                     /locus_tag="TPHA_0H01490"
                     /inference="similar to DNA sequence:INSDC:YDR331W"
                     /note="similar to Saccharomyces cerevisiae GPI8 (YDR331W);
                     ancestral locus Anc_5.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686789.1"
                     /db_xref="GeneID:11533841"
                     /db_xref="GOA:G8BX51"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="InterPro:IPR028361"
                     /db_xref="UniProtKB/TrEMBL:G8BX51"
                     /translation="MHTLTKYLKFIQIIGTEYQTHVVTMRFNFFIPFLLLLTTNYVLA
                     DEEKNNHTNNWAVLVSTSTFWFNYRHMANVLSMYRTVKRLGIPDSQIILMLSDDVACN
                     SRNLFPGSVFNNQDRKIDLYGESIEVDYKGYDVTVENFIRLLTDRWPDEQPKSKRLLT
                     DENSNIFIYMTGHGGDDFLKFQDAEEIASEDIADAFEQMHEKKRYNEIFFMVDTCQAN
                     TMFSKFYSPNILAIGSSELDESSYSHHSDVELGVAVIDRFTYYTLEFLEQIDKSSTLT
                     LEDLFQYYTFEKVHSNVGVRKDLYSRDPKDVLITDFFANVPNIIPDSSSENESSNKYI
                     NLINLAMDQYNSNSKVSKNKDNALSPSVLSKSQNFNNIEYIEDTRTAISSSIKTLLVT
                     SVVTLLCILFYLQEAESSKTFTK"
     gene            complement(<336652..>339639)
                     /gene="TPHA0H01500"
                     /locus_tag="TPHA_0H01500"
                     /db_xref="GeneID:11533842"
     mRNA            complement(<336652..>339639)
                     /gene="TPHA0H01500"
                     /locus_tag="TPHA_0H01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686742.1"
                     /db_xref="GeneID:11533842"
     CDS             complement(336652..339639)
                     /gene="TPHA0H01500"
                     /locus_tag="TPHA_0H01500"
                     /inference="similar to DNA sequence:INSDC:YHR082C"
                     /note="similar to Saccharomyces cerevisiae KSP1 (YHR082C);
                     ancestral locus Anc_5.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686790.1"
                     /db_xref="GeneID:11533842"
                     /db_xref="GOA:G8BX52"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BX52"
                     /translation="MSLSYSIYKEGGLLNDRYQKIEDISEGSYGYVSLANDVKEKRLV
                     AVKYIFKLDEDDDGEKDDDDDSDCPSVCDSSIEKRQQLVNNRNSRISSKIRSKFYENV
                     CLEAVYEVDIQLKIGQHKNIVSLLDYFDSYIILEYCSGGDLYEAIKDDIVPRKTVSIV
                     KIFNQIMDAVEFVHSKSIYHRDIKPENILISGIDWNIKLTDWGLATTEKTSLDRNVGS
                     ERYMAPELFESNLDLQERKEPYDCSKVDIWAMGIVFLNIVFQKNPFSVANQTDKSFCY
                     FAGNREALFDVFSTMSYDFFQVLRYSLTIDPLNRNLLSMRNELNGLSEFTMDDEYYNN
                     LGSDNYTAVSDSGDYMKYSDVSSSTTAVNDKFLLNDTKAFDKQIPFSLPNPIPAMTLS
                     TSVDAEPILINNARTGSPTVSTVSSNSENSNQNNTSTAYSTNNTSRELSREKYQNKDG
                     KVNHENSKARAKSVPKFRFNKRSHPKPETTNQGNTQHGLNHTKQTNRRKSFNDVGFRF
                     NNNYGNKNHNNTNNINNYNKFPRAIKIQRRKKKPIIKNSRKPLGLPTPNSHMNNFFNE
                     YKSKDNFNTSDFFTPPTLHNRYIEGIFNNNNRSHDYNKFQHGKLHNNSNKLSYNYHNN
                     SVSSSKNQRRPSTTGSITGSEAINYIRNRGHSRNNSSNNPHVSPGRYIPPNLRITSLY
                     SGENSTPKNISEVLDIPPPSTYHEQFLSNTNGSNNNGEPDLDDVLFTLEENDYDFVKD
                     MDSLSLNNNVNSQSGTNLVPDLLKTNHVSTSIQQPAARSYNGVLRNSTTGGDNNSQDS
                     RRRSSSHKYKAGVYVPPHHRRLSAEPSYDETLSVPPNGIAVTNTNNPYYNQRRPSLTP
                     SPRSNASQWTNSVLQRSDRTSDNISSSLDQRFMAKSGRASPFPLINHASSTTAVQNRD
                     VFAEDNDALVFEDDDDELDENGMVDKRAMFGPYEIYDQNVTEPSTNKQKDRTARKSSL
                     LQDQAVNSLEEYKNNWLMLQQQD"
     gene            <340988..>343018
                     /gene="TPHA0H01510"
                     /locus_tag="TPHA_0H01510"
                     /db_xref="GeneID:11533910"
     mRNA            <340988..>343018
                     /gene="TPHA0H01510"
                     /locus_tag="TPHA_0H01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686743.1"
                     /db_xref="GeneID:11533910"
     CDS             340988..343018
                     /gene="TPHA0H01510"
                     /locus_tag="TPHA_0H01510"
                     /inference="similar to DNA sequence:INSDC:YDR332W"
                     /note="similar to Saccharomyces cerevisiae YDR332W;
                     ancestral locus Anc_5.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686791.1"
                     /db_xref="GeneID:11533910"
                     /db_xref="GOA:G8BX53"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BX53"
                     /translation="MIKVGLETLSRLLFAREVSTQYKLRNYQQVAIDKCVDSIANGIK
                     KIGVSLATGGGKTVIFTNLIDQLKSRTPKNEGDKFRTLILVHRRELALQTINTIKNFS
                     HDINAQVEMGKYHCEVEQADVIVGSVQSLLNRLAKYNEKNIDLIIIDEAHHAVAKSYI
                     KVVDTINSNGKIPVIGFSATFERNDNKALSVMFDEIVYHKGIVEMIKENWLCEGLFTS
                     VNVDVNLDDVEVSSCNDFKLDSLSKVMNTEKINNIVVRTYLEERQKENLKSTLLFAVD
                     VAHVKYLCEEFRKFGINAEYVTGTTKVAERDRIINDFKNFKIEVLINCGIFTEGTDIP
                     NIDCVLLCRPTKSRSLLVQMIGRGLRLHHSKKHCHIIDFVGVENVGVVSVPTLMGIDN
                     FNDELEAATISELNTLKLQIDKEKQEMVLKNAAVEDSLKAKYNDYLEEHNDFDLTLTS
                     YPSFEDFCEAYKDSNGYLSLTEKEPISNTERENQYFMKSSYPWVKTANTAWAFSIHNN
                     HHIRLYKETKEKDNVAKEIYIAKIYRELPFAMREESGIRFIPRELVKTNDFFKAAGII
                     EQTISEMQMRGNDDKGYTLNVNKFSPWRKLQATPKQKALLLKRLNKVNSLEKKESDRL
                     EKKDIDNYVEHISKGEISNVLFASTIAPIYPLKRLLKVIKYRINRERIQAFQ"
     gene            <343322..>344806
                     /gene="TPHA0H01520"
                     /locus_tag="TPHA_0H01520"
                     /db_xref="GeneID:11533911"
     mRNA            <343322..>344806
                     /gene="TPHA0H01520"
                     /locus_tag="TPHA_0H01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686744.1"
                     /db_xref="GeneID:11533911"
     CDS             343322..344806
                     /gene="TPHA0H01520"
                     /locus_tag="TPHA_0H01520"
                     /inference="similar to DNA sequence:INSDC:YHR086W"
                     /note="similar to Saccharomyces cerevisiae NAM8 (YHR086W);
                     ancestral locus Anc_5.382"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686792.1"
                     /db_xref="GeneID:11533911"
                     /db_xref="GOA:G8BX54"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BX54"
                     /translation="MNYNQKSNYNKNFTKSNEFQHSKPYNNYKPRYNYKQTQGKGNNV
                     LYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVEF
                     STHETASNAIMKNGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSNDYSVFVGD
                     LGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDALSKMQN
                     KILNGRGIKVRTVGNNDNNTTNKNVQFSNFRKDTFVPKTTSTTIASSATIVKPKQKQD
                     RKLSNLVITKQVLPVLNDSTNPDNTTLVVSNASKDISMNEFKSYFLPFGNLIEISKDP
                     NTNILFVTYVDRICAENSMRILQGKVIRGNKIQIAWGRPLLEIKNSLKQQNKQKSKRH
                     PKRNSNVYEYIPEAINADSSLQLLSNKETDVMLPGISSLSFKNLEIQIGSSRNYNYSG
                     LQHSSNNSTDKTLEVNFQPNSVYSHQINASIERLEKGSNGWLLS"
     gene            <345222..>346106
                     /gene="TPHA0H01530"
                     /locus_tag="TPHA_0H01530"
                     /db_xref="GeneID:11534008"
     mRNA            <345222..>346106
                     /gene="TPHA0H01530"
                     /locus_tag="TPHA_0H01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686745.1"
                     /db_xref="GeneID:11534008"
     CDS             345222..346106
                     /gene="TPHA0H01530"
                     /locus_tag="TPHA_0H01530"
                     /inference="similar to DNA sequence:INSDC:YHR088W"
                     /note="similar to Saccharomyces cerevisiae RPF1 (YHR088W);
                     ancestral locus Anc_5.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686793.1"
                     /db_xref="GeneID:11534008"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:G8BX55"
                     /translation="MAAEDIRIGNKLKRQELFAEVKDQKNKERHTMRRQRAKEERDNP
                     ELKEKRLKENVTNTIESMRVYDETITKDIEGDEDELMKFFNSDNNNPPKILVTTNVNA
                     KKKAYEFANVLIEVLPNVTFVKRKFGIKLKDMADMCEKRDFTDIVIINEDKKKVTGLT
                     FMHLPEGPTFYFKLSSYVEVTKITGHGRPTSHIPELILNNFQTRLGKTVGRLFQSIFP
                     KNPEFEGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTLKLKRLQRGIKEE
                     TEWEHKPEMDKQKKQFYL"
     gene            <346959..>350675
                     /gene="TPHA0H01540"
                     /locus_tag="TPHA_0H01540"
                     /db_xref="GeneID:11534009"
     mRNA            <346959..>350675
                     /gene="TPHA0H01540"
                     /locus_tag="TPHA_0H01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686746.1"
                     /db_xref="GeneID:11534009"
     CDS             346959..350675
                     /gene="TPHA0H01540"
                     /locus_tag="TPHA_0H01540"
                     /inference="similar to DNA sequence:INSDC:YDR335W"
                     /note="similar to Saccharomyces cerevisiae MSN5 (YDR335W);
                     ancestral locus Anc_5.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686794.1"
                     /db_xref="GeneID:11534009"
                     /db_xref="GOA:G8BX56"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BX56"
                     /translation="MDSSGASQVISALELIYEPKSTNEQRLEAQKFLDQVKLQDESPY
                     WGYDIAINNQDNHILKYFGLNMINDSIQHKWISYDDAKKNTVRQWIIELNLKISDKDP
                     RYIKEKLAFLWVEVAKRVWGEVLKDNTPSSDDFINSWVDMDSSLNELWNIGNSSRELT
                     LIIFRILFEDVFLLDDLIVLKRMTIIQPLCVMIVCPMDVFSKRYKFNENWKLFKFNEN
                     GWFSVWANELYNTLDMMQNTNHVLNDNYNDQNANYVIRLLETLKTCLNWPLSDVIIRT
                     NILDILLKCFLSNIPKAQSTALDAIHILLTRPYNNEEHHQEIINKLFSNMDLLSQLYD
                     NLQFNTSVDGVDDVKYPILKKYVDMISCLYSCIFKLNNSEELIDRYLKLVMKATRNDS
                     LIVSGLTLDLWCACLRNDDCLPLLENGLIPELLSFSAGALIYYEQIDGHISKEYVDID
                     FQSTSEFQSFCSTYRKRIRDIIRLISCVKVDFTNDWLNNRLNEYFSSPPGQLVLNSTF
                     LDTKSEPYLGALSQLMIIECFINGCIRWKIWYPNGEDYDEKLDDILGKLQVLSNQLIA
                     LNIRVPLLLKKQIQNFALFLTMLKDNVIFTLLEKIIISATMDYPNVDLEERNDEADAV
                     RDLRYACGIEINRMALLMPESLKSIFPELENVIAKIMPNLSYHEKISFKSFLLTIILK
                     SSLDNKEERFSAIVDPELLAWSDKSTVMGLSDLPWFMERLGIVKISEYFQKRGIKEDS
                     DLLTIPIDDEGKQLKQELTKHWQTLFPVRATRMFIHYSMQNIKKEEDFRLIQELWRPR
                     IVPILPYIMRLLYQLQSYHDPANWKELPNVVQKFVEYSTVERFWEAGTSNKSKDEFID
                     EHLKAMQTLRDFADSVGHIVRYTREYVLLVISGISFLGSVFYDDVNAPNLLIDSIAIY
                     NPQSNEISPGVSTHGWKHILNVAIRPILRNCPDSSAPGFMKAFLPKFFGTLDVLITEK
                     WSTHMHADMEVVSSVDEDEITDEIMEENLLRQFTSVTVRILIDCVGQGGTNTSSSKSK
                     FSQHQLKMRKIIFEDVSILAPFLKLLNHLMSVKDGKCSFNSILIMKVCLSEVLINNGH
                     VDEFFTHEVMKNLLLNILCNSAYKDSFSEALYIFTVLFLTLIKEYDSTRIFLIGISNG
                     YNISNLYEQLRNVDNYKGQRSLMIEYIEWVKNSLNINEDEGTDRVAEERRRKEKREAT
                     LQKANDRLVNKNKESGDILDDPNTEDAAFGTLFQ"
     gene            <350943..>351887
                     /gene="TPHA0H01550"
                     /locus_tag="TPHA_0H01550"
                     /db_xref="GeneID:11534006"
     mRNA            <350943..>351887
                     /gene="TPHA0H01550"
                     /locus_tag="TPHA_0H01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686747.1"
                     /db_xref="GeneID:11534006"
     CDS             350943..351887
                     /gene="TPHA0H01550"
                     /locus_tag="TPHA_0H01550"
                     /inference="similar to DNA sequence:INSDC:YDR336W"
                     /note="similar to Saccharomyces cerevisiae YDR336W;
                     ancestral locus Anc_5.387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686795.1"
                     /db_xref="GeneID:11534006"
                     /db_xref="GOA:G8BX57"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BX57"
                     /translation="MYCRRVYSTLNTKYDISTIKNIISTVKGKTSLTESTKENSQKPS
                     IKVPRIKTPKVIKTKTIPLSINLFEKYNGELYSVSDINKCNKFFNGANVTFERSAVNS
                     IEFENPMNTLLDDPIDGIDQPKLRNTIKILPEIAFLGSSNAGKSSLLNALLTKYNKAS
                     TESIARTSHKAGYTKYLNFFNISNKFRLVDTPGYGYNSTNVQGELTRQYLLNRKELLR
                     SYILIPAKKLPNHRDLSVMNFLNENGISYDVIFTKMDELKNTEELERSIKEFIYGSSR
                     VKPNIFFVNSITNKYCEHRYGFDKLRMSIINITNTSIK"
     gene            complement(<352042..>354123)
                     /gene="TPHA0H01560"
                     /locus_tag="TPHA_0H01560"
                     /db_xref="GeneID:11534007"
     mRNA            complement(<352042..>354123)
                     /gene="TPHA0H01560"
                     /locus_tag="TPHA_0H01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686748.1"
                     /db_xref="GeneID:11534007"
     CDS             complement(352042..354123)
                     /gene="TPHA0H01560"
                     /locus_tag="TPHA_0H01560"
                     /inference="similar to DNA sequence:INSDC:YDR338C"
                     /note="similar to Saccharomyces cerevisiae YDR338C;
                     ancestral locus Anc_5.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686796.1"
                     /db_xref="GeneID:11534007"
                     /db_xref="GOA:G8BX58"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:G8BX58"
                     /translation="MVNILTKTLSNAHSNLQTTGLGIGNTHRRISLGFFPPNKKNLLV
                     RKYRKRRNRVEDQRSYYSLGEDFSSSVRDSSLHPFLGDIIEEIGHEGNYSHGGDELSR
                     TVSLPSHLSDVTDYISDNDRNNGDNDHMISFMANSDIEDQAALSSIAGSHNRESDYDE
                     FMKQIYAYKNNINSQLSAKVHTSQRRPSFVTVSSRGSIPTVYQERYGTHPELYGGIRP
                     EDVTYMSELAILCSYSFPLIFTFLLEQIFPIVCSITVAHLGKTELASVSLGAMTSNIT
                     LAVFEGISTSLDTLCPQAYGAGRHKSVGIHMQRCIVFSLILYIPFAFMWYYSEHLLKL
                     VIPEKELVTLTSQFLRVQILGAPGYIGFENLKRFLQAQGIFDAGIYVLMICAPLNILM
                     SYLLVWNKYIGFGFIGSAIAVVINFWLMFILLVLYVIFIDGKKCWGGFSKKAFKHWKD
                     LAQLAFSGIIMLEAEELSYELLTLFSSYFGSTYLAVQSAVSTMAALLYMVPFAIGIAT
                     STRIANFIGAKLTHCAYISSQVGLSMSQAAGLVNCFLLIGFRKHIARIFSQDAEVIEL
                     IIDLLPLVGCVQIFDALNAVAGSCLRGQGMQTLGSIVNLITYYLFAIPFGMFLSQWYD
                     LKLYGLWIGIGSGMFIIGVIESYYVLKPDWEQILNYSEILKETENDEDSNSEYFTDSD
                     NDESEDTPLLN"
     gene            complement(<354813..>356744)
                     /gene="TPHA0H01570"
                     /locus_tag="TPHA_0H01570"
                     /db_xref="GeneID:11533851"
     mRNA            complement(<354813..>356744)
                     /gene="TPHA0H01570"
                     /locus_tag="TPHA_0H01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686749.1"
                     /db_xref="GeneID:11533851"
     CDS             complement(354813..356744)
                     /gene="TPHA0H01570"
                     /locus_tag="TPHA_0H01570"
                     /inference="similar to DNA sequence:INSDC:YHR096C,YDR345C"
                     /note="similar to Saccharomyces cerevisiae HXT5 (YHR096C)
                     and HXT3 (YDR345C); ancestral locus Anc_5.396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686797.1"
                     /db_xref="GeneID:11533851"
                     /db_xref="GOA:G8BX59"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BX59"
                     /translation="MSSVAPEDTSVPNPSVTNEQVAGTPNEYNVNGQFPRVSMQQSSE
                     FETAHTQSTNDHSVLAGKSAGSNLQEEGSIFNEPGEKDELTVMEKEADMQVKTKKKKD
                     LTFVAICCVMVAFGGFIFGWDTGTISGFIRQTDFIRRFGQTRSDGTSYLSNVRTGLVV
                     SIFNIGCAIGGIVLTKVGDVYGRKIGLYFVVTVYIIGIIIQIASINKWYQYFIGRIIS
                     GLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQW
                     RVPLGLSFAWALFMIIGTSFVPESPRFLVETGRIEEAKRALAKTNKTSPDSSFVLVEL
                     EKYEAAIEAETVAGKAGWSELVTGKPQMFRRTIIGMMIQSLQQLTGANYFFYYGTTIF
                     QAVGLSDSFETAIVLGIVNFASTFVALYVVDRYGRRNCLLWGCVGMVCCYVVYASVGV
                     TRLYPNGQSQPTSQGAGNCMIVFACFFIFCFATTWAPIAYVIVSETYPLRIRGKAISI
                     ANACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYFFVFFIVPETKGLTLEEVN
                     EMYEENVLPWKSSAWIPPSRRDANYNVDQLKEDKRPWYKRMPGQNKDKDRDAKGEVGQ
                     ERDTKSPWYKKFSKKTSEV"
     gene            complement(<357847..>359187)
                     /gene="TPHA0H01580"
                     /locus_tag="TPHA_0H01580"
                     /db_xref="GeneID:11533852"
     mRNA            complement(<357847..>359187)
                     /gene="TPHA0H01580"
                     /locus_tag="TPHA_0H01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686750.1"
                     /db_xref="GeneID:11533852"
     CDS             complement(357847..359187)
                     /gene="TPHA0H01580"
                     /locus_tag="TPHA_0H01580"
                     /inference="similar to DNA sequence:INSDC:YDR346C"
                     /note="similar to Saccharomyces cerevisiae SVF1 (YDR346C);
                     ancestral locus Anc_5.397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686798.1"
                     /db_xref="GeneID:11533852"
                     /db_xref="GOA:G8BX60"
                     /db_xref="InterPro:IPR013931"
                     /db_xref="UniProtKB/TrEMBL:G8BX60"
                     /translation="MLKWIQGGLSAVTGIAEPEYGKEYIHPATERVVEEKRQPFVELK
                     KEDVDWINPDHTNVETATFYFSNLDTGVLGFAQIIHSNIIGYITQAQFTFRIYDSRNP
                     GNLNLWTSTKLENFKIEGPNFYADNLSLELNEENTEYHFVSSVNDDSKIDLTFTRLVP
                     GVKVGDNSTTYYGDNIEEPWGTMRHVFWPRNSVVGTIDLKKPIEVKSATNGESETQDN
                     EEGQEENDQDESESNEEIQKEDINIKFTKEYPVYSLFIMAVQGMKPHHAAKTWNFLNF
                     HSEEGSTVLIEFTTPKSYANTKVSIGIVTSKEDILAVTVDNNYEHLNSEVDEIGWKVP
                     KNIQVTLNGIKSNISDEQVAGGELTDADKFTAVYEAKLEQLVERVDVMSEIPQFVKNI
                     VSGIAGTKPYIYQYANIEDCTLKINEKSIKGLGWMEVTFISESDAITEESYNEN"
     gap             359297..359370
                     /estimated_length=74
     gene            complement(<359889..>360767)
                     /gene="TPHA0H01590"
                     /locus_tag="TPHA_0H01590"
                     /db_xref="GeneID:11533891"
     mRNA            complement(<359889..>360767)
                     /gene="TPHA0H01590"
                     /locus_tag="TPHA_0H01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686751.1"
                     /db_xref="GeneID:11533891"
     CDS             complement(359889..360767)
                     /gene="TPHA0H01590"
                     /locus_tag="TPHA_0H01590"
                     /inference="similar to DNA sequence:INSDC:YDR348C,YHR097C"
                     /note="similar to Saccharomyces cerevisiae YDR348C and
                     YHR097C; ancestral locus Anc_5.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686799.1"
                     /db_xref="GeneID:11533891"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="UniProtKB/TrEMBL:G8BX61"
                     /translation="MTSSQYSKFSRSLGDLSNIKEIPLSTDEKRRQHVRYKVGNNSHS
                     NNNLKRRKAYQRGKEHSSELREQDRSGEVPSNDRNQRKIKRAESLERHYKTTPRRSNS
                     FSHIEKDGSDYEIASNEKTFSRPRLQSGKCDRIDELDVTATFGRLFHHEGPFDAVAAY
                     TNMNYKVAPIYAFPPDGANNTLGPLRKTRFTGIAKSDLYYRPRFLYDNELDMSGNEEN
                     NQYNSLYDNPDNSSSSLCCFDSKTNVKKVNGPATAGLGSSTFIDGCPASRNEVLKYYT
                     QEKANKNKHLQFFKKS"
     gene            complement(<361686..>364577)
                     /gene="TPHA0H01600"
                     /locus_tag="TPHA_0H01600"
                     /db_xref="GeneID:11533892"
     mRNA            complement(<361686..>364577)
                     /gene="TPHA0H01600"
                     /locus_tag="TPHA_0H01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686752.1"
                     /db_xref="GeneID:11533892"
     CDS             complement(361686..364577)
                     /gene="TPHA0H01600"
                     /locus_tag="TPHA_0H01600"
                     /inference="similar to DNA sequence:INSDC:YHR098C"
                     /note="similar to Saccharomyces cerevisiae SFB3 (YHR098C);
                     ancestral locus Anc_5.400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686800.1"
                     /db_xref="GeneID:11533892"
                     /db_xref="GOA:G8BX62"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BX62"
                     /translation="MTMTTNTMGSAAATHNLGIRADHRRNKRQARALHQFPTAALNGI
                     NNQFSQSPVIGLDNSSIQSGMNTLSDFLSNGSSSGVTPNSATPVLMNDKMNSFTPKQF
                     SATSFETPVSMLSPSKSQAPDSYNSPYVQLDFESLTIHDMSPIVPTQRWEDQLVYLTK
                     SYGTNSSKIPPLPSTQFYCHEEDGNCDPRLLASSMCTIPAEESLREATKLPLGLTVQP
                     FTRTIPTEEISVIKLNNSTVTPSILTENYEVGPLRCRRCRAYLNPHFQFTFDSAVICN
                     ICNVKMKLANEQVAPIDVDGKRSDYSIRPELFKGCVDFEVPSLYNAIPDKETLPLHYL
                     FLIDVSTRSIENGGCISFIHSVKRSINYIRENQPNCKVAIMSYDKNIRFYELDPSFER
                     CREYIVSEIDDCFIPFNSFFFASTIESQNIIETTLDQLASTIENHMDLHLSDNCYGSA
                     INAAKLAFDTFLGGQGGKIIAQLGSQPTIGSGKVNTLNEKAGKTSLKPDLSFYKDLSK
                     SFNKSFLSLDLYVTAQSFVHLANVGYPSIATSGVVKYYGMFTYERCNFILCKDILHNI
                     SIIKGYQAQLKIRASNGLSINKYFCESNNNSDEDPIIPVITSSTVVDVLLKYSDKLKK
                     DTKLFIQAALLYTDINGVRKVRVINTSAPSSSSMTTIFKFVNQNVIMRLMIRQLLLKS
                     HSLDFASMKKSILEDLSSVAAQYRALISGNSNKQFVTADTLMTLPTFMLGFQKSKVMK
                     STIQKTFNNDRISDYFKYFTMNQSELSYKLYPQIIPLHIPLAGGDLSFYDANYQLLRI
                     SVGSLENLTVRNSMSQIVNGGAYLIFNGEIVYLWFNENTNRSLLEDLLGVPATIPIEQ
                     IKLVENKLRKTGTRINKKVAETMRYWSQIVNKRYIPLVPLRPQIDSYYPNVIGSILIE
                     DYSMSKMDSLNEFTASINNLSSTKIQNKQFIKTSGNEELDITHQKFVQF"
     gene            complement(<366969..>368024)
                     /gene="TPHA0H01610"
                     /locus_tag="TPHA_0H01610"
                     /db_xref="GeneID:11533875"
     mRNA            complement(<366969..>368024)
                     /gene="TPHA0H01610"
                     /locus_tag="TPHA_0H01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686753.1"
                     /db_xref="GeneID:11533875"
     CDS             complement(366969..368024)
                     /gene="TPHA0H01610"
                     /locus_tag="TPHA_0H01610"
                     /inference="similar to DNA sequence:INSDC:YHR101C"
                     /note="similar to Saccharomyces cerevisiae BIG1 (YHR101C);
                     ancestral locus Anc_5.404"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686801.1"
                     /db_xref="GeneID:11533875"
                     /db_xref="InterPro:IPR024722"
                     /db_xref="UniProtKB/TrEMBL:G8BX63"
                     /translation="MYKLWVTLYLSLFSLIAHASNDFLPQTDVPALIFAQKLVLDLPN
                     LPDRYEQIQILPKTSFMSLVGDIIDSCSFDAFIFINQPHLRKSDFPNYSNSFVSLRNY
                     LTQSSTAFRFEKVELLDNSTFELFAQDLEDVCSIKEFVKVTEKEDYVFTPYLDTEKRI
                     IRVDLPELPENTENEPFLRSNQIFENDKLVRSILGKIPSPYYAVVYTSLNPGNIATHD
                     NASPIRIFSDIFKKGKFYKRDLTKNNRKFDAPPSVHNYKPKFDKMSDSYVTVFDKEFI
                     EKHLPTLKTIVTVFTLFLMQQLIQFFQSNKTSNKFDEKPKKKQVTKKESKRNVMEPKN
                     HEIEIVEENVEVEPNTE"
     gene            complement(<368563..>370677)
                     /gene="TPHA0H01620"
                     /locus_tag="TPHA_0H01620"
                     /db_xref="GeneID:11533876"
     mRNA            complement(<368563..>370677)
                     /gene="TPHA0H01620"
                     /locus_tag="TPHA_0H01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686754.1"
                     /db_xref="GeneID:11533876"
     CDS             complement(368563..370677)
                     /gene="TPHA0H01620"
                     /locus_tag="TPHA_0H01620"
                     /inference="similar to DNA sequence:INSDC:YDR350C"
                     /note="similar to Saccharomyces cerevisiae ATP22
                     (YDR350C); ancestral locus Anc_5.405"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686802.1"
                     /db_xref="GeneID:11533876"
                     /db_xref="UniProtKB/TrEMBL:G8BX64"
                     /translation="MLRRSLKLQLCPVKYLSGVSVLESDARSKVRSLVANEGIKKFLK
                     PNSQSTKDLANIIETTENIKEINAVKNILMRKFKNCYSPLSINIISESKNKLFMKLML
                     LRSVGKTFDSVLLELAREIINDQALPITVKKEKLYELIEFLAEAHPVYMKKNGWILPS
                     IMHEWFWENIQRNESFQHYHFLIEHKVQLSSCKYIIYFCRRLLLGSEAERNLASFKLF
                     LGDPLQEKKYLTLFKKSYSMETIIMIINNNIKSKDLRYIDKYFSILLKKTESISSGNQ
                     EEDIGRMLYADISFIKFSNCLLYYLAATKNVSIFIETFLLNIERINKLRSTDFSSYNG
                     DTEKFNKTLSRESQKAISMLLKIIQENGLQEEMFGVLSFLPDKSYVQNLRFTKHLIGR
                     LLKAIAQFNDSKLLLNYIISSYRSKKTAMIVNKLGLWGHILYNDTKLIEHTTLMNDIK
                     KFERNIVPKTLSLPSVPGPHVLNLLYLVVLTINSKVLKKEEFQNLIIDLYEKYKETMF
                     SLIKGKTYWRSNTSVLGIFLHQIRYVLKDPKLAYNILMDFYGCGLGKKMSHKGTSSVF
                     SLVVYNNHTINMLEINKVLDIMEALKVPLDLKFCIDMVLRNLKKGDTEVAHDWYKKIL
                     GARFQIKHMKLIQHIVANNWEFPEDFDMNLLQLLNQEISNNTEEMLFDENDHTIDYNN
                     FKPTILASMHKLFKKDIKTLNS"
     gene            <371333..>374443
                     /gene="TPHA0H01630"
                     /locus_tag="TPHA_0H01630"
                     /db_xref="GeneID:11534160"
     mRNA            <371333..>374443
                     /gene="TPHA0H01630"
                     /locus_tag="TPHA_0H01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686755.1"
                     /db_xref="GeneID:11534160"
     CDS             371333..374443
                     /gene="TPHA0H01630"
                     /locus_tag="TPHA_0H01630"
                     /inference="similar to DNA sequence:INSDC:YHR102W"
                     /note="similar to Saccharomyces cerevisiae KIC1 (YHR102W);
                     ancestral locus Anc_5.406"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686803.1"
                     /db_xref="GeneID:11534160"
                     /db_xref="GOA:G8BX65"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BX65"
                     /translation="MATSRKVNNPNTNKEETFLQTTDNVTTIAPKHTLAQSQDSDVCS
                     SFRRTEVIGRGKFGVVYKGYHVKTQQVYAIKVLNLDSESDEVEDVQREVQFLSSLKQF
                     PNIIRYFGSYLKDTNLWIIMDYCAGGSIRTLLRPGKIDEKYIGIIMREILIALQYIHK
                     DNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRRQTMAGTPYWMAPEVIMEGA
                     YYDTKADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRSYSTSLKEFI
                     ALCLDEDPKERLSAEELQKTKFIKSQRAVPTTILKELISRYLLFRDKHTPREHSYADD
                     LGNNKESEVNYKNQDVAVAEPATDAKPDDMDVKWDFDSLTSTDYIMENDINVDIIPEE
                     NSNDWSKTEGDQFNFAYPDEDPYYFGHTNNNNTHHIRKTYQESTMGKQYHATFMKNST
                     LNAYNGQTHTTTNNFTSNLQRTGLGNNGMMGTHATHTTANKATESRATKQLLQLFEDS
                     DVITEERSIDNDIYNIQKPHSLVPPQDLQSNGVTNPPSSILRPQLNMINGPNIASHST
                     QSLPVLQTKFSKNMTGPGNVVTSAATPIEIEIPEELPVSSIKVPSNLDTPIETKTRSA
                     TVSASNLNHTNHPNLYRRLTVTGNNNNASAPVINRKDSQLGKGHSDDPSNFSKVHRRT
                     PTPPNNSVTSSNQSPAKMLTASPNGNSSSIYHSSFKSAPIPLIESKDSFVQSANNGAS
                     LGTSLEGETSRVKRDFKLNNPNLKLHMPSPTNITSNKLLVNTTQIGDSPGIGGENINQ
                     FGFNTTSTANIPVSMTPINEKHMDFGSKIKRSQSLSKVKSSTIHDNTGTPGVVNRSKK
                     PSSNTTNSIGSIGSEQAESTTLSNESQLNSSSTAGSHVALNQSLSNIYNSATSVWNGN
                     SNNLSGANPKLCMSMPPVSIPTELFLDFDLKNPSNKNEYVWQDQKTRVLDELKSLLTL
                     FDDNLLVLESSLKKQLHSVEKAIPSNTSMQLTAVASHPEMEEEANEAGTPETINNLSN
                     EQEASL"
     gene            <375668..>378193
                     /gene="TPHA0H01640"
                     /locus_tag="TPHA_0H01640"
                     /db_xref="GeneID:11534161"
     mRNA            <375668..>378193
                     /gene="TPHA0H01640"
                     /locus_tag="TPHA_0H01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686756.1"
                     /db_xref="GeneID:11534161"
     CDS             375668..378193
                     /gene="TPHA0H01640"
                     /locus_tag="TPHA_0H01640"
                     /inference="similar to DNA sequence:INSDC:YDR351W,YHR103W"
                     /note="similar to Saccharomyces cerevisiae SBE2 (YDR351W)
                     and SBE22 (YHR103W); ancestral locus Anc_5.407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686804.1"
                     /db_xref="GeneID:11534161"
                     /db_xref="UniProtKB/TrEMBL:G8BX66"
                     /translation="MTVAGDMKIVSSTTNLDVLREGKFFSSSKDSSNNDTCGNLKIPN
                     VNSPRSRAVSLTSSNGSRASNGIRTVDLNHVARRPSDNLLFNSLLENDNELNNTYADL
                     HPPQLNKYINDGSNTKKNRPISNDSIYTRSTEVFSSHSSTGTISRSSSNVEADDMHTN
                     ETQNSSLEQPQKTNFYFNATQGSVNHGSYISRAASQPNIPSSENMNYYKKSNTNNQTI
                     NNQSNIIKTQIASHHNTVGSTNYNGFKSTPAITEHTNSHKEKPHMPALTPSQRYRLRK
                     VNTESSVRRTAKEKEKYYVENDVNDNLDVDDIDDSLIWDIPMASFSTTSFLNRKKSLK
                     KKGNRTMENLTYSDSSKTSKSSADQNTTTTNIVKNNKYLARNGSKRQFNSNYDFFEMP
                     ITPIPGISKQSDLKYIHDTTSNLSSMYLHSSIKLSGNKMSTRAQSVDFLPLEFKENSQ
                     NGFEDLLTVSEDKLNLVSNSRPYWLPPKDANEKITQERQISKTISIASIEQLDKNKFT
                     ETRMKNDLVNHNKVLSLLEKGLTRNSSIQSLKSIIWETGLTKDIRISVWSQLCQDNEK
                     FVSKHFFESFEDLNSILRKMDFPLVKQREIEKLIENNISMKLSGKYPISDKLLYLLKL
                     KSISKEGVLPGDDLLFHHLLIEYFGNDSISECNTKAAESLLKEIWELVNLFQLICFND
                     KVKEKYDYHIMDRYGVVGHYIANNKYFQEEYNISCLNIGNFWHILERIDHNLFLWIVD
                     IIIVLNSQAIEKKTYSQLEQEYKGKSWDHYRSKNIVSNYKILLSLTLDVLLNYHFGFN
                     DLIKLSFLEDKNFCIPMTIDEKMDENDVNALFIKKWLHYYKKF"
     gene            <378693..>379715
                     /gene="TPHA0H01650"
                     /locus_tag="TPHA_0H01650"
                     /db_xref="GeneID:11533867"
     mRNA            <378693..>379715
                     /gene="TPHA0H01650"
                     /locus_tag="TPHA_0H01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686757.1"
                     /db_xref="GeneID:11533867"
     CDS             378693..379715
                     /gene="TPHA0H01650"
                     /locus_tag="TPHA_0H01650"
                     /inference="similar to DNA sequence:INSDC:YDR352W"
                     /note="similar to Saccharomyces cerevisiae YDR352W;
                     ancestral locus Anc_5.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686805.1"
                     /db_xref="GeneID:11533867"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G8BX67"
                     /translation="MIRWASDATICHYISLIFSGISFFSSFIALFPQILQTYNDKSVE
                     GLSFLFLSSWVLGDTVTLIGAILTDQLTFQVILAMYHLSNDLLVCGQYYYYGILYKNQ
                     YSGLHKNNRYKFNNNKSSSNFNIFTAVVGFFSQITRARASSGTSTPVGNNDKIGYILS
                     WLGATFYVFSRLPQLIKNHKRKSTDGISPFLFWMIAISNVAYNISILTSVEFVMNDNK
                     ADFILNELPFIIGNSGTVIFDMVYFYQHYYLYRGNRNKAVDITEDHEMNVEAGPVFEL
                     KEETSALQKVKSKSRDPIPVILQGRDIELTTLNSNDMKIKNKIEKEEQEINRYKSNTN
                     DDNTTE"
     gene            <381171..>382133
                     /gene="TPHA0H01660"
                     /locus_tag="TPHA_0H01660"
                     /db_xref="GeneID:11533868"
     mRNA            <381171..>382133
                     /gene="TPHA0H01660"
                     /locus_tag="TPHA_0H01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686758.1"
                     /db_xref="GeneID:11533868"
     CDS             381171..382133
                     /gene="TPHA0H01660"
                     /locus_tag="TPHA_0H01660"
                     /inference="similar to DNA sequence:INSDC:YDR353W,YHR106W"
                     /note="similar to Saccharomyces cerevisiae TRR1 (YDR353W)
                     and TRR2 (YHR106W); ancestral locus Anc_5.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686806.1"
                     /db_xref="GeneID:11533868"
                     /db_xref="GOA:G8BX68"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:G8BX68"
                     /translation="MVHHKAVIIGSGPAAHTAAIYLARAEIPPTLYEGMFANGIAAGG
                     QLTTTTEIENFPGFPDALTGSELVERMKQQSTKFGTTVVTETVSKVDLSSRPFKLWTE
                     FNEDAEPVTTDALILATGASAKRMHVPGEDTYWQKGISACAVCDGAVPIFRNKPLAVV
                     GGGDSACEEAEFLTKYGSKVFLLVRKDHLRASTIMQRRVEKNPKIEILYNTELKEAKG
                     DGKALQSLAIFNNKENTNSDLPVNGLFYAIGHTPATAIVKGQVDQDEVGYIKTVPGTS
                     LTSVKGVFAAGDVQDSRYRQAITSAGSGCMAALDAEKYLQELDE"
     gene            <382497..>383675
                     /gene="TPHA0H01670"
                     /locus_tag="TPHA_0H01670"
                     /db_xref="GeneID:11534018"
     mRNA            <382497..>383675
                     /gene="TPHA0H01670"
                     /locus_tag="TPHA_0H01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686759.1"
                     /db_xref="GeneID:11534018"
     CDS             382497..383675
                     /gene="TPHA0H01670"
                     /locus_tag="TPHA_0H01670"
                     /inference="similar to DNA sequence:INSDC:YDR354W"
                     /note="similar to Saccharomyces cerevisiae TRP4 (YDR354W);
                     ancestral locus Anc_5.413"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686807.1"
                     /db_xref="GeneID:11534018"
                     /db_xref="GOA:G8BX69"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /db_xref="InterPro:IPR017459"
                     /db_xref="UniProtKB/TrEMBL:G8BX69"
                     /translation="MKRLQNRIVIEKMGEQKLVSYTKKLLLHPPTLTPSELYDAISLI
                     LGALEKHDGIDLSDESMLKEYVQISSFLTSLRTTGLDHKAEYISKAAEAVVQHSDLVN
                     PDTLTGNITKDCTVLDIVGTGGDGQNTFNVSTSAAIIASGIPNIKVCKHGGKASTSNS
                     GAGDLINQLGCDSSKLNAQSVPKIWNDEKNTFIFLLAPYFHNGMKYAANIRKILGIPT
                     IFNVLGPLLHPVNSVNKRVLGVFSKELAPEYARAAKLVYPNSEVFVVWGHVGLDEVSP
                     IGKTTVWHVGSVSDEIESFDLEPSMFGLQEHDLSECVSLGPKENAVLLRDEILSGKYK
                     LGDNHPIYDYIILNTAVLWCLSQSNRDWKKGIEIANESIQSGSALRSLDYFITSVQNM
                     "
     gene            <384306..>387275
                     /gene="TPHA0H01680"
                     /locus_tag="TPHA_0H01680"
                     /db_xref="GeneID:11534019"
     mRNA            <384306..>387275
                     /gene="TPHA0H01680"
                     /locus_tag="TPHA_0H01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686760.1"
                     /db_xref="GeneID:11534019"
     CDS             384306..387275
                     /gene="TPHA0H01680"
                     /locus_tag="TPHA_0H01680"
                     /inference="similar to DNA sequence:INSDC:YDR356W"
                     /note="similar to Saccharomyces cerevisiae SPC110
                     (YDR356W); ancestral locus Anc_5.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686808.1"
                     /db_xref="GeneID:11534019"
                     /db_xref="UniProtKB/TrEMBL:G8BX70"
                     /translation="MSQSKEHSQRIASLEFTPIGQAKQAPKRPLESPTHNNGTEDIRD
                     TTLNSPPRKYQKINPDDTLNSVNMFNESLEFDEVIPELSNTILSNSDINRRDSNEIIG
                     RNLVNELKENASTSNPLKEQQEQIQSLIKENYNLKAKVTSLLKYLNTVMNKGELQKTL
                     PLLDEINELKVLSGKKDRKIQEIKIKCDDLVTQNNILIRKSRELEALVASKNESATNS
                     KEIDIINGKNQKIIEELETKLSNAKEDVANELNMTISELNDLKIRYNKFEKTIMEKDK
                     LINAKDDLISSLEGNLEEITTEVENLQDLLRKKEEVIKEYKDKCNTMLEKNHDDDNNE
                     QFMLVQDELNMKLSEIENLELELNDLKDLNTKLKESLNDKENELTNVSSEYEKYKLDA
                     EAHMGIMKDSDDKLKNQVIEIRKKNIELNSKLLQMNEVNENLNDELMSLKDIIEKLEQ
                     DKKAKLQELKSLKSSDISQIEDLKQNNLTLERKLKENLDEKNVEINKLRRQHVDMQKT
                     NSALVDKLTKESQSLRKEYEDKINDLENQLKSNITDLSTNKDLLAVEYNSKMDKLNKE
                     LEENKHALKTSEEIIKDLKNQLIENVTNSSQKLAKLTEAKNSEIESLLSQMESLRNKY
                     RKKTETLINEQEEERQSYIRKLREEKLSTEREKDNYDKLLLQFNSEKNAIINSKKELE
                     DNLNNKINSLEKLLQQTSSTDVELETLKSELRGKELEIKELYKKVKSVTDSKEELNSD
                     YLKIRSINRELKVELKKIVDEYNDIAKKYRTLNDEFINNSKAKNGLEEAKANLLILQS
                     KYNMMKKDFLNRLEELGKENVELENKVNLLSSGSRPSTSEIKFEDSTSQNRADYYRLK
                     YNNEVRLNNDLRVMNDYLNRVMRASSQQLRLDLLKLGNEKNSNYLDIYDNIVRGKTDI
                     NGDYDPYYSSHNYPPTRNDFLSNDRKAYRRKFKSIAMMILSCIRMRNVASTSRMNKMK
                     VDYLQKKIAMDNDRITW"
     gene            complement(<387491..>387844)
                     /gene="TPHA0H01690"
                     /locus_tag="TPHA_0H01690"
                     /db_xref="GeneID:11533853"
     mRNA            complement(<387491..>387844)
                     /gene="TPHA0H01690"
                     /locus_tag="TPHA_0H01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686761.1"
                     /db_xref="GeneID:11533853"
     CDS             complement(387491..387844)
                     /gene="TPHA0H01690"
                     /locus_tag="TPHA_0H01690"
                     /inference="similar to DNA sequence:INSDC:YDR357C"
                     /note="similar to Saccharomyces cerevisiae YDR357C;
                     ancestral locus Anc_5.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686809.1"
                     /db_xref="GeneID:11533853"
                     /db_xref="UniProtKB/TrEMBL:G8BX71"
                     /translation="MSNTKMENTSAEHVESKDNLGVDKLNVDFDYLLYKIKDYISTIE
                     LQTNEMCRKRHQLITKDIIEDIVDKNIADFKELLAKCEDLENYYNMLDQIEVITGTFE
                     ERLNQIVLDYSEIDQ"
     gene            <388393..>390069
                     /gene="TPHA0H01700"
                     /locus_tag="TPHA_0H01700"
                     /db_xref="GeneID:11533854"
     mRNA            <388393..>390069
                     /gene="TPHA0H01700"
                     /locus_tag="TPHA_0H01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686762.1"
                     /db_xref="GeneID:11533854"
     CDS             388393..390069
                     /gene="TPHA0H01700"
                     /locus_tag="TPHA_0H01700"
                     /inference="similar to DNA sequence:INSDC:YDR358W,YHR108W"
                     /note="similar to Saccharomyces cerevisiae GGA1 (YDR358W)
                     and GGA2 (YHR108W); ancestral locus Anc_5.416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686810.1"
                     /db_xref="GeneID:11533854"
                     /db_xref="GOA:G8BX72"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:G8BX72"
                     /translation="MSAIYLTDAPVRRQHTSGNPLLRKIQRACRISLTEPDLALNLDV
                     ADYINEKQGATSRDAIITIARLINTRDTHTAVFAIALLDVLVKNCGYPVHLQISRKEF
                     LNELVKRFPEHPPLRYSKVQRLILTAIEEWYQTLCKHASYKDDLGFIRDMHRLLKYKG
                     YVFPKLDESQLSVLKPNNNLKTASEIQKEQEIAQAAKLEELIRRGKPEDLKEANKLMK
                     IMAGFKEDNVVEAKQAVVHELNKLKRKADLLNEMLNSGDLDLNNETIQELYGSLKSAQ
                     PKFQKIIEEEQDEDNGLVQDLLKFNDNVNQILEKFTLLKSGDSQGASQINPENLSTAI
                     QMNQGGALANEINLLDFDDNTESSSPAPESMTTNTQPVDPLTDLLGDLNDLNITTPAA
                     STPNFGLGGDISLGSAQPTSAVTNSTAAQSDAFDLLGDFSSSIPPTSAQTQSRVLVNQ
                     SENVKFEFEVVRENQNSLKIKSFFSNLSSSPLTEVAVLLAAPKTMSLRLNPQSSSTLR
                     SFINDGITQSIWIDNAQANAPKPVKLKWKVSYKINGSPVEETAVFTLPNI"
     gene            complement(<390358..>393969)
                     /gene="TPHA0H01710"
                     /locus_tag="TPHA_0H01710"
                     /db_xref="GeneID:11533847"
     mRNA            complement(<390358..>393969)
                     /gene="TPHA0H01710"
                     /locus_tag="TPHA_0H01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686763.1"
                     /db_xref="GeneID:11533847"
     CDS             complement(390358..393969)
                     /gene="TPHA0H01710"
                     /locus_tag="TPHA_0H01710"
                     /inference="similar to DNA sequence:INSDC:YDR359C"
                     /note="similar to Saccharomyces cerevisiae EAF1 (YDR359C);
                     ancestral locus Anc_5.417"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686811.1"
                     /db_xref="GeneID:11533847"
                     /db_xref="GOA:G8BX73"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:G8BX73"
                     /translation="MPSDYNSGSTTRNSSNKSLSTAVADVSSEMLSSRTNVTKSSIDN
                     SDSDTPEGQSLNKLLRQRTNNLIELYCISRLHDLLNINDEDKFKEDLKEFLDTNDYNK
                     NGPFNNDNIPNFSQLIPITSLSSATSQSSSSSSSPPYNESITNNNVIVNEKRGKNIRQ
                     NKVSNAFKTYKDQSTLIPSTSGDSNAKKRSIDESNNDLIHEQNEEDNYKKTKLQGTTN
                     SSSYVISSTGEIQQTTKIVTNPDDNKIIQNKEKMEGARKRNLYLMSGSSHLQPSSTLD
                     HGIPREYTTVSSVKAEPTPVTITPKSYSNNMLFEMKSKHNESVDFFDKNNINSNESIY
                     LLMKENVPSKIPQALPLAELKYLAHTLPLIKLLPMSHKALTTDIISSALNEGRITVVA
                     SRIEELRRLGLWSLRQPKKFIDPWGNQVTHNRVMLEEAKWMYENFKEDKYYKMAMCAT
                     VAQAISDYWNYGKRCCVKVQPIQHLPSVRIEKEEIKELSKCDDNTNVAKDEFIKGDHG
                     NDNTITEKDTKENNHRGEINNNESEITDEISRSLEIETKENIIVTPTSINDNLEDAVA
                     NEHNKSKLDGIQKEKIQLNEEPESKSLELDLKTTENAPELLSDIDSAVPDIISDESTN
                     TIAIESNPQAIFNPEVELDTLSKGDQDEKEIEEQFTYSPFKLFLQYNELSSLEQTIVQ
                     AASPYSGLLESASQLPDQMSFVQISKSLVTLDDDHYFKIVERQLVDEEQSLVQLSKRR
                     GIFYGNRRSHYLKPPAAPSLKYLTSRTPTIWLPEDDEELVKNINAYAYNWELIAAHMF
                     PHPRDSYISNIERRTPWQCFERFVQLNEKFNFNDLKGPKAHMAQQWLIEAHKFQQKQN
                     RRISPLGVGTESIQRGHKRLRWASMFDAIRKCIKKRENSPRPNPTQQRKPLDIKSMKV
                     PTPAEMSNLKLQRDEALRRDIQMRRNVKSRLQQQQQQQQQHQQGQQLQQQQQQQHLQQ
                     KQIPLATQQVQTSNSEPLNNFTNNIIPNNSSNVNVVNHISQNSQNFLPQQSNILAEGV
                     KATPQQSMPSSNQVSSAHTTGRKQFTEKEIIETYARKILQQKPEITPEMAIRAAHNYL
                     KNFKQQQLRLHQAQQLQTQTLQNEQANQAMNSGNQGGTGQISVNNMNNLRLSLDSGLS
                     PSSQLKQLSSNMNNNNGFNLPETPNIHLNNGNFTSSSSNNQSMNSPTPQEILQRLQK"
     gene            complement(<394677..>395504)
                     /gene="TPHA0H01720"
                     /locus_tag="TPHA_0H01720"
                     /db_xref="GeneID:11533848"
     mRNA            complement(<394677..>395504)
                     /gene="TPHA0H01720"
                     /locus_tag="TPHA_0H01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686764.1"
                     /db_xref="GeneID:11533848"
     CDS             complement(394677..395504)
                     /gene="TPHA0H01720"
                     /locus_tag="TPHA_0H01720"
                     /inference="similar to DNA sequence:INSDC:YDR361C"
                     /note="similar to Saccharomyces cerevisiae BCP1 (YDR361C);
                     ancestral locus Anc_5.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686812.1"
                     /db_xref="GeneID:11533848"
                     /db_xref="GOA:G8BX74"
                     /db_xref="InterPro:IPR025602"
                     /db_xref="UniProtKB/TrEMBL:G8BX74"
                     /translation="MVQAIKLSELTNRKRPAGDGANADSESDIDISSTDSENENENEE
                     AGDEEIVNIDFDFFNGNIDVDFHAMKNLMRQLLGPQESNKVQLSALADLILNSPTTTI
                     KTDGPESDPYCFLSFIDYKENRDSDWSKYLQNLDIRLKTFLKTIDSSNKKCALVASER
                     LINMPPEVITPLYRITLEDVQNSLGDGQHYDFYVILSRKYEVNVDADETTSDRNKKRV
                     KSDEIEYYHEEDRFFEKYSQIHFDSESRKGIISTYIVINHENLLKAINEFETEVAKW"
     gene            <395984..>397282
                     /gene="TPHA0H01730"
                     /locus_tag="TPHA_0H01730"
                     /db_xref="GeneID:11533998"
     mRNA            <395984..>397282
                     /gene="TPHA0H01730"
                     /locus_tag="TPHA_0H01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686765.1"
                     /db_xref="GeneID:11533998"
     CDS             395984..397282
                     /gene="TPHA0H01730"
                     /locus_tag="TPHA_0H01730"
                     /inference="similar to DNA sequence:INSDC:YHR111W"
                     /note="similar to Saccharomyces cerevisiae UBA4 (YHR111W);
                     ancestral locus Anc_5.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686813.1"
                     /db_xref="GeneID:11533998"
                     /db_xref="GOA:G8BX75"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028885"
                     /db_xref="UniProtKB/TrEMBL:G8BX75"
                     /translation="MEQLRKEIENLREENAKLRSQLSESKVNNESLSLTEYQRYGRQM
                     IVEESGGLRGQLELKSTRIVVVGAGGLGCPSLQYLVGAGVGHIGIVDNDTVEASNLHR
                     QTLHDTSRVGTLKCESAKQKLNLLNPFVDIKTYPVRLTSENAFEIFDGYNYVLDCTDS
                     PATRYLVNDVAVSLGITVISASGVGTEGQLCILNFKNQGPCYRCFYPTPPPPNSVSSC
                     SEGGVIGPCIGLVGVMMAIETLKLIYGVYTIENFKPFLMSYSGFPQQSLRVFKMRGKQ
                     TTCKCCGSDPKITKETIESGEINYTEFCGQRNYNVCSADERITVKQYHSEYIESLEKD
                     HILIDVRPSHHYDISHFQHSINIPLKELKNMHGSLDKLKERIPQLQENTNLVVLCRFG
                     NDSQLATRIFKDEFKIKSVKDVKGGFFKYIDNINQDIPKY"
     gene            complement(<397344..>399305)
                     /gene="TPHA0H01740"
                     /locus_tag="TPHA_0H01740"
                     /db_xref="GeneID:11533999"
     mRNA            complement(<397344..>399305)
                     /gene="TPHA0H01740"
                     /locus_tag="TPHA_0H01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686766.1"
                     /db_xref="GeneID:11533999"
     CDS             complement(397344..399305)
                     /gene="TPHA0H01740"
                     /locus_tag="TPHA_0H01740"
                     /inference="similar to DNA sequence:INSDC:YDR362C"
                     /note="similar to Saccharomyces cerevisiae TFC6 (YDR362C);
                     ancestral locus Anc_5.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686814.1"
                     /db_xref="GeneID:11533999"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BX76"
                     /translation="MSTRRTSRTTKAQKEGASDILSISSPVSDKPLISTSDITATAKR
                     ALRTKIKVDPSIDASIFEEQASENDDDDDFVIDNNDNGDTNGDDISFSEVEELVQKTP
                     ASKKRRITKNSIPTNKKPKSSINAMQNKNNRVVRGFKDLTSQRAKLGRLFGNNEEKLL
                     TLAKAKEAFEGSAFSFPTENVQKGSKYYLDYKPLCSVQSDTSVEELTNIFGVSKNHTK
                     YIQLTEPEMFEKFNYSKDKLGVIIGEVQHFLNVGDKLEFPVFNNNNRKGFVYNAGGLV
                     TDMAWLTNENLDSSEQYLAVSISKIHKNPSDKRLMLFEKECHYSSIEIFKLHTISLKF
                     DKVQTIIHNFGETWNLKWHEGFNEVSTSNDYIGLLGFCCQEGSVKLIEINRNENLIIT
                     ELESPSFSFSIPEYLITSFDFLSPTAIVCGFNSGHLAEFVLSETDLPSYFIKVTESYI
                     VNISVGYSKFENPVIATISIDGNMHIFDPKDIFSSKCTLNRFKGDISLPLTYLPNLYA
                     FIYSDSGNSTKFITPKAQFPLQISSLDANVTSFGSSRLHPFILSAGSDGIIQIDNVAR
                     KIFDSLKKTNSHKTLRLWKWDYSKRDNLYKLNHHYEAKKMVSNEVFNCKLNPHGINIT
                     TVKWNENRAGCKFYAFANAAGFLTFEELE"
     gene            <400461..>401936
                     /gene="TPHA0H01750"
                     /locus_tag="TPHA_0H01750"
                     /db_xref="GeneID:11533837"
     mRNA            <400461..>401936
                     /gene="TPHA0H01750"
                     /locus_tag="TPHA_0H01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686767.1"
                     /db_xref="GeneID:11533837"
     CDS             400461..401936
                     /gene="TPHA0H01750"
                     /locus_tag="TPHA_0H01750"
                     /inference="similar to DNA sequence:INSDC:YHR113W"
                     /note="similar to Saccharomyces cerevisiae YHR113W;
                     ancestral locus Anc_5.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686815.1"
                     /db_xref="GeneID:11533837"
                     /db_xref="GOA:G8BX77"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:G8BX77"
                     /translation="MLKLHLRKMSSSSSQNYAQDFVNFLNASPTPYHAVHNMKAHLLK
                     YNFKELKETEAWEFGNQIQPKGKYFVTRNNSSIIAFVIGNKWTAGNPIAITGAHTDSP
                     VLRIKPISNKVKEKFQQIGVEVYGGGIWHSWFDSDLSIAGRVMCKDEKSGKIVSRLVD
                     LKKPLLKIPTLAIHLDRTVNERFEFNKEAQLLPIAGLVNESKGKKTGCCGNEDSELSD
                     TQFSSIKSIIERHHEDLLELIVKEVSLPSINSIEDFELILYDNKPSCLGGLHQEFIFS
                     GRLDNLTSCFTSMHGLSEAADVDLENETGIRLMSCFDHEEIGSSTAQGADSNFLPNIL
                     ERLTLSNAEGYVKSLLLESSAKSFFLSSDVAHGVHPNYASKSEEDHKPELGAGPVIKI
                     NANQRYMTNSPGLVLIKQIADKAKVPLQLFVVKNDSPCGSTIGPILASKTGIRTLDLG
                     NAILSMHSIRETGAARDIASQIGLFKQYFATYSKTYDDIVV"
     gene            complement(<402254..>406633)
                     /gene="TPHA0H01760"
                     /locus_tag="TPHA_0H01760"
                     /db_xref="GeneID:11533838"
     mRNA            complement(<402254..>406633)
                     /gene="TPHA0H01760"
                     /locus_tag="TPHA_0H01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686768.1"
                     /db_xref="GeneID:11533838"
     CDS             complement(402254..406633)
                     /gene="TPHA0H01760"
                     /locus_tag="TPHA_0H01760"
                     /inference="similar to DNA sequence:INSDC:YOR116C"
                     /note="similar to Saccharomyces cerevisiae RPO31
                     (YOR116C); ancestral locus Anc_5.426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686816.1"
                     /db_xref="GeneID:11533838"
                     /db_xref="GOA:G8BX78"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:G8BX78"
                     /translation="MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLEN
                     GRAPIEGGALDPKMGVSSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQI
                     LQGVCKSCSAILLNDTDKRHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDL
                     NGVVKRAATGSGSASLKIIHDTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRC
                     TDDLNPLKTLNLFKQIKNEDCELLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQD
                     SSASNEDDLTVKLTEIVWTSSLIKAGLEKGISINNMMEHWDYLQLSVAMYINSDSVNL
                     LVMPGSNGGTKAKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVA
                     VPELVAKVLTYPEKVTRYNKTKLQKLVMNGPNVHPGANYLLKSNEEARRNLRYGNRDK
                     LAKQLRIGDIVERHLEDGDIVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTPYN
                     ADFDGDEMNLLCYQQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISH
                     KDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKPQCLWTGKQIFSLLIKPNKESPVVI
                     NLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEILSGVMDKSVLGDGKKHSVFYTIL
                     RDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPGEELKLKKEDLVEIAYKKCDE
                     LIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCG
                     SKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSKTPQSKGFVRNSFFTGL
                     TPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTIRTSSNGIVQF
                     TYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQIIKQTNLILQPLEN
                     ALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLAKIRKARSLKE
                     LISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHRAKVEPGTA
                     VGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPIIKAVLV
                     NDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLELTIED
                     IAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEASKSISTSLKESSENTVFYKMQTLR
                     RALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHILEI
                     FNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR
                     DSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSP
                     EQVKPKRTLFESLVSSNDHNKLN"
     gene            <408198..>409502
                     /gene="TPHA0H01770"
                     /locus_tag="TPHA_0H01770"
                     /db_xref="GeneID:11533889"
     mRNA            <408198..>409502
                     /gene="TPHA0H01770"
                     /locus_tag="TPHA_0H01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686769.1"
                     /db_xref="GeneID:11533889"
     CDS             408198..409502
                     /gene="TPHA0H01770"
                     /locus_tag="TPHA_0H01770"
                     /inference="similar to DNA sequence:INSDC:YKL145W"
                     /note="similar to Saccharomyces cerevisiae RPT1 (YKL145W);
                     ancestral locus Anc_5.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686817.1"
                     /db_xref="GeneID:11533889"
                     /db_xref="GOA:G8BX79"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BX79"
                     /translation="MATLEELEAQTVPGDNELDQEILNLSTQELSTRTKLMDNEIRIF
                     RSELQRLSHESNVMQEKVKDNKEKIKNNKQLPYLVANVVEIMDMNEIEDQENSESKTQ
                     GGNVNLDNTSKGKAAVVKTSSRQTVFLPLVGLVDPKNLKPNDLVGVNKDSYLILDTLP
                     SEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKELGIKAPKGA
                     LMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPT
                     IIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLD
                     PALLRSGRLDRKIEFPLPTEESRAQILQIHSRKMTTDDDINWSELARSTDEFNGAQLK
                     AVAVEAGMIALRNGQSSVKHEDFVEAISEVQARKSKSVSFYA"
     gene            complement(<409713..>411581)
                     /gene="TPHA0H01780"
                     /locus_tag="TPHA_0H01780"
                     /db_xref="GeneID:11533890"
     mRNA            complement(<409713..>411581)
                     /gene="TPHA0H01780"
                     /locus_tag="TPHA_0H01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686770.1"
                     /db_xref="GeneID:11533890"
     CDS             complement(409713..411581)
                     /gene="TPHA0H01780"
                     /locus_tag="TPHA_0H01780"
                     /inference="similar to DNA sequence:INSDC:YDR365C"
                     /note="similar to Saccharomyces cerevisiae ESF1 (YDR365C);
                     ancestral locus Anc_5.430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686818.1"
                     /db_xref="GeneID:11533890"
                     /db_xref="GOA:G8BX80"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="UniProtKB/TrEMBL:G8BX80"
                     /translation="MSSDKPVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLE
                     VNRKARVDKYGRKISNLNNQEAKDFDKYFEKEEDGKGEEIAVKPLIDRARGEVPSDYQ
                     SSLDDYTSSESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDL
                     LVTFSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFN
                     DDSDVDINDLYEEGDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGT
                     EYESTANVFDLRYVPDGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETP
                     ADRVEIAKRAFTQKEIDEMDFKAYLASDSEESEGENEEVKNKLKSLVGLSMKIGDKSI
                     MDNKSDNEDGEVDMEITFTPGLAENDNNDKEEENEETTIEKVRRKEKERRKARKQKLK
                     EIKQNSEQEKREKLKSLKTERSKKSEDTESDKNAKAELELLMMDEDEINGTSTINKKA
                     HFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDPTQSEY
                     KETAAMKEILKERSKRSTMKKANRSEKRKISPSDGSQKDISNIVNKLKNKNKKSKR"
     gene            <412229..>413926
                     /gene="TPHA0H01790"
                     /locus_tag="TPHA_0H01790"
                     /db_xref="GeneID:11534020"
     mRNA            <412229..>413926
                     /gene="TPHA0H01790"
                     /locus_tag="TPHA_0H01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686771.1"
                     /db_xref="GeneID:11534020"
     CDS             412229..413926
                     /gene="TPHA0H01790"
                     /locus_tag="TPHA_0H01790"
                     /inference="similar to DNA sequence:INSDC:YOR118W"
                     /note="similar to Saccharomyces cerevisiae YOR118W;
                     ancestral locus Anc_5.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686819.1"
                     /db_xref="GeneID:11534020"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:G8BX81"
                     /translation="MGQGSSIPEASSGDSNESIKDLTSELEIVDYFNKRVISQFSNIE
                     LLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVSDRLRNLILNFIKRLTNFPFISTVADN
                     VTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIALGDYDREEDNKKILDCHNISIS
                     TILTTYDGIPIHDISVSSSNMISFLTWILALSNVCPTNNSIVDTKHMFKYWEKYETSA
                     ISLVRSMNPDIIKPDDNQNILFIQFKTALETIMPHVYLPLEHLLNHLLFMESSLIKSQ
                     EIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSGRESGFSMRSFQSKAFKWNA
                     PTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQNLEPCHSKLRKVTFAVYV
                     DEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTVGGGIGIGSSQPVQKKN
                     SLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDATRTFEIRFLIQDIEV
                     WGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGIIGNHAHSGGSL"
     gene            <414300..>415142
                     /gene="TPHA0H01800"
                     /locus_tag="TPHA_0H01800"
                     /db_xref="GeneID:11534021"
     mRNA            <414300..>415142
                     /gene="TPHA0H01800"
                     /locus_tag="TPHA_0H01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686772.1"
                     /db_xref="GeneID:11534021"
     CDS             414300..415142
                     /gene="TPHA0H01800"
                     /locus_tag="TPHA_0H01800"
                     /inference="similar to DNA sequence:INSDC:YMR178W"
                     /note="similar to Saccharomyces cerevisiae YMR178W;
                     ancestral locus Anc_6.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686820.1"
                     /db_xref="GeneID:11534021"
                     /db_xref="GOA:G8BX82"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="UniProtKB/TrEMBL:G8BX82"
                     /translation="MSIVAAACVIIGDEVLNSKIHDSNSRYFAKYCYNLGIELKEIAT
                     IGDDEDIIVETLQRLSKKYDFIVTTGGIGPTHDDITYDAIAKSFNLPCELDLDCKARM
                     TNISNPESKLDSDSLKAHYRMATLPTGKIVENYYLADDLWVPVCCINKQVYIFPGIPQ
                     LFIKLLNLLTPILKTTYSIEDNNQDYVRYFVKTSFKESEISTYLRLLQEESSKISKNI
                     KIGSYPHFGHGFNTVSILGTSDFSDYLAKIRDQTIERLNGEQISEAEEERISNDFENQ
                     GIKP"
     gene            complement(<415382..>418765)
                     /gene="TPHA0H01820"
                     /locus_tag="TPHA_0H01820"
                     /db_xref="GeneID:11533899"
     mRNA            complement(<415382..>418765)
                     /gene="TPHA0H01820"
                     /locus_tag="TPHA_0H01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686773.1"
                     /db_xref="GeneID:11533899"
     CDS             complement(415382..418765)
                     /gene="TPHA0H01820"
                     /locus_tag="TPHA_0H01820"
                     /inference="similar to DNA sequence:INSDC:YPL226W"
                     /note="similar to Saccharomyces cerevisiae NEW1 (YPL226W);
                     ancestral locus Anc_6.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686821.1"
                     /db_xref="GeneID:11533899"
                     /db_xref="GOA:G8BX83"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BX83"
                     /translation="MPPKKIQSLDDFLNDQKPDANMVPSPFGGYFKKQESNQMPAQKN
                     YNSYNQKRNWNDGSNYNKSTYQNYNQNPVRGYQYHQATVTPNTSGTPTPSASSTTLSS
                     LPDNVAKLELSPVSALLSALSQSESIADCKKTADEIVAKFDESENYVNVNLEDWKVKE
                     VLVKFLKPKNSALVRESALLVIDKLAQSLVTKTPQQIFLLQFVDLVLDAYADKESTVK
                     RAAQHAIDSIISAFPAEALTSMVLPVILKYLASGAKWGSKLGALTVIDRIREDAPNDL
                     LELTFREAIPVLTDVATDFKPELAKQAKQSLLEYVSILDNLDLVSRYELIVDTLQNPQ
                     KVPESVKALSGVTFVAEVTEPALSLLVPILNRSLNLSSSSQEQLRQTVIVIENLTRLV
                     NNRYEIESFIPLLLPGVQKVVDTASLPEVRELAEKALEVLKEDEEGKTAGAFEGRLTL
                     NSAKKFLTENLNQLPADKFDSKLSTLLNEPFVFENLCRYLANNSNVNDWKKIESYFKS
                     TLGEDHADFIRNCLIHNLRALYHQEKEATDENEGIEIVNTDFSLAYGSRMLLNKTRLR
                     LLKGHRYGLCGRNGAGKSTLMRSIANGQLEGFPDKDTLRTCFVEHKLQGEEGDLDLVS
                     FIALDEQLQNTSREEIAKALESVGFDDERRSQTVGSLSGGWKMKLELARAMLQRADIL
                     LLDEPTNHLDVSNVKWLEEYLLENTEITSLIVSHDSGFLDTVCTDIIHYENKKLAYYK
                     GNLAKFVEQKPEAKAYYTLTDSNAQMHFPPPGILTGVKSNTRAVAKMTNVTFTYPGRD
                     KPQLENASCALSLSSRVAVLGPNGAGKSTLIKLLTAELVPDEGKVEKHPNLRIGYIAQ
                     HALQHVNEHKEKTANQYLQWRYKFGDDREVLLKESRKISDEEKELMTKEIDIDDGRGP
                     RAIEAIVGRQKLKKTFQYEVKWKWWKPKYNSWVPKDVLIGHGFEKLVQKFDDHEASRE
                     GLGYRELTPSVITKHFEDVGLDAEIANHTPMGSLSGGQLVKVVIAGAMWNNPHLLVLD
                     EPTNYLDRDSLGALAMAIREWSGGVVMISHNNEFVGALCPEQWIVENGKLTQKGVAEV
                     DQSRFEDGGNTEAVGLAKKCLLHLLSTMILQLILRSNKE"
     gene            <420005..>421891
                     /gene="TPHA0H01830"
                     /locus_tag="TPHA_0H01830"
                     /db_xref="GeneID:11534002"
     mRNA            <420005..>421891
                     /gene="TPHA0H01830"
                     /locus_tag="TPHA_0H01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686774.1"
                     /db_xref="GeneID:11534002"
     CDS             420005..421891
                     /gene="TPHA0H01830"
                     /locus_tag="TPHA_0H01830"
                     /inference="similar to DNA sequence:INSDC:YMR179W"
                     /note="similar to Saccharomyces cerevisiae SPT21
                     (YMR179W); ancestral locus Anc_6.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686822.1"
                     /db_xref="GeneID:11534002"
                     /db_xref="UniProtKB/TrEMBL:G8BX84"
                     /translation="MKLHIKIVFILDGENNTCNTYMTQSKVPKEVQIINMTKEFIKHT
                     DGVTKLGLIPVIEVLDEIQQSSPEIINNSLEENGFDYNVYYKDISEQDEPFVTLGLLS
                     TIKKNIKLLKNDDKTIKSESKKLELTQTENILLMGRIKQDIKQFLRQKNNKSVKRNSN
                     HECLEIKMKFVRVFSVNCRKPPASSSILPITKANRQPLKLQQAINTTFERHTNPMPAP
                     KAVRTQSLPVWKQALSNTNYNGVGLPTNSLAHRIYMTDRQGEQNSKNIPKLAYSTTTM
                     KENTHKHSQEVSNDIQNRFNFINQKKKSSNIRPTNITKSNIPTTINNESRRNSYKLNQ
                     PYKKNVERSDNIGKSSKSYNKIKKTNKLEVKLSGLDKNSQIYQHNESQFPVNDTSQTI
                     PENKENIPPISEVALLGFDIDDFAKLQNNGESNVDWLVDGSYFDQKFVDEHFNSLLEQ
                     KHLVTGASDNRLYIKADNEKIESKVKEDTTSDVDRTSPIDTLSMPLMELNQKDASHID
                     TSCQEQLKKLPILISRKKEDMELISNMALEDNEATSILEHSSSSPHNQITASEEKMDI
                     FYATKINEKRVTMASSPAKNSNYSGTSSDVEPNEELSLFNDGQRESPNSHYTSTSSDL
                     HKSL"
     gene            complement(<422099..>423841)
                     /gene="TPHA0H01840"
                     /locus_tag="TPHA_0H01840"
                     /db_xref="GeneID:11534003"
     mRNA            complement(<422099..>423841)
                     /gene="TPHA0H01840"
                     /locus_tag="TPHA_0H01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686775.1"
                     /db_xref="GeneID:11534003"
     CDS             complement(422099..423841)
                     /gene="TPHA0H01840"
                     /locus_tag="TPHA_0H01840"
                     /inference="similar to DNA sequence:INSDC:YMR180C,YPL228W"
                     /note="similar to Saccharomyces cerevisiae CTL1 (YMR180C)
                     and CET1 (YPL228W); ancestral locus Anc_6.254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686823.1"
                     /db_xref="GeneID:11534003"
                     /db_xref="GOA:G8BX85"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:G8BX85"
                     /translation="MSEDNTETASQLPQKRALPLNDLVHHEQDENVKVQKVTENTEDV
                     NENDDVATATAKAESEQISVATAVPEVASIEPTQPYDDSDTDTDDNGEINFDSSMAFD
                     YDKQGNPSPEKPVPKHHHTKVKQSNSKTKLNTLAKSESKEELPRSPKDTSKHDEVTKF
                     KTEHSKTETNETPSETPANGEKGELKVGKESLEGTTENKELKVGKESLEGTTENKESK
                     VSEKKSKNKAKSEEPIKVDNIFKEKPSTKSKKQNLKKDLELLKEINADSKPNKYKNAP
                     MWAQKWRPSVKALEKVDTNDIKLDQSILNFIPDDDLTKAVQDWVYATIYSIDPELRQF
                     IEFEMKFGVIVCGNSPDRVNPPVSTQAVYTEMDGHLTPNVDKILFNELTKYLQGLTKL
                     TENTDKFGTIESHTKDSVYRVGVSTQRPRFLRMSTDVKTGRVGQFIEKRHVSQLMLYS
                     PKDNYDVKLSINLELPVPENEPPEKYINEETINERTKERISFIHNDSCTRFDITRVSN
                     HRQGIKGNDTEVTHEIELEINTPALLMAFDNIATNSNDYASIIRTFLSNGSIVRRKLT
                     SLSQSIYEGSKKVM"
     gene            complement(<425548..>426633)
                     /gene="TPHA0H01850"
                     /locus_tag="TPHA_0H01850"
                     /db_xref="GeneID:11533695"
     mRNA            complement(<425548..>426633)
                     /gene="TPHA0H01850"
                     /locus_tag="TPHA_0H01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686776.1"
                     /db_xref="GeneID:11533695"
     CDS             complement(425548..426633)
                     /gene="TPHA0H01850"
                     /locus_tag="TPHA_0H01850"
                     /inference="similar to DNA sequence:INSDC:YMR182C,YPL230W"
                     /note="similar to Saccharomyces cerevisiae RGM1 (YMR182C)
                     and YPL230W; ancestral locus Anc_6.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686824.1"
                     /db_xref="GeneID:11533695"
                     /db_xref="GOA:G8BX86"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8BX86"
                     /translation="MPKNRIMSLTTQKKQLGKKVTSKPTNQKRAKKKYVCTGFEGCNM
                     VFTRSENLTRHRRKHTGEKPFKCHVCLKFFSRIDNLKQHIESVHGKDMVIQTRRRRNG
                     NNGRHETFTNITLVHGVSKPSTITATSTNAIDLNSMPSSHLGYMQLPPSNEYRQINVN
                     NPIYSPNLMKMDQAYGGFYEIQNGNNELPTPPPSQIAQHITYTQNSVPHSNFSPQASF
                     SLSPINQSQYVGYDNIKTRRLPLPIHANPIGNIGYGGEPASVHRPLDNQILYNYNQPE
                     LPPSNQVYVQQERPMSTYQPPQQQRPAQTRLPQPYTQNSSIQTYLPLNREYHHDITSN
                     SEHSPTYRTYQNLPTMLPLGNHKSLII"
     gene            complement(<430105..>435756)
                     /gene="TPHA0H01860"
                     /locus_tag="TPHA_0H01860"
                     /db_xref="GeneID:11533696"
     mRNA            complement(<430105..>435756)
                     /gene="TPHA0H01860"
                     /locus_tag="TPHA_0H01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686777.1"
                     /db_xref="GeneID:11533696"
     CDS             complement(430105..435756)
                     /gene="TPHA0H01860"
                     /locus_tag="TPHA_0H01860"
                     /inference="similar to DNA sequence:INSDC:YPL231W"
                     /note="similar to Saccharomyces cerevisiae FAS2 (YPL231W);
                     ancestral locus Anc_6.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686825.1"
                     /db_xref="GeneID:11533696"
                     /db_xref="GOA:G8BX87"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR026025"
                     /db_xref="UniProtKB/TrEMBL:G8BX87"
                     /translation="MVMKAEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKDFNTE
                     RVVEIGPSPTLAGMAQRTIKSKYESYDSALSLQRQVLCYGKDANEIYYTPEIQETEEP
                     EPTTTAPTVAAPVANAPAVSAPAPTSSAPAAALSEEPVKAALVLNVLVAHKLKKPLDG
                     ISMSKTIKDLVGGKSTVQNEILGDLGKEFGNTPEKPEETPLEELAETFQDTFSGSLGK
                     QSSSLVSRLISSKMPGGFSITVTRKYLQNRWGLPPSRQDSVLLVALAQEPTSRLTSEA
                     DANSFWDSATQKYASMYGIDLSAASSGASSTGAGAGAGGATIDAAAFDEFTKDQKVMA
                     RQQLQALARYLKMDLDGGERKFLKEKDSVAELQAQLDYLTAELGEYFVSGIATSFSRK
                     KARVFDSSWNWARQSLLCLYFEVIHGVLKNVDRKVVSEAINIMNRSNETLIKFMEYHV
                     SNTNETKGENYQMVKNLGYQLIENCKEVIKMDPVYKDISKPTGPKTSIDKNGNITYSE
                     EPREKVRKLSQYVQEMALGGPMTREQHSTIQDDLTRVYKAITLQATQHDISDSTALEF
                     ENLYGELIKFLKNSDEIDSSQTTKLAGVIDDDLDTDATKVVATLTNKTNSNKNVSSTI
                     PRETVPFLHLKKKLPSGEWKYDRQLSSLFLDGLERAAMDGITFKDKYVLITGAGQGSI
                     GADVLQGLLQGGAKVIVTTSRFSKKVTDFYQSMYATYGSRGSILMVVPFNQGSKQDVE
                     ALVNYIYDDEKNGGLGWDLDVIIPFAAIPENGIELENIDSKSEFAHRIMLTNILRLMG
                     AVKKEKSSRGIETRPAQVILPLSPNHGTFGGDGLYSESKLSMETLFNRWHSESWANQL
                     TICGAIIGWTRGTGLMSANNIIAEGIEKMGVRTFSQKEMAFNLLGLIMPEIVELSQKS
                     PVMADLNGGLQFLTDLKEFTAKLRADLTETSDVRKAVSIETALEHKTVKGENADSAYT
                     KVEIKPRANIQLNFPELRAHKEIKQTTNEDLEGLLDLEKVIVVTGFAEVGPWGSSRTR
                     WEMESTGKFSLEGCVEMAWMMGLIKYHNGNLKGRSYTGWVDSKTNEPVNDNDVKTKYE
                     SYILEHAGIRLIESELFNGYDPNKKQLIQEVLIEEDMEPFEASMETAKQFKLQHGDKV
                     DIFEIPESGEYSIKLLKGASLYIPKALKFDRLVAGQIPTGWNAKTYGISDDIISQVDP
                     LTLYVLVSVVEAFISSGITDPYEMYEYVHISEVGNCSGSGIGGVSALRGMFKDRYKDI
                     PVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESVDVGVETILSKKAKI
                     CIVGGYDDFQEEGSYEFANMNATSNTLEEFEHGRTPAEMSRPATTSRNGFMEAQGAGI
                     QVIMQADLALKMGVPIYGIVAMTATATDKIGRSVPAPGKGILTTAREFNGNLKFKSPM
                     LDVKYRKRQFVNRERQIKEWIENEIELLQYEVSGLSEEDKKEFILERTDEIQREADKQ
                     VRYAQSQWGNEFFKSDPRIAPLRGSLATFGLTIDDLGVASFHGTSTKANEKNESATIN
                     KMMEHLGRSEGNPVLGVFQKFLTGHPKGAAGAWMLNGALQILNSGIVPGNRNADNIDK
                     YLEQFEYVLFPSKSIRTDGIKAVSITSFGFGQKGGQAIVVHPDYLYAAVSEEVYNKYA
                     LKVNTRSKSASKYFNNGMFHNKLFVSKENPPYSDELEQRVYLDPLTRVSPCTKTGELI
                     YKEGGIQREDNYISVSEKDTANIVNNLVTEAISKSKDTKNVGVDVELINAININNSTF
                     IERNFTPKEIEYCQAQPSIQSSFAGTWSAKEAVFKALGVKSQGGGAPLIDIEIFRAEG
                     KGPQVVLHGEAKILASAAGVNEVTVSISHNDFQSVAVAISK"
     gene            complement(<437907..>438779)
                     /gene="TPHA0H01870"
                     /locus_tag="TPHA_0H01870"
                     /db_xref="GeneID:11533839"
     mRNA            complement(<437907..>438779)
                     /gene="TPHA0H01870"
                     /locus_tag="TPHA_0H01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686778.1"
                     /db_xref="GeneID:11533839"
     CDS             complement(437907..438779)
                     /gene="TPHA0H01870"
                     /locus_tag="TPHA_0H01870"
                     /inference="similar to DNA sequence:INSDC:YMR183C,YPL232W"
                     /note="similar to Saccharomyces cerevisiae SSO2 (YMR183C)
                     and SSO1 (YPL232W); ancestral locus Anc_6.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686826.1"
                     /db_xref="GeneID:11533839"
                     /db_xref="GOA:G8BX88"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G8BX88"
                     /translation="MSNPYATENPYEENYELNDTPNNNNNASGNDFVEFMSSINVINQ
                     DLSNYENIVNQIDILHKRLLSEVNEEQANQTRNSLNDLVSQATDLQYQLKDKIKEAQR
                     LGLHDTNKQAQAENSRQKFLKLIQDYRIIDSNYKEENKQQAIRQYKVIQPDATEDEIE
                     DAITDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLQLEKTMAELTQLFNDMEQ
                     LVVEQQENIEAIDQNVEAAQQDVEQGIGHTNKAVKSAKNARKNKRRCYIVCFLIIVVI
                     IIAAVVPSVVATQV"
     gene            <441140..>442402
                     /gene="TPHA0H01880"
                     /locus_tag="TPHA_0H01880"
                     /db_xref="GeneID:11533840"
     mRNA            <441140..>442402
                     /gene="TPHA0H01880"
                     /locus_tag="TPHA_0H01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686779.1"
                     /db_xref="GeneID:11533840"
     CDS             441140..442402
                     /gene="TPHA0H01880"
                     /locus_tag="TPHA_0H01880"
                     /inference="similar to DNA sequence:INSDC:YPL236C"
                     /note="similar to Saccharomyces cerevisiae YPL236C;
                     ancestral locus Anc_6.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686827.1"
                     /db_xref="GeneID:11533840"
                     /db_xref="GOA:G8BWE2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BWE2"
                     /translation="MDSILKLIGSCLCYEHVFSRYTVPEVTINGEKYIVNELIAEDND
                     CYKYTITSQSSLNSARANPSSGSDNNGNKYILKRVNCFTMEDLKIALTEINYYNTFDC
                     KYIMKLVDSQILQQYNGLIHGVPEISNGSSLTLGSSYSSTSTNNISKVCNIVFPYFPL
                     GTIDDLMNKSIINNDFVLNENEIIEILLGVARALQYLHNPELRNESHHIEPSNNINTT
                     VNDTYKTTTPILKSDTPLEHILNESETVSSGSNFNNNVYIGMNLSPFNIFIQKNQQND
                     NEEYEFTPVIGDLSCCIKSSEICNSIQFKEWLDRIGHVEYKAPELIQKNIEVISTKSD
                     IWSFGCLTYALIYGTSPFKREEELRGSSLSYSVNIGKFSFPEKAEKYTDTAFTKLNEL
                     NELITKCLKVDPNQRLDTTSVIEFITTL"
     gene            <445606..>446157
                     /gene="TPHA0H01890"
                     /locus_tag="TPHA_0H01890"
                     /db_xref="GeneID:11533720"
     mRNA            <445606..>446157
                     /gene="TPHA0H01890"
                     /locus_tag="TPHA_0H01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686780.1"
                     /db_xref="GeneID:11533720"
     CDS             445606..446157
                     /gene="TPHA0H01890"
                     /locus_tag="TPHA_0H01890"
                     /inference="similar to DNA sequence:INSDC:YMR184W"
                     /note="similar to Saccharomyces cerevisiae ADD37
                     (YMR184W); ancestral locus Anc_6.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686828.1"
                     /db_xref="GeneID:11533720"
                     /db_xref="UniProtKB/TrEMBL:G8BWE3"
                     /translation="MSTTVYTKSFQNCSENEVTGYNDCPSFLLSGKNKKNPLSSHRIV
                     DNVPEYMYGKKIALNNIAPPPPSKRMLSRRVSTSSEISFSSMDSENYLEKNEIVLLVQ
                     NLLSSETRLNENEFQFYKKKIETNFLSSLENENTIMVLSQFFNEASKNKSNAQKLMKN
                     WLVSDISVSNWVPSFIKIYENSI"
     gene            complement(<447041..>447898)
                     /gene="TPHA0H01900"
                     /locus_tag="TPHA_0H01900"
                     /db_xref="GeneID:11533721"
     mRNA            complement(<447041..>447898)
                     /gene="TPHA0H01900"
                     /locus_tag="TPHA_0H01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686781.1"
                     /db_xref="GeneID:11533721"
     CDS             complement(447041..447898)
                     /gene="TPHA0H01900"
                     /locus_tag="TPHA_0H01900"
                     /inference="similar to DNA sequence:INSDC:YPL237W"
                     /note="similar to Saccharomyces cerevisiae SUI3 (YPL237W);
                     ancestral locus Anc_6.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686829.1"
                     /db_xref="GeneID:11533721"
                     /db_xref="GOA:G8BWE4"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:G8BWE4"
                     /translation="MSSDLASDLGFDLSLKKKKKGKKVAPEGLDGAATEASSTPTGDE
                     DALFAGLKKKKKKSKTSTTGDETEDVDDITEALGDLKLKKKKKKAPVADVDEFEQELA
                     KAGVVVDETSNEATPGHESSLQQDVGLPYDKLLSRFFNILRTNNPELAGDRSGPKFRI
                     PPPICLRDGKKTIFSNIEDISEKLQRSTDHLIQYLFAELGTSGSVDGQKRLVIKGKFQ
                     SKQMENVLRRYIMEYVTCKTCKSINTELKKEQSNRLFFLVCKSCGSTRSVSSIKTGFQ
                     ATVGKRKKM"
     gene            complement(<448970..>449575)
                     /gene="TPHA0H01910"
                     /locus_tag="TPHA_0H01910"
                     /db_xref="GeneID:11533749"
     mRNA            complement(<448970..>449575)
                     /gene="TPHA0H01910"
                     /locus_tag="TPHA_0H01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686782.1"
                     /db_xref="GeneID:11533749"
     CDS             complement(448970..449575)
                     /gene="TPHA0H01910"
                     /locus_tag="TPHA_0H01910"
                     /inference="similar to DNA sequence:INSDC:YPL239W"
                     /note="similar to Saccharomyces cerevisiae YAR1 (YPL239W);
                     ancestral locus Anc_6.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686830.1"
                     /db_xref="GeneID:11533749"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BWE5"
                     /translation="MSLYSGPLDEEDQDAILLDARAGDIESLQEVFSIVIDPKSMVTC
                     RDSSSKSTALHYAAGNGHLEMTKYILKLAKETTSEEKFKEFVDEKNENGNTALHWASL
                     NGHLEVVKLLCDEYDADPFIKNKFDHDAIFEAENNGKEEVETYFLKKFDVEPLEDETV
                     ISSKDIATVDNIGIKEGTEIANMTNDATEALREKTETLNIE"
     gene            <450069..>453008
                     /gene="TPHA0H01920"
                     /locus_tag="TPHA_0H01920"
                     /db_xref="GeneID:11533750"
     mRNA            <450069..>453008
                     /gene="TPHA0H01920"
                     /locus_tag="TPHA_0H01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686783.1"
                     /db_xref="GeneID:11533750"
     CDS             450069..453008
                     /gene="TPHA0H01920"
                     /locus_tag="TPHA_0H01920"
                     /inference="similar to DNA sequence:INSDC:YMR185W"
                     /note="similar to Saccharomyces cerevisiae YMR185W;
                     ancestral locus Anc_6.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686831.1"
                     /db_xref="GeneID:11533750"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019451"
                     /db_xref="UniProtKB/TrEMBL:G8BWE6"
                     /translation="METEKKVNIKEVLLKEPEFVRGSDLDLFFEKLNDELIAKLKAAN
                     KNQDLPNIYQLLGFHNNEEFVTKIIDYFTQLHQITLSTQKQLSEEGKDILPISLHDIK
                     FVDELIKLVIVHGIDANLPQTVRIPTEQKQLNAYKESNITNSIPKDTVPNFKVLETVI
                     RSFYTIFKPGSSSSIAKDDYLRKVLLNGPLYSNVYIGLVFLHLQNNSFASLDLLNEFE
                     KLQETYSLFVIYTLYIQTIKEHSLKAFFLNKLALLPLERSNGVISLVDFLLGVRDDDQ
                     IKMENLNRVSQTLLSKPSKLSNTEYLTKLFPQIIEALQSTNRPILITSMNQVILDFFN
                     KNKLIVKDFLLKPVLGVFFNDPVKEHSVKELNDTINVLVSLSKTTSIELAHFITNYKE
                     NHQFYLNLWIYALFLKNSHIKKPLRYDNNGLKDSSYYEIILSLIKSYLNITGDFGALN
                     TIYLNLANYQHADWKYQIDLETNLAYIVVDKQQDVKEDLRITTESDTDKLTKVTKVFQ
                     EMDDGIDLFIEFLKLLNIDDVTTNTFLNRLSSWIRTSKNDIYTENKTNTDTNLINNEN
                     SIFILQDLKFLEKVNDNFKSDFVKKPGAILNVVDELLDYISTAKDEGTDLTNIPNREI
                     ATGGDSDDDSEDESDGENQEDLLKDVSNDNTSSTFNILIDLLLTVLDNTNVMVLLKYK
                     DTLINIKSKLAKDETKSERLGKISNQIDGILKSKPTGNSNNKLIDSIKYDEDNEKLDN
                     IMINLSDPLVPIEVHGLHELCKLIQTGTEVITLSKVVDLQFQFLRNSDPFLYLNVIKN
                     LNLLLRLNKEKTLPLILDRYNNIKKTKLDDILKIGEVLINFIQELNELFVGKIANMII
                     ESCIHKIRRHDTLDTRIRMSAMSILGVCLQVNAIGISDKIPDILDCAFKILQLETTEK
                     NSFLMRRSSIHIIHDLIYNSGFQLFPEQFSPEKTRTLLEYVKSNDNDGLVCETTRQLL
                     EIIVTDQ"
     gene            <453630..>455753
                     /gene="TPHA0H01930"
                     /locus_tag="TPHA_0H01930"
                     /db_xref="GeneID:11534047"
     mRNA            <453630..>455753
                     /gene="TPHA0H01930"
                     /locus_tag="TPHA_0H01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686784.1"
                     /db_xref="GeneID:11534047"
     CDS             453630..455753
                     /gene="TPHA0H01930"
                     /locus_tag="TPHA_0H01930"
                     /inference="similar to DNA sequence:INSDC:YMR186W,YPL240C"
                     /note="similar to Saccharomyces cerevisiae HSC82 (YMR186W)
                     and HSP82 (YPL240C); ancestral locus Anc_6.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686832.1"
                     /db_xref="GeneID:11534047"
                     /db_xref="GOA:G8BWE7"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:G8BWE7"
                     /translation="MAAETFEFQAEITQLMSLFINTVYSNKEIFLRELISNASDAIDK
                     IRYQSLSDPKVLETEPELFIRITPKPEDKVLELRDSGIGMTKADLINNLGTIAKSGTK
                     AFMEALSAGADVSMIGQFGVGFYSLFLVADKVQVISKNNDDDQYIWESNAGGSFTVTK
                     DEVNEKIGRGTILRLFLKEDQLDYLEEKRIKEVIKRHSEFVAYPIQLLVTKEVEKEIP
                     LTEEEKKEEDEEKTEEDDKKPKLEEVKEDDDAEEKPKTKTIKEEVQELEELNKTKPLW
                     TRNPTEINKEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFKAILFIPGRAPFDLFESK
                     KKKNNIKLYVRRVFITDEAEDLIPEWLSFVQGVVDSEDLPLNLSREMLQQNKIMKVIK
                     KNIVKKLIESFNEIAEDSEQFDKFYKAFSKNIKLGVHEDTQNRAALSKLLRYNSTKSA
                     DEMTSLTDYVTRMPEHQKNIYYITGESMKIVEQSPFLDALKAKNFEVLFLVDPIDEYA
                     FTQLKEYEGKTLVDITKDFEIEETEEEKAAREKEEKEFEELAKALKEILGEQVEKVVV
                     SQKLSDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPKSPIIKEL
                     KKRVAEGGAQDRTVKDLTNLLYETALLTSGFSLDEPSSFAGRVNRLISLGLNIDEEEE
                     EAAPEAASEAVVEEVPADTEMEEVD"
     gene            <456179..>456988
                     /gene="TPHA0H01940"
                     /locus_tag="TPHA_0H01940"
                     /db_xref="GeneID:11534048"
     mRNA            <456179..>456988
                     /gene="TPHA0H01940"
                     /locus_tag="TPHA_0H01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686785.1"
                     /db_xref="GeneID:11534048"
     CDS             456179..456988
                     /gene="TPHA0H01940"
                     /locus_tag="TPHA_0H01940"
                     /inference="similar to DNA sequence:INSDC:YPL246C"
                     /note="similar to Saccharomyces cerevisiae RBD2 (YPL246C);
                     ancestral locus Anc_6.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686833.1"
                     /db_xref="GeneID:11534048"
                     /db_xref="GOA:G8BWE8"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:G8BWE8"
                     /translation="MNLRNIILPNSQPPAFLTVIVLITIIFIFITDEFVDINKYCTLS
                     PSSLWDLDLTRLLLYPLAHLSIPHLLFNCFALFTPLNAFEATHGTVYTFIMLNILSVV
                     TGVIYCVVGHWLYPTVAIAGASGWCFTLFAYFSVRESTVKPTTTLFFANITIPTILDP
                     VVTLVVIALLIPGSSFWGHLFGLLVGYLMGWKEIIFRMVVIPSWIITYFESKLKFFIN
                     LTPRFLKYYLNEDIQVNEDYVSIWENVVTLPITNNPNQPTFQGTGNVLGTA"
     gene            complement(<457304..>457969)
                     /gene="TPHA0H01950"
                     /locus_tag="TPHA_0H01950"
                     /db_xref="GeneID:11534026"
     mRNA            complement(<457304..>457969)
                     /gene="TPHA0H01950"
                     /locus_tag="TPHA_0H01950"
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /transcript_id="XM_003686786.1"
                     /db_xref="GeneID:11534026"
     CDS             complement(457304..457969)
                     /gene="TPHA0H01950"
                     /locus_tag="TPHA_0H01950"
                     /inference="similar to DNA sequence:INSDC:YMR188C"
                     /note="similar to Saccharomyces cerevisiae MRPS17
                     (YMR188C); ancestral locus Anc_6.275"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /protein_id="XP_003686834.1"
                     /db_xref="GeneID:11534026"
                     /db_xref="GOA:G8BWE9"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8BWE9"
                     /translation="MARQNFIGLVVSQGKMQKTVKVRVETKVFNKLVNKELFRRKDYL
                     VHDEGDISREGDLVRIEATRPLSKKKFFAIAEIIKNKGQQFALYQSQAEVNVAKEEYA
                     KAQEFLKRRAEIDSKQDVVLINDIRTIQDALSEGKNPEELTEIKNRYGIESFTPQTIK
                     KLLTLNVSGLEAQVESQKNKISNIQNKLGELMKDDAKAIEFLKTHGVQEPELLKKNIK
                     KIY"
     gene            <459288..>462383
                     /gene="TPHA0H01960"
                     /locus_tag="TPHA_0H01960"
                     /db_xref="GeneID:11534027"
     mRNA            <459288..>462383
                     /gene="TPHA0H01960"
                     /locus_tag="TPHA_0H01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686787.1"
                     /db_xref="GeneID:11534027"
     CDS             459288..462383
                     /gene="TPHA0H01960"
                     /locus_tag="TPHA_0H01960"
                     /inference="similar to DNA sequence:INSDC:YMR189W"
                     /note="similar to Saccharomyces cerevisiae GCV2 (YMR189W);
                     ancestral locus Anc_6.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686835.1"
                     /db_xref="GeneID:11534027"
                     /db_xref="GOA:G8BWF0"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/TrEMBL:G8BWF0"
                     /translation="MLGLRRSSAHLYKTIKFVALQKQLSTSAIHFDVANVSSDTYSKI
                     YNVDVSELNRPLDNFQRRHLGPSPENTEKMLKLMNYKDLDSFINKVVPKNILIKRQLQ
                     LDAPLDGFSENEMLENLKKIANKNNYKVKNYIGKGYYGTILPPVIKRNLVESPEWYTS
                     YTPYQPEISQGRLESLLNFQTVVTELTGLPVANASLLDEGTSAGEALLLSFYSAKKKK
                     TKYAIDKNIHPQTKSVLLSRANPFNIEIVEIDFNNVENTIAALEDPQVCGCLLQYPDT
                     NGSILSPEILLKYSNIIHENKGLFSVASDLLALTLLKPPSEFGADIVLGSSQRFGVPL
                     GYGGPHAAFFAVQKKLNRRIPGRIVGVSKDRLGKPALRLAIQTREQHIKRDKATSNIC
                     TAQALLANVAANYAVYHGPKGLTDIAKRIYGMTSILAEEIKSANSKGNLINESWFDTL
                     TVELKDGQTSKEFLQRAFNEFNINIFAVDKKTISLSLDETTTMEDLNALVALFTDKSN
                     DTVSNYVKTKTPLKEFPIHLRRTNDFLKQEVFNIHHSETAMLRYLHRLQSRDLSLANS
                     MIPLGSCTMKLNATTEMIPMTWPQFANIHPFQPIDQVKGYQEMINSFEKDLCSITGFD
                     GCSLQPNSGAQGEYAGLRTIKAYLESINQGNRNICLIPISAHGTNPASSAMCNFKVIP
                     VNCLENGALDLIDLRQKAKLHKDNLATAMITYPSTYGLFEEGIKEAINIVHNFGGQVY
                     LDGANMNAQVGLTSPGDLGADVCHLNCHKTFSIPHGGGGPAGAPICVKSHLVPFLPRH
                     DVVTMLSDIGSEESIKPVSSAAYGNALVIPISYTYIKMMGSKGLPFSSVIAMLNANYM
                     MKRLQSHYEILFIDGSDKSFDHCAHEFILDLRMYKKHGIEAIDVAKRLQDYGFHAPTL
                     AFPVPGTLMVEPTESENLEELDRFVNTMISIKSEIDAYIRGKSNGLLIKNAPHSLEDL
                     ITSTDWETRGYTREQAAYPLPHLKYNKFWPTVTRLDDTYGDLNLICTCPSVEEVANEI
                     N"
     gene            complement(<462534..>466601)
                     /gene="TPHA0H01970"
                     /locus_tag="TPHA_0H01970"
                     /db_xref="GeneID:11533900"
     mRNA            complement(<462534..>466601)
                     /gene="TPHA0H01970"
                     /locus_tag="TPHA_0H01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686788.1"
                     /db_xref="GeneID:11533900"
     CDS             complement(462534..466601)
                     /gene="TPHA0H01970"
                     /locus_tag="TPHA_0H01970"
                     /inference="similar to DNA sequence:INSDC:YMR190C"
                     /note="similar to Saccharomyces cerevisiae SGS1 (YMR190C);
                     ancestral locus Anc_6.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686836.1"
                     /db_xref="GeneID:11533900"
                     /db_xref="GOA:G8BWF1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWF1"
                     /translation="MATKPSNNLRREHKWLREAQLFNSSSNELLLRILTDNTISARLP
                     TTVPIQPPLNSQRVNIDTHSVNNINATRSEFTSELSDTRRQNHEERSSNLVICAEAQS
                     NSSIGKSLIQTSVNTNTENEILEIENDLIRNLESHLNLIKEQIEILSNSRRTRKSKKE
                     SLMQDVHPKLDQLEPVIKTLKRQYFEKTNKQINHNANNSQPPVPQLSGRETIDDRVLI
                     HVLDEEEDFAEDNDNDIIITQANIGLDRSDKLHEQPPKRSLRERKNVDYRVFPTLESA
                     TVSFQTSELHDEDTMEAEYDAVSDYMTTRSEDRDEELNKSDEDFVVPDSNGNVLNQTQ
                     DSEYKDDYGADTEYGNSQSTNIQTAENNVVEVQIQTLYKSNANDNASNSEDDEILMSS
                     PVKDNKTNNYSNENTNNEIVEIDLIERDLDLDLDSIVANEKSHIIGANNMSSQRNLSL
                     SDQNNLSSSGQMAISHSDLELLDADEGLSDSDLELFDEERENKTQNINIKELDDDLKI
                     IAERKLNDDVPLEFPGIKKEDSELYENISLSNTTKMNAQNDNQVSELLDDSYYELEEA
                     NSLTYNQEQNNGTGKHLWTNEVKSKLQEVFKLPGFRPNQEDAVNATLSGKDVFVLMPT
                     GGGKSLCYQLPAIIKSGNTKGTTIVVSPLISLMQDQVDHLLAKNIKASMFSSKGTADQ
                     RRQTFNLFIHGLLDLIYISPEMISASEQCKRAIAKLHEDGNLARIVVDEAHCVSNWGH
                     DFRPDYKELKFFKGEYPNIPMMALTATASEQVRMDIIHNLKLKDPVFLKQSFNRTNLY
                     YEIIKKSKNTIFEMSDDIKRRFRNQTGIIYCHSKNSCEQTSAQMERAGIKCAYYHAGM
                     EPDDRLKVQKAWQADEVQVICATVAFGMGIDKPDVRFVYHFTVPRTLEGYYQETGRAG
                     RDGKFSYCITYYSFKDVRTIQTMIQKDENLDRENKEKHLNKLQQVMAYCDNVTDCRRK
                     LVLSYFNEQFDSKLCKKNCDNCRNSKNIVTEERDVTNDAKVIAKMVKEIEYNRVTLIY
                     CQDIFKGSKSSKVVRAGHDSLNGHGAGKSLSRSDIERIFFHLITIGVLQEYSIMNNSG
                     FASNYVKLGPKAYGLLTGNMKVKMQFNISVDSSKSSTPAPNSSRPQSRQDYNKNYSNN
                     IEIVSAKQHLQGYTYNENSASKPKSYSNSNEKQFSNETDFAFKTIKDLCQQTGLNVSN
                     QSINLLVNFLPVTAEEFYALVGNNGKFSLFKNEFMKLRKKKFQLLASNNDMNTSSESY
                     SINDSIILSNYNSTQKNQKVTGNKSQYFGMSYEEEKENSEIMDILRDNQYHNKPSVKE
                     VPNSSYMANSNMTAKKKSYYKKGFRSYNGSKRYRK"
     gene            <467688..>470669
                     /gene="TPHA0H01980"
                     /locus_tag="TPHA_0H01980"
                     /db_xref="GeneID:11533901"
     mRNA            <467688..>470669
                     /gene="TPHA0H01980"
                     /locus_tag="TPHA_0H01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686789.1"
                     /db_xref="GeneID:11533901"
     CDS             467688..470669
                     /gene="TPHA0H01980"
                     /locus_tag="TPHA_0H01980"
                     /inference="similar to DNA sequence:INSDC:YPL248C"
                     /note="similar to Saccharomyces cerevisiae GAL4 (YPL248C);
                     ancestral locus Anc_6.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686837.1"
                     /db_xref="GeneID:11533901"
                     /db_xref="GOA:G8BWF2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR005600"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8BWF2"
                     /translation="MPRIPGVVDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPR
                     KRRSPLTRAHLTEVEDRLSKFEQLFYEFFPNINLDNTLNLNNATEMKKILLDNSVDFI
                     KDFKNVKKTDESEDNDGPNADDSHDENDDNDNDNDRPNDDIDDNDTQRNNTKNINDTI
                     NDSVAKCNNKMKMYTYNNSYDDDDNNNNKRARDTSNSSPAFEINGYGKKKNKMVTVKK
                     EPSIKDSNKILDSNSIIYEDYSILEKNTPNDHLRGFDWSEDISVKPADDPIAFLLADV
                     NNCGFFGTSSQYSLLRSIIESKNININKLFNVNVCQTKKYTGPKPLTTKNALTSRNVT
                     AEYLDSYFSNFHVHFPIVSKESMMSIYNNEFDVTDKDEWQALFNAILAIGSWCINGDS
                     VDIDYFYYQNAILKLKNTIFTSGSFTLVINFYLLSKYAQLKMKFNTSYVFIGHAVSLA
                     LSLGLNKEISEKVKDSGTKEQRRRIWWLIYIQEFQLSLLLDRPTQLGHCETNVFNISL
                     PSSLDNSLQHTTHPTMYILCIEETRLVKTFLRRGDNSNKTYHDITSSKCLQVCDEIEK
                     WAKNRPKYLQTDISASALANYLQEYPWLAFTRFLLMWQKEYLIIFILQQFFSTKKNKI
                     SESDDNKYEIQKCVTLLFDTLQRIIMSVNNFINNHPINALFAWYCSFYLSNAAIVLIS
                     FCIHNPTSTYKSNLMISLKTVIEVYEKLQKEKLIDCEPFIKIITVIYKDDINASVGTP
                     VTESLPVELEDLRSNLSREQQKIVATPQMFPFDASVTFPKSVSVPSADFNKSNSFMDL
                     MKLLSNDGNYNGNTNNTTLFRQGPQSNFNLTPKFSNPHMQQFPIQFSPLLQQFPTQSQ
                     FQFQMPYQLPSQNLSEAVHSLNQKSITSQQKQYQSIEQPIIQSATLLPNQNIQTQNTQ
                     SLVPASPQFLNSMDLNQVYLNGSYNANTNNASSENIVNGALKKEDLAKLNDQTALNAF
                     NLQPMFNTTTMDDVYNYLFDD"
     gene            <471336..>474155
                     /gene="TPHA0H02000"
                     /locus_tag="TPHA_0H02000"
                     /db_xref="GeneID:11534215"
     mRNA            <471336..>474155
                     /gene="TPHA0H02000"
                     /locus_tag="TPHA_0H02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686790.1"
                     /db_xref="GeneID:11534215"
     CDS             471336..474155
                     /gene="TPHA0H02000"
                     /locus_tag="TPHA_0H02000"
                     /inference="similar to DNA sequence:INSDC:YMR192W,YPL249C"
                     /note="similar to Saccharomyces cerevisiae GYL1 (YMR192W)
                     and GYP5 (YPL249C); ancestral locus Anc_6.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686838.1"
                     /db_xref="GeneID:11534215"
                     /db_xref="GOA:G8BWF3"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8BWF3"
                     /translation="MSESIKGEDKKLHFENTDQDRMELDHEDIQTDTNSLVKETIDAQ
                     VSEYEDFGDANDSIIDQNDVKTNQGEVQKDTNRPENKLVDDVNQSLSNMKTNDNQSIN
                     TIGNEAFKEILKSSDEGDQLPNDDGVNLNEEPDKVLMAGDYITDNIGGESLEEDHESN
                     LANIKNEETPNATILDVNREEHFNEELEKEDSNLLAIEINNQHAFHDIQDNDSINTKG
                     ENNAGDDINTNLSLTATPEKDDVEYSNQENQTTNLTPQLPPRKGSMSLDSSNLTKVAP
                     GPSSPPLPSRNRVAVPVSNNVGIKNAVHNVPPTLETEMQSEAFRKNLGFTNADVIPPK
                     LPSRNHSKNTSIISSAAEINLIVDRFRKTSHNFQNENDVSKENLKEGRCILRSSYSTL
                     VERLVSDSTATNNELASKTESEKSDQEENIMEIDWNFWSEVVDDFSKVTRDDPDKLEK
                     MITDGIPPQIRGIIWQLISNSKSKEFTEIYSSLINLESVHEAAIRRDIRRTNFIPEDK
                     TESLFSVMKAYSLYDKEVGYTQGMAFIVAPLLLNCESEADTFGLLIRLMNNYELRELF
                     LPGMPGLMLMLYQFDRLIEESSPQLYNYLTRQSIRSTMYATQWFLTFFAYRFPLGFVI
                     RIFDIVFVEGIEAILKFAVILMLKNEDHILSLKFEQLLDFLKTELFHYYSYESINERA
                     AMSTKNNNSIDSNNSTDDVYDSDKADAQSVVQNELKMVPSSHSTIKRTVTKTIRDSEY
                     DTDLFVHDAMNEVHITPISLQRYSNEYKDIHELEQQKEQQYEHMRIKNHQLHREVKKL
                     EHDYTQLNREHVSIANELINNRLKNETLIDENNDLRLTVLTLKRQLEEEVRKQSLPNP
                     DAALPNDLKYDLEQAMNRNREVMTENMKLQDKIGDLENYIERLKAIRYPKSPSKDSNS
                     NPVEPASPPSGGWSGFKKVFAKPTS"
     gene            <474795..>475759
                     /gene="TPHA0H02010"
                     /locus_tag="TPHA_0H02010"
                     /db_xref="GeneID:11534216"
     mRNA            join(<474795..474810,475473..>475759)
                     /gene="TPHA0H02010"
                     /locus_tag="TPHA_0H02010"
                     /product="60S ribosomal protein L36"
                     /transcript_id="XM_003686791.1"
                     /db_xref="GeneID:11534216"
     CDS             join(474795..474810,475473..475759)
                     /gene="TPHA0H02010"
                     /locus_tag="TPHA_0H02010"
                     /inference="similar to DNA
                     sequence:INSDC:YMR194W,YPL249C-A"
                     /note="similar to Saccharomyces cerevisiae RPL36A
                     (YMR194W) and RPL36B (YPL249C-A); ancestral locus
                     Anc_6.283"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_003686839.1"
                     /db_xref="GeneID:11534216"
                     /db_xref="GOA:G8BWF4"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:G8BWF4"
                     /translation="MAVKTGIAVGLNKGKKVTSMTPAPKISYRKGAASNRTKFVRSIV
                     REFAGLAPYERRLMDVIRNVGEKRARKVAKKRLGSFKRAKAKVEEMTNIIAASRRH"
     gene            <478901..>479305
                     /gene="TPHA0H02020"
                     /locus_tag="TPHA_0H02020"
                     /db_xref="GeneID:11534310"
     mRNA            <478901..>479305
                     /gene="TPHA0H02020"
                     /locus_tag="TPHA_0H02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686792.1"
                     /db_xref="GeneID:11534310"
     CDS             478901..479305
                     /gene="TPHA0H02020"
                     /locus_tag="TPHA_0H02020"
                     /inference="similar to DNA sequence:INSDC:YPL250C,YMR195W"
                     /note="similar to Saccharomyces cerevisiae ICY2 (YPL250C)
                     and ICY1 (YMR195W); ancestral locus Anc_6.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686840.1"
                     /db_xref="GeneID:11534310"
                     /db_xref="UniProtKB/TrEMBL:G8BWF5"
                     /translation="MSNYYTINNSQNISGLNLDHNNNNLNRANGDENGNNLSLSPSDT
                     YIPISNSQFQQEQFTSINNMEQQEQSEIDDDDLLFSMEIQQPYELNDINKINNSFTSA
                     ITNMSISNYGFDYENSFVDPAQQNYKLWLSSF"
     gap             480523..480836
                     /estimated_length=314
     gene            <480962..>484252
                     /gene="TPHA0H02030"
                     /locus_tag="TPHA_0H02030"
                     /db_xref="GeneID:11534311"
     mRNA            <480962..>484252
                     /gene="TPHA0H02030"
                     /locus_tag="TPHA_0H02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686793.1"
                     /db_xref="GeneID:11534311"
     CDS             480962..484252
                     /gene="TPHA0H02030"
                     /locus_tag="TPHA_0H02030"
                     /inference="similar to DNA sequence:INSDC:YMR196W"
                     /note="similar to Saccharomyces cerevisiae YMR196W;
                     ancestral locus Anc_6.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686841.1"
                     /db_xref="GeneID:11534311"
                     /db_xref="GOA:G8BWF6"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:G8BWF6"
                     /translation="MNQFSAKFIDTTVEEQRLAENRNKEKYWLKWGPYLSERAWATVR
                     EDYSYNGDAWANFPFSHANARTFRWGEDGIFGVSDNKQFICLSVALWNGKDERLKERL
                     FGLTGPQGNHGEDVKELYYYLDNTPTHSFMKSLYKYPFKKPYPYQELVNENGRRTYAD
                     KEFEIYDIDGLFKDSKDDDDNKYYDVFFEMAKDDKNPDELNFRITVHNRSEKDSGELY
                     VIPQIFFRNTWAWGTKHNKYKKKPILKKDEKLSNMIHVSHEKYGERAIIFQPSPGEFP
                     IDSTQGNNGHNSVENTTDDVKPQLLFTDNESNLVKLYNSKENTSKYTKDAFEEYIVHG
                     NKDNSVNPNNEGTKACAVYHFKNIPPKEYVTVRYKFTNDLETSIYQIDDLAVVDEEEL
                     DTTINDREEEADNFYWRITPLPIDDHLRKIQRQAFAGLLWTKQFYNLTFNSWYYGDPN
                     SKLRPAPDRANGRNKNWKHLYIEDVLSMPDKWEYPFFASWDTAFHCIPLAMIDPDFAK
                     KQLDLLTREWYMHPNGQIPAYEWNFNDVNPPVHAWAVYRVFKIERNLYNREDRVFLER
                     VFQKLLLNFTWWVNRKDSSGNNIFEGGFLGLDNIGIFNRSEPLPTGGTLEQADSTGWM
                     AFFSLQMLNIALELAKENPVYEDIASKFFEHFILISDSLSFEYLVDLTGSECKDIVKQ
                     NLWNEEDQFYYDTISWGAENKMQLPIRSLVGLIPLYASMTLEPHLLTKFPNFKKRVDW
                     FVENQPEILERNFASMTKRGVGERMLLSLVTEDRLKAILSRLLDENEFLSEFGVRSLS
                     KHHEEHPYVMDVNNSTYTVKYLPGESDSGMFGGNSNWRGPIWFPTTFLLIEALQRFFL
                     YYGPEFKIECPTGSGQMMNLAEVAEEICYRMIHIFLPDENGRKAVFDGNTCNVLSHDE
                     YFKDYILFYEYFDGDTGRGLGASHQCGWTSLVAKWISDIGLSNVRQSRASRASINSIV
                     SENEAHVSDTQLKRPQLPKIRKKSIKSMVILTSNLLELSEEEKHNYTIGNIKSGNSTP
                     TPKQHSSRYSSLEPHSHSNSFAHENEQHLINKLKDEIGKMSFEADGSEKKKPGSSIYD
                     TENEFSCQ"
     gene            complement(<484435..>485124)
                     /gene="TPHA0H02040"
                     /locus_tag="TPHA_0H02040"
                     /db_xref="GeneID:11534306"
     mRNA            complement(<484435..>485124)
                     /gene="TPHA0H02040"
                     /locus_tag="TPHA_0H02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686794.1"
                     /db_xref="GeneID:11534306"
     CDS             complement(484435..485124)
                     /gene="TPHA0H02040"
                     /locus_tag="TPHA_0H02040"
                     /inference="similar to DNA sequence:INSDC:YMR197C"
                     /note="similar to Saccharomyces cerevisiae VTI1 (YMR197C);
                     ancestral locus Anc_6.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686842.1"
                     /db_xref="GeneID:11534306"
                     /db_xref="GOA:G8BWF7"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:G8BWF7"
                     /translation="MSSLLSSYESEFKLTLEKARSNLREAKNQQLPQRNATLKEIEEE
                     QDELLDLIDQMDIEINNTITGSNSQDRARLKSKLRDYQKFIVNDVKQPLQKLMDERDR
                     DMLFGGNGNENNLENNGSLQYMDDEQRQQLLKNHATLTKSGDRLTEATRIATETENIG
                     SQIMRDLRSQRETLENARQTLFQADSYIDKSMQTIKTMSRRLVANKFISYAIIAVLIL
                     LILLVLFSKFK"
     gene            <485808..>486374
                     /gene="TPHA0H02050"
                     /locus_tag="TPHA_0H02050"
                     /db_xref="GeneID:11534307"
     mRNA            <485808..>486374
                     /gene="TPHA0H02050"
                     /locus_tag="TPHA_0H02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686795.1"
                     /db_xref="GeneID:11534307"
     CDS             485808..486374
                     /gene="TPHA0H02050"
                     /locus_tag="TPHA_0H02050"
                     /inference="similar to DNA sequence:INSDC:YPL252C"
                     /note="similar to Saccharomyces cerevisiae YAH1 (YPL252C);
                     ancestral locus Anc_6.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686843.1"
                     /db_xref="GeneID:11534307"
                     /db_xref="GOA:G8BWF8"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:G8BWF8"
                     /translation="MSFLYGVPLRSITTGTRRVTAKTTIGSLGYAATMLYNSGKVSNN
                     NTSLRARVLSAGFSTSSIWYHGHLKTPKPGEELKITFILKDGKQTTYDTSEGDSILDI
                     AEAHNLDMEGACGGSCACSTCHVIVDPDYYDAIPEPNDDENDMLDLAYGLTETSRLGC
                     QVKMSKDIDGIRVALPALTRNVSLKDYK"
     gene            <487254..>489296
                     /gene="TPHA0H02060"
                     /locus_tag="TPHA_0H02060"
                     /db_xref="GeneID:11533705"
     mRNA            <487254..>489296
                     /gene="TPHA0H02060"
                     /locus_tag="TPHA_0H02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686796.1"
                     /db_xref="GeneID:11533705"
     CDS             487254..489296
                     /gene="TPHA0H02060"
                     /locus_tag="TPHA_0H02060"
                     /inference="similar to DNA sequence:INSDC:YMR198W,YPL253C"
                     /note="similar to Saccharomyces cerevisiae CIK1 (YMR198W)
                     and VIK1 (YPL253C); ancestral locus Anc_6.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686844.1"
                     /db_xref="GeneID:11533705"
                     /db_xref="UniProtKB/TrEMBL:G8BWF9"
                     /translation="MSNNTSKIPSLSLVDNTFDSTLHVNKKLKLSSDREMLSDVTNNA
                     KNKYSYRKNSNDKNVSNISRLNSLYDMQNRRLMNKYIYGDAHAVEEVKKRERKIIKDM
                     NHLINAIAEIDKETSSVMSSDLPEIRYQISKKKNGCAELEKEIMNLNSMLDLKQGDLD
                     LFKRNEELEIKNLHLKYEVELQELENELQEELNQEKFKWEKQKQELENMKPSEEIAQE
                     IEILKGELESAKIELNNIINQNEIQLNDYKAELQNKFEEFKKEKKAPLDKLISNKEQL
                     KENIEKYETEIINITKEQDLLKKSQEDLREKIENYSQKLKNSENEMVPLNEKLMAVSK
                     EFEILKSENDKLKELAFKEEQLYKEKYEQVEEEQLRRKKLENSIDELKGTIRCVAYYS
                     TTELQDAYSIDIPSHTITSIDVAGNENNLNLKFSDNVNKKDEVKSLPNMYEFNRVIPS
                     ELIEESMMLCDEYQCYHDMCLENRTNFNLISVSASPWNKLRKAVFQLLIPKYLEKYNI
                     SLQSVFLSEEVYSQDLLLQYADTSMNPEDIKDGIDLKIEENSIELNSYSMEIKEDISE
                     LPTEVIEPKEITESGINILKFKFLEKNESELEQEENPINYYFVEFYNLETNYVLEKYV
                     TPGETPTTPIGMIIKKLIQDTKSYFIFKMDKVDVTDLFTNISNKVSKLKNPKRKPN"
     gene            complement(<489494..>490843)
                     /gene="TPHA0H02070"
                     /locus_tag="TPHA_0H02070"
                     /db_xref="GeneID:11533706"
     mRNA            complement(<489494..>490843)
                     /gene="TPHA0H02070"
                     /locus_tag="TPHA_0H02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686797.1"
                     /db_xref="GeneID:11533706"
     CDS             complement(489494..490843)
                     /gene="TPHA0H02070"
                     /locus_tag="TPHA_0H02070"
                     /inference="similar to DNA sequence:INSDC:YPL254W"
                     /note="similar to Saccharomyces cerevisiae HFI1 (YPL254W);
                     ancestral locus Anc_6.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686845.1"
                     /db_xref="GeneID:11533706"
                     /db_xref="GOA:G8BWG0"
                     /db_xref="InterPro:IPR024738"
                     /db_xref="UniProtKB/TrEMBL:G8BWG0"
                     /translation="MSIVKPGPTVMNTDLLESSQTMTMKNGETRPYSVSDPNNRSVAV
                     INTPLKINNDASPMVSTAKVNMQLNKRVDLESLIEQYTNILGRESWARYAQIITLFML
                     GKLSRKELSNEIDLLFVPPNVPNTTPALHKNVRKTLIRLHNQIMLSVLSNALRDSPLG
                     VNAEGSWGFGKSGSQMSKKRVNKHNSQIETYKKIVMSLPPIDRQRLRAITKESGKRGF
                     VLCSVLQARLDTIPKIPIVTNQESVKFVKENNFKTPTEWSQDVMNGFSAPLAIDTHSL
                     PDTDSLYLRMLGISREHGLVGAVDANSVDILSLALDQYLKNVIESVIDTVKYSKKNTT
                     EFYDLDETSRYQPIAPLGPSEQLEDQNEGQTISLTNEDMYTAFNVYPYLVQSESTKLT
                     VSSLDLLNDDELVITKSSIDDLVDFLDEKPSFTPTDENNIGSREELNWLIKDILTDR"
     gene            complement(<491587..>493020)
                     /gene="TPHA0H02080"
                     /locus_tag="TPHA_0H02080"
                     /db_xref="GeneID:11534036"
     mRNA            complement(<491587..>493020)
                     /gene="TPHA0H02080"
                     /locus_tag="TPHA_0H02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686798.1"
                     /db_xref="GeneID:11534036"
     CDS             complement(491587..493020)
                     /gene="TPHA0H02080"
                     /locus_tag="TPHA_0H02080"
                     /inference="similar to DNA sequence:INSDC:YPL255W"
                     /note="similar to Saccharomyces cerevisiae BBP1 (YPL255W);
                     ancestral locus Anc_6.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686846.1"
                     /db_xref="GeneID:11534036"
                     /db_xref="InterPro:IPR029328"
                     /db_xref="InterPro:IPR029330"
                     /db_xref="UniProtKB/TrEMBL:G8BWG1"
                     /translation="MNADIITNDINPKDHGGITGLFKWTKDALFGSSVSPTRKYKEFA
                     QDDTNYKYQRFNNIYHENNDECTVEHGRSRSSSWTGGSNQAFYDKYDLLRDPLVNDDK
                     YRKNKVRFSHQRYQTGMDESTHEGNYVNVKNMQQDLDYIMDPERRLKIEKLLAPVEIH
                     PNSMSNAGYNDNTDTFANKTNGFRKTSTLYDDVKVPTQDPAFLSALFRKTVGNESERF
                     DRSQAPNISRSESPQVLPGKFTSPLKNNGNKNLIKDHTSDYLSLLDKLDKNSRDLELM
                     YKDILGRKEENKKREESYKMKYMEIKNELNNEKLQSKKIFDNFYKLHSKYDELKKISN
                     KAIELSYNSPKVDDKLVAQVMDKDREISNLNDKIVELEITNKKLREKNEIDKMKYISK
                     LDELETLFNKQRQLKGKEYFEKEFLEDKFKHSDYEKAKYLADQDLKLDDIFNRNPDLS
                     SIENRYSPDHNYKYSKYKEINVDSDYL"
     gene            <493355..>494356
                     /gene="TPHA0H02090"
                     /locus_tag="TPHA_0H02090"
                     /db_xref="GeneID:11534037"
     mRNA            <493355..>494356
                     /gene="TPHA0H02090"
                     /locus_tag="TPHA_0H02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686799.1"
                     /db_xref="GeneID:11534037"
     CDS             493355..494356
                     /gene="TPHA0H02090"
                     /locus_tag="TPHA_0H02090"
                     /note="ancestral locus Anc_6.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686847.1"
                     /db_xref="GeneID:11534037"
                     /db_xref="UniProtKB/TrEMBL:G8BWG2"
                     /translation="MTKITQSVVAMDSIDKNVPVLWQDDEFVIRYNVAKSVHKLVLSM
                     NKSASDCNNQSSLRGDDVLLKWTHTCLSIDPQSFILKKTDQVSRIQLVWCHGNVVYCD
                     SLTIDSQNIVGFETEPLITVDFDVSAYYVIWNHGLVLLYEKLSSILHVFDTGYNKKIG
                     EIAMYSTDLHDTPMRSYVLYSRNHDLFSVVVFEYDSSIKKTIHYLNTYSLPNFNLKHY
                     SRLPEGYIDYVILQPQPSTIRTCNTLNNEIITICSYCNILQKITIQWFSFTNETNTKP
                     WFETTIRDYSFNMGATIKDHTVSLLLSNSNATGKQLFRATFDPFSLSQEWEINQINN"
     gene            <494741..>495532
                     /gene="TPHA0H02100"
                     /locus_tag="TPHA_0H02100"
                     /db_xref="GeneID:11534012"
     mRNA            <494741..>495532
                     /gene="TPHA0H02100"
                     /locus_tag="TPHA_0H02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686800.1"
                     /db_xref="GeneID:11534012"
     CDS             494741..495532
                     /gene="TPHA0H02100"
                     /locus_tag="TPHA_0H02100"
                     /inference="similar to DNA sequence:INSDC:YMR200W"
                     /note="similar to Saccharomyces cerevisiae ROT1 (YMR200W);
                     ancestral locus Anc_6.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686848.1"
                     /db_xref="GeneID:11534012"
                     /db_xref="InterPro:IPR019623"
                     /db_xref="UniProtKB/TrEMBL:G8BWG3"
                     /translation="MFAVIWVTCLLQCLLMNSIGVVADDSVPDYSGDTLHGTWSSKSN
                     QVFTGPGFYDPVDELLIEPSLPGISISFTEDGFYEEAWYRVAGNAKDPRCPTAVLIFQ
                     HGKYEVLTNGTLKLYPFEVDGRQLLSDPCNDGGVSAYTRYSQVGTYLSFYTVLDDYHG
                     VFKLQLFEFDGTPLQPLYLAYRPPIMLPTITLNPTASGSEDSSSDETSSAVAKRSLRS
                     LVKRNLENRYKTNAVKKQRSIFNSSTVWYACMTVICICSAAFIFS"
     gene            <496274..>498142
                     /gene="TPHA0H02110"
                     /locus_tag="TPHA_0H02110"
                     /db_xref="GeneID:11534013"
     mRNA            <496274..>498142
                     /gene="TPHA0H02110"
                     /locus_tag="TPHA_0H02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686801.1"
                     /db_xref="GeneID:11534013"
     CDS             496274..498142
                     /gene="TPHA0H02110"
                     /locus_tag="TPHA_0H02110"
                     /inference="similar to DNA sequence:INSDC:YNR006W"
                     /note="similar to Saccharomyces cerevisiae VPS27
                     (YNR006W); ancestral locus Anc_6.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686849.1"
                     /db_xref="GeneID:11534013"
                     /db_xref="GOA:G8BWG4"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017073"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:G8BWG4"
                     /translation="MTGLVVYPNELDSLIEAATSSSIPNGDVDLHASLEISDIIRSKR
                     IPHKDSMRCLKKRIIGTYSNPNTQLASWKLTDICIKNGGTGFIKEICSREFMDTMEST
                     ILKSELDAEVKDLVTKLVYELYLAFKNDSQLNYVSKVHDKLKARGIQFPDNLMDSRSA
                     LNLFDSKTPADWIDSDACMICSRKFSLLNRRHHCRSCGGIFCQDHSSNNIQLPDLGIH
                     DLVRVCDNCYDDYDIKNSGGSSKPRIHHHKSDKNKEYFDAEEEQLRKAIKLSLKENHQ
                     SNQYNNKTEPIVPYVNHEDAPKDTINTEEIDNDPELKAAIEASLKQSEIDKDKRLQLE
                     QYSQQQQEQQQGTYYRNPNINQASIQQSAPYNSYEISSEEENNIYLFASLVEKLKNKP
                     TTEVLEDQQLQALYQKVVQSRPRLNNSLNDTVTKYNTLIEMNGKISNIMNIYDELLEN
                     QLNSINVRQTYAAPVVPSDPYTYYQQQSAQPHQSNTHLQQHQVANEIVQPTQVKEEST
                     LKALGNLVIDNQKPNNAIISPYPIEESEPEPVVTHLKVATEPPYSDNELKIGSSTEFA
                     PIDGSADSPLAETSNKQTDNITAFDFPTVPAVKTALVTQEPQIVQEEPQEELLLEL"
     gene            complement(<498282..>499385)
                     /gene="TPHA0H02120"
                     /locus_tag="TPHA_0H02120"
                     /db_xref="GeneID:11534004"
     mRNA            complement(<498282..>499385)
                     /gene="TPHA0H02120"
                     /locus_tag="TPHA_0H02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686802.1"
                     /db_xref="GeneID:11534004"
     CDS             complement(498282..499385)
                     /gene="TPHA0H02120"
                     /locus_tag="TPHA_0H02120"
                     /inference="similar to DNA sequence:INSDC:YMR201C"
                     /note="similar to Saccharomyces cerevisiae RAD14
                     (YMR201C); ancestral locus Anc_6.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686850.1"
                     /db_xref="GeneID:11534004"
                     /db_xref="GOA:G8BWG5"
                     /db_xref="InterPro:IPR000465"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR022652"
                     /db_xref="InterPro:IPR022656"
                     /db_xref="InterPro:IPR022658"
                     /db_xref="UniProtKB/TrEMBL:G8BWG5"
                     /translation="MTPEQKAKIEANRIKALERLKSRGILKASQEQQISRRIAPTVIE
                     INAGNNTTNSDLTPRPLPSVIEVNSSDVRNIDLSTSNVSSPIANNDKPQNAQKDPLSR
                     IRPSIRTQDYIEYDFAKVRNSNGGFINIEDRASGFDADDFDYYGEDSNGPTKHKSLED
                     WKREQQERKYIYENAPPPEHISQAPKCIECKINIEMDPVLNDVFKLQVCKKCAKDIPE
                     KYALLTKTECKEDYLLTDPELNDIGLFHRLEKPNPHSGTFARMQLFVRCEIEKFAFEK
                     WEGEEGLDNEWKRREEGKVSRREKKYQEKMKQMRLKTRAQEYTNRLKEKKYGKTHVHN
                     FSNPIDGGEDEDGNALQRRRCMECGLQTDEVVL"
     gene            <500790..>501608
                     /gene="TPHA0H02130"
                     /locus_tag="TPHA_0H02130"
                     /db_xref="GeneID:11534005"
     mRNA            <500790..>501608
                     /gene="TPHA0H02130"
                     /locus_tag="TPHA_0H02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686803.1"
                     /db_xref="GeneID:11534005"
     CDS             500790..501608
                     /gene="TPHA0H02130"
                     /locus_tag="TPHA_0H02130"
                     /inference="similar to DNA sequence:INSDC:YNR009W"
                     /note="similar to Saccharomyces cerevisiae NRM1 (YNR009W);
                     ancestral locus Anc_6.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686851.1"
                     /db_xref="GeneID:11534005"
                     /db_xref="InterPro:IPR013734"
                     /db_xref="UniProtKB/TrEMBL:G8BWG6"
                     /translation="MDIQRLPLRDLSNIRFYKQPVLHNNNEKFHFHLDTLSSITTLIG
                     DTHFQGNSKDSVLPTDVKLHNTTQTSNIFNDHSSNETSKRTSELKHTDDICNRLKIRL
                     QFAFYKYQTNQIDKKFTDIKKSLANTSATYPDDCDFQLLIETPSKKRNHDNMGKISKK
                     KHNGKRKLMMSSGNFFISHGKKDTQGSTIEKHHSKYSSQPNDSSINSIASDNDTKDCK
                     NITGDTTIFTTPSSKTHTFPNNNVSSSSVKNKQETPMSVKAAKSLISLFTSNRN"
     gene            <502263..>502721
                     /gene="TPHA0H02140"
                     /locus_tag="TPHA_0H02140"
                     /db_xref="GeneID:11533871"
     mRNA            <502263..>502721
                     /gene="TPHA0H02140"
                     /locus_tag="TPHA_0H02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686804.1"
                     /db_xref="GeneID:11533871"
     CDS             502263..502721
                     /gene="TPHA0H02140"
                     /locus_tag="TPHA_0H02140"
                     /inference="similar to DNA sequence:INSDC:YNR010W"
                     /note="similar to Saccharomyces cerevisiae CSE2 (YNR010W);
                     ancestral locus Anc_6.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686852.1"
                     /db_xref="GeneID:11533871"
                     /db_xref="GOA:G8BWG7"
                     /db_xref="InterPro:IPR011425"
                     /db_xref="UniProtKB/TrEMBL:G8BWG7"
                     /translation="MSLRNKSLIEIMNKLEPADVGTNQASSELESEGKPTLGPNLASA
                     PSSTTLNTIGSNTNIANTEFIPYLFYCLHQIRKDQSNSANKFELQVGFIKHRLRSCKT
                     FIETDQVFKDLMSKSIEDWNEEIQNRECELQRKKEVINNLRSTIDSILNK"
     gene            complement(<502970..>504268)
                     /gene="TPHA0H02150"
                     /locus_tag="TPHA_0H02150"
                     /db_xref="GeneID:11533872"
     mRNA            complement(<502970..>504268)
                     /gene="TPHA0H02150"
                     /locus_tag="TPHA_0H02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686805.1"
                     /db_xref="GeneID:11533872"
     CDS             complement(502970..504268)
                     /gene="TPHA0H02150"
                     /locus_tag="TPHA_0H02150"
                     /inference="similar to DNA sequence:INSDC:YMR204C"
                     /note="similar to Saccharomyces cerevisiae INP1 (YMR204C);
                     ancestral locus Anc_6.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686853.1"
                     /db_xref="GeneID:11533872"
                     /db_xref="GOA:G8BWG8"
                     /db_xref="InterPro:IPR024758"
                     /db_xref="UniProtKB/TrEMBL:G8BWG8"
                     /translation="MKNYNASVNKQLTSKHDGVLEKKKNDTTAKYTTTNKQGTKKKKQ
                     LSALGILKDTLKLKSSKNAMKTASTKYTKSNSLTNYDTNNNTGKDIDSERKAKINKRL
                     STQRVTLFYHNDVRVMSYTPNIKHQATDKVNSSENNKLHNRDDTSFSSSISNNTVSMK
                     PYSLVAHGPIEIYQIRTISNLPNEKPQTMNYLSLGRKGNIIHPILPKLKVTKSTGSTT
                     YSIHFYNPERFWSVDFYLNQGTKDEDNEMKIVLTSFEEQISKICDFTIKTADDTLLPI
                     LMANTESAKDCLIINSSPSNNTKISYDEESEDDQLSYLLEDSSESDSSDVGSISHDIL
                     INNHSNVISSQCTLNPKNWIANNHVQEDIINDAFKKAFQQYSHIPINSQSTLLEKENT
                     TQLKTKRYSSYNPLVSTFDIRNHYKENNKSLSNGRSSSFE"
     gene            complement(<504996..>507866)
                     /gene="TPHA0H02160"
                     /locus_tag="TPHA_0H02160"
                     /db_xref="GeneID:11533992"
     mRNA            complement(<504996..>507866)
                     /gene="TPHA0H02160"
                     /locus_tag="TPHA_0H02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686806.1"
                     /db_xref="GeneID:11533992"
     CDS             complement(504996..507866)
                     /gene="TPHA0H02160"
                     /locus_tag="TPHA_0H02160"
                     /inference="similar to DNA sequence:INSDC:YMR205C"
                     /note="similar to Saccharomyces cerevisiae PFK2 (YMR205C);
                     ancestral locus Anc_6.304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686854.1"
                     /db_xref="GeneID:11533992"
                     /db_xref="GOA:G8BWG9"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:G8BWG9"
                     /translation="MTVTLPLVNGTSYSTINAYSKDLLHETVKFYENVLGLSSREISE
                     TSYILSNGAVTIKVVLSEDSTKAQEHSKRVEFFSKNQSSIDWRTAASSATVFNSADIC
                     SVRQKLAASNSPTQSFPSELNPLLLYSIDPLGNLFGVTATKNAISTKPTEKVEESHKK
                     RDLTSKLGSYTDLSSQLATSVDYPSLPTKLNPNKAEKAIAVMTSGGDAQGMNSCVRAI
                     VRSTIFKGCRAFCHGRLRRFSQGGPEYIKEVTWEDVRGWSAEGGTNIGTARCLEFRQR
                     EGRLLGAQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIDELLKTKKISSEQFNRY
                     QHLNICGTVGSIDNDMSTTDATIGAYSALDRICTAVDYVEATANSHSRAFVVEVMGRN
                     CGWLALLAGIATSADYIFIPEQPAVAGQWQEEMCNIVSKHRAHGKRTSIIVVAEGAID
                     CDLNPISAKDVHSVLCELGLDTRITTLGHVQRGGTAVAYDRMLATLQGVEAVNAVLDS
                     TPETPSALIAINENQITRKPLVDSVALTKSVADAIHAKDFKKAMALRDTEFIEHFNNY
                     MAINVADHAEPRLPVDKRLKIAIVSVGAPAGGINSAVYSMATYCMAQGHKPYAIYNGF
                     SGLARHESVRSLSWKDIIGWQSRGGSEIGTNRATPEEADIGMIAYYFQKYQFDGLIVV
                     GGFEAFISLHQLEVARDSYAAFRIPMVLIPATLSNNVPATEYSLGADTALNSLMQYCD
                     VVKQSAASIRGRAFVIDVQGGNSGYLATCAALAVGAQASYVPEEGLSLQQLSQDIKTL
                     DESFKKAQGRGRFGKVILKSSNASKAMSAKQIAEIITAEAEGRFDAKPAIPGHVQQGG
                     LPSPIDRTRATRLAVRAVSFIEEQQDVIKSARAADDDFVYEDKAVSATASVIGIRGTH
                     VVFTPIRHAYDFEADIEKRMPKVIHWQATREIADYLVGRKRV"
     gene            complement(<510002..>512734)
                     /gene="TPHA0H02170"
                     /locus_tag="TPHA_0H02170"
                     /db_xref="GeneID:11533993"
     mRNA            complement(<510002..>512734)
                     /gene="TPHA0H02170"
                     /locus_tag="TPHA_0H02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686807.1"
                     /db_xref="GeneID:11533993"
     CDS             complement(510002..512734)
                     /gene="TPHA0H02170"
                     /locus_tag="TPHA_0H02170"
                     /inference="similar to DNA sequence:INSDC:YNR013C"
                     /note="similar to Saccharomyces cerevisiae PHO91
                     (YNR013C); ancestral locus Anc_6.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686855.1"
                     /db_xref="GeneID:11533993"
                     /db_xref="GOA:G8BWH0"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:G8BWH0"
                     /translation="MKFSHSLQFNAVPDWSSKYIAYSQLKKTIYALQKDKLYNSSNIT
                     DLENDGLSPDNDHNTSDDIYINKFIKELNAQLQKIDGFYINQEKTLIDNFNDILQEIN
                     EFDEYYLSDALVCSHLNSGVIQNANEIENEPSNDDETSSLIIHRNLSLQNDRNYSSIG
                     ENKRNFSGGGNLLDNNTIDGVDDTVKKFLPLKNSISNSVLDDNNRKISYGKIRKTSMT
                     NSINNMVMDNNIYIEHKITIKKRLISIFTQFNELLDYINLNLTGFTKICKKFDKSLET
                     NIKTTYLSLITKKSHCFNDITINRVKVIINRIIIMFAKFSNSIPQESSILLFSSDDSY
                     DTSDNNAGIQDYTNEEANEEVEKSELFMNAKRQLSSHLRDHIIWERNTVWKDMINLER
                     KANNVNNDTNASYFNNLYTSFNIKNNLKKDFEKLKGNDGFNNATSITDIIQLRTFVHF
                     MILTLIFIFFLIISPFQEDILQKNCFAILIYASLLWATETIPLFVTSLLVPLLIVMFP
                     VLSDPTDPGTILTPVQSSQYILSTMWSSVIMLLLGGFTLAAALSKYNIAKVIATKILS
                     SVGTNPKIILITMMFLALFISMWVSNVAAPVICFSIIQPILRTLPKQSSYGKSLIMGI
                     ALASNIGGMASPISSPQNIFAISLMDPQPTWIEWFAIAIPICILCIVIIWILLIITFP
                     LDPNLKILQLHPIRESFSHKQWAVCGISMLTILLWCFSNQISSYFGEMGIISIIPLVL
                     FFGTGLLTSEDFNSFMWTIIILAMGGTTLGKAVSLSGLLSHVAEIIKAQVEHDTIFTI
                     VLIFGLLILTIATFVSHVVAAMIVLPLMSEIGSSLPSDHSRLLVMMATMLCSCAMGLP
                     TSGIPNVTAISLTDEFGDRYLTVGNFITRGVPSGFLCYFIIVTVGFGLMKLIGF"
     gene            <514726..>515448
                     /gene="TPHA0H02180"
                     /locus_tag="TPHA_0H02180"
                     /db_xref="GeneID:11533912"
     mRNA            <514726..>515448
                     /gene="TPHA0H02180"
                     /locus_tag="TPHA_0H02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686808.1"
                     /db_xref="GeneID:11533912"
     CDS             514726..515448
                     /gene="TPHA0H02180"
                     /locus_tag="TPHA_0H02180"
                     /inference="similar to DNA sequence:INSDC:YMR206W,YNR014W"
                     /note="similar to Saccharomyces cerevisiae YMR206W and
                     YNR014W; ancestral locus Anc_6.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686856.1"
                     /db_xref="GeneID:11533912"
                     /db_xref="UniProtKB/TrEMBL:G8BWH1"
                     /translation="MGLNRPISAQLMIYNTNSNSDDEGLVGSRSELENRAAASSHSTL
                     QSESSSHSGACFSCKYGGDPRHSQLPRRVVSSSVPISSAGTSMKLNGSRQRSICDLFQ
                     CEHKSHSCRSNSSGNRHSASSSHIETAGARGRRRSDSHLTIKNDNNSSFFNNFLLHDL
                     VTEDSGATERNYSCFPSPTTNPGPATLSRKDSFGKGSSETEDDEEENGEVTISFLNES
                     PCTRHHHRRNSTALKFEKPYYI"
     gene            complement(<515628..>522332)
                     /gene="TPHA0H02190"
                     /locus_tag="TPHA_0H02190"
                     /db_xref="GeneID:11533991"
     mRNA            complement(<515628..>522332)
                     /gene="TPHA0H02190"
                     /locus_tag="TPHA_0H02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686809.1"
                     /db_xref="GeneID:11533991"
     CDS             complement(515628..522332)
                     /gene="TPHA0H02190"
                     /locus_tag="TPHA_0H02190"
                     /inference="similar to DNA sequence:INSDC:YMR207C,YNR016C"
                     /note="similar to Saccharomyces cerevisiae HFA1 (YMR207C)
                     and ACC1 (YNR016C); ancestral locus Anc_6.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686857.1"
                     /db_xref="GeneID:11533991"
                     /db_xref="GOA:G8BWH2"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8BWH2"
                     /translation="MSEENLFETSVDKSKYEVTDYSSYHADLPSNFIGLNIIEKAEES
                     PLKEFVKSHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGDEKVVQFVAMATPED
                     LEANAEYIRMADQYIEVPGGTNNNNYANVDLIVDLAERCDVDAVWAGWGHASENPHLP
                     EKLADSKRKVIFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDKVHIDEKTG
                     LVSVDDDVYQQGCCNSPEDGLIKAKEIGFPVMIKASEGGGGKGIRKVENEEEFISLYH
                     QASNEIPGSPIFIMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPV
                     TIAGQKTFSEMEKAAVRLGKLVGYVSAGTVEYLYSHKEDKFYFLELNPRLQVEHPTTE
                     MVSGVNLPAAQLQIAMGIPMHRIRDIRTLYGLDPHGAAEIDFEFNNEESMKKQRKPTP
                     KGHCTACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGNIHSFSDSQFGH
                     IFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDLI
                     IQKMTAEKPDPTLAVICGAATKAFIASEATRKEYVESLKRGQVPSKSILQTMFPVEFI
                     HEGKRYKFTVAKSAEDRYTLFINGSKCEVRARKLSDGGLLITIGGKSHTIYWKEEVSA
                     TRLSVDSKSTLLEVENDPTQLRTPSPGKLVKFLVENGDHISSGQPYAEVEVMKMQMPL
                     IAQESGIVQLLKQPGSNIVAGDIIAILTLDDPSKVKHALPFEGMLPEFGSPDIEGTKA
                     AHKFNSLVATLENILKGYDNQVTMNSSLQLLIEVLRNPELPYTEWKLHISALHSRIPP
                     HIDQQLEQLLERSIKRNAVFPARQLSKILESSINDESTDALFEATISPLLDITKRYEN
                     GLQAHEHNVFVHFLEEYYDIEKLFAGPNVREENVILKLRDENSENLDKVALMVLSHAK
                     VSAKNNLILNILKHYQPLCKMSSEVASAFMQPLHHIVELESKSTAKVALQAREILIQG
                     ALPSVQERVNQIEHILKSSVVNTSYGQTSVKSRAEPDQRILKDLIDSNYVVFDVLTPF
                     LCNQDPAIASAAAHVYVQRAYRAYTVGEVKIHNGFSNVVCEWKFQLPTAAFAAAPQIN
                     NKMGMNRAMSVSDLSFVVDSDTSPLRTGLLIASDHLDDIDTALSQALEVIPVHSASNG
                     PGPDRSSVSATLSNVANIYVHSTEGFDNDEAVLVRLKEILNDNKSQLVDSSIRRITFM
                     FGFEDGAYPKYFTFRGPSYKEDETIRHIEPALAFQLELGRMSNFNIKPIFTENRNIHV
                     YEAVSKTSQLDKRFFTRGVIRTGSIRDDISIQEYLTSEAHRLISDILDNLEIIDTSNS
                     DLNHMFINFSAVFDISPEDVEAAFGGFLERFGKRLLRLRVTSAEIRIIIKEPVSGTPV
                     PLRALISNVSGYVVRAELYTEVKNSRSEWVFKSLGKPGSMHLRPIATPYPVKEWLQPK
                     RYKAHLMGTTYVYDFPELFRQASTTQWHKKDPKTNVSDSFFTSHELIEDENGELTEVE
                     REPGANSIGMVAFIITVKTPEYPRGRQFVIVANDITFKIGSFGPQEDEFFNKVTDYAR
                     MRGIPRIYLSANSGARIGIAEELIPLFKVAWKDDNDSTKGFEYLYLTEEDMVVLKKHD
                     KDNTVITERIVEGGEQRNVIKTIIGTEDGLGVECLRGSGLIAGATSRAYNDIFTITLV
                     TCRSVGIGAYLVRLGQRAIQIEGQPIILTGAPSINKLLGREVYASNLQLGGPQIMYNN
                     GVSHLTATDDLAAVDQILQWISYIPAKRNMPVPIYETGDSWDRDVEYKPLPKEPYNVR
                     WLIEGRDTDDGFEYGLFDKGSFFETLSGWAKGVVIGRARLGGIPLGVIAVETRTIENV
                     IPADPANPDSTESIIQEAGQVWYPNSAFKTAQAIKDFNNGEQLPLMILANWRGFSGGQ
                     RDMYNEVLKYGSFIVDALVDYKQPVMIYIPPTGELRGGSWVVVDPNINPDQMEMYADV
                     ESRAGVLEPEGMVGLKYRREKLLGTMNRLDDKYRTLRAKLSDTSLSDEEHQEVSKELA
                     HRERQLLPIYHQVTVQFADLHDRTGRMLAKGVIRKELEWSNSRRFFFWRLRRRLNEEY
                     LIRRLNKSFKNSANVSRLEKISRIRSWYPSSIDNDDDQAISKFIEEKYAVIDENFNKL
                     KVETVAQDLAKSFRSDHDSTIAGLSEVLKMLSTEDKQKLLKSLK"
     gene            <524645..>525280
                     /gene="TPHA0H02200"
                     /locus_tag="TPHA_0H02200"
                     /db_xref="GeneID:11533885"
     mRNA            <524645..>525280
                     /gene="TPHA0H02200"
                     /locus_tag="TPHA_0H02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686810.1"
                     /db_xref="GeneID:11533885"
     CDS             524645..525280
                     /gene="TPHA0H02200"
                     /locus_tag="TPHA_0H02200"
                     /inference="similar to DNA sequence:INSDC:YNR017W"
                     /note="similar to Saccharomyces cerevisiae TIM23
                     (YNR017W); ancestral locus Anc_6.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686858.1"
                     /db_xref="GeneID:11533885"
                     /db_xref="GOA:G8BWH3"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005681"
                     /db_xref="UniProtKB/TrEMBL:G8BWH3"
                     /translation="MSWIFGTNKKTSEEVHEKETSKLGFDPEQVSNVSNIISSGTSFD
                     ASRLHPLAGLEKGVEYLDLEEEQLSAIEGSQGLIPSRGWSDDLCYGTGAVYLLGLGTG
                     GAYGFIEGVRNITPGSPGKLKLNTILNHITKRGPFMGNSAGVLALTYNIINSTIDSVR
                     GKHDASGAIVAGAVTGAIFKSSKGFKPMAYASGLTAGAAALWSGVKGSVLE"
     gene            complement(<525856..>526671)
                     /gene="TPHA0H02210"
                     /locus_tag="TPHA_0H02210"
                     /db_xref="GeneID:11533886"
     mRNA            complement(<525856..>526671)
                     /gene="TPHA0H02210"
                     /locus_tag="TPHA_0H02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686811.1"
                     /db_xref="GeneID:11533886"
     CDS             complement(525856..526671)
                     /gene="TPHA0H02210"
                     /locus_tag="TPHA_0H02210"
                     /inference="similar to DNA sequence:INSDC:YCR047C"
                     /note="similar to Saccharomyces cerevisiae BUD23
                     (YCR047C); ancestral locus Anc_6.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686859.1"
                     /db_xref="GeneID:11533886"
                     /db_xref="GOA:G8BWH4"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BWH4"
                     /translation="MSRPEDLAPPEFFYDDIESKKYTSSTRVQHIQAKMTLRALELLN
                     LPPNSFILDIGCGSGLSGEILTEDDHVWCGLDISPSMLATGLTRDVEGDLMLHDMGQG
                     IPFRAGTFDAAISISAIQWLGNADTSYNDPKKRLLRFFNTLFASLKKGGKFAAQFYPK
                     NEDQIDEILKTAKVAGFSGGLVIDDPESKKNKKYYLVLTSGSPRVTDENVNLQGVTMD
                     ATELEKAKIHRNRKKVMESNKTYINRKKDLMRRRGRKVALDSKFTGRKRRARF"
     gene            <527641..>529419
                     /gene="TPHA0H02220"
                     /locus_tag="TPHA_0H02220"
                     /db_xref="GeneID:11534212"
     mRNA            <527641..>529419
                     /gene="TPHA0H02220"
                     /locus_tag="TPHA_0H02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686812.1"
                     /db_xref="GeneID:11534212"
     CDS             527641..529419
                     /gene="TPHA0H02220"
                     /locus_tag="TPHA_0H02220"
                     /inference="similar to DNA sequence:INSDC:YCR048W,YNR019W"
                     /note="similar to Saccharomyces cerevisiae ARE1 (YCR048W)
                     and ARE2 (YNR019W); ancestral locus Anc_6.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686860.1"
                     /db_xref="GeneID:11534212"
                     /db_xref="GOA:G8BWH5"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:G8BWH5"
                     /translation="MASGLLKDQKFIKIQKLNSIDNGRKKKSIIINDGDFDAVSDGSF
                     VDLNDEKIEKIKIIEDNIESISSGVNVKIPANSLSAAASNNSTVFNANSEYIERHIKI
                     IDGRARSRYKRNTKEAISYFGDVSFQTRPSILDGSINNPYQEKFSGPIFEKISFSDKN
                     SDVLVASNFGGFYVLAWMSVAFSCFKMLIEYYNTHDHSFKDSEILHFMTTDLFTVAAV
                     DLMMYSNLWFIFAIQWLCKMNILKWKPVGRMITAIFESCFVIFYIILTENILGLHWVA
                     KIFLFLHSLVLLMKMHSFAFYNGYLWNIKSELSFSTRALKKYYNSENKEVIETLNRSK
                     DFCTSELNAISDTVAFPENINVKNFFMYTMFPTLVYQVEYPRTERIRWRYVLEKACAI
                     FGTIFLMMLLAQTYMYPVAMRAIAVKHTQWQGYVHRAKQWAELLIDLVPSFITMYILN
                     FYLIWDAILNCIAELTCFGDRYFYGDWWNCVDWGDFSRIWNIPVHKFLLRHVYHSSIS
                     FLNLSKSQATLMTFFISSVVHELAMYVIFKKLRCYLFILQMTQLPLVTISKTKYFRDR
                     TIINNVFFWLGICTGPSIMCTLYLTF"
     gene            complement(<529605..>530363)
                     /gene="TPHA0H02230"
                     /locus_tag="TPHA_0H02230"
                     /db_xref="GeneID:11533869"
     mRNA            complement(<529605..>530363)
                     /gene="TPHA0H02230"
                     /locus_tag="TPHA_0H02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686813.1"
                     /db_xref="GeneID:11533869"
     CDS             complement(529605..530363)
                     /gene="TPHA0H02230"
                     /locus_tag="TPHA_0H02230"
                     /inference="similar to DNA sequence:INSDC:YNR020C"
                     /note="similar to Saccharomyces cerevisiae ATP23
                     (YNR020C); ancestral locus Anc_6.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686861.1"
                     /db_xref="GeneID:11533869"
                     /db_xref="GOA:G8BWH6"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="UniProtKB/TrEMBL:G8BWH6"
                     /translation="MDDSNSKDNSIVETIKVANTPKDLNSLKGFQWWRRTFQYNTGLG
                     LTPEEKSNYENDYQYILTRKQCNSCYEYRDWLLKYSPTVRFMIQQISKLSENNPNIDN
                     KTVKSFDESKIICDVCPELRSGGFHPDYGILICQNRIRDKWHLEDTLAHELVHQFDNL
                     KWKVDWLNLKQHACSEIRASSLSGECRFFQEFSKRGFGFTIAKGHQECVKRRAVLSLM
                     GNPNCKDKKQAELVVDEVWESCFNDTRPFEDIYR"
     gene            <530907..>532133
                     /gene="TPHA0H02240"
                     /locus_tag="TPHA_0H02240"
                     /db_xref="GeneID:11533870"
     mRNA            <530907..>532133
                     /gene="TPHA0H02240"
                     /locus_tag="TPHA_0H02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686814.1"
                     /db_xref="GeneID:11533870"
     CDS             530907..532133
                     /gene="TPHA0H02240"
                     /locus_tag="TPHA_0H02240"
                     /inference="similar to DNA sequence:INSDC:YNR021W"
                     /note="similar to Saccharomyces cerevisiae YNR021W;
                     ancestral locus Anc_6.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686862.1"
                     /db_xref="GeneID:11533870"
                     /db_xref="InterPro:IPR012879"
                     /db_xref="UniProtKB/TrEMBL:G8BWH7"
                     /translation="MSVIFEAMNSFSRILESMNAEYLSYTPEQLKEMSVFQRLSVYNF
                     TFEFFCISIIVLIFVFYQVGISINKGKADKLFKEFNNYFGHDLKFSRVAFSDKDNKEL
                     PYAEQEKSSWFTSFATGRSSIESITLRAHLYPRNNPISLGFELVLGYFFPSLKIKDLE
                     EFAEFTIKPNGIFVSTETSEANGNAKEILKNFKFVTAIVNKSAMNESRRDNFFLSVTH
                     TSESDKLPANYVYMSEVNQFNGIYENYVPTILNKDLLLKLSHILKFVSFTDLPSEKPF
                     SQAEWEANQQPKAVIRVSFPTSTTDIENIKVLIGAVVEIFDKATNNLVNNKGTQFIKP
                     DMLNKSLKLRSQHLDSINKAIEQAKKELAAEKKYEADKEMRRQKKKSGELLEYDKKMA
                     EKRARRAKNKQKQRMQ"
     gene            <532810..>534357
                     /gene="TPHA0H02250"
                     /locus_tag="TPHA_0H02250"
                     /db_xref="GeneID:11533724"
     mRNA            <532810..>534357
                     /gene="TPHA0H02250"
                     /locus_tag="TPHA_0H02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686815.1"
                     /db_xref="GeneID:11533724"
     CDS             532810..534357
                     /gene="TPHA0H02250"
                     /locus_tag="TPHA_0H02250"
                     /inference="similar to DNA sequence:INSDC:YCR053W"
                     /note="similar to Saccharomyces cerevisiae THR4 (YCR053W);
                     ancestral locus Anc_6.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686863.1"
                     /db_xref="GeneID:11533724"
                     /db_xref="GOA:G8BWH8"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:G8BWH8"
                     /translation="MVTPSQVYRSTRSDSTETRSFEEAVLQGLATDGGLFIPPTIPHV
                     SAETLKQWSKLSFQDLAFEIMSLYIARDEIPSEDLKALVDRSYSTFRSKDVTPLVKNL
                     TGSKENIHILELFHGPTYAFKDVALQFVGNLFEYFLQRFNQGKQDSEKKKLTVVGATS
                     GDTGSAAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVPDKNVQTLSVNGTFDNCQD
                     IVKAIFGDKDFNSGHHVGAVNSINWARILAQITYYFYSYFQVTDGKDEKVKFVVPSGN
                     FGDILAGYFAKKMGLPIEKLVIATNENDILDRFLKSGTYERSDAVAATLSPAMDILIS
                     SNFERLLWFLARENLTANGSDDLKAGEIVNNWFHQLKTAGKFIVDPKIIAGASVDFAS
                     ERVSNEETISTIKDIYQNSENPKKYILDPHTAVGVCATKRVIAKDSNDANLHYISLST
                     AHPAKFADAVNKALSEFEGYSFEKDVLPAELKKLSTLEKRLKFVEKPDIELVKNAIEE
                     ELVKMGL"
     gene            <535452..>537377
                     /gene="TPHA0H02260"
                     /locus_tag="TPHA_0H02260"
                     /db_xref="GeneID:11533725"
     mRNA            <535452..>537377
                     /gene="TPHA0H02260"
                     /locus_tag="TPHA_0H02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686816.1"
                     /db_xref="GeneID:11533725"
     CDS             535452..537377
                     /gene="TPHA0H02260"
                     /locus_tag="TPHA_0H02260"
                     /inference="similar to DNA sequence:INSDC:YCR061W"
                     /note="similar to Saccharomyces cerevisiae YCR061W;
                     ancestral locus Anc_6.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686864.1"
                     /db_xref="GeneID:11533725"
                     /db_xref="InterPro:IPR018825"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:G8BWH9"
                     /translation="MKVNILYKTLLLSLVPSLISAIPHNGVDHGSPTTHMMPNAASEG
                     LREEYNSTTIIPTPYAMAHMHGQPILEQAGLTPAQKLYWESYNTTTFLNSDMGNRSAL
                     KFHTVSLIVIAAFIYPICLVLNNVESNWYLPLLTVNFGLTIMSLTALQVFVTSFQDTL
                     YPGNLYRPVSYILLILASIHYISAVVYCAIKWMPKGYNQVLTYENGETHNTSIPLQEF
                     HSHSEESTASSNFLSDVPNISTDVNNNNNNNDIHKNNFNSEANIDNFDIEDQNTPFQD
                     GQTLRSKHFKGQHQSRNEILEKVYDQPIIQILSNRFGTLFELTFNLLNYPLFVYYLIY
                     ITIGLTVGNLFGKGQRKFNLLAHFIKGGVFILLGFVSLARYCGFGQKRGWAWNRIIIY
                     RRDVTPQNSKLFGFITLPKGTITMEGLESFLIFFYGSTNVFLEHLAGAGGAWTAKDLQ
                     HVSIAFMYIGTGLCGLLAEKNLNEKNFKTVIENANKNNIDGEIIHEEDVFACSGGYSP
                     NPFPAFTIFWTGILMSQHAQASTTSTAIHIQWGSLLSYGSFFRIFTFLILFFVPNKNS
                     SPSRPLTELITSFCMLSGGLIFMESTDQVIEAMEYRGYTPMFTFNVSVGFVALVMAWE
                     MILFMWRDYLKNHNSTN"
     gene            540393..540485
                     /gene="TPHA0Htrna7S"
                     /locus_tag="TPHA_0Htrna7S"
                     /db_xref="GeneID:11534196"
     tRNA            join(540393..540430,540440..540485)
                     /gene="TPHA0Htrna7S"
                     /locus_tag="TPHA_0Htrna7S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCG"
                     /db_xref="GeneID:11534196"
     gene            complement(<540737..>543412)
                     /gene="TPHA0H02270"
                     /locus_tag="TPHA_0H02270"
                     /db_xref="GeneID:11534200"
     mRNA            complement(<540737..>543412)
                     /gene="TPHA0H02270"
                     /locus_tag="TPHA_0H02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686817.1"
                     /db_xref="GeneID:11534200"
     CDS             complement(540737..543412)
                     /gene="TPHA0H02270"
                     /locus_tag="TPHA_0H02270"
                     /inference="similar to DNA sequence:INSDC:YCR067C,YNR026C"
                     /note="similar to Saccharomyces cerevisiae SED4 (YCR067C)
                     and SEC12 (YNR026C); ancestral locus Anc_6.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686865.1"
                     /db_xref="GeneID:11534200"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:G8BWI0"
                     /translation="MKLSASIYNSGYPLYGAKFLNDRILLVAGGGGEGNNGIPNKITA
                     LRIDFSKKKVIKRFREIVLDPNDDSPTTLDAAKNIILVGCNENSEKIKSGSGNHHIRK
                     FDYENDHLKFVAGIDFDGSKNPDDYTKLVYMSKDATVGAIASSAIPTVIRIIDPNDLT
                     EKYEIDTGHDVKDMHFSPDGKVICYITPNTLEVISIVTGRFIIRKTDFDKSWILSKIR
                     FINDDTVLVAAVLKNNKQNGIVMTTISLKSGNATVLKSKLVTKQFKGITSMDIDPSGE
                     CAAIASNDNSIALVILKDLSVGKVFYQIHTFAITKVAFSPDSKYVASVSAANTVHVIE
                     VPKDFSKSTSIIHKLWKFFKNVLLIVILAYLAQLAYVNNYNIKALDYMKIKYLHKYVD
                     KSTIDKYVNRDVIHKYLDEQKIEQYKGSAKSIYNELLKKTTLVHHCTDNYYYGQLQSK
                     INDYLQKSASEDIPTTIGEALTTGAYTSTFKPEIASPSEDAPSTTASSKTSDHEEGGH
                     WDDFEKTAFNLEDLAYLESQPEIPEPSSVQEEEDTINKYNNIPQSVLSSIVSQEPSNQ
                     SIQNEQNIGEQVQDPQQQQQQESMEETTVVETIVEEPKVEEPIVEEPVVEELKVDAPI
                     VEEPVVEEPVVEEPVVDAPIVEEPVVEEPQVEKPVVDAPIVEEPVVEEPVVEEPVVDA
                     PIVEEPVVEEPQVEEPVVDAPIVEEPVVEEPQVDEPKLEKPKLEEPKLEEPKVEEPKV
                     EEPLVKEPKVEEPKVEAPIAEEAKVKEPKVEEPKVKEPVVEEPVVEEPVVEEPVVDAP
                     IVEEPVVEEPVVEEPVVDAPIVEEPVVEEPKVEKPVVEEPQVDEPKLEEPKLEAPIAE
                     EPKVEEPKVKEPKVERGNTNQQETQTQEQLQHDEL"
     gene            <544705..>545769
                     /gene="TPHA0H02280"
                     /locus_tag="TPHA_0H02280"
                     /db_xref="GeneID:11533748"
     mRNA            <544705..>545769
                     /gene="TPHA0H02280"
                     /locus_tag="TPHA_0H02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686818.1"
                     /db_xref="GeneID:11533748"
     CDS             544705..545769
                     /gene="TPHA0H02280"
                     /locus_tag="TPHA_0H02280"
                     /inference="similar to DNA sequence:INSDC:YCR069W,YNR028W"
                     /note="similar to Saccharomyces cerevisiae CPR4 (YCR069W)
                     and CPR8 (YNR028W); ancestral locus Anc_6.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686866.1"
                     /db_xref="GeneID:11533748"
                     /db_xref="GOA:G8BWI1"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BWI1"
                     /translation="MLLSKIFIQSIPILATLLYAFPAPVEQKTKPVLPNVNMPYKEIN
                     EERVAYDLDRVYEPNPPPSSYVEFTIEYLDKVTGEKKEHEIGMELYGTIVPKTVANFL
                     MFAAGMKIIINKNTRFLAVARYKHTKFDEIIPNQRISGGHVLKDLGSLSIYGGAFKDE
                     NFELKHDRPGRLSMRNTGPNTNKAAFFITTGQEPQIEYDDKYVAFGQVTRGLDFILNE
                     FQYLDTDSNNTPLEEVDIKYTLNNIPVNGYLQDEHKLYLEKLEKFRNGDLSQGITLKN
                     MMEKHFPVESSVKKSSSENYFADEEKSNFFSDVGEDFSKNFTYLFFWVLVIASLATSA
                     SKYKTIILTGATKSNTIKGY"
     gene            complement(<545849..>547213)
                     /gene="TPHA0H02290"
                     /locus_tag="TPHA_0H02290"
                     /db_xref="GeneID:11533734"
     mRNA            complement(<545849..>547213)
                     /gene="TPHA0H02290"
                     /locus_tag="TPHA_0H02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686819.1"
                     /db_xref="GeneID:11533734"
     CDS             complement(545849..547213)
                     /gene="TPHA0H02290"
                     /locus_tag="TPHA_0H02290"
                     /inference="similar to DNA sequence:INSDC:YNR029C"
                     /note="similar to Saccharomyces cerevisiae YNR029C;
                     ancestral locus Anc_6.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686867.1"
                     /db_xref="GeneID:11533734"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWI2"
                     /translation="MSALKNFAYKEDEDGELPTLVTGQESNIKSILENTKNDVTTSFV
                     SDAKMERANKQVEDEEIIKQKANRANDELQDAQKLESVTKKIPVSVITGYLGSGKSTL
                     LEQIALKGSDKKIAVILNEFGDSSEIEKAMKIRNGSSAYEEWLDLGNGCLCCSLKNVG
                     VKAIEDMVLRSPGKIDYILLETSGIADPAPIAKMFWQDEGLNSCVYLDGIITVLDAEN
                     ILKCLDDVSPDTHWHGEKVLMENNLTIAHFQIAMADRILLNKMDRVEGSPDSSETVKV
                     LEDRIRQINAVAPIYHTKYGDTALEYLLDIHAYDNSVINETNIYEELKMSRPTLHDPR
                     MNTVALTFRPLKNEEEYSHFLKNFLQPLLWRFVGVTDEPANFKSHYNDDDEWEVQRTK
                     GLIIIEHLKTDSTAVKIIQGVRETYDITDGELRPGIAECKLVFIGKYLEKTYFESLLK
                     KVLG"
     gene            complement(<547589..>548092)
                     /gene="TPHA0H02300"
                     /locus_tag="TPHA_0H02300"
                     /db_xref="GeneID:11533735"
     mRNA            complement(<547589..>548092)
                     /gene="TPHA0H02300"
                     /locus_tag="TPHA_0H02300"
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /transcript_id="XM_003686820.1"
                     /db_xref="GeneID:11533735"
     CDS             complement(547589..548092)
                     /gene="TPHA0H02300"
                     /locus_tag="TPHA_0H02300"
                     /inference="similar to DNA sequence:INSDC:YCR071C"
                     /note="similar to Saccharomyces cerevisiae IMG2 (YCR071C);
                     ancestral locus Anc_6.339"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /protein_id="XP_003686868.1"
                     /db_xref="GeneID:11533735"
                     /db_xref="GOA:G8BWI3"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="UniProtKB/TrEMBL:G8BWI3"
                     /translation="MSRIAVLKNVSAMHTPFLNASRLFSTTRYSLTDSNTVETHSHSH
                     APEQAPVESEQLQEVDEFMVFPDIRDILPTDLVGSKVFNSKQYFIERSATGNLPIYSE
                     YKKAGHVAYTEIRKIHGNVLQFRKELQNAVPSIDPDSFSIRQQANKLIIKGNHTDLLK
                     KLLSTKF"
     gene            complement(<548385..>548609)
                     /gene="TPHA0H02310"
                     /locus_tag="TPHA_0H02310"
                     /db_xref="GeneID:11533835"
     mRNA            complement(<548385..>548609)
                     /gene="TPHA0H02310"
                     /locus_tag="TPHA_0H02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686821.1"
                     /db_xref="GeneID:11533835"
     CDS             complement(548385..548609)
                     /gene="TPHA0H02310"
                     /locus_tag="TPHA_0H02310"
                     /inference="similar to DNA sequence:INSDC:YNR032C-A"
                     /note="similar to Saccharomyces cerevisiae HUB1
                     (YNR032C-A); ancestral locus Anc_6.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686869.1"
                     /db_xref="GeneID:11533835"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BWI4"
                     /translation="MIEIIVDDRLSKKIKVKCLEDDTIEDLKKLICVQLGLSSINKID
                     LQKNNIKLKNHITLDDYEIHSMTSLDLYYI"
     gene            <549721..>550806
                     /gene="TPHA0H02320"
                     /locus_tag="TPHA_0H02320"
                     /db_xref="GeneID:11533836"
     mRNA            <549721..>550806
                     /gene="TPHA0H02320"
                     /locus_tag="TPHA_0H02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686822.1"
                     /db_xref="GeneID:11533836"
     CDS             549721..550806
                     /gene="TPHA0H02320"
                     /locus_tag="TPHA_0H02320"
                     /inference="similar to DNA
                     sequence:INSDC:YCR073W-A,YNR034W"
                     /note="similar to Saccharomyces cerevisiae SOL2
                     (YCR073W-A) and SOL1 (YNR034W); ancestral locus Anc_6.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686870.1"
                     /db_xref="GeneID:11533836"
                     /db_xref="GOA:G8BWI5"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:G8BWI5"
                     /translation="MTTNVPKVYAFHDFSDVAIAVADYVVYAQNHALTVKNKNDRKHS
                     NTSLNSINSAVAAEPSQNTIPSTATHPVHLKKNKSHTLLNHGVHDQTGNAAAPMKNYS
                     NINIEREKEKDNSRDNKESPLNVVKEKRFRIALSGGSLIQVLHEGLLKRDDVQWGKWD
                     IYFADERLVPFDSENSNYGLAKRKIFDLIDTKKYGKPKVYHVNEKLIKDPQECADNYE
                     KILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQETLREKLAWVVPVEGAPSG
                     PSNRISLTIPVICHSHRVAFVVEGSTKAPVLKTIMERPEKGLPSSIVNEGAAGRVSWF
                     VDNDALSDVFVTKKAYKFRSAQKVTVG"
     gene            complement(<551091..>551936)
                     /gene="TPHA0H02330"
                     /locus_tag="TPHA_0H02330"
                     /db_xref="GeneID:11534206"
     mRNA            complement(<551091..>551936)
                     /gene="TPHA0H02330"
                     /locus_tag="TPHA_0H02330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686823.1"
                     /db_xref="GeneID:11534206"
     CDS             complement(551091..551936)
                     /gene="TPHA0H02330"
                     /locus_tag="TPHA_0H02330"
                     /inference="similar to DNA sequence:INSDC:YCR075C"
                     /note="similar to Saccharomyces cerevisiae ERS1 (YCR075C);
                     ancestral locus Anc_6.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686871.1"
                     /db_xref="GeneID:11534206"
                     /db_xref="InterPro:IPR005282"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G8BWI6"
                     /translation="MMSLDELLGAIYVLVWSISMYTPIITNWRFKSSAAISVDFLMLN
                     IVGYMLLTASMYLQLYSWLPVSEELNKLDNINNTEYIPRPKITEFDLFYTFHGFLLNI
                     VLATQVYFPRLWKFRVEKTSEMKLLYSRILSATLILFSFATGHFIYYNDNNGWSNVRT
                     LSYCNKLFALKLVMSLVKYLPQVKHNFERKSMKGFSISGTFLDAIGGIASLLQLCLQL
                     YNDEGFSVKLMVTNFGKIGLGIITLIFDFIFLTQWNLYKESDIQTTKNIEGSDYRQND
                     DFKIQ"
     gene            complement(<552534..>553526)
                     /gene="TPHA0H02340"
                     /locus_tag="TPHA_0H02340"
                     /db_xref="GeneID:11534207"
     mRNA            complement(<552534..>553526)
                     /gene="TPHA0H02340"
                     /locus_tag="TPHA_0H02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686824.1"
                     /db_xref="GeneID:11534207"
     CDS             complement(552534..553526)
                     /gene="TPHA0H02340"
                     /locus_tag="TPHA_0H02340"
                     /inference="similar to DNA sequence:INSDC:YNR035C"
                     /note="similar to Saccharomyces cerevisiae ARC35
                     (YNR035C); ancestral locus Anc_6.351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686872.1"
                     /db_xref="GeneID:11534207"
                     /db_xref="GOA:G8BWI7"
                     /db_xref="InterPro:IPR007188"
                     /db_xref="UniProtKB/TrEMBL:G8BWI7"
                     /translation="MLHLKSHNLLIQKTLSEAIEANSNGTPLTLDRIVSDFDYTIFHI
                     SNQEGNKTILLLSIKTKAWVSIQKIDANNGLLPYLQSKYQPFAGISVSQSAEPGYDFT
                     LVLDLASLTNESVVESSLLKTAILSFPFQLAFQESFELSKLPAPEDGSSIDSQKLYNI
                     QNRDDEQFFIKASNDRVTVIFETIFQDETDKILGKVFLQEFVDARKRNRSIQSAPQVL
                     VSNEPPLELQSFTSSRNPQNDASRRFITFVLFPRHFQTAELQHMSISQLTLFRNYFHY
                     HIKCSKAYMHSRMRYRVDSFVKVLNRAKLDEDKDGLENDNQSTRRTITGRKMVY"
     gene            complement(<554149..>556032)
                     /gene="TPHA0H02350"
                     /locus_tag="TPHA_0H02350"
                     /db_xref="GeneID:11533849"
     mRNA            complement(<554149..>556032)
                     /gene="TPHA0H02350"
                     /locus_tag="TPHA_0H02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686825.1"
                     /db_xref="GeneID:11533849"
     CDS             complement(554149..556032)
                     /gene="TPHA0H02350"
                     /locus_tag="TPHA_0H02350"
                     /inference="similar to DNA sequence:INSDC:YNR039C"
                     /note="similar to Saccharomyces cerevisiae ZRG17
                     (YNR039C); ancestral locus Anc_6.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686873.1"
                     /db_xref="GeneID:11533849"
                     /db_xref="GOA:G8BWI8"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="UniProtKB/TrEMBL:G8BWI8"
                     /translation="MENSNDPRFRSIVSTPVMKAIQEEDSPSVPNMDVDPVDLNNDVS
                     FDKSFADTTFASTNTEGNRSPLAKPLFGSPTNLSRPGSSFYASKENNNSSSSLIYNPT
                     FTFGNNDNRSSKDNLNPNSNKSFAVPSLPGSPKRESRRGSLKYIPSIQLAPPTNRSKS
                     PRRSKSPKRSMSPESRKKRGSIVGIPGDSASPFNFSSSSMRPQSNSSNSGVSGSRTSF
                     RKGHRYKHSSVSMNFFQESEVKIPLNIAKSLPIPDWNDIISNIPWSKASLQLIIVVTQ
                     IFICPIILVLGHLKHWNNFITLSHFILYDIIGSVAIILVENLSQFESWSTGTITFPFG
                     LKRIDVLLSFALAISLCFVGLDLLFHILEEVIVLFVETSSHSHDEISSSIPHSHGNDL
                     KPITQNDFIIWYIILIINFIFSALALYKIFYANTNSRLKTKNPLVTLTYTCYLFTYPL
                     LVTNFASIADYIATILLASLILTHGLTIVQWTSTILMLGFSTSTLSLTLVDDDDDIMP
                     SEATSKVSTDTNSDLPMTMKPKLSRKINNAKKQETNPSCIKSTLIEKIQNLPEFKSRC
                     HVDDNNLLISKINFDLYIVLIKISMEGGSNMDELNLRLATEKCVRTLLPSSEITIDIE
                     IVA"
     gene            <556658..>557053
                     /gene="TPHA0H02360"
                     /locus_tag="TPHA_0H02360"
                     /db_xref="GeneID:11533850"
     mRNA            <556658..>557053
                     /gene="TPHA0H02360"
                     /locus_tag="TPHA_0H02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686826.1"
                     /db_xref="GeneID:11533850"
     CDS             556658..557053
                     /gene="TPHA0H02360"
                     /locus_tag="TPHA_0H02360"
                     /inference="similar to DNA sequence:INSDC:YCR083W"
                     /note="similar to Saccharomyces cerevisiae TRX3 (YCR083W);
                     ancestral locus Anc_6.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686874.1"
                     /db_xref="GeneID:11533850"
                     /db_xref="GOA:G8BWI9"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:G8BWI9"
                     /translation="MFRRTASTHLMRPANRMFVRMGSTYKDIHKITSLAEYEKLISRD
                     EGKLSVIDFYATWCGPCKAMAPHLSKFVKEYSKVNFYKIDVDENVDIAQKCAVTAMPT
                     FFLVKDGEVLDKVVGADPHKLEEQIKELN"
     gene            complement(<557163..>557627)
                     /gene="TPHA0H02370"
                     /locus_tag="TPHA_0H02370"
                     /db_xref="GeneID:11534024"
     mRNA            complement(<557163..>557627)
                     /gene="TPHA0H02370"
                     /locus_tag="TPHA_0H02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686827.1"
                     /db_xref="GeneID:11534024"
     CDS             complement(557163..557627)
                     /gene="TPHA0H02370"
                     /locus_tag="TPHA_0H02370"
                     /inference="similar to DNA sequence:INSDC:YCR084C"
                     /note="similar to Saccharomyces cerevisiae TUP1 (YCR084C);
                     ancestral locus Anc_6.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686875.1"
                     /db_xref="GeneID:11534024"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ0"
                     /translation="MANRMAKLDELLSAISLEYSNIANDANSMAMQNQKGYEFQINQH
                     ISELQSIRNKIFELELTHKKMKQSYEEEINRLKLDINQRDNQILNLRSAAPNGHQILH
                     QPPQPTIQMHMSPPTIPIAAQPTIHNTNNRLMNVQQQQQQQQHILPNINPIL"
     gene            <558973..>560559
                     /gene="TPHA0H02380"
                     /locus_tag="TPHA_0H02380"
                     /db_xref="GeneID:11534025"
     mRNA            <558973..>560559
                     /gene="TPHA0H02380"
                     /locus_tag="TPHA_0H02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686828.1"
                     /db_xref="GeneID:11534025"
     CDS             558973..560559
                     /gene="TPHA0H02380"
                     /locus_tag="TPHA_0H02380"
                     /inference="similar to DNA sequence:INSDC:YCR088W"
                     /note="similar to Saccharomyces cerevisiae ABP1 (YCR088W);
                     ancestral locus Anc_6.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686876.1"
                     /db_xref="GeneID:11534025"
                     /db_xref="GOA:G8BWJ1"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ1"
                     /translation="MALEPINCSAHARDIEDVYQKIVRDSDPDTTWMIISPNAQKEYL
                     PETTGSDFSEFLGSFDETKVQYGFARITPPGSDVGKNILIGWCPDSAAMKSRASFAAN
                     FGVVANTVLKSYHVQVSARDSDDLAERDILKRISDAAGARYSIQSSDSNSAASKPRSS
                     VASKPAPIFNKPKPTPVVNTPKPAVSKPANNDDDWDEPEVEERDFSANPLKPNASTYK
                     PIGKVDLQKVIAEEKAKEDPRLVHNGPVVGTKPPINVGAASTQSDSDHLVKGFKTEKS
                     PAELWAEKKAAKSGSTTTQREAPQQQQNASQEEDTEEHLEEVDELKSKFEKLSANAEP
                     QVITPKPFSKPQQVEEIPSKTNIKMTGTPLPGMHNEEPEKDEEDNNDDDWNDDEEQEQ
                     APQPLPPRNVRPEQEQEQELEEQEPEQEEEADVPPPPLPSREQVQEPEPEATLPLPAR
                     ESSAPPPPPRKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLG
                     ENGTTGEKGLFPANYVSLEN"
     gene            <561244..>563436
                     /gene="TPHA0H02390"
                     /locus_tag="TPHA_0H02390"
                     /db_xref="GeneID:11533893"
     mRNA            <561244..>563436
                     /gene="TPHA0H02390"
                     /locus_tag="TPHA_0H02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686829.1"
                     /db_xref="GeneID:11533893"
     CDS             561244..563436
                     /gene="TPHA0H02390"
                     /locus_tag="TPHA_0H02390"
                     /inference="similar to DNA sequence:INSDC:YCR091W,YNR047W"
                     /note="similar to Saccharomyces cerevisiae KIN82 (YCR091W)
                     and YNR047W; ancestral locus Anc_6.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686877.1"
                     /db_xref="GeneID:11533893"
                     /db_xref="GOA:G8BWJ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR006141"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ2"
                     /translation="MKKYGNTKVKTASQNTEDKSSISFSKMIKQSWKKKLPGNSSGDV
                     NNKYKLRYDVETGSRLGDDPKVEALTDNNDYNLYSTTVSINSTKESKDLQTLVPAHTV
                     TQHSLHQGPESLTDSITSAPISNIYYDSNETPDYTTDLSRTATKSMQSSTFNTSGKDQ
                     RKQSVSYATMAPPRRTLSHISSKNTYSPISTNLAPSRNSNISDLKQYEELQAQLPNRL
                     FRDRSISDISDGGVAFPCITINFGKECPEPKCERNYDSSDNYSNVSEKFSEENNSKIV
                     NSEDTVRSTNAFHSDINEDSNDIILKRNNEMAPIRSKKLQAKIYHKRFCEIKVGPKSF
                     EKVRLLGQGDIGKVYLVREKKTNKLFALKILSKSEMIKRKKVRRILTEQEILATSDHP
                     FIVTLYHTFQTKTYLYICMEYCMGGEFFRALQTRENKCISENAARFYASEVVAALEYL
                     HLLGFIYRDLKPENILLHKSGHIMLADFDLSIQSQSDSEPVIDSLTNNAYIDTKKISE
                     GFRTNSFVGTEEYIAPEVIRGNGHTTAVDWWTLGILVYEMLYGYSPFKGRNTNETFSN
                     IIKEQVSFQGHDISKTGKDLIKKLLIKNEIKRLGSKQGAADIKSHPFFKNTQWSFLRN
                     REPPLIPILTDEGFELKNSLKAKEKVDKKDDQPKTDFETKAFDGEVSLDEDIPMKDPF
                     SDFSSMTLIKDNYDTAIPYKKCDSYGVIFYKKNKNFLSTTAPKGFFNR"
     gene            complement(<563496..>566681)
                     /gene="TPHA0H02400"
                     /locus_tag="TPHA_0H02400"
                     /db_xref="GeneID:11533894"
     mRNA            complement(<563496..>566681)
                     /gene="TPHA0H02400"
                     /locus_tag="TPHA_0H02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686830.1"
                     /db_xref="GeneID:11533894"
     CDS             complement(563496..566681)
                     /gene="TPHA0H02400"
                     /locus_tag="TPHA_0H02400"
                     /inference="similar to DNA sequence:INSDC:YCR092C"
                     /note="similar to Saccharomyces cerevisiae MSH3 (YCR092C);
                     ancestral locus Anc_6.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686878.1"
                     /db_xref="GeneID:11533894"
                     /db_xref="GOA:G8BWJ3"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ3"
                     /translation="MSKQPIISRFFKSVKKSKNDAIELSVSANSAMPEPILIDISNEV
                     KDDRVSSDLLRSGSSEDTETRNSSIHVTSLNDTELSNPTDDLITEEDEIIKETDKVEN
                     ISNGQRSSTFLKTLNNIMSKRKRVTNEHIDEIDEPSTEAAEGSYNTKKSKKTNTDQLT
                     PLDKQIKDIKIKNMDKVLIVRVGYKYKCFAEDAIIVSQLLHIMLIPGKLSIDGSNPQD
                     KNYKQFAYCSFPDIRLKVHLENLVHHNLKVAIVEQTETSAIKKVLPSSKSSSVFERQI
                     TGVFTKATFGVNSTFTNLREKFVLGHNNSIWILKLNLVINELNLKNNDLFEFFLISVN
                     LNSGEVVYDSFTEPINRLEKFETRLLHLNPVEVLTTEEFPELISKKLKGKECSIIKQS
                     KDIPNDIVPTKELDEIVKGNDMKDVFRSLLYHLYFYLTEYNNQNILKLPTNYKHFLTN
                     SSFTLDKNTIQSLDIFSNDCGKGSLFWLLDHTRTAFGSRQLRDWVLHPLTNQVLIEER
                     LNSIEALVTEIENIFFDSLNNLLKNTPDILKTINRISYGITSRKEVYYFLKQMKQFYD
                     HFQVHNEFLSSEVINENGLINKKSPFLFNLFKTINENLLTSRIPELLAMINISAVLDK
                     DPKIQVCEFFNLNNYCNSENMTSIQREIGSIKNELQEELQNIKNILKRPHLSFKDETE
                     YLIEVRNTQVKGIPADWVVVNRTKMISRYQTPKTKLLCEKLQFQNELLYNEANSEYLS
                     FVKCINKEYTKLHQIISNFGVYDALLSLSATSNYTNYVRPKFTDVPQYIQASNSRNPI
                     IESLNLNYVPNNVTISQKEGSFLIITGPNMGGKSSYIRQVALLIILSQIGSFVPADVL
                     EISIFDNVLTRIGAYDNLLQGQSTFKVELQEILHIIKNSTENSLLLLDEVGRGTSTKD
                     GQAISWSLINYFVTLPSCPVVLFTTHYSNLTKNLSSKVIQNYYMDFVERKLEGESWTT
                     VVFLYKLKKGLTDNSYGLNVAKLAQIDARIINEAHSASETMRDEEEIEPKLNVIYTMK
                     NILSSSLDNAEKVSSLITLIDSTTNEEENSK"
     gene            <567257..>573022
                     /gene="TPHA0H02420"
                     /locus_tag="TPHA_0H02420"
                     /db_xref="GeneID:11533877"
     mRNA            <567257..>573022
                     /gene="TPHA0H02420"
                     /locus_tag="TPHA_0H02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686831.1"
                     /db_xref="GeneID:11533877"
     CDS             567257..573022
                     /gene="TPHA0H02420"
                     /locus_tag="TPHA_0H02420"
                     /inference="similar to DNA sequence:INSDC:YCR093W"
                     /note="similar to Saccharomyces cerevisiae CDC39
                     (YCR093W); ancestral locus Anc_6.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686879.1"
                     /db_xref="GeneID:11533877"
                     /db_xref="InterPro:IPR007196"
                     /db_xref="InterPro:IPR024557"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ4"
                     /translation="MNNFKNFQSFITETNLETLVSNLSDLLYSLDGESLNDMIALILS
                     EILAPGSQNGLQSNLNNSWLTPLNKIGDATKIGECVSQAIVDTANNKINWNRVFNLMS
                     TKYFLNNKKVKLSNASLSSVFSILRSGALIDEFLECDWDLNCKLDIAYLLHKWSISEG
                     CFNLLGLEDMKPVITTTNDLPNDLDLNQKMSLLYFKSIASLNLEIFLLRDEMAENEQL
                     PLYQDFFFQDYNNVPEFLALALILDYKKFVLLTENKATIDELLVTLALQVYEKNQVFM
                     KSLIKKLNTIDNNSEKLVEITSSIANNDKLLISNFINILNEENKLNFIINKMEVGESI
                     KILSAATQVGWKGFDEYIDKNLNINSVAGVLDYLEKICSMNDNNTLDRKSRVFDISSL
                     HKIITKLMNLPMNPQERQMFEKIQLSIIIVFPRIINFGYGNDDAILKNGDLVPIPAEV
                     ETEMQSYLQQMYSNELSIKDIIDLLRKLRDSDNSRDQDLFTCMTHAVLAESTFFKDYP
                     LDALATTSVLFGSIILFQLLRGFVLDVAFKVILNFAKEGPESKMFKFAIQAIYAFKMR
                     LVDYPQYCKDLITQIPGLQTQPQVYQAVAEAAALLDQRAATTGPNQKHQVEYIPIKYF
                     FVEELVTGIPQENPSKDTIEKILFLVNNMTEENFDSKIDNIKSLLQPAYSSWFSHYLV
                     TQRAITEPNYHSLYSKIITFIDSDVLYEYMLNTTLKQLLLLISTKEVSSIDKNALKSL
                     SSWLGRITLGVDKPIRHKNIAIRELLLDAHKNNRLEIIVPFVCKIIANVIDSKIFAPP
                     NAWTMGILMLLAELNKKANWKLSLTFEVEVLFKLLSISLAEIEESHYLENIDIVEELA
                     GSLNNVSVEQRHIEQQRQMATIQQYQHHNVSIQNRQSSIPHNNLQGEQQSQSEVGTSN
                     DELFSNLVGSTLFVTHPDLRRVFRMAIAKSVREILPPAIEKSASIAVVTTTRIVSKDF
                     ATEVDDSKFKAAAITMVRQLAQSLARTTSIELLKDDIRTTTQSLAPNLTSLIAQPMEE
                     LQKAIDENVGIALVIIENAAMDRAMQEIGEHLMQEIAIRHYHKDRRSDQPFLSPNANP
                     YALGLPEPLGLKTAGVTPQQFRIYENFGKFKINNDNVSIPPGAPVGINNQQRNMPQQN
                     LNINQQQQQQPQIFQNYAAGMQPQVNGQIPGDIEQVHRVLVQLMDSLVIQIKENSNKS
                     GLKDLEEQNPIKQIILQILSFIDNSLQRDQLALKVAQAVVNSLFATSDSPLCREVLSI
                     FLEQLCSLSALAKKDVIWWLIYAPDSRKFNTLVINSLLHVNLIIGSDVDTMLSVAINN
                     KIENAVMFTIKLLQENILSDVSIMMRMDFVKTVKALSLINDENVRSFLDEYKSRRIIP
                     IGPEVKISETEKYHAIFTEWVKLLEEVEPNDEITVVFITQLLKKGVLSNTADLTKMMK
                     ASLELSISIFKESDPTGEVFVSIDALTKLIICLITYQVFETISISEFIHIIFSVIILV
                     FTKDHEQTGSTFNERPYFRLFSNMLSEWSKLRGHNFVNINDAKIRNEFIKFDSEFYEI
                     FSTYLLALQPLAYPGFSFAFITLLSHRMFLPVMLRLPENKGWENLTLLIIALFKFLDQ
                     YTEKEGISNAISVVYKGTLRVMLGISNDQPEYLIENHYELLSHLTASYVQLKNVILSA
                     VPKKMFIPNPYNPQLEMKDIEDCQKNPSVFYDPVLDLHVFKKPVDNYLRIPSNSLFKT
                     ILNAVHKKEYVMKNGVGYDYVAVDTKLVRAIVLHIGVEVGIDNEKTSSNVIFNTKSSY
                     YTLLFDLINEGSVELKSQLTEAIVEQLRYPNIHTYWFSYVLKQFFYSQDWGEKTSEIQ
                     EIILRNLLERIIVNKPHPWGVTVLFTELLHNKDTKLIDLNCVKSVPEIEKIIKILSQT
                     SGNMKVDAVENTIQAPPIPIL"
     gene            <573375..>574571
                     /gene="TPHA0H02430"
                     /locus_tag="TPHA_0H02430"
                     /db_xref="GeneID:11533878"
     mRNA            <573375..>574571
                     /gene="TPHA0H02430"
                     /locus_tag="TPHA_0H02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686832.1"
                     /db_xref="GeneID:11533878"
     CDS             573375..574571
                     /gene="TPHA0H02430"
                     /locus_tag="TPHA_0H02430"
                     /inference="similar to DNA sequence:INSDC:YCR094W,YNR048W"
                     /note="similar to Saccharomyces cerevisiae CDC50 (YCR094W)
                     and YNR048W; ancestral locus Anc_6.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686880.1"
                     /db_xref="GeneID:11533878"
                     /db_xref="GOA:G8BWJ5"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ5"
                     /translation="MNITSKFKTLIPFISEDSEFEESAVKSNRPPNTAFRQQRLKSWQ
                     PILNPRTVLPLLIMIACIFTPAGVGLIISPLSVQDVTINYTDCSSLATTSNFTEIPHK
                     LANYHFKSRVESRPLWKLGESSDGDVICQIKFEVPNNIDKSIYVYYKLTNFHQNHRRY
                     VDSRDWNQLKGHAVKLDDIVNSCKPLRERDEKIVYPCGLIANSMFNDTFSTTLQNEDG
                     EANSYNLTNKKIAWKTDRKRYKKTKYNATEIAPPPNWIKKFPDGYTDDNIPDLSTWEE
                     LQVWMRTAGQPDFYKLALKNEQDELYQGTYIMEITDNYPIKSYGGTKSFVLTTITETG
                     GRNISLGVVFIIVAGISIIVAFIFVIKLFLQPRAMGDQAYLNFADEDELKNNSDVFDP
                     EMREIL"
     gene            complement(<575387..>576580)
                     /gene="TPHA0H02440"
                     /locus_tag="TPHA_0H02440"
                     /db_xref="GeneID:11534217"
     mRNA            complement(<575387..>576580)
                     /gene="TPHA0H02440"
                     /locus_tag="TPHA_0H02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686833.1"
                     /db_xref="GeneID:11534217"
     CDS             complement(575387..576580)
                     /gene="TPHA0H02440"
                     /locus_tag="TPHA_0H02440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686881.1"
                     /db_xref="GeneID:11534217"
                     /db_xref="GOA:G8BWJ6"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ6"
                     /translation="MNFVSGFKPEALGNTNLFKPMKIGNTTVKHRVVMPPLSRMRANE
                     DHVLDKDWTIKYYDQRSKREGTMIIAEGAFPSAQCGGYAGAPGIWSAEQTAQWKKIIQ
                     KVHDNKSFMWVQLWVLGRQAPPANMASAGLRFDSPSDLPYQNEKQEAAAKEAGTVQHG
                     ITKDEIKQYVADYVNAANNAIAAGAEGVEIHCANGYLLNQFLDPKSNKRTDEYGGSIE
                     NRARFPLEVVDAVIAAIGAEKVGIRFSPYGIFGDMSGGDNPMLISQFSYIIGELERRG
                     KEGKRIAYVHVVEPLATDFMLTEGDGILEGVTNDFVFSIWKGPIIRAGNLSLNPAIVR
                     EYVKDDRTLIAYGRYFVSNPDIVDRVEKGLPLNNYDQPHFYTMTAEGYIDYPTYDEAI
                     KAGYK"
     gene            complement(<577784..>580273)
                     /gene="TPHA0H02450"
                     /locus_tag="TPHA_0H02450"
                     /db_xref="GeneID:11534218"
     mRNA            complement(<577784..>580273)
                     /gene="TPHA0H02450"
                     /locus_tag="TPHA_0H02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686834.1"
                     /db_xref="GeneID:11534218"
     CDS             complement(577784..580273)
                     /gene="TPHA0H02450"
                     /locus_tag="TPHA_0H02450"
                     /inference="similar to DNA sequence:INSDC:YOL036W,YIR016W"
                     /note="similar to Saccharomyces cerevisiae YOL036W and
                     YIR016W; ancestral locus Anc_7.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686882.1"
                     /db_xref="GeneID:11534218"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ7"
                     /translation="MEVIPLSGAELKNNSYQLGIKMLELNALHDIKEEEDIELTQLNS
                     NVSSICSRQMPLATSPPLTAHANTSTESIAYSTNGANDTVLIHNETFNNDNSVQLVTS
                     NSKDELNLLPPLPDNSRNDDDISSNSNTNSNEMNMSNNIQNMKTILAENNENVNIHSN
                     DIKNYENLQNDVAGLGLNIADLDQALHSPRNYSEQHFINSTSDSDSNDILDPESIAET
                     SFDLSKALKIPQNFNIQQQGINSPLSGNNILNSTDILSDVNNSVNSNPYDMNTASNNL
                     NINNNNGTLSPIITSPRLLLKKKFSNVMLNSNSGNIANSNIPDDGQSFQPIEFPITSS
                     PADIEHSHSSSSSSHDTSTIASVIKQSRNPSRKISIGSSHSISTNNSMNIHYKNLNQD
                     DLLYNLPIRTNGNPIENIYRTRSDSTSSSMKHMLESAPLESSSSEKRPPLLKRASSAL
                     LRKTSMIHISNSNSVQNNNNIKNDISASPSMSTASSFEPPTFEQLSDKLNYIAQTTSN
                     TNNPNFDLQSITSSSYLSRKDDISRNPSIGSRVKRSFSRIISNGGDSVRRVVSNSNLR
                     DESPSPIYMKNSNLSSLSTNHINSSERISSMPVRLSGSGRNASMPSNYRRIGSHGAGI
                     TRSFSATDAIKTSSTNISDSRSSSGRSKSSRTGSLKASSSNNGYESNRNNLNNNISQV
                     PDLSKLNINALKVNVEKITKSVPVISVTDDFSSKHSNNYQIQSNIRFDEVYYGKANNE
                     ENVIERTSSPTDENGKLPEKLKELTIKEYINLLIKQQDVEDRRLQYLEESFSKSGWSS
                     ANDLELLRMKRVAINKKWADRISFYQNKLDA"
     gene            <580922..>581140
                     /gene="TPHA0H02460"
                     /locus_tag="TPHA_0H02460"
                     /db_xref="GeneID:11534016"
     mRNA            <580922..>581140
                     /gene="TPHA0H02460"
                     /locus_tag="TPHA_0H02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686835.1"
                     /db_xref="GeneID:11534016"
     CDS             580922..581140
                     /gene="TPHA0H02460"
                     /locus_tag="TPHA_0H02460"
                     /inference="similar to DNA sequence:INSDC:YOL026C"
                     /note="similar to Saccharomyces cerevisiae MIM1 (YOL026C);
                     ancestral locus Anc_7.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686883.1"
                     /db_xref="GeneID:11534016"
                     /db_xref="GOA:G8BWJ8"
                     /db_xref="InterPro:IPR013262"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ8"
                     /translation="MEKDGQPQQLVRFVRSCSINLLLPFINGLMLGFGELFAHEISWR
                     YSIFRRENKGYRVFPERRVEEERKSAFI"
     gene            <581837..>583696
                     /gene="TPHA0H02470"
                     /locus_tag="TPHA_0H02470"
                     /db_xref="GeneID:11534017"
     mRNA            <581837..>583696
                     /gene="TPHA0H02470"
                     /locus_tag="TPHA_0H02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686836.1"
                     /db_xref="GeneID:11534017"
     CDS             581837..583696
                     /gene="TPHA0H02470"
                     /locus_tag="TPHA_0H02470"
                     /inference="similar to DNA sequence:INSDC:YOL027C"
                     /note="similar to Saccharomyces cerevisiae MDM38
                     (YOL027C); ancestral locus Anc_7.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686884.1"
                     /db_xref="GeneID:11534017"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:G8BWJ9"
                     /translation="MLLCCSLTTTFHLCRTLDHHWLIALSSTITTMFSRGLATLSKNR
                     IGIKSTAAVQLCLDNCIPYSTHNALLYNTLASTAVRNRYLGVRLYSTPPSTEQKKEKP
                     PLMQRIKHEVKHYVNGTKLLGYEIKVSTKLLIKFSQGYELTRREQNQLKRTISDVFRL
                     IPFSAFVIIPFAELLLPIALKIFPNLLPSTYESVTDKDQKRVKLLETRRKTSKFLHET
                     LEESNLLNYNSIENVEKRKIFISFFKKLYNSKNDSSIKFEHEEIMTIANMFKNDTVLD
                     NLSRPQLMAICKFMSITPFGNDNLLRYQIRYKLKSIMHDDIIIDYEGVKSLSPEELHQ
                     ACVSRGIKAFGTSQEELTNTLSVWLHLRLKEKVPSVLMMLSSTYVYGGKSVEDISSKI
                     IKKSPSSTKSAPVSDTTKSAATYNELLELYYEGILQVLSSIPDPVYNVAKLDVTESKS
                     EAAEQKAAEKSQKNVQPSPTETAAPQTAKTSTPSKPSPAAAETTATPSGAKDTVSTKS
                     GKKPEGVETVPELKTEAKLVTPKLANKDVKVVASAPTGSKTEEDPESADSSAFKLRVL
                     KEQDELIKKEEDELRARKVREQIADDINLDDVEKEAVPPKTEQPKNNKKNECR"
     gene            <584363..>585436
                     /gene="TPHA0H02480"
                     /locus_tag="TPHA_0H02480"
                     /db_xref="GeneID:11533895"
     mRNA            <584363..>585436
                     /gene="TPHA0H02480"
                     /locus_tag="TPHA_0H02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686837.1"
                     /db_xref="GeneID:11533895"
     CDS             584363..585436
                     /gene="TPHA0H02480"
                     /locus_tag="TPHA_0H02480"
                     /inference="similar to DNA sequence:INSDC:YIR018W,YOL028C"
                     /note="similar to Saccharomyces cerevisiae YAP5 (YIR018W)
                     and YAP7 (YOL028C); ancestral locus Anc_7.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686885.1"
                     /db_xref="GeneID:11533895"
                     /db_xref="GOA:G8BWK0"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BWK0"
                     /translation="MNNQNTKFPKLEPKVPLANNLYSLNLQFSRDCVLPARPTSTRKG
                     GSINKVAQESQKLSKDKSKMETLTSPESDKNDDIDDTELKRKRKLNREAQRAFRERKS
                     LRMEQLKDTIERLQDSIDMWEKKFKKCQGELRRLRKENLNFKKEHIALKSSLEELKTI
                     KTKEGFTGVLGLPKTHDPLIGDLINNFKPMDAISLKNKNKETYSKRANDRKPSTLNSL
                     KSREKVSLSVPRCGLCTDESFCVCSQLSDPVVARTNNERKQTTIDATPAADTLSKLTC
                     SSNPASCSKCADIDRSCIGTNSNGVGEAPNLPEPVSESKDNGHVKDTRELVQDCKDLD
                     YIEIQLSYMPKKKKGFESCHGIY"
     gene            complement(<585623..>587236)
                     /gene="TPHA0H02490"
                     /locus_tag="TPHA_0H02490"
                     /db_xref="GeneID:11533896"
     mRNA            complement(<585623..>587236)
                     /gene="TPHA0H02490"
                     /locus_tag="TPHA_0H02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686838.1"
                     /db_xref="GeneID:11533896"
     CDS             complement(585623..587236)
                     /gene="TPHA0H02490"
                     /locus_tag="TPHA_0H02490"
                     /inference="similar to DNA sequence:INSDC:YOL030W"
                     /note="similar to Saccharomyces cerevisiae GAS5 (YOL030W);
                     ancestral locus Anc_7.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686886.1"
                     /db_xref="GeneID:11533896"
                     /db_xref="GOA:G8BWK1"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8BWK1"
                     /translation="MLPAVSFYITIDITDVKVVFDFFSLSLYKKHLRYLPIHIIGPRN
                     PLYLSFKNAKAVSAKKMLVKSLLSGAAILGNTLVSAATASTNSSTPIVNITGNAFFDS
                     ESGERFYIRGVDYQPGGSSNLTDPLADSTICQRDIPVFKDLGINTIRVYTVDNSLDHS
                     ECMSLLQQNGIYLILDVNTPTSAISRTDPACSYNADYLQSVFATIDAFADYDNVLGFF
                     AGNEVINSANTTNTATYVKAVVRDMKKYMEARSYRKIPVGYSAADIAENRLYAAEYFN
                     CGDDEYARIDMLGVNDYSWCGHSSFQTSGYAQKVQLYSDYSVPIFLSEFGCNEVVDSR
                     PFTEIQSIYSTQMSSVFSGGLVYEYSNETNNFGLVQIDNDTSVTKLTDFQNLKSEYSS
                     VSNPSGDGGFSTSYNYSTCPAYQSGTWEANNTLPDMPSAASAYFSSGAGRAWGTGLST
                     INHCHEDDEDVDSSSSSSSSSSSSSSSSFSSSSLSSSSSSSRSSSASSSSSSSSSSSS
                     SSRTSKGAAVNVAVPQFVQVITQVIGFLL"
     gene            complement(587726..587798)
                     /gene="TPHA0Htrna8T"
                     /locus_tag="TPHA_0Htrna8T"
                     /db_xref="GeneID:11533908"
     tRNA            complement(587726..587798)
                     /gene="TPHA0Htrna8T"
                     /locus_tag="TPHA_0Htrna8T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11533908"
     gene            <589935..>590465
                     /gene="TPHA0H02500"
                     /locus_tag="TPHA_0H02500"
                     /db_xref="GeneID:11533708"
     mRNA            <589935..>590465
                     /gene="TPHA0H02500"
                     /locus_tag="TPHA_0H02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686839.1"
                     /db_xref="GeneID:11533708"
     CDS             589935..590465
                     /gene="TPHA0H02500"
                     /locus_tag="TPHA_0H02500"
                     /inference="similar to DNA sequence:INSDC:YMR009W"
                     /note="similar to Saccharomyces cerevisiae ADI1 (YMR009W);
                     ancestral locus Anc_7.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686887.1"
                     /db_xref="GeneID:11533708"
                     /db_xref="GOA:G8BWK2"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /db_xref="UniProtKB/TrEMBL:G8BWK2"
                     /translation="MVQAYIHDDNNDIDFREAHNSGKSVSIEDLEKIGVFYKYCATVE
                     DVDVIAKERNYKNRDVVNISKESFGNENNMMEKLNMFYSEHLHEDEEIRYCLDGSGYF
                     DLRAQNDTDWIRCRVNKGDLLVVPAGIYHRFTLTTENYIKALRLFKDEPKWNAIKRPD
                     GDSYQVREEYLSQTKA"
     gene            <591394..>592542
                     /gene="TPHA0H02510"
                     /locus_tag="TPHA_0H02510"
                     /db_xref="GeneID:11533909"
     mRNA            <591394..>592542
                     /gene="TPHA0H02510"
                     /locus_tag="TPHA_0H02510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686840.1"
                     /db_xref="GeneID:11533909"
     CDS             591394..592542
                     /gene="TPHA0H02510"
                     /locus_tag="TPHA_0H02510"
                     /inference="similar to DNA sequence:INSDC:YMR010W"
                     /note="similar to Saccharomyces cerevisiae YMR010W;
                     ancestral locus Anc_7.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686888.1"
                     /db_xref="GeneID:11533909"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G8BWK3"
                     /translation="MPEDVVTTTIANAVATTAVAEAISEVIDASVTTTKNTYADAIAA
                     YFPIVDQFYIPDWFTIQFIANNIISFTPLFSYGTTVISIQRSQTSLGFSLDICATMLI
                     ASILRVCYYLITPYDLSLLRQSLVMIFIQLILLNTTLKFRPIEYQYDNLLAVESFQKL
                     FHDIFLEYFATDKPLQNWKTIINNLTFTKVTGFLGKCGLVIVYKTLKFFDPSYKRILS
                     FWQWNNDTIFWKFIAYFACLNFFFTLFVVKIMDWPTIAEWVGSIFGSLGLLIESLLPL
                     PQISILHKLKSIQGFKLILLVSWLCGDTLKITYLIFGASNISYMFVVFALFQMSLDFY
                     IAGQYIYYRFYYETFRHDNEASMALNTGDIELRNFNVTVDGSSNNNSY"
     gene            complement(<592810..>594999)
                     /gene="TPHA0H02520"
                     /locus_tag="TPHA_0H02520"
                     /db_xref="GeneID:11533887"
     mRNA            complement(<592810..>594999)
                     /gene="TPHA0H02520"
                     /locus_tag="TPHA_0H02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686841.1"
                     /db_xref="GeneID:11533887"
     CDS             complement(592810..594999)
                     /gene="TPHA0H02520"
                     /locus_tag="TPHA_0H02520"
                     /inference="similar to DNA sequence:INSDC:YOR017W"
                     /note="similar to Saccharomyces cerevisiae PET127
                     (YOR017W); ancestral locus Anc_7.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686889.1"
                     /db_xref="GeneID:11533887"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="UniProtKB/TrEMBL:G8BWK4"
                     /translation="MFKSSSISKFGGSNICHCPKSNNLLVIIRWRSDYPPGHRNRKRR
                     KAAFKRYSYSDTNAFTCLQSDSIWKPVRPSDISGNKQLLDYEKLPKLRDSLEKVLYEP
                     LVLHTLRDERTGAYNYDKTLEVVNTITPETSSSSLNFIPPQKDEILWNMANQKNLKYI
                     SSTSSMTAVLSQLHFLLSNCRALNVTNYLESKDVLLPSSKNFKSAQIPASIIVSKLKK
                     TVNHKVFTVKSIDSDPYFNREMILSALGHTLEEFLTRGGNQSSDYDPNERHYHYSIVD
                     DFLIRSQLDCYNPLLPNNGVFDLKTRAVGAIRYDLPFVERNLNYTGYEINKLHGQFES
                     MNREFKDMIKGPLLKYSLQARMGAMDGIFVAYHNINRIFGFQYLPLEYLDHILHSASD
                     YKFRTSLKDKENITKSVFGINEHVLNHEYKEREISTLLADAEFKLSMQIFKKILVFIE
                     NKYAANHFKWEKLKIMMKIDVSKAKEPKLDVICLPMEAGSSNKYLSPLVRDNDSKNIT
                     AMLDRVKAEHDQFLKLHLKKAIGLVINVKNIFGRHSSSPNYSELFNTNSTVDLDFDDK
                     SYLNHKMNKDFYENSNRWMHPNFLDPEDVQTWKVNGNIIEMTESKIKTSYSDMIKEKL
                     SFIEKENNEDFSRTLDKDYENDQLKTRIIDYIKNEKSLENIFNRSTMHKKQNNDDFRL
                     TFRAYGKKGAIRYQERQNRQNQHNQQKRKNEDNFKFVNHFLIKERGI"
     gene            <595722..>596864
                     /gene="TPHA0H02530"
                     /locus_tag="TPHA_0H02530"
                     /db_xref="GeneID:11533888"
     mRNA            <595722..>596864
                     /gene="TPHA0H02530"
                     /locus_tag="TPHA_0H02530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686842.1"
                     /db_xref="GeneID:11533888"
     CDS             595722..596864
                     /gene="TPHA0H02530"
                     /locus_tag="TPHA_0H02530"
                     /inference="similar to DNA sequence:INSDC:YHL022C"
                     /note="similar to Saccharomyces cerevisiae SPO11
                     (YHL022C); ancestral locus Anc_7.109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686890.1"
                     /db_xref="GeneID:11533888"
                     /db_xref="GOA:G8BWK5"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013049"
                     /db_xref="UniProtKB/TrEMBL:G8BWK5"
                     /translation="MKSLKVLTEQCLTKNDLVTALLPEVRSVQFGQADTDKFKHDELA
                     NYIEGIIILLCSCIEYHQHNFEIILKHGVNGKMHTAKSSKLSLINYYNTEKTSSKLSI
                     FLSLINVIESTLKKNEVRTIRDVYYGNVELYKNQNTVVYWLNKIQKNLSLKSRNELNI
                     IPAQKGLCYIPFQLRIVNQKTGNYTFVAKNESTLIPHFTKDSNFIIEEIELPNISKII
                     VVEKEAVYDKFIRYHCSNINPEKMIIVTGKGYPDFLTRLFLNKLQTLKALDESSWEIY
                     VDADPYGISIATKYIISTSDQMYSCRKLIHKGARISHLIHNLNQSKHIQLLNLTTRDI
                     TYLMKMISRLFNNEALSHNHSSSFSIKTEIQRQLFFAKKGEMNALY"
     gene            <597241..>597873
                     /gene="TPHA0H02540"
                     /locus_tag="TPHA_0H02540"
                     /db_xref="GeneID:11533906"
     mRNA            <597241..>597873
                     /gene="TPHA0H02540"
                     /locus_tag="TPHA_0H02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686843.1"
                     /db_xref="GeneID:11533906"
     CDS             597241..597873
                     /gene="TPHA0H02540"
                     /locus_tag="TPHA_0H02540"
                     /inference="similar to DNA sequence:INSDC:YOR016C,YAL007C"
                     /note="similar to Saccharomyces cerevisiae ERP4 (YOR016C)
                     and ERP2 (YAL007C); ancestral locus Anc_7.108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686891.1"
                     /db_xref="GeneID:11533906"
                     /db_xref="GOA:G8BWK6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:G8BWK6"
                     /translation="MLYSVLFSTLLFVTEIFASTQQIPIVLELPAHSSECLYEDLHNP
                     DDTINISYQVLTGGNFEIDFKIEAPDKSELVSEVQKKYSDFALKSFGLGQYKFCFFNN
                     YGSDSKKVEIILGLESRLVSVKDVEDDDDGKDAVANNAIEEIDRNLDKITKSLNYLRA
                     REWRNMSTVQSTEFRITWLSLLVIAVMIGISVGQAFIIQFFFTKNRKNYV"
     gene            complement(<598416..>600647)
                     /gene="TPHA0H02550"
                     /locus_tag="TPHA_0H02550"
                     /db_xref="GeneID:11533907"
     mRNA            complement(<598416..>600647)
                     /gene="TPHA0H02550"
                     /locus_tag="TPHA_0H02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686844.1"
                     /db_xref="GeneID:11533907"
     CDS             complement(598416..600647)
                     /gene="TPHA0H02550"
                     /locus_tag="TPHA_0H02550"
                     /inference="similar to DNA sequence:INSDC:YOR014W"
                     /note="similar to Saccharomyces cerevisiae RTS1 (YOR014W);
                     ancestral locus Anc_7.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686892.1"
                     /db_xref="GeneID:11533907"
                     /db_xref="GOA:G8BWK7"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8BWK7"
                     /translation="MMRGFKQKLIKKTTGSSSSSKKKEKEKEKEKEKESRKASSMGSS
                     STSSSRKNSSENSRPSSTSSSKKEYPASSSKTKGIVSSASSTRSDTRNATPIIGSGND
                     KSNNTARANSSSVSNANSNANNVPPSNGSSSTTIDSPTSTPSISLSNAESNSIEFRDN
                     NHKINSDESMGRNNTLFTNEPNNVNGGASENSLKDNSNGITHTITKSDFTSAVNKEGM
                     TPSSPQSPNIDIPRASHSFERLPTTAKLNPDGELDLVKTPQRHSSSRFETSRYSQLTK
                     LPSFEEVEPEERLQLFIAKVDQCTAMFDFNDPSFDIQGKEIKRITLQELIEFIVTNRF
                     TYTNEMYEHVIAMFKINLFRPIPPPVNPIGDIYDPDEDEPVNELAWPHMQLVYEFFLR
                     FVESPDFNHQIAKQYIDQDFILKLLDLFDSEDIRERDCLKTTLHRIYGKFLSLRSFIR
                     RSMNYIFLQFVYETEKFNGIAELLEILGSIINGFALPLKEEHKIFLLRVLLPLHKVPC
                     LSLYHPQLAYCIVQFLEKEPLLTEEVVMGLLRYWPKINSTKEIMLLNEIEDIFEVIEP
                     LEFIKIEVPLFVQLAKCIGSSHFQVAEKVLSYWNNEYFLNLCIENAEVILPIVFPPLY
                     ELTSQLELDNINGQDGIISDPYILVEQAINSGSWNRAIHAMAFKALKIFLETNPVLYE
                     NCNSLYLSSLKETQQRKKQRQENWKNLETYVSEIKIAENSNRMTEEILGYEKQVPNTQ
                     EKI"
     gene            complement(<601469..>602122)
                     /gene="TPHA0H02560"
                     /locus_tag="TPHA_0H02560"
                     /db_xref="GeneID:11534158"
     mRNA            complement(<601469..>602122)
                     /gene="TPHA0H02560"
                     /locus_tag="TPHA_0H02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686845.1"
                     /db_xref="GeneID:11534158"
     CDS             complement(601469..602122)
                     /gene="TPHA0H02560"
                     /locus_tag="TPHA_0H02560"
                     /inference="similar to DNA sequence:INSDC:YOR012W"
                     /note="similar to Saccharomyces cerevisiae YOR012W;
                     ancestral locus Anc_7.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686893.1"
                     /db_xref="GeneID:11534158"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:G8BWK8"
                     /translation="MSIQLNITDDVDRAADVLNNAFSPSHCSDFIFKKFFNISLDEKC
                     SRARIKAIIHYYTALYHDLDGGDIVEVNDFDAVALFSTPGKHLPPTLTGDAKFDKEFI
                     TDISKRKKEVIPEGVPYYYLFMIGRDLKGPHKKGSVKKIFETYKEKADKDNAAIVLES
                     IADHATSVYEYFGFKNYLTYTIGKGEVNSKGEPDSTGEGFTVKLMFYHKDGEKVLRP"
     gene            complement(<602500..>604137)
                     /gene="TPHA0H02570"
                     /locus_tag="TPHA_0H02570"
                     /db_xref="GeneID:11534159"
     mRNA            complement(<602500..>604137)
                     /gene="TPHA0H02570"
                     /locus_tag="TPHA_0H02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686846.1"
                     /db_xref="GeneID:11534159"
     CDS             complement(602500..604137)
                     /gene="TPHA0H02570"
                     /locus_tag="TPHA_0H02570"
                     /inference="similar to DNA sequence:INSDC:YOL031C"
                     /note="similar to Saccharomyces cerevisiae SIL1 (YOL031C);
                     ancestral locus Anc_7.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686894.1"
                     /db_xref="GeneID:11534159"
                     /db_xref="UniProtKB/TrEMBL:G8BWK9"
                     /translation="MVKRKIILSTLLLGLVPLSNAQQVLSPEPKNTVDVDKATETEGL
                     YVGDSLICNDRTCYPKVFEADDEWRVVKPLQRLPGGLDIRINFDTKLKEARLLPAGVK
                     PVKQEQREKEKKEEQLANEETATSAVEKISTSVSSITSETKMDTAESSTSSQKSLGSS
                     ASITKSQKEKSKETASALKENKKNELAISRDTDLAVNDSDVVAEDADISAKSMAVSTK
                     STQALAKDTDTAIKDTNIQPNDATDNYEFTKEFKVIRDIYNKKARLTNSEIKEIEAKL
                     EELMEFTHDYKHGMKIITHEFELLKSISLSDKLPVSLRELSTRAITGCLRNNPPVLEF
                     ICVNHKEFPSELFQWLSTLQDKSIDVLNLYKTLIKRYISILDEILSSMPIYDMNTTDL
                     ESLTVIYESLDDPKIKTKVLELVSRFFSKHIEVITIESGDEPSIKKRNEQVVQDVQKW
                     TDELATSIQDKNNDEMHIRKFFNGLYQIKSHFKNDIKVDNSFLNWLAKETELRKPNKE
                     KSEEKDSDQDYFDSLLVSSRHLIFGNELAHNLKHDEL"
     gene            complement(<605077..>605397)
                     /gene="TPHA0H02580"
                     /locus_tag="TPHA_0H02580"
                     /db_xref="GeneID:11534156"
     mRNA            complement(<605077..>605397)
                     /gene="TPHA0H02580"
                     /locus_tag="TPHA_0H02580"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_003686847.1"
                     /db_xref="GeneID:11534156"
     CDS             complement(605077..605397)
                     /gene="TPHA0H02580"
                     /locus_tag="TPHA_0H02580"
                     /inference="similar to DNA sequence:INSDC:YOL039W"
                     /note="similar to Saccharomyces cerevisiae RPP2A
                     (YOL039W); ancestral locus Anc_7.96"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_003686895.1"
                     /db_xref="GeneID:11534156"
                     /db_xref="GOA:G8BWL0"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G8BWL0"
                     /translation="MKYLAAYLLLNAAGAAPSADKVKEVLSSVGIEVEDDKVSSLISS
                     LEGKSIEELIAEGQEKMASVPAAGPASGNGAAASGSSAAAAEEEAEEEAEESDDEMGF
                     GLFD"
     gene            <606671..>607102
                     /gene="TPHA0H02590"
                     /locus_tag="TPHA_0H02590"
                     /db_xref="GeneID:11534157"
     mRNA            <606671..>607102
                     /gene="TPHA0H02590"
                     /locus_tag="TPHA_0H02590"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_003686848.1"
                     /db_xref="GeneID:11534157"
     CDS             606671..607102
                     /gene="TPHA0H02590"
                     /locus_tag="TPHA_0H02590"
                     /inference="similar to DNA sequence:INSDC:YOL040C"
                     /note="similar to Saccharomyces cerevisiae RPS15
                     (YOL040C); ancestral locus Anc_7.95"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_003686896.1"
                     /db_xref="GeneID:11534157"
                     /db_xref="GOA:G8BWL1"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:G8BWL1"
                     /translation="MSTAATNAKKRTFKTYSYKGVDLEKMLEMPTEEFIKLAPARVRR
                     RYARGLSTKPAGLMKKLRAAKLAAVENEKPPVVRTHLRNMIIVPEMIGSVVGVYNGKV
                     FNQVEIRPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLK"
     gene            <607962..>609338
                     /gene="TPHA0H02600"
                     /locus_tag="TPHA_0H02600"
                     /db_xref="GeneID:11534028"
     mRNA            <607962..>609338
                     /gene="TPHA0H02600"
                     /locus_tag="TPHA_0H02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686849.1"
                     /db_xref="GeneID:11534028"
     CDS             607962..609338
                     /gene="TPHA0H02600"
                     /locus_tag="TPHA_0H02600"
                     /inference="similar to DNA sequence:INSDC:YOL041C"
                     /note="similar to Saccharomyces cerevisiae NOP12
                     (YOL041C); ancestral locus Anc_7.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686897.1"
                     /db_xref="GeneID:11534028"
                     /db_xref="GOA:G8BWL2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BWL2"
                     /translation="MSSINKLFGAVDSARVESSVDKLFSSSTGPIDETLPKLKARTVL
                     PSNKRTKSNKSDKTKDEEDEEEENKEDESKAEPLKKKQKKVANSEDDDDLESKYYAKL
                     IKEDDTEDKRNKSDLSDKEDDAPKEKTAAAAKILDLKEEELEKARKTIFIGNVPNTVI
                     GNKNIYKEFKKLFSTNPKKDEEAKEEEEKTDEKKVNKFEIESIRFRSISFEEMLPRKI
                     AYVKQKLHKTRDSVNAYIIYKNKKVIKTITKNLNGYIFHDHHLRVDSVSHPTAHDNKR
                     SLFVGNLDFEEAEETLWRHFAKAGEIEYVRVVRDSKTNVGKGFAYVQFKDFQSVNKAL
                     LLDGKPMINKNKPDKKARKLRITRCKNMHKVAASAINGKITKKLNENQKTKFGRAKKI
                     LGKADRATVGTELTIEGARATKGQGVSLRRKKQRSVSGRVTKRSQAFKKAQSEEDAHP
                     KASKKIEN"
     gene            <609732..>611099
                     /gene="TPHA0H02610"
                     /locus_tag="TPHA_0H02610"
                     /db_xref="GeneID:11534029"
     mRNA            <609732..>611099
                     /gene="TPHA0H02610"
                     /locus_tag="TPHA_0H02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686850.1"
                     /db_xref="GeneID:11534029"
     CDS             609732..611099
                     /gene="TPHA0H02610"
                     /locus_tag="TPHA_0H02610"
                     /inference="similar to DNA sequence:INSDC:YAL015C,YOL043C"
                     /note="similar to Saccharomyces cerevisiae NTG1 (YAL015C)
                     and NTG2 (YOL043C); ancestral locus Anc_7.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686898.1"
                     /db_xref="GeneID:11534029"
                     /db_xref="GOA:G8BWL3"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:G8BWL3"
                     /translation="MRILLDKYNKSIYTFINKSIVMRNTRKRLRSDYDLVSPIKDEPK
                     IKSKYFKKEEDGLIVTLDNDKIEVPYEDKVDIEWVKTLKNGEYFKYLDDKTGEKPHQW
                     RQPLDLSIFKNTPKHLLPDNFISTYSKIRLIRSMIRTPVDTMGCATLPLTVGVKVGIK
                     KSQIIPKNYRLQTLLGVMLSAQTKDEVTAQAIHNIMEYCIDELKSEEGLNLDSLLEID
                     NKTLDDMIYSVGFHNRKTKFIKETAKLLKEKYNSDIPSNIKDLLALPGVGPKMGYLVM
                     QKAWGKIDGICVDVHVHRFAKLFKWVDPKKCTTPEHTRKALEKWLPHELWYEINSVLV
                     GFGQVISEPSFKRFRLNSNKMINSKISKNEEDTQITGLEDWSLEFTKSRGDCSEWLNY
                     VNNINIKENIIKNEDGLENILKTEYATSIVEKNDVFQLKSESETYKIEEPILKKETIK
                     VKIEN"
     gene            complement(<611303..>613132)
                     /gene="TPHA0H02620"
                     /locus_tag="TPHA_0H02620"
                     /db_xref="GeneID:11534174"
     mRNA            complement(<611303..>613132)
                     /gene="TPHA0H02620"
                     /locus_tag="TPHA_0H02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686851.1"
                     /db_xref="GeneID:11534174"
     CDS             complement(611303..613132)
                     /gene="TPHA0H02620"
                     /locus_tag="TPHA_0H02620"
                     /inference="similar to DNA sequence:INSDC:YAL016W"
                     /note="similar to Saccharomyces cerevisiae TPD3 (YAL016W);
                     ancestral locus Anc_7.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686899.1"
                     /db_xref="GeneID:11534174"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:G8BWL4"
                     /translation="MGSEISPEDDIYPLALLMDELKHVDVINRVEAMQRIDTVAEALG
                     PERCRDELIPFLLEVAQDDEDEVFAILADQLGKFTQYVGGPEHLTILIQPLEVLASAE
                     DTVVREKAVMSLNNIAQELSEEQLFNAFIPLIQNLSTADWFSAKVSACGLFKSVLVRI
                     KDDSIRSNMLSMYLQLIEDETPMVRRSASKNLPSIIDLFAQNQSLPTPEDWKSISTMF
                     QKIMDDDQDSVKFLAVDCLISILKYFNKNKDYSNANDLLESTKKLITDESWRVRYMIA
                     DKFEEVASQFSNDEAYINSLVEPFIGLCEDNEADIRKAIAKQLPGFVSLLNNPTVVLE
                     KIFPIIRSLSMDDNEATRASLALTITNIADVLDRQQTTDNLIPVLLDMLKDEFPEVRL
                     NIIGNLKAVYDVVGVQLLSESLLPAITELANDMNWRVRLAIIKYIPILAEQLGEEFFD
                     KQLRELCLSWLWDTVYSIRNAAINNIKRLTEIFGDKWCQEEIISKLLKFDTQLLENFV
                     YRFTLLSALTTLIPVVSQKITAEDILPFINHLANDSVPNIRFNIAKSYAAVAESFSKD
                     LNTYQDTIKNTIIPALKNLNEDEDIDVKYFASQSLEKSQSILQ"
     gene            complement(<614048..>618151)
                     /gene="TPHA0H02630"
                     /locus_tag="TPHA_0H02630"
                     /db_xref="GeneID:11534175"
     mRNA            complement(<614048..>618151)
                     /gene="TPHA0H02630"
                     /locus_tag="TPHA_0H02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686852.1"
                     /db_xref="GeneID:11534175"
     CDS             complement(614048..618151)
                     /gene="TPHA0H02630"
                     /locus_tag="TPHA_0H02630"
                     /inference="similar to DNA sequence:INSDC:YAL017W,YOL045W"
                     /note="similar to Saccharomyces cerevisiae PSK1 (YAL017W)
                     and PSK2 (YOL045W); ancestral locus Anc_7.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686900.1"
                     /db_xref="GeneID:11534175"
                     /db_xref="GOA:G8BWL5"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BWL5"
                     /translation="MPYIGGSDTSRNSFQTLREKHSILNEGNPTNQAQSQFNVSEKQV
                     IEDLSPPNAANLQERSNSLHSLNSCSTDIDMQELMNLPNESTHVYSYNPLSPNSLAVR
                     LKILKRSLEILIGNPDMLKDPSGSNSANGDDAETNHSRHLSQFIKHDKDFLSHLESYN
                     SSQHNRDNNTSYDSADGVYAKNNRRDSLQLNKHTTHSATLQAFVTKSATATIMNTPTV
                     SDTNIASMPRATSLMHLPSGHSSSLNGAYGKIKTSNSHSINKMTMHKLSNISEHETSY
                     NNNNSGDESAESEINSESDEDNLNFTAISISTKHRKGVESKKENIFYNNSTASQSAEI
                     VTSRISDLVQLLDLLNETLENNLSAKASALHNMSLLNINKLNIGDVKNSGSTTVTKTL
                     LDSLAEPFFELLADERSIDDEAELKTEMNEFLGNKNNGNAIPSEDNESFTEFRPQQDY
                     GRLLHTFTSIKNSAPHAIFTCSEQYPWQFRAANDLSCLSFGISRNAIKALSLLDLIHP
                     DNRDFVCNKILGTEGRDIVFTGEIVAIVQPGGSQKSGSGKNNLIWASIWAKRKNNLLV
                     CVFEKVPCDYMDLKLNLNDFSIEDIVSNDALFKQKQSPGDDLKLSSLSMEKELSLALL
                     PSHTNTDNDFENHDFSSNKENENIDIAPIPTKKKSVKFANEMHDVSDISLSLSKLIKD
                     VMQGKIFEKEDKLYSVQERVANHINRRRYFTINHLSYNIPCAVSAIMLEKELKLKVHS
                     LPYEAGLFIIDTHTLQLITFNRSIAKNMFGLHFSELAGEHIDTIIPLFSKIISYVAQK
                     YSALDITNCRNKGLVLTEHFFRKIQAEMDGDRDAFYTSVGIDGLHRDGCSIKIDFQLR
                     VVDPSVAFVWITHSRDVVFEDYNSNPSQLQMLNESELAFISSNSSSASSSKKSTLKIN
                     IKDLSALSKLSLDNKHMSGETITSQGTAPNSNSSQSHSSLNLHVPRTPESVRSSSNVL
                     SPKTSNNKKHTDSKGDVETNDNENIFNDSELRNKLELANVYVKDKSQFINSGRFTVDE
                     GLIKSMATSPISSKSASSLQLSARVPSKEISSGGSFPDLNSNISSLKNSPSELKTTFL
                     HVPENQIGSQKRTKKFSDFVILQKMGEGAYGKVNLCLHKKKRYIVVIKMIFKERILVD
                     TWVRDRQLGTIPSEIQIMTTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLF
                     DLIEFKSNMTESEARLIFIQVVLGIKHLHDSNIVHRDVKDENVIVDAKGFVKLIDFGS
                     AAYVNSGPFDVFVGTIDYAAPEVLSGEPYLGKPQDIWAIGILLYTIMFKENPFYNIDE
                     ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIVNDKWLKL"
     gene            <619151..>620128
                     /gene="TPHA0H02640"
                     /locus_tag="TPHA_0H02640"
                     /db_xref="GeneID:11534166"
     mRNA            <619151..>620128
                     /gene="TPHA0H02640"
                     /locus_tag="TPHA_0H02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686853.1"
                     /db_xref="GeneID:11534166"
     CDS             619151..620128
                     /gene="TPHA0H02640"
                     /locus_tag="TPHA_0H02640"
                     /inference="similar to DNA sequence:INSDC:YAL018C"
                     /note="similar to Saccharomyces cerevisiae YAL018C;
                     ancestral locus Anc_7.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686901.1"
                     /db_xref="GeneID:11534166"
                     /db_xref="UniProtKB/TrEMBL:G8BWL6"
                     /translation="MSLGGSCILSAIGGMVYKFDRNQVYERLPASQDIHLKYFKLDNS
                     NDSKTTKQLNQTTATNKGIYNSKFIKFKNQVPVIFINFFKDFFESRSFILPINGIKEL
                     FNNFKVYMVPTLLTFIIYFLMYLLVSMAYFATITPVYTSLLLFLGPLGLIISLIHTVL
                     QTNQLTMMFMRLSHFQNFVVKKYINQNDLQELIKNKPKPIKYYISPRTKYFWVYYLPK
                     KLVKYVLGLLVFNMLFAISFAPIIGPFLFHFLIAPVITRIYVSKFFRLRGISNVERNQ
                     NFYLHLGRYTIIGLFAGLLENIPILSGFFLTSNTIAVTMWGIDEISKFE"
     gene            complement(<620318..>621769)
                     /gene="TPHA0H02650"
                     /locus_tag="TPHA_0H02650"
                     /db_xref="GeneID:11534167"
     mRNA            complement(<620318..>621769)
                     /gene="TPHA0H02650"
                     /locus_tag="TPHA_0H02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686854.1"
                     /db_xref="GeneID:11534167"
     CDS             complement(620318..621769)
                     /gene="TPHA0H02650"
                     /locus_tag="TPHA_0H02650"
                     /inference="similar to DNA sequence:INSDC:YOL049W"
                     /note="similar to Saccharomyces cerevisiae GSH2 (YOL049W);
                     ancestral locus Anc_7.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686902.1"
                     /db_xref="GeneID:11534167"
                     /db_xref="GOA:G8BWL7"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G8BWL7"
                     /translation="MSGKYPSFPKLTDEELVNHVIPEMHQWSLANGLVMYPPNFKEEG
                     ASTAPTTVFPTPLPRESFEHAVNVQKSYNELYAKIAQDKSNWLREESKKLSKFDVEFT
                     GRLWKTYLKAEGKGIKQKLRLGVFRSDYLIDKERNAIKQVEFNTVSVSFGGLSYKVSQ
                     LHEYLNDSGKYSLNNGLKFYDNIPISDSSQKLTEGLATAIKHYDSLKENPIVVFIVQK
                     KERNAFDQRLLEYNLLTNYGIKSRRLILDEVKNSTYMDLESNRLFVKATGEEIGVIYF
                     RSCYSPSDFASEDDWDTRLYLENSYAIKAPDLLTQLSGTKKIQQLLTDKDILKDYIED
                     KDSLEDLHSTFVKIYPLDDSNLGKQGQKLAFESPNNYVLKPQREGGGNNIYKEDIPVF
                     LQKLDKNDWNAYILMELIQPEPTTQNVLVRGGEYFRESIISELGIFGCVLFNDDDILY
                     NEYSGWLLRSKFNSSNEGGVAAGFGCVDSVVLY"
     gene            complement(<622277..>625420)
                     /gene="TPHA0H02660"
                     /locus_tag="TPHA_0H02660"
                     /db_xref="GeneID:11534182"
     mRNA            complement(<622277..>625420)
                     /gene="TPHA0H02660"
                     /locus_tag="TPHA_0H02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686855.1"
                     /db_xref="GeneID:11534182"
     CDS             complement(622277..625420)
                     /gene="TPHA0H02660"
                     /locus_tag="TPHA_0H02660"
                     /inference="similar to DNA sequence:INSDC:YAL019W"
                     /note="similar to Saccharomyces cerevisiae FUN30
                     (YAL019W); ancestral locus Anc_7.80"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686903.1"
                     /db_xref="GeneID:11534182"
                     /db_xref="GOA:G8BWL8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWL8"
                     /translation="MNDDIQVPESSSPSRYNIPSSSPLKKESDFKMDNANSLREKFSF
                     KGGNSQNVVSPSKDGDDFRANLTILSEEFSDFSATLIQAVFKSNSFNLALSRERLNKI
                     RSQRTSWSASSPKKVNRLSTTAEDSSKITLVKQKASIFDRYSNVLNKKHVNESELTDL
                     LSENESSENSDPPVAKKKRRLVKYADMQSTKVQKTNTHLDQAKEKIMKKKSVKQLMED
                     EEEHDVIDDGLTDLDSENDNYEEQVTEENIDAQILKFINTAEANDIADLADIPIEKAK
                     LIIESRTFKSIAQFSAMEFITEKEKEKLESQKENKRKSRKPKLPEGEKLVDKLFQSIK
                     GYNAIDSLIKQCSSYGTLIASQIKKWGVDLEKPSENGELDITSLDTDDQNKAVVEEFD
                     DSEVSGTPTPTPTPSSSTANLLAKKTARRIKRLDSEDEEEDFDIGVEEADDDEGADDD
                     EDFAIDSKTRVTRTSNKIKARKLIKFFMGKPKLLAEDITLKDYQQAGINWLNLMYHNK
                     MSCILADDMGLGKTCQVISFMAYLKQINEPGPHLVVVPSSTLENWLREFQKFCPELKI
                     EPYYGTQAERADLRDILEENVGQYDVIVSTYNLAAGNKQDVSFLRNCNFNAIVYDEGH
                     MLKNSSSERFNKLMRIDCNFRLLLTGTPLQNNLKELMSLLEFIMPSIFESKKESLASI
                     FKQRAKTTTASKDYNPLLAQEAINRAKTMMRPFILRRRKDQVLKHLPAKHKHIVYCDM
                     ASSQREIYDKEIQMVKDHKKLIRDGMLPTDAKARKAIKDSSSKNLIMSLRKASIHPLL
                     FRHIYDDATISKMSKAILREPEYAENGNIEYIKEDMSYMTDYELHRLCTNFPKSLSQY
                     QLKNDEWMNSGKVEKLCELLKTIIIDKKEKVLIFSLFTQVLDILENVLSTLKYKFLRL
                     DGSTQVNDRQSLIDKFYEDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQ
                     ASDRAHRVGQTKEVQITTLITQKSIEEKILQLANNKLDLDSHISEDDKKSEDALESKV
                     NDMLEDIIFEESTEEGK"
     gene            <625896..>627017
                     /gene="TPHA0H02670"
                     /locus_tag="TPHA_0H02670"
                     /db_xref="GeneID:11534183"
     mRNA            <625896..>627017
                     /gene="TPHA0H02670"
                     /locus_tag="TPHA_0H02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686856.1"
                     /db_xref="GeneID:11534183"
     CDS             625896..627017
                     /gene="TPHA0H02670"
                     /locus_tag="TPHA_0H02670"
                     /inference="similar to DNA sequence:INSDC:YAL020C"
                     /note="similar to Saccharomyces cerevisiae ATS1 (YAL020C);
                     ancestral locus Anc_7.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686904.1"
                     /db_xref="GeneID:11534183"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:G8BWL9"
                     /translation="MFRIKTVPVNLGLPHQEDLIVPSLTLETQKSIKKIACGGNHTII
                     LCENEILGCGETSAGQLGDDVSTNLGWKVLFPTRSIIDVACGWEFTVVIDFNNQVLSC
                     GTGGKGELGLGADVTQSDSLQSVFKIPDGYQGKLFSSLQNCILVMTNKTTKHCQIFGW
                     GSNTKEQLFKPKNRKVASPTLIYESQNTTIDYVSMGKDFILLINDHNEVIEARGNLPA
                     GFTISDWVSKQLSHVACMWTSIHIQLEDKIHSFGNNRYGQLLNKQIPNIKNFSTGSEH
                     GIMSLNNPSTISCWGWGEHGNCGPLNSPTRLENLSPHPITTPPNANSINDYSNTISPP
                     NTILHLDNKNTHQVLLQGGYATSWIVIYTSKQTPPPISP"
     gene            <627935..>630553
                     /gene="TPHA0H02680"
                     /locus_tag="TPHA_0H02680"
                     /db_xref="GeneID:11534061"
     mRNA            <627935..>630553
                     /gene="TPHA0H02680"
                     /locus_tag="TPHA_0H02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686857.1"
                     /db_xref="GeneID:11534061"
     CDS             627935..630553
                     /gene="TPHA0H02680"
                     /locus_tag="TPHA_0H02680"
                     /inference="similar to DNA sequence:INSDC:YAL021C"
                     /note="similar to Saccharomyces cerevisiae CCR4 (YAL021C);
                     ancestral locus Anc_7.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686905.1"
                     /db_xref="GeneID:11534061"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8BWM0"
                     /translation="MNNPTLLGGPGNIVDPTGQKPGTPLNHQQQLHTPPGMMNNENTL
                     HLLSQLHNAGNPNPQQLNANDILNVNLNMHNNNANANTNVNNLPNNINMRMNMGNGMN
                     MNMNMNMNMNMNMNMNMNMNMNMNNVVPDGNINNPLFHPHLEDPSLLNNPIWKLQLQL
                     VSTSMQTLGQPNVYARQNAMKKYLVNQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     KQGQQSKLHSQLNMPQDQLLNPMQDQNLNVNNPQMNEAAISLVDRTKKLLMDMASDSS
                     HTASDGSLDNTKLPNTNNIGGGNSTISTPTTPTRELNQVAGTPNTHAAVLLQHKKLSQ
                     YNIDEDDEAEQQQKRSMNSTSSSNINENSSKYNDQLWHAIDLSNLQLYCVTKNVFKYE
                     FLTRLYLNGNNLTTLPKEIKKLNNLRVLDLSHNKLTVLPKELGFCYQLKYLYLFNNMI
                     TDLPWEFGNLFNLQFLGCEGNPLDRKLLKILAEKSVTGLVFYLRDNRPEIPLKKDRKF
                     ITINADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVL
                     SWDTRREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQ
                     SKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALF
                     VKLEHINSGESVWVVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYNNASSKQEIRK
                     CPVIICGDLNSHLQSAVYELLSTGHVKVHEDIQDRFYGFMSQKNFSHSLSLRSTYDCI
                     GELPFTNFTPSFTSVIDYIWYSTQALRVRGVLGPIDEEYVSKFIGFPNDKFPSDHIPL
                     LARYEFTKGGAASRKV"
     gene            <631046..>632320
                     /gene="TPHA0H02690"
                     /locus_tag="TPHA_0H02690"
                     /db_xref="GeneID:11534062"
     mRNA            <631046..>632320
                     /gene="TPHA0H02690"
                     /locus_tag="TPHA_0H02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686858.1"
                     /db_xref="GeneID:11534062"
     CDS             631046..632320
                     /gene="TPHA0H02690"
                     /locus_tag="TPHA_0H02690"
                     /inference="similar to DNA sequence:INSDC:YAL022C"
                     /note="similar to Saccharomyces cerevisiae FUN26
                     (YAL022C); ancestral locus Anc_7.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686906.1"
                     /db_xref="GeneID:11534062"
                     /db_xref="GOA:G8BWM1"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8BWM1"
                     /translation="MNDYEINLAILPFHKRIQNPVYLTFIFVGIGLLWPWNTILSASD
                     YYKHDIFHDTTIWAKIFTSSMMTVSTVTSLLFNIWLTERQFGYAKRVVNGLVWEIVVF
                     ILIILIAIIHSNFPLGLNFFALLMLVMISSTGTALTQNGILAIANHRGSDMTQAVMLG
                     QAIAGVLPSLVLFLISLFKDPESKSSSNINFYLFTTVIISWICIWLFKSNKLEDSLNY
                     ATDPQPNGEYQELREIENEVLEKYQIPFSVLYEKLKYLVLSIFTTFTITMVFAVFASN
                     TSAQGLPLSDNQFIPLAFSIWNIGDLCGRFIAELPYFSKSSFTPYKTLIYSLLRIGLI
                     PMFLPFILPADNFKIITDLLYLSLQFMFGLTNGHIISMCFIKIPQNLENSAAKQAAGG
                     FANTFVATGLTTGSILSFVFVYIINQLKTSSD"
     gene            <632941..>635223
                     /gene="TPHA0H02700"
                     /locus_tag="TPHA_0H02700"
                     /db_xref="GeneID:11534063"
     mRNA            <632941..>635223
                     /gene="TPHA0H02700"
                     /locus_tag="TPHA_0H02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686859.1"
                     /db_xref="GeneID:11534063"
     CDS             632941..635223
                     /gene="TPHA0H02700"
                     /locus_tag="TPHA_0H02700"
                     /inference="similar to DNA sequence:INSDC:YAL023C,YOR321W"
                     /note="similar to Saccharomyces cerevisiae PMT2 (YAL023C)
                     and PMT3 (YOR321W); ancestral locus Anc_7.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686907.1"
                     /db_xref="GeneID:11534063"
                     /db_xref="GOA:G8BWM2"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:G8BWM2"
                     /translation="MVAASGFNASKDDSSVEICKRKENETKDLKEEVSVEDTIDSEDS
                     SKEKELKILEAPKGKLYRLEAIFMPLLFTGLAFFTRMYRIGANNHVVWDEAHFGKFGS
                     FYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGQEYPDYIDFVKMRLFNATFS
                     ALCVPLAYFTGKSLNWSLPSVWLFTVLVLFENSYATLGRMILLDSMLLFFTIASFYCF
                     VNFHNQRSNSFSFKWWKWLFLTGLTLGCTISVKMVGLFIITLVGIYTAVDLWLKLADK
                     EISWKRYGSHWLARILCLIVVPMVVFMICFKIHFSLLTRTGKNDATMPSLFQANLAGN
                     TLGQGPRDIALGSSTISIRNQALGGALLHSHQQLYPVGSKQQQITGYGHKDANNEFIF
                     HRIREKPLYSTNETDIEYIKDGETYRLIHRLTNKNLHTHQVAAPISKTEWEVSGYGDL
                     EGGDSKDNWIVEIVNQLGDEDKTKLHTLTTSFRLKNAVLGCYLAQTSNRYPEWGFSQS
                     EIACLRSPFKRDKRTWWNIETHVNEKLPNIDENFEFPRASFFKDFIYLNLAMMATNNA
                     LVTDPDKLDRLASSAWEWPTLHKGLRLNGWHDENVKYYLMGTPASTWASTLAVFSFMV
                     LVIVLFLRWLRQYNDYKDEKKLDLFLMSGVYPMFGWGLHFCPFVIMARVTYVHHYLPA
                     LYFALVVLVYFFEAGTQLLPKTKSGQMLRIGIYTVYILLVIGCFCCFAPISFGMEGKS
                     TDYKYLAWLPEWNIDEDKPF"
     gene            complement(<635454..>637640)
                     /gene="TPHA0H02710"
                     /locus_tag="TPHA_0H02710"
                     /db_xref="GeneID:11534064"
     mRNA            complement(<635454..>637640)
                     /gene="TPHA0H02710"
                     /locus_tag="TPHA_0H02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686860.1"
                     /db_xref="GeneID:11534064"
     CDS             complement(635454..637640)
                     /gene="TPHA0H02710"
                     /locus_tag="TPHA_0H02710"
                     /inference="similar to DNA sequence:INSDC:YOR322C"
                     /note="similar to Saccharomyces cerevisiae LDB19
                     (YOR322C); ancestral locus Anc_7.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686908.1"
                     /db_xref="GeneID:11534064"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:G8BWM3"
                     /translation="MSALSKLITLPLSGKKKNEAKKASLKATKKKNHNSIPVELIIDI
                     ESPPCVLYGNANESTGCLLSGLLTVKVKDLIAKTKNSTVNKLTSLNVRSLKLSFIQRV
                     SYNKPFSQGPSTVINCKDCNTRKQVLKTWNIVENSTTLDSGSTQIFPFSHLISGKSTV
                     TCYLGSNSDTKVRYELIASIRYFDNSENSQSKNLEPKLVTVKLPIMLTRSILRGPDKN
                     SLRVFPPTNLTTAAVLPSVVYPKSTFPLEMKLEGISGEDTRWRMRKLSYRIEETVRIR
                     NNVCEKHVEDLKVLENVVKEKEVQKSKKPPNPIKRYGDLAPQVRLSVNTIGGSSSSHN
                     NGARSALNTPQSVANNSGDRDEDDEEMENSSTFVHPNDDVARQEILQQRQRIRKEEIE
                     AELQNETSLFTEEVRIIAEGIMKSGWKTDFNESGKIEIVTDIDCSSLNSGVSNSITHA
                     SSEYLENEMPKAKSVNVSCDIQDPVLGINVSHILSVEMVVAEEALQYKNGQPVRHSNS
                     SAVGDSASKNSSADQRLAELSPMLANRNSNRRKNLASTALSKVASINSNNDNKDNSSD
                     VPIVGGDSSSKTVGIPTGAARVLRMQFRVNVTERSGLGISWDEEVPPIYQNVSFVSPP
                     SYDNLDGVSTRHAGSESAVYDNSEMIPLNSTDFKYSTLDLERPVQIYNQASTNALSAI
                     QSLPLESVESIDGSDPTYHNSLTPRQTRDIRIPTISEVIDTDKITQ"
     gene            <638758..>642849
                     /gene="TPHA0H02720"
                     /locus_tag="TPHA_0H02720"
                     /db_xref="GeneID:11534150"
     mRNA            <638758..>642849
                     /gene="TPHA0H02720"
                     /locus_tag="TPHA_0H02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686861.1"
                     /db_xref="GeneID:11534150"
     CDS             638758..642849
                     /gene="TPHA0H02720"
                     /locus_tag="TPHA_0H02720"
                     /inference="similar to DNA sequence:INSDC:YAL026C"
                     /note="similar to Saccharomyces cerevisiae DRS2 (YAL026C);
                     ancestral locus Anc_7.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686909.1"
                     /db_xref="GeneID:11534150"
                     /db_xref="GOA:G8BWM4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8BWM4"
                     /translation="MSDHIKNQNGDKEVDTLFDIDFDYDNANKENQKSKKAYSLRDEQ
                     GNDNVFYQEVIDLNKNDSIVNDVADGRVHSENPFNSTNSAVADDYEFFNWNNDNGSID
                     GDRFKGPSDLTKIGSKPNILKRTFNKIKQPFTGSSANLDGDDNRFEMSQYNKVTNNED
                     GDAYVNSRDRFDIKILFNRYILRKGKPDDQENGEPRLIYLNDSNSNGLMRYSNNHIST
                     TKYNFATFLPKFLFQEFSKYANLFFLFTCIIQQVPNVSPTNRYTTIGTLLVVLVVSAV
                     KELIEDIKRANSDKELNYSKTEIFSEMDGTFVSRRWIDIRVGDIIKVKSEEAIPADII
                     LLSSSEPEGLCYIETANLDGETNLKIKQSRSETAPYLSSNQLSSIRGKIMSEHPNSSL
                     YTYEGTLVLNGHDIPLSPDQMILRGATLRNTSWVFGAVIFTGHETKLMRNATATPIKR
                     TAVERIINMQIVALFGILITLSVVSSLGNVITLNARGSELSYLYLEGTSRVGLFFKDI
                     LTYWILYSNLVPISMFVTVELIKYYQAYLISSDLELYDETSDTPTVVRTSSLVEELGQ
                     IEYIFSDKTGTLTRNIMEFKSCSIAGRCYIEKIPEDKGAKMENGIEVGYRTFDDMKHR
                     LSDNDDEGRVIDNFLTLLATCHTVIPEFQEDGSVKYQAASPDEGALVQGAADLGYKFL
                     VRKPNSISIYIDNKGKQQEFQLLNICEFNSTRKRMTTIYRFPDGSIKLFCKGADTVIL
                     ERMDKSKSQYVDVTLRHLEDYASEGLRTLCLAMRDISEDEYQEWKILYDEAATTLDNR
                     AEKLDAVAEKIEKELVLIGATAIEDKLQDDVPDTIRILQNAGIKIWVLTGDRQETAIN
                     IGMSCNLLSEDMNLLIVNEETKEATRENLIEKVTAIKEHSDMVRDLNTLSLIIDGKSL
                     GFALEPDLEDYLLQLGTLCRAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVS
                     MIQAAHVGIGISGMEGMQAARSADFAIAQFKYLKKLLLVHGLWSYQRIAVAILYSFYK
                     NIALYMTQFWYVFSNGFSGQSIIESWTMTFYNLFFTVAPPLVMGVFDQFVSNRLLERY
                     PRLYRLGQKGQFFSVPIFWGWICNGFYHSAITYVGSILFYKYGFALNINGETADHWTW
                     GTAVYSTSVVIVLGKAALVTNQWTIYTLIAIPGSLLFWFIFFPIYASIFPHANVSPEY
                     FGVVSHTYGSGTFWLMIIVLPSLALLRDFAWKYYRRMYVPETYHVIQEMQKFNISDYR
                     PHLQQFQKAIHKVRQVQRMKKQRGFAFSQTEEGQEEIMRMYDTTQKRGDYGELHEAAN
                     NPFSDQNALGNGNNNAGNPFAHSGTNSIEGDFVTLDRSDSFDI"
     gene            complement(<642961..>644511)
                     /gene="TPHA0H02730"
                     /locus_tag="TPHA_0H02730"
                     /db_xref="GeneID:11534151"
     mRNA            complement(<642961..>644511)
                     /gene="TPHA0H02730"
                     /locus_tag="TPHA_0H02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686862.1"
                     /db_xref="GeneID:11534151"
     CDS             complement(642961..644511)
                     /gene="TPHA0H02730"
                     /locus_tag="TPHA_0H02730"
                     /inference="similar to DNA sequence:INSDC:YAL028W,YOR324C"
                     /note="similar to Saccharomyces cerevisiae FRT2 (YAL028W)
                     and FRT1 (YOR324C); ancestral locus Anc_7.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686910.1"
                     /db_xref="GeneID:11534151"
                     /db_xref="UniProtKB/TrEMBL:G8BWM5"
                     /translation="MKRAHSSRSFFINQSTGTNDDDKFNIDADIVLPLFTVSGNETVT
                     QTQDEDNVKVPTIKINNSTITDSSRTKSCRNLQHSSNTSINKRSNAKLHVRSYNRIPS
                     IPSFKHLSLVQNEMLSAGSGSFSNTLFANEEDSSIQPDTYISDNESIMSATIPKDTTP
                     FTEYDLYLFPKQINHNNNRQKTRSYSFISIDDRQRKLSPNVNHFDSRRLATQFLESSN
                     TPFKEQVNFHTKLQIGNKKNSFSETKLSRDNLLEGRKSFKTDQIDNRLYIKNLNDMSE
                     VLSKFGDLETSKPSSSALTFSSSSSTSSSSSSSSSLVIDFKNNHSALGSRDTQSKGTV
                     FSEKSSTSRRDTDKEDDWNIKSMDPGIQITTNLNEVNFSQMHIAKRISTLEILINSGI
                     TNVIYKGENEFHKLITNFDDLSQRLQKLRSNLNDITLAVKNSHLENLDKKFDRNNESS
                     LIYQVTENVAEFVEKLENIQKRYDTCKSLVDRHREVIRIMEQELEKRISKKKVKKAVD
                     IQQFLMLV"
     gene            complement(<645428..>645775)
                     /gene="TPHA0H02740"
                     /locus_tag="TPHA_0H02740"
                     /db_xref="GeneID:11534069"
     mRNA            complement(<645428..>645775)
                     /gene="TPHA0H02740"
                     /locus_tag="TPHA_0H02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686863.1"
                     /db_xref="GeneID:11534069"
     CDS             complement(645428..645775)
                     /gene="TPHA0H02740"
                     /locus_tag="TPHA_0H02740"
                     /inference="similar to DNA sequence:INSDC:YAL030W,YOR327C"
                     /note="similar to Saccharomyces cerevisiae SNC1 (YAL030W)
                     and SNC2 (YOR327C); ancestral locus Anc_7.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686911.1"
                     /db_xref="GeneID:11534069"
                     /db_xref="GOA:G8BWM6"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR016444"
                     /db_xref="UniProtKB/TrEMBL:G8BWM6"
                     /translation="MSSSIPYDPYVPPEEHFNAAEEPSQSKTAALQAEIDDTVGIMRD
                     NINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVICIIIL
                     LVVIIVPIVVHFT"
     gene            complement(<646233..>649103)
                     /gene="TPHA0H02750"
                     /locus_tag="TPHA_0H02750"
                     /db_xref="GeneID:11534172"
     mRNA            complement(<646233..>649103)
                     /gene="TPHA0H02750"
                     /locus_tag="TPHA_0H02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686864.1"
                     /db_xref="GeneID:11534172"
     CDS             complement(646233..649103)
                     /gene="TPHA0H02750"
                     /locus_tag="TPHA_0H02750"
                     /inference="similar to DNA sequence:INSDC:YOR335C"
                     /note="similar to Saccharomyces cerevisiae ALA1 (YOR335C);
                     ancestral locus Anc_7.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686912.1"
                     /db_xref="GeneID:11534172"
                     /db_xref="GOA:G8BWM7"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:G8BWM7"
                     /translation="MTVGDKSKWMAKNVRQTFFDYFKSKGHTYVPSSSVVPFDDPTLL
                     FTNAGMNQYKPIFLGTVDPSSDFATLKRAYNSQKCIRAGGKHNDLEDVGRDSYHHTFF
                     EMLGNWSFGDYFKKEAIAYAWELLTVVYGLPADRLYVTYFEGDAQQGLEPDLEAKDLW
                     LAVGVSEDHIIPGNSHDNFWEMGEQGPCGPCSEMHYDRIGGRNAAHLVNMDDPDVLEI
                     WNLVFMQYNREQDRSLKSLPAKHIDTGMGFERLVSILQDVRSNYDTDVFQPLFVKIQE
                     ITGVRPYSGKFGAEDVDGIDTAYRVLADHVRTLTFAITDGGIPNNEGRGYVLRRILRR
                     GARYARKYMNYPIGNFFSTLAPTLIEQVKEIFPQVTKDPAFLFEILDEEEASFAKTLD
                     RGEKLFEKYAEAAAKSQTKILDGLQVWRLFDTYGFPVDLTELMAEEQGLKIDEEGFEK
                     AKQESYEASKRGGKKDNFDMLKLNVHELSQLNELKVPKTDDSAKYISTDAESVILSLY
                     DGETFVDSISEAGKKYGVILDKTSFYAEQGGQEYDTGKIIIDGEAEFQVDNVQLYNGY
                     VFHTGTLIEGTLNKGDKTISSHDEERRLPIKNNHTGTHILNLALRQTLGNDVDQKGSL
                     VAPEKLRFDFSHKKALSLDELRKVEEIANDQIKKNLPVYYKDVPLELAKGISSVRAVF
                     GETYPDPVRVVSVGKTVEDLLADPTNEEWNKYSVEFCGGTHVPKTGDIKFFVILEESG
                     IAKGIRRIVAVSGAEAFEVQRIANEFDEELNKTEQLPFSQAKEKKLKELGVQLNQLSI
                     SVIRKNELKEKFTKIEKVVKDEVKARAKVETKQVVDAVKEHFENNKDSLYFAQFIDIP
                     ANAKAITEAINHIKSKSKDKSIYLLTGNDPEGRVAHGCYISDESLASGLDGAALAKQV
                     SQLIGGKAGGKGNVFQGMGDKPEAIEEAVKTIEIAFNEKLSI"
     gene            <649734..>653798
                     /gene="TPHA0H02760"
                     /locus_tag="TPHA_0H02760"
                     /db_xref="GeneID:11534173"
     mRNA            <649734..>653798
                     /gene="TPHA0H02760"
                     /locus_tag="TPHA_0H02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686865.1"
                     /db_xref="GeneID:11534173"
     CDS             649734..653798
                     /gene="TPHA0H02760"
                     /locus_tag="TPHA_0H02760"
                     /inference="similar to DNA sequence:INSDC:YOR336W"
                     /note="similar to Saccharomyces cerevisiae KRE5 (YOR336W);
                     ancestral locus Anc_7.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686913.1"
                     /db_xref="GeneID:11534173"
                     /db_xref="GOA:G8BWM8"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="UniProtKB/TrEMBL:G8BWM8"
                     /translation="MEQKMMRFLLFWFFVVTVASLHGVRGSHFAVAPPTRIWSVLNRL
                     LHGSSLRSRVLNDLYPLVTGVEEGVDAYAEDGELVDLVADVLVDKFDLPEMASLFLHY
                     YDLYPMGFPSGNQTFNNENYFILNGQKFLNAEDIFYFKTGDLKAQSKIPDSQIVQDND
                     VVIGKDPTAPICILYGCPSPGDDSENSFDAFNRNLYSDAVNTGKLRFIWRSTCSFDFD
                     DPEQELGYPLELTKREGLRNAIWKWDTPYDMPEQFSKVGYEMYEPKVEELGDLDLRVS
                     SLIAKTYKENKDFKKTFKLIKGISNNFPLIIKDLLKLKINNKIMESNEKFQKSGVDYN
                     MLGLFINGQSMRYSALDDYSLLNAITKEYKRISSFQNDLKHFKLKHFKKASKSLLNKF
                     SSISLSNLQEMQPNKIDLHRHPAFANSIIYFNDIEKDKQYKGLSKKIERFFEKSKFGE
                     VPELRKNWNEVIFVIDFNDLENSVTQEALAGLLRALTIIEQGYPQRIGLLPLNTGLDK
                     NIINSIYELKESNLQNLIEFLTQLEANKEGERTDEEFLFSDFDDVPNVAELLNELQIF
                     GTSIIINGEIYPFKSNTWHYLLTKVIKKDVNLLKRELTKYKGQKKVDVRGILHLKSAT
                     GRHFKYTPDYFSDATYTSMNSFELDSLDVGIIDFIPIEEYNVLHTISLVDDFENEISL
                     ERLHNILKVGFSGIRIRLINTNTNIKSKTWKSLQLILKTSNDDIESKLVSLIKQVRKS
                     NKNKVTKSENKLNIELLSKWLPDISNRILKSSDAFFTINGRFVHLESSELPSTTDFKN
                     IIQREAKRTIDAVMVLEDEYPGFTEERIDPNLIEMVSSHLTKLFYHGSQIYDNGIDYK
                     TESTLPRMNLSGFFKNNGYTVFERSSKKSQPIELTLVIDPLEERTQKIMTLVDKIMDL
                     DFISIQIVLLPTNELKVVPNQRIYIDDSSEYHSEIHSLKKTFNIDIDNPYQITIKNHE
                     NIGYKSVVLDVNAFNEKDPISENNIDGISGACLQLIGENGEVIDKTFTMGTFGYGQFQ
                     ISKLSSKLKIQSCDNNFEVVSISMDGKPDYIEDETIELLNFDPHKVYVKLRKLESKPS
                     NDAEDKTAINIFNIINDETENEEEQYKKFITTISTHNVDNKKINFWLLNEPYLSNNLL
                     TFIQRFNNEHNSMSIELLNYQWPTWLRPQRFRSREMKISKILFNDVLFPREVKQVIYM
                     DLTEEEPVAVDPFVIAKRLNQQRDQDYSFRMVKMEGTGYWDEGYWLKYKTENENNKLA
                     FNFYSSRPIIVINIKKLREQKSEFYSDKSIGDLIRIHYQRVSNDFNSLQNIDQDLLND
                     LQNQVTIREIAKYLLKPLEANSSGSSDANLHDEL"
     gene            <654327..>654968
                     /gene="TPHA0H02770"
                     /locus_tag="TPHA_0H02770"
                     /db_xref="GeneID:11534186"
     mRNA            <654327..>654968
                     /gene="TPHA0H02770"
                     /locus_tag="TPHA_0H02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686866.1"
                     /db_xref="GeneID:11534186"
     CDS             654327..654968
                     /gene="TPHA0H02770"
                     /locus_tag="TPHA_0H02770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686914.1"
                     /db_xref="GeneID:11534186"
                     /db_xref="UniProtKB/TrEMBL:G8BWM9"
                     /translation="MTRRPPPSPLAFGPHSWREGPFLRYDVVSFQPFGIEPYQSAALC
                     WPHTEKYVHAWHWRQGLQPQSRIVFSIQQARREARPSSGERRLPVGANAIRNKSGHKS
                     GPNHLWPTPSPTPLPGFASSFIRRFPFPLVSFVFLFSFSAFFHSEMRDWRSALCGCTR
                     TAHCANGQLHVEELNDLVVPPVRPHGAWQSTQLIRLHAHNPVMAALLDLPLPG"
     gene            <655311..>656549
                     /gene="TPHA0H02780"
                     /locus_tag="TPHA_0H02780"
                     /db_xref="GeneID:11534187"
     mRNA            <655311..>656549
                     /gene="TPHA0H02780"
                     /locus_tag="TPHA_0H02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686867.1"
                     /db_xref="GeneID:11534187"
     CDS             655311..656549
                     /gene="TPHA0H02780"
                     /locus_tag="TPHA_0H02780"
                     /inference="similar to DNA sequence:INSDC:YAL034C,YOR338W"
                     /note="similar to Saccharomyces cerevisiae FUN19 (YAL034C)
                     and YOR338W; ancestral locus Anc_7.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686915.1"
                     /db_xref="GeneID:11534187"
                     /db_xref="GOA:G8BWN0"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:G8BWN0"
                     /translation="MNLYSPQLEHSQLNAINPRLGPVPHPPAVQNSKSDVTPRFGVGY
                     GLPVPSILVNSYNQAAPEERSVPSPPLSPKIAPVSYNGPKVTLPSIAGLISKHPLDEE
                     EAIRVRQSWPVGMTVKDYTGNNMRFLSEYSVFKDRSPRYPQTYTSPHSYYHGSLPPVC
                     YGNAMNDANHARFRSPKRILDSQFNRERAFNRTNRKYTAVVRDNNSYSYTSPPTYTTN
                     NSSYVYGGGYQQISSSPARPHIQQQQHKRQHAKTAGQNSSSTANRRFERKANPATIPP
                     LASAAIVSKAPQYVPQISWQQLPDYSPPLSTIPDNKYCMKIEWKGSQMDLSNDPLRDQ
                     LHPAELVLAQILRLPCDLYLDSKRRFFLEKVYRVKNGKTFRRTDAQKACRIDVNKASR
                     LFQAFEKIGWLDDKYFKGVV"
     gene            complement(<656942..>657886)
                     /gene="TPHA0H02790"
                     /locus_tag="TPHA_0H02790"
                     /db_xref="GeneID:11534194"
     mRNA            complement(<656942..>657886)
                     /gene="TPHA0H02790"
                     /locus_tag="TPHA_0H02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686868.1"
                     /db_xref="GeneID:11534194"
     CDS             complement(656942..657886)
                     /gene="TPHA0H02790"
                     /locus_tag="TPHA_0H02790"
                     /inference="similar to DNA sequence:INSDC:YOR340C"
                     /note="similar to Saccharomyces cerevisiae RPA43
                     (YOR340C); ancestral locus Anc_7.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686916.1"
                     /db_xref="GeneID:11534194"
                     /db_xref="GOA:G8BWN1"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:G8BWN1"
                     /translation="MSKRSADSSAVAKFIKKHKNSIPNPVDYESGISNCILRVPISLY
                     VSVAPIYANNPAQGVMKQHLNPMVMKYNPKVNGVVLGYQNVRILDSDPSNPPDSHEKL
                     IKITADTPFGFCWCNCDMFVWQPQVGDIIEGWCFIQSVSHIGLLIHDAFNASINKNYI
                     PDDWTFIQNEEHFDDWDETEEGETENTSNEAGTTKHNTSMGHWVDGNGENIDGKLKFK
                     IRNVFTKGRVISIDGTLLTDNYENGDASVNNLNGVSSEIENLPVVSNKKIIFDEEVSA
                     ENTESHKDLELPEVKDSGEQLVYEENSSGSDEDSSDSD"
     gene            <659254..>664200
                     /gene="TPHA0H02800"
                     /locus_tag="TPHA_0H02800"
                     /db_xref="GeneID:11534195"
     mRNA            <659254..>664200
                     /gene="TPHA0H02800"
                     /locus_tag="TPHA_0H02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686869.1"
                     /db_xref="GeneID:11534195"
     CDS             659254..664200
                     /gene="TPHA0H02800"
                     /locus_tag="TPHA_0H02800"
                     /inference="similar to DNA sequence:INSDC:YOR341W"
                     /note="similar to Saccharomyces cerevisiae RPA190
                     (YOR341W); ancestral locus Anc_7.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686917.1"
                     /db_xref="GeneID:11534195"
                     /db_xref="GOA:G8BWN2"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015699"
                     /db_xref="UniProtKB/TrEMBL:G8BWN2"
                     /translation="MDISKPVGSEITSVDFSILSAEEIRNLSTKQITNPTVLDNLGHP
                     ISGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSC
                     LFCHHFRLRSVEVHRYTCKLKLLQYGLIEESYQIDNLTIGGLDESITDAEEAEEDNAL
                     DGEQSSRIKNFADSYVKEIKIKRNEFVEMAIAKALSEGKTSVRGTFTAIINDERKKLV
                     HDFYKKLLARPKCDNCGMFSPKFRKDGFTKIFETALSDKQLTNNRVRGFVRQDMIKKQ
                     EQAKKLNGEETTEENFEVGRNPSRKTKTGSTYILSTEVRNILRAVFKTEQQVLQYVFH
                     ARPNLTGKIVKADDFFMDVVLVPPTRFRLPSKLGDEVHENSQNQLLSKILTTSLLIRD
                     LNDEISKLQKDKVALDDRRIIFSRLMNAFVTIQNDVNSFIDSSKAQGNNSGKLPVPGV
                     KQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSY
                     NIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHT
                     LNKKVYRHIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDG
                     DEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFT
                     REQYQQYIYGCIRPEDGHSANNKLLTIPPAIIKPVPLWTGKQIITTVLLNVSPVDMPG
                     INLKSKNKIKDEYWGQHSEENEVLFKDGALLCGILDKSQYGASKYGIVHALQEVYGPE
                     VAAKVLSVLGRLFTNYITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVT
                     NLEKDTSADDSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRF
                     PENSMQSMALSGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMA
                     GGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDN
                     TVRDGDGTLIEFLYGGDAVDVTKESYMNQFDFCLDNYDSLLKRYNPAALIDFLDVDSA
                     LKYSKKTLKHRKKNKNVPHYLQNIKYDPVLAKYNPAKYLGSVSEKFQDKLENFLDSNS
                     QLFKSHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGH
                     GAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIFAKSISKVILSEVID
                     SVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNVVANNFLTSLEIAIHKEI
                     KKQKKTTASDVGIAIPKAQLALAAVEGLSSKVMEDNDEEQSRKKTKQAVSYDEPDEDE
                     IETMREAEKSSDEDAMGSDKDSDSSDDESESDEEIEKETTPIKTLNKSQRDRQSAIIS
                     NHKFVTKYNFDDETGRWCEFRLELAADTEKLLMVNIVEDVCRKSVVRQVPNIDRCVHP
                     NAENGKRVLVTEGVNFQAMWEQNDFVNVDGITSNDVSSVLKTYGVEAARNTIVNEINN
                     VFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLMKMSYETTCQFLTKAV
                     LDNEREELNSPSARIVLGKLNNVGTGAFDVLAKASHAN"
     gene            complement(<664582..>665592)
                     /gene="TPHA0H02810"
                     /locus_tag="TPHA_0H02810"
                     /db_xref="GeneID:11534164"
     mRNA            complement(<664582..>665592)
                     /gene="TPHA0H02810"
                     /locus_tag="TPHA_0H02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686870.1"
                     /db_xref="GeneID:11534164"
     CDS             complement(664582..665592)
                     /gene="TPHA0H02810"
                     /locus_tag="TPHA_0H02810"
                     /inference="similar to DNA sequence:INSDC:YAL037W,YOR342C"
                     /note="similar to Saccharomyces cerevisiae YAL037W and
                     YOR342C; ancestral locus Anc_7.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686918.1"
                     /db_xref="GeneID:11534164"
                     /db_xref="UniProtKB/TrEMBL:G8BWN3"
                     /translation="MDFNENYHLSQQQVCLDRLDNQVFFSSVSSLLHNPNLITENNIR
                     YLFTTGISINDFIATIYNNDNELLKNIANNLCIINLDTLDSVAGQQFQYSYSDDVQAF
                     KRHHTQKLQDIISYLVNDIEQRVNGKMNNNTDDNSINRYLSPIPDKVNLSSILYGDVS
                     YYYGSNEFNDSDINRFKTFNDLLTILKTYNQREKALIISQDGNDYNMIAYLISTVLKL
                     NPSYNIYEALRHLKCLTENFEELNNERIIWYSGLLSYYELIRANELYWGNVNVNSLNS
                     TKTNMNFANANTCATNSRSSSISPNKRRDSNNIATAITQPTPVTQSSPILSSNKRSRL
                     ID"
     gene            668550..668622
                     /gene="TPHA0Htrna4M"
                     /locus_tag="TPHA_0Htrna4M"
                     /db_xref="GeneID:11534165"
     tRNA            668550..668622
                     /gene="TPHA0Htrna4M"
                     /locus_tag="TPHA_0Htrna4M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11534165"
     gene            complement(<668773..>669828)
                     /gene="TPHA0H02820"
                     /locus_tag="TPHA_0H02820"
                     /db_xref="GeneID:11534198"
     mRNA            complement(<668773..>669828)
                     /gene="TPHA0H02820"
                     /locus_tag="TPHA_0H02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686871.1"
                     /db_xref="GeneID:11534198"
     CDS             complement(668773..669828)
                     /gene="TPHA0H02820"
                     /locus_tag="TPHA_0H02820"
                     /inference="similar to DNA sequence:INSDC:YOR344C"
                     /note="similar to Saccharomyces cerevisiae TYE7 (YOR344C);
                     ancestral locus Anc_7.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686919.1"
                     /db_xref="GeneID:11534198"
                     /db_xref="GOA:G8BWN4"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8BWN4"
                     /translation="MPIHSNANNSEDKVSNGDPILTFDEWMLSNSETDLTNTKFNTQD
                     INNNGTIDENRIRKTQSSNNVPSGNLKSVNVVDSSSFNSSSGSWFEPLENILSPDVSS
                     NSSKNSTPKGVKNGESNSNNNNSNRMFNRMNANSFYQNSNNYNNIEEFASSLNNDLNP
                     RIKRENEPQPFSPGLPAFPLVNYEISQKYLENMNNHNDSNNNNNNNDNNNIQQISAIR
                     ENTEKRKYARKKLTDHQKEAHNKIEKRYRNNINTKITQLQQIIPWVASEQTSFVADEY
                     NEDNVSQDNLNNIQFAQMNDITGGETPRLNKSMILEKAVDYILYLQNNERLYELEVQR
                     LKMEVDSLKRRLNNNAQ"
     gene            <670361..>673132
                     /gene="TPHA0H02830"
                     /locus_tag="TPHA_0H02830"
                     /db_xref="GeneID:11534065"
     mRNA            <670361..>673132
                     /gene="TPHA0H02830"
                     /locus_tag="TPHA_0H02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686872.1"
                     /db_xref="GeneID:11534065"
     CDS             670361..673132
                     /gene="TPHA0H02830"
                     /locus_tag="TPHA_0H02830"
                     /inference="similar to DNA sequence:INSDC:YOR346W"
                     /note="similar to Saccharomyces cerevisiae REV1 (YOR346W);
                     ancestral locus Anc_7.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686920.1"
                     /db_xref="GeneID:11534065"
                     /db_xref="GOA:G8BWN5"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012112"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:G8BWN5"
                     /translation="MAHFTDDVVGNVENFHEDFISSLDDESLIRYVEELSQENIRPAG
                     SQHLDDLLIDDKIKNVTNLNFSEKNKIAKVEEQVHSDDRSSNSNIVKTAHYGRGQYFR
                     DKEFKQLQQDQKLVQENQDKIKIFKNCVIYINGYTDPDRLVLHKLIVIHGGKFLHHMT
                     SKGRVTHIVATNLPLKKRVEFAKYKVITPEWILDSVKAEVLQPWQEYSLLETNDYRQP
                     KLDLANRTNKNDNYSEMNIDCNSPLFVENYFKNSRLHHLSLWKSDLRDQFLKKYRDNK
                     ILQRSIPKQNDQLTILHIDFDSFFASVATLVAIRDRNLNINLKKDAILVCHGSNNSDI
                     ASCNYVARNLGIKNGMWVSHAKKLCPPGTVLTCLPYNFQEFEAASKILYNCLNNSGLF
                     DMVLPVSIDEAICVMVNRNYSKNEVEDICKTVRSNIEAEARGCKISIGCANSLVLARL
                     ALKLAKPDGYHILDQDEFNNNSSNSNLKFWSQFKINDLPGIGYSIVQKLSDYFGLKKG
                     ATVEQLIKVSTMEKLKLCTGSKVSSKISLAISGKDDEESSKLLFQPLELFQRKTLSME
                     INWGIRFENIQQVDVFISRCVEYLLKKLQELQKSVAQITLKIMKRAAGAMVDPPKYMG
                     MGKCDAFSRSSNFGIGATDHGTISTELKNLFRTLSCPPKELRGVSIQFTKLTDLAENI
                     NQYKLPFKKVISLQTVNNLPSDLKLKFETEIKRRNIEIKQTNKSPSSKVLIPKNVLKK
                     YSPTKQEEDFLKELPTQIRNEVASNLIIEKKIKDSKVEDLHLMVQTKKNLIENSKDHF
                     QGNNSIFQPISFQGQTSFKKICKLVREWVSTTLLEKGPHKRDTKLFKKYLLKLSNSNR
                     LFLILQLIKLVSQILTLNRIKANGIDGSINVGFMEWEKILLKEMIPILNKSGNSFQSK
                     QKLEFEFDI"
     gene            complement(<673323..>674828)
                     /gene="TPHA0H02840"
                     /locus_tag="TPHA_0H02840"
                     /db_xref="GeneID:11534066"
     mRNA            complement(<673323..>674828)
                     /gene="TPHA0H02840"
                     /locus_tag="TPHA_0H02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686873.1"
                     /db_xref="GeneID:11534066"
     CDS             complement(673323..674828)
                     /gene="TPHA0H02840"
                     /locus_tag="TPHA_0H02840"
                     /inference="similar to DNA sequence:INSDC:YAL038W,YOR347C"
                     /note="similar to Saccharomyces cerevisiae CDC19 (YAL038W)
                     and PYK2 (YOR347C); ancestral locus Anc_7.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686921.1"
                     /db_xref="GeneID:11534066"
                     /db_xref="GOA:G8BWN6"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:G8BWN6"
                     /translation="MASRLERLTQLSTDTGKNVRRTSIIGTIGPKTNSPEALVALRKA
                     GLNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTINEVDY
                     PIPPNHEMIFSTDDKFAKACDDKVMFVDYKNITKVISKGRVIYVDDGVLSFEVLEVID
                     DKNLKVKSLNAGKICSHKGVNLPGTDVDLPALSEKDTADLRFGVKNGVHMIFASFIRT
                     AEDVLHIRSVLGEDGKDIKIIVKIENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPE
                     VLAVQKRLIAKCNLAGKPVVCATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSG
                     ETAKGNYPINAVTTMAQTALMAENATAYLPNYDDIRNLTPKPTSTTETVAASAVAAVF
                     EQNAKAIIVLSTSGTTARLLSKYRPDCPIILVTRNERAARFSHLYRGVYPFVYSKPEV
                     ADWTEDVESRLNFGVKVAKEFGVLADGDVIVTVQGFKAGEGHSNTMRVTTA"
     gene            complement(<676524..>678329)
                     /gene="TPHA0H02850"
                     /locus_tag="TPHA_0H02850"
                     /db_xref="GeneID:11533861"
     mRNA            complement(<676524..>678329)
                     /gene="TPHA0H02850"
                     /locus_tag="TPHA_0H02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686874.1"
                     /db_xref="GeneID:11533861"
     CDS             complement(676524..678329)
                     /gene="TPHA0H02850"
                     /locus_tag="TPHA_0H02850"
                     /inference="similar to DNA sequence:INSDC:YOR348C"
                     /note="similar to Saccharomyces cerevisiae PUT4 (YOR348C);
                     ancestral locus Anc_7.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686922.1"
                     /db_xref="GeneID:11533861"
                     /db_xref="GOA:G8BWN7"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8BWN7"
                     /translation="MANNRGQVTYNYELEDIPSSKNELKELGDMEAQQMNLDDSLDDR
                     FNKKDSGLNKVLTVSSDTSTNSLEEDYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTS
                     STLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDES
                     LAFATGWNYFYCYVILVAAECTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKY
                     FGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVTDGSLG
                     NFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLA
                     IGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSGNA
                     FMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFT
                     WLSNISTISGFLGWICACIAYLRFRKAIFYNNLYDRMPFKTWGQPYLILWSLTVVSII
                     TITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDI
                     DVITGLDEIETKTCELDENRILPTNRWERFIDWLL"
     gene            <679148..>679609
                     /gene="TPHA0H02860"
                     /locus_tag="TPHA_0H02860"
                     /db_xref="GeneID:11533862"
     mRNA            <679148..>679609
                     /gene="TPHA0H02860"
                     /locus_tag="TPHA_0H02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686875.1"
                     /db_xref="GeneID:11533862"
     CDS             679148..679609
                     /gene="TPHA0H02860"
                     /locus_tag="TPHA_0H02860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686923.1"
                     /db_xref="GeneID:11533862"
                     /db_xref="UniProtKB/TrEMBL:G8BWN8"
                     /translation="MTPKKECGHMFSFLFFSFFCPFPLEDYGCSRGFRKRKTMTNPKM
                     ELATRRDSIRRATGRGVILFIIRREQMDREGNRAILDVCFMYSTPNCPVVEIIQFGTK
                     RTEAAEPHSLIERRARNIDCYMMYLWRSLTPTVLPSVAEGEGGVLSWRRSR"
     gene            <680144..>683509
                     /gene="TPHA0H02870"
                     /locus_tag="TPHA_0H02870"
                     /db_xref="GeneID:11534041"
     mRNA            <680144..>683509
                     /gene="TPHA0H02870"
                     /locus_tag="TPHA_0H02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686876.1"
                     /db_xref="GeneID:11534041"
     CDS             680144..683509
                     /gene="TPHA0H02870"
                     /locus_tag="TPHA_0H02870"
                     /inference="similar to DNA sequence:INSDC:YOR349W"
                     /note="similar to Saccharomyces cerevisiae CIN1 (YOR349W);
                     ancestral locus Anc_7.43"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686924.1"
                     /db_xref="GeneID:11534041"
                     /db_xref="UniProtKB/TrEMBL:G8BWN9"
                     /translation="MTTDESKQLSDFIGLSSGLDTEELLDALQEYCSRDNIIQKESDI
                     IKIINKFENDPSLLTRHLSTIIKSLVELVLPSGVDADGDSLDLIVTIGNVYYELYKIV
                     STRNLGNYLPTEISNLAEIINLYQINRENLITGHVPYSWKLDFFLLSWLNVLVESPFR
                     FTNDKVILALMMQDGFHESESILRFDIINLKSKVTANLIIKNIDLFDKSLLIGNFTLL
                     DFFLKKLIILPTNKILSLISAFKNDIIDLTIFLLNLQVDNENELNRRKLLKIFSKLFK
                     LNYYLNNGELLIRIIKKFERIMFDLKLLNSGDFRYTLSNKYSNVIHFLNYEIKNTKMV
                     NQIINGKINKTVKMLDSLELIDTDILHLTLLFIADNISIILTNNIVDIDFLFSKIFIK
                     TINFQKLEINNNNTIIVGGNNIKDATNFILWSILRSNSKIITKKTIDLIFIHLLTSSL
                     YDNELIIRKSSNAALQELLGRFNKHLDLDSSRIMRIIELPITNLNVNYEENTVKLYKN
                     IFDEDISRHYWYKILEWMVSFNISKKIKILKTFLLNLNLINNFISLSNYNNTYEKNIY
                     HRIIQEKHNYDLERLLFLLINYYSKLEHNTTHKENLLTQINKIFHDLSDTLELKKYSA
                     NSPFISFRVLSILEYFKFMIELTLSNINNSSSYPISFQLKMDDISLIIKILQTINDSS
                     MFFDDIKLKVNYIVSKIEKGSQIYKDTETEEYFWSNFEKLLFYNNAFASFSLPYLHYK
                     YFLQLFLKCLQKLNCNSKSIILHSLTPLFSERYFELNTISDQILLKRIIINLLNDYTI
                     TEQGDIGRLVRTSSIKLIECNFSLFFEHADSNEAGELQKTLISNCLRLLGEPQLEIKQ
                     LAFKVLKKKFGYTKETTNSIDFDILLFQHKQFEGKSRAFWEGFLMTSGAIHTTDIQLK
                     SSVDSFIYYYSTYLETGNRKKGITKLELCNELFRIIPNASKIIESKKESCVDPLTGSV
                     GQDILKITTSYLYFWSRVLESSLEIPREFNYAGAYGKLYNLQILKGSSLLKSITIKIL
                     PYFVISHSSHFGTDLSNSFTKTVILRLLKLINREIMIKKDSHINGSPTYRASVEGLAK
                     IYIYFNNFSKLSLLEQITNDVGKFNKLEEKEFL"
     gene            complement(<683578..>685470)
                     /gene="TPHA0H02880"
                     /locus_tag="TPHA_0H02880"
                     /db_xref="GeneID:11534042"
     mRNA            complement(<683578..>685470)
                     /gene="TPHA0H02880"
                     /locus_tag="TPHA_0H02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686877.1"
                     /db_xref="GeneID:11534042"
     CDS             complement(683578..685470)
                     /gene="TPHA0H02880"
                     /locus_tag="TPHA_0H02880"
                     /inference="similar to DNA sequence:INSDC:YOR350C"
                     /note="similar to Saccharomyces cerevisiae MNE1 (YOR350C);
                     ancestral locus Anc_7.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686925.1"
                     /db_xref="GeneID:11534042"
                     /db_xref="InterPro:IPR025694"
                     /db_xref="UniProtKB/TrEMBL:G8BWP0"
                     /translation="MVIRNKTNIASDIIGITNRVLNISKNNAPSPVSYINQNININNV
                     DKNTDIWIKNCLSTKIKHAKNDSITLLIPKVLQKLQHLRTSDHNDSYFRLLAKLKATD
                     INWVTRNNNSIGTSVYLPIEFYNELSIMLKKLASKDVDYTTKMALAKYSLKMIKTYNT
                     IISDRCISNNYRFYRDCITCICNTESVLLLHETIRYFKEKNLPEFLTHYANLTFYHKT
                     SEITKLLEYLEFYIYHEKFKITADQRDLLEPIFLNVIKKLTLLNAEEESIILLKYMKK
                     WSININDHDKSVLLDLCEKKGSFKLKKEIVSFDSMDNSQNLIIDWKILQSSDSVEKIM
                     IDLNNRNINPFNSAGEYTFLQLCFNDRDQNIEFWNQYITRNIVASTLSTPLKVLYLQS
                     LLSYLVSSGMKFQDVLSILNYLSVDLRSNELFLLTTNLKGMEKSTSFNILFKLLERRP
                     SAKLTSQTLLGFLEKYHNELNYTISCSNYISLFKTALSNNDTETIYYFLLKYLILEGD
                     TLYLNDAEKSWKLPDEIEMFFRSNEIPKEAIKFLDKIHLYANNSKKENEFSEATVLGE
                     FGNKGIYPLTEENIRSNNYRSIMMNEDNELYFSSYHSYYYTDDKKLDTKLKSFLSNLT
                     PLQSKL"
     gene            <692491..>694128
                     /gene="TPHA0H02890"
                     /locus_tag="TPHA_0H02890"
                     /db_xref="GeneID:11533744"
     mRNA            <692491..>694128
                     /gene="TPHA0H02890"
                     /locus_tag="TPHA_0H02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686878.1"
                     /db_xref="GeneID:11533744"
     CDS             692491..694128
                     /gene="TPHA0H02890"
                     /locus_tag="TPHA_0H02890"
                     /inference="similar to DNA sequence:INSDC:YAL040C"
                     /note="similar to Saccharomyces cerevisiae CLN3 (YAL040C);
                     ancestral locus Anc_7.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686926.1"
                     /db_xref="GeneID:11533744"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G8BWP1"
                     /translation="MSHTISNKNDRMLNTSQRGISHLAYFSHVRRNVTKVKSQNPNLL
                     KREYENHTQSVMEYSGSLLNHLIQVEENQTGVRPNLASFNAQPQINEKMRILIVDFLM
                     CCHVRLKLCSSTLFLALDILNRYSSKFILKCNDYQLIALTALWLSSKYWDSKNRIPNL
                     NVLTSLCCNQYTATQFKEIEWHLLSCLDWSILNNPTPDYFIDLLLLLKNNKNYSPLAL
                     QHGITNIDEIRAGALLLSELAAFDMKLSYKYNSSAIALAAITVSALALKFYDTNNWEN
                     YRLETSDSNLIKICDEILKLAINNESIPSSFQFKYLSDSASPSNIVSKKLMESFSNYH
                     VELQMSELYNSKEFQILTNSQIDNIANYDDFNQINEYQSNMHKYNDIADVNQINNNQF
                     YFSDDNEENEKTNTSNNSTNISNNFASSPDIFLSSNNDAVNGTDKDFLANSLFQPFFL
                     LPLTPTTPTLFQVDGKSQFPPNIDISRRPTISKPALANTNSRYTRKKSTPTGFPSSST
                     GTAKNRPFLKTHYKRSSSTMDIDFFSSEMDLKKTHSR"
     gene            <694616..>696172
                     /gene="TPHA0H02900"
                     /locus_tag="TPHA_0H02900"
                     /db_xref="GeneID:11533745"
     mRNA            <694616..>696172
                     /gene="TPHA0H02900"
                     /locus_tag="TPHA_0H02900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686879.1"
                     /db_xref="GeneID:11533745"
     CDS             694616..696172
                     /gene="TPHA0H02900"
                     /locus_tag="TPHA_0H02900"
                     /note="ancestral locus Anc_7.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686927.1"
                     /db_xref="GeneID:11533745"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:G8BWP2"
                     /translation="MKREINTTQPGDFKKAVSLDSKITATYNGYYPEDYKTSIDVIDV
                     PNTEKEKLNFFDKYVLRRKPCKIIGVSSEGFPLKELQFENIKNTLNENEILQIEKKAN
                     GGFGSGNKRLKLKFGEFIDEITKNQQTDLYLTTQYYEDDPENGNYSSDEEEKDQIIDE
                     KFNTNFSDNESLVNLNDLHDDFDELEQCNGNSEDEENVEDQIIEDQLRLKELYQPPMT
                     NLVKTLPETPDFLDYLIPQQINLWVGATSKQDNINFTESFKPDSSDKWMGLGRNIPGD
                     GSSSGLHHDHADNLYIPIDGYKRFTLFSPGDAAKMYLVGDIKRVFNSGLIDYIHNEKA
                     PFWRELRADGAIVAETYKKILNDKSIELDDKQKNEYEDFVRKDFLASTELTDKGTLNT
                     DPASFSTIPPSFIHLDEIENEVTKKAMDELIDKKWPLFKKANRIEVNVKPGEMLYLPT
                     GWFHEVTSYGADNKKIKNKNNVHVSVNYWFIPPDGNSIENIYANADNYWPTDYKRTKE
                     ALKRIREAVK"
     gene            <698822..>700351
                     /gene="TPHA0H02910"
                     /locus_tag="TPHA_0H02910"
                     /db_xref="GeneID:11533859"
     mRNA            <698822..>700351
                     /gene="TPHA0H02910"
                     /locus_tag="TPHA_0H02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686880.1"
                     /db_xref="GeneID:11533859"
     CDS             698822..700351
                     /gene="TPHA0H02910"
                     /locus_tag="TPHA_0H02910"
                     /inference="similar to DNA sequence:INSDC:YOR355W"
                     /note="similar to Saccharomyces cerevisiae GDS1 (YOR355W);
                     ancestral locus Anc_7.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686928.1"
                     /db_xref="GeneID:11533859"
                     /db_xref="UniProtKB/TrEMBL:G8BWP3"
                     /translation="MALTNSRPFQLPTSSDDNEILLNNTSPVFQASALGFNSHMDPLT
                     ATAADVFPVPTQDNGINSGSSQKGKASSNNSAKDGKIKKEPKEKDSLSIVFSKIIPVT
                     DERPMPTDRSSPLDDEVLHRVFIILWEKDPDQKGMTVKQLCDHLLEKNPEMSNLSTKL
                     SNLISAKLNAYVKKIEKGEKTLTYALFRDWSDSSPRRMLYVYKGILRSDYKEHAQAAL
                     AKIRQQQQLEEKLNPKDDDKKLASRKDSKKNSKAENKKVMKNDDKILGSLSSVNGEIN
                     SNQFLVDQNNVSFGQKISMANNINFTLSNDFNIPYSTSPVSANLTPRGPARLNSPMVS
                     PSSTVTSNQSPKKNSVYNKKRPSVSDDLEKGGKGDNKKQKVVNSKLNNEQSVSNSNSN
                     GISTMNGSPVPYITAAAAAPKLSKYSTKDGFKSNSASSIGFLSAIQKVITTQTPIEPS
                     SDSSRQSSNCSTGPSTPGGGTNNSVAISSWVQKVRSGFLIQDIESPETLSLEDLDSFF
                     K"
     gene            complement(<700975..>703335)
                     /gene="TPHA0H02920"
                     /locus_tag="TPHA_0H02920"
                     /db_xref="GeneID:11533860"
     mRNA            complement(<700975..>703335)
                     /gene="TPHA0H02920"
                     /locus_tag="TPHA_0H02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686881.1"
                     /db_xref="GeneID:11533860"
     CDS             complement(700975..703335)
                     /gene="TPHA0H02920"
                     /locus_tag="TPHA_0H02920"
                     /inference="similar to DNA sequence:INSDC:YAL041W"
                     /note="similar to Saccharomyces cerevisiae CDC24
                     (YAL041W); ancestral locus Anc_7.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686929.1"
                     /db_xref="GeneID:11533860"
                     /db_xref="GOA:G8BWP4"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001331"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010481"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BWP4"
                     /translation="MSSTSRVPSSTVIMSNVMNTNVTAQDSLYHICITIKRRLEALPQ
                     LKPYLNLAYSSSELLCERQSLLLSQKQQQKKDNGHASIQSNSSIGGDSSASNGNSTSN
                     GTAVSANGRTSLSSTLSTKDDMFMDSTINTSSGLSRSTTLNTTNTTGSNNNIEDTLLT
                     FSMGILPITENCDPVTQLSQLFQQGSPLCIIFNAVQSQVKLPVVSSDDLKICKKSIYD
                     FILGCKQQLAFNDEELFTISDVFANTTGQLMKVLDVVETLIDSAPNVFPSAKHILAEE
                     TKKLNEEMASQKASKNNESYNKIMKEFVATERKYVNDLEILDVYRQQLLDSNSITSEE
                     LYMLFPNLSETIDFQRRFLVSLEINAKVEPTKQRIGALFMHSKFFFKLYEPWSIGQNA
                     AIDFLSNNLDRFQDTEFVIKTKLELQSFLYKPVQRLCRYPLLLKELLQRSQSNTNIKE
                     LEMALEIAKGIARSINDNQRRTENHEVVKKLYGRVVNWKGYRIAKFGELLYFDKVSIS
                     TSNSSESEKEFEVYLFEKIIILFSEVSQKKPASLSLKKKTTASSLSLNLNNSHSTNST
                     SSFMNEPKLDLRGRILIMNLNTINAEGSRSLDITWESPKEQGNFILKFKNEEIRDNWS
                     SCLQELVRNIRTESFRNSSSHENRTSLQSPTLVRDTHNSIMSVGSSQIKRVSDLLPKN
                     SSSFGQEYRSVSDNYKSSIPESALLIRIAYNSDFYTILIELDATISELLQTIKRKLSH
                     SGVITKIKYQDEDGDYVILESEDDWIVAKEMLRENNDQILNVCAFN"
     gene            complement(<704515..>705834)
                     /gene="TPHA0H02930"
                     /locus_tag="TPHA_0H02930"
                     /db_xref="GeneID:11533755"
     mRNA            complement(<704515..>705834)
                     /gene="TPHA0H02930"
                     /locus_tag="TPHA_0H02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686882.1"
                     /db_xref="GeneID:11533755"
     CDS             complement(704515..705834)
                     /gene="TPHA0H02930"
                     /locus_tag="TPHA_0H02930"
                     /inference="similar to DNA sequence:INSDC:YAL042W"
                     /note="similar to Saccharomyces cerevisiae ERV46
                     (YAL042W); ancestral locus Anc_7.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686930.1"
                     /db_xref="GeneID:11533755"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:G8BWP5"
                     /translation="MSSKKREDNLLAYDVFTKVEEDIRIRTRTGGLITLICIGVTFLL
                     LISEWFQFKKVISKPELVIDRDYQSKLELNIDVTFPYIPCDLLNLDILDDSGNVQLDI
                     DLEEASSNFVKTRLNNRGEVIGKAKKFKITDDLGEYAPEDKENYCGSCYGSKDQTKNE
                     DIEKITDKVCCNSCEDVRQAYSEAGWAFFDGKNIEQCEREGYVKTINERLSEGCRVKG
                     EALLNKIHGNLHFAPGKAFQNRRGHFHDTSLFNQHKNLNFQHVINHLSFGKPIRQLVT
                     SNFQDTMSDSLRAQTAPIDGHQAFIQDNTGDSDSASTTIAAHDYQFIYYAEIISTRFE
                     YLKGDLEETSQLTVTSHYKKIGYQNGQDYMQGMQSRSGIPGLYIDFEVSPLKVINKEQ
                     YSTSWSGYLLKTITSIGGILAVGTVIDKVVYATQTALKQASIVKARK"
     gene            <707213..>708973
                     /gene="TPHA0H02940"
                     /locus_tag="TPHA_0H02940"
                     /db_xref="GeneID:11533834"
     mRNA            <707213..>708973
                     /gene="TPHA0H02940"
                     /locus_tag="TPHA_0H02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686883.1"
                     /db_xref="GeneID:11533834"
     CDS             707213..708973
                     /gene="TPHA0H02940"
                     /locus_tag="TPHA_0H02940"
                     /inference="similar to DNA sequence:INSDC:YOR359W"
                     /note="similar to Saccharomyces cerevisiae VTS1 (YOR359W);
                     ancestral locus Anc_7.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686931.1"
                     /db_xref="GeneID:11533834"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:G8BWP6"
                     /translation="MHNMGYDYDEFPSSNQSPFNNTTQNINRSAHPGAVLLVSPNTSS
                     ASQNTSNILNDGINVPQNGNLSGQHNGGLPITDFLDQQRSIFTDPSNTVPNSIVGFSN
                     QSNGSSLMNNNVAVSPSLNNIPLMSHSQHNSAGSELVSPTPYYLDVNDSKSNVEQSNS
                     NLNFLQSAGNGSSCQDSQAISFNQNINGLSSWVPQLSSLQQNILMSSLFPLLHEDVLA
                     STKLKLDNMLATYDQTTFKNQAHIIHINNFTNETNSKDIMGMSSPNMSRGSSPLMREN
                     TYPLSNMSDLFTSGSTPSPNANNDNISVSSMRFKNNANIFNQWSNSTFKNNLMGDLGS
                     EFQRPKSVDPYVIQAINNKSSGSLYNKKLYTNSGNVNGTTIPNSINKNQANAHNNNIQ
                     NNFHGNNNMTAGVMSRNKSANDHDVKSKYPSPYYSESKSSQWNSRSNTSFQMDNNYVP
                     YGNAKQNTSSINSSSNAQANTNAFGNHNNSSMNPKSLTDPKLLSNIPLWLKSLRLHKY
                     SEALKNIKWTDLIVLNDLQLEELGITALGARRKLLKAFLVVLDYQEKGLIPTAAYTDT
                     DETLNPNSNQKNLWNHRFTK"
     gene            complement(<709212..>710831)
                     /gene="TPHA0H02950"
                     /locus_tag="TPHA_0H02950"
                     /db_xref="GeneID:11533740"
     mRNA            complement(<709212..>710831)
                     /gene="TPHA0H02950"
                     /locus_tag="TPHA_0H02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686884.1"
                     /db_xref="GeneID:11533740"
     CDS             complement(709212..710831)
                     /gene="TPHA0H02950"
                     /locus_tag="TPHA_0H02950"
                     /inference="similar to DNA sequence:INSDC:YOR360C"
                     /note="similar to Saccharomyces cerevisiae PDE2 (YOR360C);
                     ancestral locus Anc_7.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686932.1"
                     /db_xref="GeneID:11533740"
                     /db_xref="GOA:G8BWP7"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:G8BWP7"
                     /translation="MISKVFYISDLKGNSGNGCVGNVKKLLDDNELSKLFDDNIEEFK
                     SFQEFFTRIYNDRVNDSIETNFENGVYLIIVNNAESVNIRQFNSTIRSFFPTLNLLAF
                     NYSEFIGFTSDIALWQQLKDDIKVVNNKIKRAKYWMYHTDGFKNSEHTNCSSNIYSMW
                     SHFNSVDASHKRISGNGNATHIPEYLRSIDFKKIITSRLKYTDDEEKYISIVSNWSFA
                     INELNSSELIYCSYLIIKLSINQLMQNTVKINENDIFLFLFSIEASYHKVNKFHNFKH
                     AVDVMQATWKLSQYLLPNDKKYSLTVLLLCFAAIGHDMAHPGTNNNIFIKYNTELSSY
                     YNNESILENFHLFLFNNLLNEQRNCILPITDNNNVIKEAIMATDMAKHKHYVKKLDNL
                     VITENAQVDLSEPQLHDMISFIIKAADISNVTRPLRISAQWAYLISLEFKECELLENY
                     INNGKDDIIDKLSNDADDNIMIRENLVLSTDQLIKRNPHLSKSQIFFIDVFAEEFFNK
                     LTKKFPILSFLTDNIVFNKNYWLKHSDEVND"
     gene            complement(<711521..>711904)
                     /gene="TPHA0H02960"
                     /locus_tag="TPHA_0H02960"
                     /db_xref="GeneID:11533741"
     mRNA            complement(<711521..>711904)
                     /gene="TPHA0H02960"
                     /locus_tag="TPHA_0H02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686885.1"
                     /db_xref="GeneID:11533741"
     CDS             complement(711521..711904)
                     /gene="TPHA0H02960"
                     /locus_tag="TPHA_0H02960"
                     /inference="similar to DNA sequence:INSDC:YAL044W-A"
                     /note="similar to Saccharomyces cerevisiae YAL044W-A;
                     ancestral locus Anc_7.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686933.1"
                     /db_xref="GeneID:11533741"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:G8BWP8"
                     /translation="MLRRTIMSSNLNKSGIVDVPRNRSITGPIANEIKSKIYEGINGI
                     DIFEIANESYKHAGHYQVKISGTNEYESHFKLMIISNEFDGMTLMKRHRRVFTILKDT
                     IDKIHSIQIDARTVPEHRKLQAKST"
     gene            <712252..>712536
                     /gene="TPHA0H02970"
                     /locus_tag="TPHA_0H02970"
                     /db_xref="GeneID:11533693"
     mRNA            <712252..>712536
                     /gene="TPHA0H02970"
                     /locus_tag="TPHA_0H02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686886.1"
                     /db_xref="GeneID:11533693"
     CDS             712252..712536
                     /gene="TPHA0H02970"
                     /locus_tag="TPHA_0H02970"
                     /inference="similar to DNA sequence:INSDC:YAL046C"
                     /note="similar to Saccharomyces cerevisiae YAL046C;
                     ancestral locus Anc_7.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686934.1"
                     /db_xref="GeneID:11533693"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:G8BWP9"
                     /translation="MLKYNSVVKQLSKRLYSMSSQEQYIYDKITKQLNPKSLQVADIS
                     GGCGSMFSIQVSSEKFKGLSIVKQHKLVNEILKDDIGKWHGLQLKTSSKV"
     gene            <712882..>715305
                     /gene="TPHA0H02980"
                     /locus_tag="TPHA_0H02980"
                     /db_xref="GeneID:11533694"
     mRNA            <712882..>715305
                     /gene="TPHA0H02980"
                     /locus_tag="TPHA_0H02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686887.1"
                     /db_xref="GeneID:11533694"
     CDS             712882..715305
                     /gene="TPHA0H02980"
                     /locus_tag="TPHA_0H02980"
                     /inference="similar to DNA sequence:INSDC:YAL047C"
                     /note="similar to Saccharomyces cerevisiae SPC72
                     (YAL047C); ancestral locus Anc_7.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686935.1"
                     /db_xref="GeneID:11533694"
                     /db_xref="InterPro:IPR024545"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ0"
                     /translation="MRMEDFSSDTSYSNNHSSALFSAKVSNSSKTHDSVSDINKRPER
                     SMQGVLGLDMATEKYNGDRKVNNVKSRNRDEDQETDSEDDNELDDDETEDVFASESLA
                     NERSSFTVPQLQESLMPWRSSKSDKDKRNSDIQFDLMSPVRYNNIKAAEATNSNRSSL
                     FGINENDLHVTEPTSESSAGIEQLQRDITYYKLKIKTLFELLKQSDKYDHKSSSVDRN
                     SPNSKAKRDSFYNNLLDSISQSNEIEQLKKTIKEQKASLDENESVQANLREKITSVNE
                     MLKLLKQENKETLDYANEYLEHSEQISKNVDELITILIEKLYKISDRRKKTLEKARSI
                     SSSFVMVKMNALISSLRRILDDLKYYQKYFEYHNESTKLDDNAEKKQITFIANSTDIQ
                     LPSHEAEPIDNQVNSAKYIEQIHSGELDSSRIDTRLENAILDIHSEYADFLHGINIKM
                     QDASLVEESLVSKFSKQMSILNRLASQYQILKQQHDEDLKYQNIKLIGLNNELENKEK
                     LIIELQNENDDRSNIVMKYNKLLKTIDDEKKLFKIKENNLNTLNNELEHDLDENRNAN
                     KNLMGIVEQLNHELEHLKLDSSDKFDTMKNNYYNMMQKYNSLNSDYKDLRYENANMIK
                     NYETIQNENYQLKKTLETVETDHNIIIRYESEFNNFKQHLILHLSTIFVTLRKILQPE
                     SIDQSEAKVDVIRRLDSLTQMKPMLKRLDSLYTFVETALESIIDSYSILIKETNQIKE
                     DRKYNSAVDTEMHKTELHDQLELRIDELERKWLSERERRKLDNNASEERILKLEEENK
                     LLREKLYNR"
     gene            <715815..>717776
                     /gene="TPHA0H02990"
                     /locus_tag="TPHA_0H02990"
                     /db_xref="GeneID:11533742"
     mRNA            <715815..>717776
                     /gene="TPHA0H02990"
                     /locus_tag="TPHA_0H02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686888.1"
                     /db_xref="GeneID:11533742"
     CDS             715815..717776
                     /gene="TPHA0H02990"
                     /locus_tag="TPHA_0H02990"
                     /inference="similar to DNA sequence:INSDC:YAL048C"
                     /note="similar to Saccharomyces cerevisiae GEM1 (YAL048C);
                     ancestral locus Anc_7.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686936.1"
                     /db_xref="GeneID:11533742"
                     /db_xref="GOA:G8BWQ1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR020860"
                     /db_xref="InterPro:IPR021181"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ1"
                     /translation="MTKETIRVVLCGDPGVGKSSLIASLAKGKFVEDSEGKFGPVVIP
                     KDFSASPYSPKNTILIDTSDNDTDELYKELKIADVIWLCYCDKESYERISLYWMVTFR
                     SLGLNLPVIVSRTKCDDYEDSTVTTSPYDTKVEDEEFIPILIDFKEVDNCIKVSAKTQ
                     FNINQAFYLCQRSIIYPISPLFDSRLGEFKPQTVSALKRIFLLSDYDQDGYLSDRELS
                     NLQKKCFKKSIDINEMQFIKQTFMTLSNSQLAESHTELYVTGKGITEEGFLFLNKLYV
                     EKGRHETIWGILRAFYYTDSLSIKVEVLYPKLNIPATSSVELSPIGYRFLVNLFLKYD
                     TDNDGGLTQDDLNKLFKCTPGIPHLWLATNFPYSTVVNGRGCITLQGWLAQWSMTTFL
                     DYKITTAYLVYFDFQEDAKIALQITKPRKFRWRNGKYYRSTVNDRKVFNCLLIGKSNC
                     GKTSLLESFLGRPYSEAHLASVIPHICVNSLELKGSKQYYLILQETGVEELAMLENKD
                     KLKNSDVICLMYDSSDPDSFSYLVELFEKYKEQFESLPVILVASKADLDKQQQRCHIQ
                     PDLFAETLFIDHPLHISCNWINSLNELLIKITETALVPIKAIPGLPEEASYSEEDYKQ
                     ASILLASSVGFISLVTFAYIKWQHYYKHS"
     gene            <718160..>718903
                     /gene="TPHA0H03000"
                     /locus_tag="TPHA_0H03000"
                     /db_xref="GeneID:11533743"
     mRNA            <718160..>718903
                     /gene="TPHA0H03000"
                     /locus_tag="TPHA_0H03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686889.1"
                     /db_xref="GeneID:11533743"
     CDS             718160..718903
                     /gene="TPHA0H03000"
                     /locus_tag="TPHA_0H03000"
                     /inference="similar to DNA sequence:INSDC:YAL049C"
                     /note="similar to Saccharomyces cerevisiae YAL049C;
                     ancestral locus Anc_7.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686937.1"
                     /db_xref="GeneID:11533743"
                     /db_xref="GOA:G8BWQ2"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ2"
                     /translation="MASKPPGKCCASGIAHTDEPIGKIEDFLGVQSYVTGEQHINEKV
                     IVIATDIYGLCLKNTKLVADKLAAGGYAVLIPDILFDDPYPTLNASEALPDWLAKHPM
                     DKVDELVIKYVKDLKAEYSPNFIGSIGYCFGAKPAIHLIDTKFALVDACAIAHPSFVS
                     MEELEAIGKNPILISAAENDPIFSEESRHATEAKLKEIGANYVMDLFGGVEHGFAVRG
                     DLSIPAVKYAREKTIVDQLFFFDHYCSKK"
     gene            complement(<719161..>721599)
                     /gene="TPHA0H03010"
                     /locus_tag="TPHA_0H03010"
                     /db_xref="GeneID:11533904"
     mRNA            complement(<719161..>721599)
                     /gene="TPHA0H03010"
                     /locus_tag="TPHA_0H03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686890.1"
                     /db_xref="GeneID:11533904"
     CDS             complement(719161..721599)
                     /gene="TPHA0H03010"
                     /locus_tag="TPHA_0H03010"
                     /inference="similar to DNA sequence:INSDC:YAL053W,YOR365C"
                     /note="similar to Saccharomyces cerevisiae FLC2 (YAL053W)
                     and YOR365C; ancestral locus Anc_7.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686938.1"
                     /db_xref="GeneID:11533904"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ3"
                     /translation="MPSIGLILWHFFLLLSSMTLTDAATSSSSSASSSSSSSSSSSSS
                     SAASTSTSSASSSSKFIKTSSLLTCMEDSKFSASYFDVKFFPNNLTVTFDIDATTTIN
                     ANVILKAQLIAYGLNVFEDTFDLCSINEVAVCPLTSGRIDLASSYTLTDSDLTKQIPS
                     IAYTIPDLDAQVRVLVYAQNDTSFSTPLACVQAILSNGKTVQTKYAAWPIAAITGTGL
                     LTSAFISVIGYTMTAAHIASNSISLFIYFQNLAITSMMGVSRVPPIAAAWTQNFQWSM
                     GIINAKFMQDIFNWYIQATNGVSTVVVANKDILSISVQKRNLQNLVKRAYSVASSSEY
                     SFDNILSDQSLYTTTERNTTEYTSKILVLRGIERVSYLAGIELSNFFLTGVVFTLFFL
                     FCLIVFLIFFKALLEVLTRARIMSESTNFFQYRKNWASIMKGTLFRMTVIAFPQISLL
                     AIWEFTQVDSPAVVVDAAFVFVIFTGLLIYGTVRVILKGRESIKLYKTPAYLLYGDTV
                     FFNRFGFLYSQFNADRYWWLIPLLFYLFFRSLFVAVLQENGKPQALILFIIELAYFVA
                     LCWIRPYLDKRTNIFNIGIHLVNTINALFFMFFSNLFKQPAIVSSVMAIILFIMNAVV
                     ALILLIFTIITCTIALLHRNPDSRYQPMKDDRVSFIPRVEENTYFVNQDSELFEMGKV
                     AMDTNETEKEREARLEKYGNNMGSTRLLFDDDAESTFSKGNNIRVSTFSDSSSAIVQP
                     SSAVMETTNHLSMPHYQNTATNQVSPRRGQNLQRPESSFFLNGGSSNGDISNSSSNLP
                     RSNPFSSKNNNAFL"
     gene            <722242..>722844
                     /gene="TPHA0H03020"
                     /locus_tag="TPHA_0H03020"
                     /db_xref="GeneID:11533905"
     mRNA            <722242..>722844
                     /gene="TPHA0H03020"
                     /locus_tag="TPHA_0H03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686891.1"
                     /db_xref="GeneID:11533905"
     CDS             722242..722844
                     /gene="TPHA0H03020"
                     /locus_tag="TPHA_0H03020"
                     /inference="similar to DNA sequence:INSDC:YOR367W"
                     /note="similar to Saccharomyces cerevisiae SCP1 (YOR367W);
                     ancestral locus Anc_7.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686939.1"
                     /db_xref="GeneID:11533905"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR003096"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ4"
                     /translation="MIVKPEVTSLDEDLRQLRNSKFSFESIDEIRKWIFGVLQEEETS
                     TAMLTLLELLKDGTVLCRLANAIYKADEPSATLITWKESKMPFVQMEQISQFLQFAGE
                     YGVPEDELFQTVDLFEEKDSAIVYQTLKSLSRYANKKHPSTFPVIGPQLATKRPRPPL
                     KQKPKHLQEKYGWSTQEYGYMKGASQATEGVVFGQRRDVT"
     gene            complement(<722981..>723490)
                     /gene="TPHA0H03030"
                     /locus_tag="TPHA_0H03030"
                     /db_xref="GeneID:11534030"
     mRNA            complement(<722981..>723490)
                     /gene="TPHA0H03030"
                     /locus_tag="TPHA_0H03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686892.1"
                     /db_xref="GeneID:11534030"
     CDS             complement(722981..723490)
                     /gene="TPHA0H03030"
                     /locus_tag="TPHA_0H03030"
                     /inference="similar to DNA sequence:INSDC:YAL055W"
                     /note="similar to Saccharomyces cerevisiae PEX22
                     (YAL055W); ancestral locus Anc_7.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686940.1"
                     /db_xref="GeneID:11534030"
                     /db_xref="InterPro:IPR024359"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ5"
                     /translation="MATRGNNRNNGFNLFIKSTCVLVGLGIAGYMWYRNAGNEERDAD
                     EELATNEKKTMMQKHSSIIILSTSLLKDTSIDWNSILENDCVILVMPGLKFDNLANIN
                     KSYKYKIIHCDTMTGIWSCIKHLRLNTLYYIKEELGPDYDDISVDLRNIFTTIRILDV
                     DKDMNMQLT"
     gene            <723980..>725350
                     /gene="TPHA0H03040"
                     /locus_tag="TPHA_0H03040"
                     /db_xref="GeneID:11534031"
     mRNA            <723980..>725350
                     /gene="TPHA0H03040"
                     /locus_tag="TPHA_0H03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686893.1"
                     /db_xref="GeneID:11534031"
     CDS             723980..725350
                     /gene="TPHA0H03040"
                     /locus_tag="TPHA_0H03040"
                     /inference="similar to DNA sequence:INSDC:YOR368W"
                     /note="similar to Saccharomyces cerevisiae RAD17
                     (YOR368W); ancestral locus Anc_7.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686941.1"
                     /db_xref="GeneID:11534031"
                     /db_xref="GOA:G8BWQ6"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ6"
                     /translation="MRIPKGEGAKFSATTVYLEHLTTALSCLVPFGNKDDVLIFIDKD
                     GLSFVRDNNHVIRIQLFLSRELFMSYSFENEIANDQSASEAGAGTHNEQMEDHLKVSV
                     KINHILDSVSIINRNVDDIVECTLFYNGYGTPFVLAFEDSLISERVAYSTYLTKEIDN
                     TGLELDRSQIIFECMVKGDVLYTALKDLKEIGCKECYIYAKSNDNPMENVFALISKSQ
                     LGFSKIKIPSSRSILEKLQVYDGDSTTKRNNEPVIGFFDFNTFDKIRISTKIASKVLF
                     RMDVHGLLSVNILSQTDDVMVSDVRNSKKTSNAADNLFNFDSYTNQKQMQLPKDYPGI
                     VIEICMLEKEAIDSLAQEEIALLMDTNDTTGMSEITKRQTIAVNKLTDQTSPLNHTNG
                     NILGLNGKVDDKFQSIDESSVPVNFIPQHDSNGHDNEGTQDRENRKRKKTETSNSSVN
                     GLPLFF"
     gene            complement(<725563..>725991)
                     /gene="TPHA0H03050"
                     /locus_tag="TPHA_0H03050"
                     /db_xref="GeneID:11533738"
     mRNA            complement(<725563..>725991)
                     /gene="TPHA0H03050"
                     /locus_tag="TPHA_0H03050"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_003686894.1"
                     /db_xref="GeneID:11533738"
     CDS             complement(725563..725991)
                     /gene="TPHA0H03050"
                     /locus_tag="TPHA_0H03050"
                     /inference="similar to DNA sequence:INSDC:YOR369C"
                     /note="similar to Saccharomyces cerevisiae RPS12
                     (YOR369C); ancestral locus Anc_7.11"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_003686942.1"
                     /db_xref="GeneID:11533738"
                     /db_xref="GOA:G8BWQ7"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ7"
                     /translation="MSDVEEVVEVQEEIVEQSGEVTIEDALKVVLRTALIHDGLARGL
                     RESAKALTKGQAQLVVLVSSVTEDNILKLIEGLANDPEHKVPLIKVADAKQLGEWAGL
                     GKVDRDGNVRKVVGASVVVVTNWGAETDERSMILDHFSQQ"
     gene            complement(<727126..>728979)
                     /gene="TPHA0H03060"
                     /locus_tag="TPHA_0H03060"
                     /db_xref="GeneID:11533739"
     mRNA            complement(<727126..>728979)
                     /gene="TPHA0H03060"
                     /locus_tag="TPHA_0H03060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686895.1"
                     /db_xref="GeneID:11533739"
     CDS             complement(727126..728979)
                     /gene="TPHA0H03060"
                     /locus_tag="TPHA_0H03060"
                     /inference="similar to DNA sequence:INSDC:YOR370C"
                     /note="similar to Saccharomyces cerevisiae MRS6 (YOR370C);
                     ancestral locus Anc_7.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686943.1"
                     /db_xref="GeneID:11533739"
                     /db_xref="GOA:G8BWQ8"
                     /db_xref="InterPro:IPR000632"
                     /db_xref="InterPro:IPR017230"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ8"
                     /translation="MLNAERRPSVAERRSSFLSGSLQNSMNIPVVPHLAGIEDPLPET
                     TPDKVDVLIAGTGMVESVLAAALAWQGSSVLHIDKNDYYGDTSATLTIDQISNWVNEV
                     NSGTSSLSVCYTNAKLYISKSLRHSNTYVSRDFGIDLSPKILFAKSDLLSILVKSRVH
                     QYLEFQSLSNFHTYENDSFEKLTNTKQEIFTDQNLSLMSKRNLMRFIKFVLVWDEQPE
                     IWQQYAEKPISDFLVEKFKLENNQLYELIFSIGLCYNLDVKTPNALQRIRRYLTSFDV
                     YGPFPVLYSKFGGPGELSQGFCRSAAVAGSTYKLNSQLLSFNPTTKEAVFKDGSKIKV
                     EERVIVSPTQAPLDSKNIPKQEYEVHRLTCIVEKSCSEWFGEGESAAVVVFPPNSLKS
                     NNRTVVQAFIVGSGTESCAKGTCIWYLSTVETGPRAELDLDAALEALERSIIRESSTD
                     LENENDLIQLGPNGQTIINSVKLGQSFKEYIPREKVQFLLKLYYTQFTSTPPFDVVTP
                     SVFEFSKEWPKDSSLLVPGASDNNIVYTSMPCAEISYDDVITAAKVLYEKIVGSDDDF
                     FDVDFEDEDIPTYQNNGDVQYQNTFEEDDEEDEARDMDIVENEEPMGEMEI"
     gene            complement(<730022..>732487)
                     /gene="TPHA0H03070"
                     /locus_tag="TPHA_0H03070"
                     /db_xref="GeneID:11534223"
     mRNA            complement(<730022..>732487)
                     /gene="TPHA0H03070"
                     /locus_tag="TPHA_0H03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686896.1"
                     /db_xref="GeneID:11534223"
     CDS             complement(730022..732487)
                     /gene="TPHA0H03070"
                     /locus_tag="TPHA_0H03070"
                     /inference="similar to DNA sequence:INSDC:YAL056W,YOR371C"
                     /note="similar to Saccharomyces cerevisiae GPB2 (YAL056W)
                     and GPB1 (YOR371C); ancestral locus Anc_7.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686944.1"
                     /db_xref="GeneID:11534223"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:G8BWQ9"
                     /translation="MSVKSDELEVGNEEYHIFSPVKYISNSFSVMKHDDIAKRNDSNY
                     LKTIQINNERYLKHYYKSMGMNLLTLKNKGQLSSTTTRVSDSHSSVSPNSSAIDSYNS
                     SAIDKANVYEYIIGNISYYPEKTLLNSFSDIAFDVVATQNEDDTHVNAIESQQIFNSK
                     ALYVYFNHFDKLSTLDNIKPSLGFDNNDIWIPAIRSEFRDRLSSKKRDKIESFKGKSC
                     PLFIEGTGYIPPEFDTFGGSTMISSYFGNIKLPSLVYHSTVKVNDQVFLFGGLVPSYK
                     YDEEAPNLKSFRIKDFIKVPPPLIPNIINNPAMVENPFLYSFNPSSNRFEKNDIHGLP
                     PPPLICVKGTKITDRYIFYYGGFELKTTWYMEDDIYYLEKNIYMNPDAYILDILSFTF
                     KKVDIYTIQKHKFGETTIQPRFGHCQIHLQNVDTDNSVYTDSTSSKASSVEAVSNPNI
                     SLSKSPRILLLEKNASKHSQKSTKKRPNSRKPYDITMLIFGGYIQKSNQSFMAVNDMW
                     KINIQVMSKGKKGYLIFRDGAEASVIARRKKNTNNTETNKDPWPEPRAFGAYCIPDIY
                     SIKKKTLLNSHLDKYYMDTNMSESNTDAPNSNQNNNEENSYCLSYPIQENINESTLLY
                     HGGANQTHIFGDMWSFNIVEETWQKLPEYARVSSDKREPKVLIELGLVGHTLFTVGNM
                     IVTVGGLLQCDVKKIYCEENASLRKNSYLKHGDALGEEKQDSIPIGASILNIFDINSL
                     CLQGNNVKTMYNADNNTFEYLFQDNSNLQNQLLISIASTPIQINGTILILGGLVAFRT
                     DVNEFYLRGTVLECILPSVSLAS"
     gene            complement(<733373..>735205)
                     /gene="TPHA0H03080"
                     /locus_tag="TPHA_0H03080"
                     /db_xref="GeneID:11534224"
     mRNA            complement(<733373..>735205)
                     /gene="TPHA0H03080"
                     /locus_tag="TPHA_0H03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686897.1"
                     /db_xref="GeneID:11534224"
     CDS             complement(733373..735205)
                     /gene="TPHA0H03080"
                     /locus_tag="TPHA_0H03080"
                     /inference="similar to DNA sequence:INSDC:YAL058W"
                     /note="similar to Saccharomyces cerevisiae CNE1 (YAL058W);
                     ancestral locus Anc_7.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686945.1"
                     /db_xref="GeneID:11534224"
                     /db_xref="GOA:G8BWR0"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018124"
                     /db_xref="UniProtKB/TrEMBL:G8BWR0"
                     /translation="MSNIKFLVALLAAASVATVSADKNGSGYKFEHPAIKEHDFKLAD
                     DSFFEDFQGYDSEKAFRKKWISSKKKINDRYSDELVEQYPVKWGLEEAYIVPGFVGDK
                     SLVTYTDKGFGMIGTVFKKPIVMEDGDDLVIQYETKIQTALECGGAFIKLLPPIKKSQ
                     LKKYGGEDSPTLELIFGPDNCAPYTNEVHLGFRRHNPISNKTELVFFEKAPESRLGED
                     LKSHLYTLRLNGKTQDFELRFDGEVTFAANLLDEGVFDPPFGGPKMIPDPNAVQPETW
                     DDRKTIPDPSKTKPKTWDDRAVIPDPEAKKPEKWDESIPKYIPDPERTKQPEWWNEEA
                     DGEWVAPLITNPSCDTEFGCGEWTAELISNPDYKGLWEQPMIENPDYMGVWEPELIKN
                     PEHYEDSTPSKLSEPVGGILFEFYSGSIDLLFDNIYVGKSIKEAEMIGNATFKAKREL
                     EDKELALGGGVSVPLDNETTQKHKRGDNEDKLKESDGALADLFIAYTKIVPPYLQGLG
                     VGLILVVLVVGAGLIVLTGVNTLKTGDERRTAKATKTAEAKEKEPKENKDEKVETEAT
                     STSVSNAVVEEANETVVEEDEDPEEVELRLRKKMIGISLEIPNQ"
     gene            complement(<735807..>736418)
                     /gene="TPHA0H03090"
                     /locus_tag="TPHA_0H03090"
                     /db_xref="GeneID:11534022"
     mRNA            complement(<735807..>736418)
                     /gene="TPHA0H03090"
                     /locus_tag="TPHA_0H03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686898.1"
                     /db_xref="GeneID:11534022"
     CDS             complement(735807..736418)
                     /gene="TPHA0H03090"
                     /locus_tag="TPHA_0H03090"
                     /inference="similar to DNA sequence:INSDC:YAL059W"
                     /note="similar to Saccharomyces cerevisiae ECM1 (YAL059W);
                     ancestral locus Anc_7.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686946.1"
                     /db_xref="GeneID:11534022"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:G8BWR1"
                     /translation="MAKKIGKNSRAARQAAYELALEPESKSLSELPRVENTNLSNILI
                     RVSAKNEALLDAKIGKKKQTKGKSKATKKLLEQRINDSITSIDKDRLERALHITNKLD
                     GKISKSISRAKYVQTTRKQGWDSINNAVRRELNPVAAEKKLDLENEDKMQDSEIAAEI
                     KDDMNVETYGDAEGWDEERNEKKVADQLQNKNMFDLLPLMEDE"
     gene            complement(<736924..>738102)
                     /gene="TPHA0H03100"
                     /locus_tag="TPHA_0H03100"
                     /db_xref="GeneID:11534023"
     mRNA            complement(<736924..>738102)
                     /gene="TPHA0H03100"
                     /locus_tag="TPHA_0H03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686899.1"
                     /db_xref="GeneID:11534023"
     CDS             complement(736924..738102)
                     /gene="TPHA0H03100"
                     /locus_tag="TPHA_0H03100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686947.1"
                     /db_xref="GeneID:11534023"
                     /db_xref="GOA:G8BWR2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BWR2"
                     /translation="MRALAYFGQNDVRFTTDLKEPVISADDELIIAVSYCGICGTDLK
                     EYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGT
                     CKDRYRWPESQNANKPMCSACSIGMTNICAHLALCGAGLESGGFAERLVINEAHVHKI
                     PDHMPLDIGALIQPISVCWHAVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIV
                     LSEPATIRREYAGKMGAKVYDPTGVPFDESVKTLREMGPNGDGFDYTFDCSGLPITLN
                     AAIECCTFRGTAVNVAVWNNKPVEFYPMDITHQEKRYTGSMCYTSEDFEEVIDAFETD
                     KIDIASASHMITNKVPIEDGVDGAIMRLLNDKGHVIKILLTPNNNGELRDRRPVELNV
                     "
     gene            <742931..>744616
                     /gene="TPHA0H03110"
                     /locus_tag="TPHA_0H03110"
                     /db_xref="GeneID:11533713"
     mRNA            <742931..>744616
                     /gene="TPHA0H03110"
                     /locus_tag="TPHA_0H03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686900.1"
                     /db_xref="GeneID:11533713"
     CDS             742931..744616
                     /gene="TPHA0H03110"
                     /locus_tag="TPHA_0H03110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686948.1"
                     /db_xref="GeneID:11533713"
                     /db_xref="GOA:G8BWR3"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BWR3"
                     /translation="MSEPVTDLQVTASSEGNVEAVSSNNSIASNKVEGDDMDLKAPED
                     PIHATGPLSQYFGVLSLCLMIAFGGFIFGWDTGTIGGFVSHEDFLRRFGSRHSDGTYY
                     FSKVRTGLVVGIFNVGCAIGGLTLGRTGDMYGRKPGLMIVVVVYVIGIIISIASIDKW
                     YQYFIGRIISGLGVGGIAVLSPTLIAETAPAHLRGTAVAFYQLLITGGIFLGYCTNYG
                     THHGYKDSTQWRVPLGLSFAWALFMIGGMLLVPESARFLVQKGRLEEAKVSLSKTNKA
                     TVDSPIVVREFDEIFAAVEAERAAGNASWGEIFSRKGAILKRTIMGVMIQSLQQLTGN
                     NYFFYYGSTLFNSVGLDDGYEASIVIGIVNFASTFVALWTVERFGRRNCLLVGAATMA
                     ACFVIYASVGVTRLYIDGYDGPTSKGAGNCMIVFTCFYIFCFATTWAPLAYVIVSETY
                     PLRIRGRAMGLSIGANWMWGFLISFFTPFITGAIHFAYGYVFFGCLIFMFFYVFFFVC
                     ETKGLTLEEVDEMYLEGVLPWKSTSWVPPSQRGVDYDASAAAHDDRPWYQRFK"
     gene            <746224..>746817
                     /gene="TPHA0H03120"
                     /locus_tag="TPHA_0H03120"
                     /db_xref="GeneID:11533714"
     mRNA            <746224..>746817
                     /gene="TPHA0H03120"
                     /locus_tag="TPHA_0H03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686901.1"
                     /db_xref="GeneID:11533714"
     CDS             746224..746817
                     /gene="TPHA0H03120"
                     /locus_tag="TPHA_0H03120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686949.1"
                     /db_xref="GeneID:11533714"
                     /db_xref="GOA:G8BWR4"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8BWR4"
                     /translation="MSFYELSAVDINGEKFSFETLKGKVVLIVNMSSQSGLDPQCKEL
                     NNLYRRFKESNFVIIGFISDQLINESIMNQPSSPSNVIDEVTSNLMSPSCNVEFLIMD
                     NIDVNGPNTDPVFKFLKERKKDSAGFQGIKWNFAKFLIDSNGNVVKRFHHIFHLRQCT
                     KMSKHYYKVKFTNAAFIQASYIYQLLFIIKTFRLLEN"
     gene            <749558..>750160
                     /gene="TPHA0H03130"
                     /locus_tag="TPHA_0H03130"
                     /db_xref="GeneID:11533717"
     mRNA            <749558..>750160
                     /gene="TPHA0H03130"
                     /locus_tag="TPHA_0H03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686902.1"
                     /db_xref="GeneID:11533717"
     CDS             749558..750160
                     /gene="TPHA0H03130"
                     /locus_tag="TPHA_0H03130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686950.1"
                     /db_xref="GeneID:11533717"
                     /db_xref="UniProtKB/TrEMBL:G8BWR5"
                     /translation="MGKQLLSRLNKNIDIVKTNLQEMNNHSELKSKQKLFGRGGSYIF
                     TYYSNVIAIVFIVLMILSLPVRQADAYVIEKRSFPLYNSIATAVSGIYGYYNYDQPIW
                     VRIAWWGSFYADDGGVLDSVESVKNVCKQCVADKQDPNMDCTQAALDLSRALMKTLVL
                     AAVGYGATHSTNGAIDGSGILNKRDKYLVQSSHTIIKQNR"
CONTIG      join(HE612863.1:1..752451)
//
DBGET integrated database retrieval system