GenomeNet

Database: RefSeq
Entry: NC_016528
LinkDB: NC_016528
Original site: NC_016528 
LOCUS       NC_016528             740259 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 9, complete genome.
ACCESSION   NC_016528
VERSION     NC_016528.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 740259)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 740259)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612864.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..740259
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="9"
     gene            complement(452..572)
                     /gene="Tpha_RDN5-1"
                     /locus_tag="TPHA_RDN5-1"
                     /db_xref="GeneID:11532818"
     rRNA            complement(452..572)
                     /gene="Tpha_RDN5-1"
                     /locus_tag="TPHA_RDN5-1"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002431956.1"
                     /db_xref="GeneID:11532818"
     STS             460..572
                     /standard_name="PMC99952P2"
                     /db_xref="UniSTS:273711"
     gene            3423..5217
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /db_xref="GeneID:11534528"
     rRNA            3423..5217
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /product="18S ribosomal RNA"
                     /transcript_id="XR_002431954.1"
                     /db_xref="GeneID:11534528"
     STS             3442..3993
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC106412P1"
                     /db_xref="UniSTS:270119"
     STS             3697..4664
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC140342P1"
                     /db_xref="UniSTS:270933"
     STS             3737..4419
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC95223P1"
                     /db_xref="UniSTS:273623"
     STS             3825..4618
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC343294P1"
                     /db_xref="UniSTS:273189"
     STS             3852..4368
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC125238P1"
                     /db_xref="UniSTS:270483"
     STS             3878..4289
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC87142P1"
                     /db_xref="UniSTS:273581"
     STS             3965..4465
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC104890P1"
                     /db_xref="UniSTS:270115"
     STS             4177..4527
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC133845P3"
                     /db_xref="UniSTS:270670"
     STS             4354..4430
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC152246P1"
                     /db_xref="UniSTS:271203"
     STS             4431..4725
                     /gene="Tpha_RDN18-1"
                     /locus_tag="TPHA_RDN18-1"
                     /standard_name="PMC84574P1"
                     /db_xref="UniSTS:273448"
     STS             5174..5736
                     /standard_name="PMC86038P1"
                     /db_xref="UniSTS:273512"
     STS             5176..5408
                     /standard_name="ITS"
                     /db_xref="UniSTS:275294"
     gene            5359..5516
                     /gene="Tpha_RDN58-1"
                     /locus_tag="TPHA_RDN58-1"
                     /db_xref="GeneID:11534526"
     rRNA            5359..5516
                     /gene="Tpha_RDN58-1"
                     /locus_tag="TPHA_RDN58-1"
                     /product="5.8S ribosomal RNA"
                     /transcript_id="XR_002431958.1"
                     /db_xref="GeneID:11534526"
     gene            5691..9084
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /db_xref="GeneID:11534339"
     rRNA            5691..9084
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /product="25S ribosomal RNA"
                     /transcript_id="XR_002431955.1"
                     /db_xref="GeneID:11534339"
     STS             7804..8179
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /standard_name="PMC133845P2"
                     /db_xref="UniSTS:270669"
     STS             7814..8061
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /standard_name="PMC120649P1"
                     /db_xref="UniSTS:270380"
     STS             7873..8129
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /standard_name="PMC89798P2"
                     /db_xref="UniSTS:273612"
     STS             7877..8327
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /standard_name="PMC156610P1"
                     /db_xref="UniSTS:271418"
     STS             7914..8329
                     /gene="Tpha_RDN25-1"
                     /locus_tag="TPHA_RDN25-1"
                     /standard_name="Pp_Pp7"
                     /db_xref="UniSTS:259708"
     gene            complement(10745..10865)
                     /gene="Tpha_RDN5-2"
                     /locus_tag="TPHA_RDN5-2"
                     /db_xref="GeneID:11534527"
     rRNA            complement(10745..10865)
                     /gene="Tpha_RDN5-2"
                     /locus_tag="TPHA_RDN5-2"
                     /product="5S ribosomal RNA"
                     /transcript_id="XR_002431957.1"
                     /db_xref="GeneID:11534527"
     STS             10753..10865
                     /standard_name="PMC99952P2"
                     /db_xref="UniSTS:273711"
     gene            complement(<12408..>13388)
                     /gene="TPHA0I00100"
                     /locus_tag="TPHA_0I00100"
                     /db_xref="GeneID:11534529"
     mRNA            complement(<12408..>13388)
                     /gene="TPHA0I00100"
                     /locus_tag="TPHA_0I00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686903.1"
                     /db_xref="GeneID:11534529"
     CDS             complement(12408..13388)
                     /gene="TPHA0I00100"
                     /locus_tag="TPHA_0I00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686951.1"
                     /db_xref="GeneID:11534529"
                     /db_xref="UniProtKB/TrEMBL:G8BX89"
                     /translation="MTKLPTTYLFTSGRITLLLSLVLIFAFTDAIPIIKRSFKEVICG
                     SGATIFIGAAAGSAKITGVVCTPEAQVAIGALTFGEGGAVACLGWFATSLVLAAAGAA
                     FAAYGTSDWNWEWEKTGVAISTRDSNIVSYTNTSNGQIITKDTYLEDFFQEALMKREI
                     VDWDLIQYYYITPYSIVSNASVPLAIDFTKNGNYVPVTYSYMHSNGTMITTLTSKNDI
                     ASQHEIFVAWINDSQLLKRDETATWWSYNTYGANPGRCNDLEQHLNTYSSDYKQDWEQ
                     IGMAIASIDNNNIPSKFCLSASDGDTTVRENSAIVGEIYANQYGGIDGTC"
     gene            complement(<16823..>18547)
                     /gene="TPHA0I00110"
                     /locus_tag="TPHA_0I00110"
                     /db_xref="GeneID:11534642"
     mRNA            complement(<16823..>18547)
                     /gene="TPHA0I00110"
                     /locus_tag="TPHA_0I00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686904.1"
                     /db_xref="GeneID:11534642"
     CDS             complement(16823..18547)
                     /gene="TPHA0I00110"
                     /locus_tag="TPHA_0I00110"
                     /inference="similar to DNA sequence:INSDC:YML130C"
                     /note="similar to Saccharomyces cerevisiae ERO1 (YML130C);
                     ancestral locus Anc_8.877"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686952.1"
                     /db_xref="GeneID:11534642"
                     /db_xref="GOA:G8BX90"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:G8BX90"
                     /translation="MKFNKLIIPLVGISNVVLGETLAPEQEPVLEAINFCKMDKDEKI
                     GSTCEITFQEINEMNKKIRPDVISLVATDFFKYFKLNLYKQCPFWEDNNAQCLHRACA
                     VDVVEDWDSLPEYWQPDALGSFSNDSIEEDSTKDDECKFLDQLCAGSGKTTSSLDNKL
                     EDESNVDYCDTADFANRDSVLVDLSANPERFTGYGGKQAGQVWQSIYQDNCFTVNEAS
                     ASLAKDVFYRLVSGLHASIGTHLSNEYLNTETGKWEPNLDLFMARVGNFPERVSNIYF
                     NYAIISKALWKIQPYLKNLEFCNSYDESVKTKIIDIISQFDSRIFNEDLVFEDDLSLL
                     LKDEFRQRFKNVTEIMDCVHCDRCRLWGKVQTTGYATSLKILFELDDADEETKQNVVD
                     KLTKYELIALFNTLDRLSKSIDSINNFERLYNERLSDNGSKLANYFQMDNFFKVVRNA
                     GKLISESMNEMNKSLNNSLNPKVKDERPKEEKKMNEFTDLDMSTKKRRVDTDITSENR
                     WKKAWKHEIHNLNEALTFLWRSYVDLPRNLFNMTLSIMSRTWNKFVGVDNYVNEHHNS
                     AEYTLDLQ"
     gene            complement(<19218..>19931)
                     /gene="TPHA0I00120"
                     /locus_tag="TPHA_0I00120"
                     /db_xref="GeneID:11534643"
     mRNA            complement(<19218..>19931)
                     /gene="TPHA0I00120"
                     /locus_tag="TPHA_0I00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686905.1"
                     /db_xref="GeneID:11534643"
     CDS             complement(19218..19931)
                     /gene="TPHA0I00120"
                     /locus_tag="TPHA_0I00120"
                     /inference="similar to DNA sequence:INSDC:YML095C"
                     /note="similar to Saccharomyces cerevisiae RAD10
                     (YML095C); ancestral locus Anc_8.874"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686953.1"
                     /db_xref="GeneID:11534643"
                     /db_xref="GOA:G8BX91"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="UniProtKB/TrEMBL:G8BX91"
                     /translation="MNNTDPTSFESILAGVKRLRQQHGANDNDAARNPHQESRNEVND
                     RERNLEQGSAQERQITNNIQTSQTDVPKEPIINAITRDPTQFDKDIQESDETSSFNGN
                     KRSLNNTNLDARVISKAVLVNTTQKDNPLLNHLKNTNWRYTSSKGGQKIYYDYLVRQR
                     PVLFLTLTYHKLYADYITRRMTPLSKNDNNILIFVVDDSNSEDTLRELTKLCMFNGFT
                     LLVAFSFEQSAKYIQYLNK"
     gene            <20680..>23427
                     /gene="TPHA0I00130"
                     /locus_tag="TPHA_0I00130"
                     /db_xref="GeneID:11534644"
     mRNA            <20680..>23427
                     /gene="TPHA0I00130"
                     /locus_tag="TPHA_0I00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686906.1"
                     /db_xref="GeneID:11534644"
     CDS             20680..23427
                     /gene="TPHA0I00130"
                     /locus_tag="TPHA_0I00130"
                     /inference="similar to DNA sequence:INSDC:YML093W"
                     /note="similar to Saccharomyces cerevisiae UTP14
                     (YML093W); ancestral locus Anc_8.872"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686954.1"
                     /db_xref="GeneID:11534644"
                     /db_xref="GOA:G8BX92"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="UniProtKB/TrEMBL:G8BX92"
                     /translation="MAKKKRTSRAKSSKRALNALELAEKAVRGYGTDSDSDDNGYRGR
                     GRGKGPTRRSNVVNLLKRVGGKEDDDDEAAEDSFEDEELDSDEAFGSGEDFDVMDSKF
                     SQTLRDLKKKNGDDYELDIDEEGGYTSIDDDDLMSLSQVWDMDEKPKKTHDADDAADD
                     ITTTSEFKLNDDDISSQSSESSSSDDSDDGSESDPFDEISEDENDIHLKTITDDLSKN
                     DDGTSKKRLDNYADGEEDEFNLPSISRIGISSTTSMGLAGNKLNLADMMSVVEDKEAV
                     SKASLLKSDNKLTVSIPLPQRIQQRNERKAAYEISKDEVNKWNDVVKQNRRSEYLSFP
                     LNPKVQHNEATTFSRADGKSKTELEVKVNEILKDSSLADPEKEQTFEQLATATVTPEE
                     MQKRTAERRLMRELMFREERKSKRLKKIKSKAFHRIKKKEMLRNKEMAGLSDESDTDM
                     DIVRAKERMTLKHKSNNKWAKDMVKHGMSNDANTREEIEEMFKQGEKLRQKILDRKDG
                     ESDEDKNLSDYEREQEDEDSLAISDPMDAKAKFGKSGVMNMAFMKNAEAREREDNKKL
                     MERLRDAEASEQITLFASDDENENNGENVRLNNGRRIYTPGNLQAKEEMDKMKEELLE
                     EQKVDESRLLANRLSTKKNVKKDKTKADDKKEKSSIETSNDTVDAESNANPWLDGDSD
                     DEAYAHKQSSKVSVIEKDSTAEKKALYKLAKSTAKSDSKSKSLKNKNRDEDLLLDMED
                     SNRLQIKDAFNGSDDDDASDSKGFMFKQQDVIAEAFAGDNVVAEFEEDKKRTVIDEDD
                     KEEDVTMPGWGDWAGAGARPKKKRKFIKKIQGVVTKDNRKDKNLKNVIINEKQNKKNS
                     KYQSSSVPFPYENKEQYERSLRMPIGQEWTSRASHQKLIKPRITTKPGEVIDPLKTLF
                     K"
     gene            <24225..>26213
                     /gene="TPHA0I00140"
                     /locus_tag="TPHA_0I00140"
                     /db_xref="GeneID:11532864"
     mRNA            <24225..>26213
                     /gene="TPHA0I00140"
                     /locus_tag="TPHA_0I00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686907.1"
                     /db_xref="GeneID:11532864"
     CDS             24225..26213
                     /gene="TPHA0I00140"
                     /locus_tag="TPHA_0I00140"
                     /inference="similar to DNA sequence:INSDC:YML088W"
                     /note="similar to Saccharomyces cerevisiae UFO1 (YML088W);
                     ancestral locus Anc_8.863"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686955.1"
                     /db_xref="GeneID:11532864"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BX93"
                     /translation="MELLDDSDLYTSKGGRVSSSMSLSTLPSEILINVFSYLEEKDLY
                     AIQLLSKRFYVLINDEELWKNLFVTKFNTKWFPTYSGSSKYSIEFINREVGLKEWKHN
                     KSIRTKYVIATGSRVASPLENMLFDYPRCLCYSDGVITMLQLQQFRNNRGNRARLTYI
                     PCTTPHGCSTMNFGINSAIFGRFDGRLYGKILNNKSYLQPIVEFDSLHSAPVTAIAIK
                     KETNDNICVSGSENGDLIWWEDTKKIKDMKISNLPILNLGINKDYTIALDSQSIYVIY
                     QMNVVRALPLPQQINSTEGSEENVPNASRSQYIQVQFCKFDFGSSSIVLADTKDMYVI
                     TLDPHSDTFGYIRKMNFGNDQIEEVVIDEPTALKPQNLEVAGESGCFIAVKTFLSAVK
                     IINIRAPGSKLIVQTELTVNDDEKIFTCQITNLVIVCAMNGFINIYDNLNGELIKTIQ
                     KTEKIPSFLRISQGRLLLSNGENVIQYIKFIPDDNADTHRSNRSGSANKNSNKWKDTL
                     NTALSVYEEEEELNERQRIEATRLLNTYGGDFEEELDSESEEITLRIALMESERIQQE
                     QLDAENQDDELQRALRESQLINQDNGILQDPNSIDADGNAILENDDELLRALRASQVE
                     EVNEYENNTDSQREGSNQADDDDDIQLAIALSLSELDS"
     gene            complement(<26448..>27404)
                     /gene="TPHA0I00150"
                     /locus_tag="TPHA_0I00150"
                     /db_xref="GeneID:11532865"
     mRNA            complement(<26448..>27404)
                     /gene="TPHA0I00150"
                     /locus_tag="TPHA_0I00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686908.1"
                     /db_xref="GeneID:11532865"
     CDS             complement(26448..27404)
                     /gene="TPHA0I00150"
                     /locus_tag="TPHA_0I00150"
                     /inference="similar to DNA sequence:INSDC:YML125C,YML087C"
                     /note="similar to Saccharomyces cerevisiae PGA3 (YML125C)
                     and YML087C; ancestral locus Anc_8.862"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686956.1"
                     /db_xref="GeneID:11532865"
                     /db_xref="GOA:G8BX94"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:G8BX94"
                     /translation="MSQLTEEEKQQLEGFSILDNPIHGILIPSTLVVVGCSVLIYLSG
                     EKRLFYAIAVLFVFLGFRAFLAYGRRKSIWPNKWSKLELEEQTLISKNSAIYRFKMKT
                     SFETLDFAPGQNLAVRTTIDGEEVIRYYTPISSNIETGHFDLIVKSYPDGKLSKHFAG
                     MKPDQQLEFQGPVGKLNYAVNSSKEIAFIAGGSGITAVLQLLNAVIIVPEDVTKIKVL
                     YANDTENDILLRDELDDIAEKYPNFEINYVLRYPTEDWDGETGLVTKELMQKYLPKAS
                     SDNRLFICGPKAMNESVLSIAEELGWPKGSLDSKGDDQVFVY"
     gene            complement(<27922..>29511)
                     /gene="TPHA0I00160"
                     /locus_tag="TPHA_0I00160"
                     /db_xref="GeneID:11534652"
     mRNA            complement(<27922..>29511)
                     /gene="TPHA0I00160"
                     /locus_tag="TPHA_0I00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686909.1"
                     /db_xref="GeneID:11534652"
     CDS             complement(27922..29511)
                     /gene="TPHA0I00160"
                     /locus_tag="TPHA_0I00160"
                     /inference="similar to DNA sequence:INSDC:YML086C"
                     /note="similar to Saccharomyces cerevisiae ALO1 (YML086C);
                     ancestral locus Anc_8.861"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686957.1"
                     /db_xref="GeneID:11534652"
                     /db_xref="GOA:G8BX95"
                     /db_xref="InterPro:IPR006093"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /db_xref="UniProtKB/TrEMBL:G8BX95"
                     /translation="MIELGQIPAKKEFLFKNWAGIYSCKPQLYFQPRSVDEVITIVNN
                     ARSEKKTIVTVGSGHSPSNMCMTSEWLMNLDNLNQVIKYEENKEQHYMDVTVDAGLRV
                     YQLNDWLAEKGYAIQNLGSISEQSVAGIISTGTHGSSPYHGLVSSNFVNLTIVNGKGE
                     LVFLDSENHPDVFRAALLSLGKIGIIVKATIRTIPAFNIKSSQEVITFDTLLEIWDTI
                     WSSSEFIRVWWYPYTRKCILWRGVKTEEEVTPPRYSWWGSRLGRFLYEALLYVSVRIY
                     PALTPYIEEFVFNRQYGNVETYGNGDIAIASSVKSLNMDCLFSQFVDEWSCPLDNGPE
                     ILRSLDHSITQACNAKEFYVHVPVEIRCSNTTLPPKPLDYSDRTSTSPGPVYGNRLRP
                     YLDNTPSHCRYAPLSDVTNGQLTLYINATIYRPFYYNTPIHKWYKLFENTMAAAGGKP
                     HWAKNFLGSTKFAMTEVKEESDYEDFEMRGMAKKIQEWYGEDLKQFQEIRRQQDPENI
                     FVSNKEWAILNGIVTANELEN"
     gene            <30199..>31275
                     /gene="TPHA0I00170"
                     /locus_tag="TPHA_0I00170"
                     /db_xref="GeneID:11534653"
     mRNA            <30199..>31275
                     /gene="TPHA0I00170"
                     /locus_tag="TPHA_0I00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686910.1"
                     /db_xref="GeneID:11534653"
     CDS             30199..31275
                     /gene="TPHA0I00170"
                     /locus_tag="TPHA_0I00170"
                     /note="ancestral locus Anc_8.860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686958.1"
                     /db_xref="GeneID:11534653"
                     /db_xref="UniProtKB/TrEMBL:G8BX96"
                     /translation="MTQWFQLQQDHGVDDGALVSQHLRFSLADTCCFNIAKYISSQNL
                     NPHHVHDLIGHVKFNSEYISKIWDLIVLLKGDNLETYLIFKSYLSFKPSGDDGSSYRY
                     ESLIIDPNKTQLDIKPTVSYLNSFPSLFNFDGRFITVLDLELDYENLIVLTNINSLVS
                     LAVKIIPRDEITHNIEDIARLWKSSLQLSRGKWKSLTTLSLPQLKNPKIFYDLFETID
                     SLRALETGINPNTIAQIPLISSKIKYFDDSSLTNKSIYEKYLIIREKCSASIDQYNSV
                     FDIKIQLSPIVQPPLRKYQFISRTTNKHYLTLQQSFIYIRYRNSDSNKRTMEPGQPGL
                     TKNRRMNNIKGKNISVSNFFGYKM"
     gene            complement(<31708..>33048)
                     /gene="TPHA0I00180"
                     /locus_tag="TPHA_0I00180"
                     /db_xref="GeneID:11534482"
     mRNA            complement(<31708..>33048)
                     /gene="TPHA0I00180"
                     /locus_tag="TPHA_0I00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686911.1"
                     /db_xref="GeneID:11534482"
     CDS             complement(31708..33048)
                     /gene="TPHA0I00180"
                     /locus_tag="TPHA_0I00180"
                     /inference="similar to DNA sequence:INSDC:YML124C,YML085C"
                     /note="similar to Saccharomyces cerevisiae TUB3 (YML124C)
                     and TUB1 (YML085C); ancestral locus Anc_8.859"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686959.1"
                     /db_xref="GeneID:11534482"
                     /db_xref="GOA:G8BX97"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:G8BX97"
                     /translation="MREVISINVGQAGCQIGNACWELYSLEHGIRPDGYLQDGLTKPK
                     GGEEGFSTFFYETGSGKFVPRAVYVDLEPNVIDEVRTGIYKDLFHPEQLISGKEDAAN
                     NYARGHYTVGRELLDDILDRIRKISDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSL
                     DYGKKSKLEFAVYPAPQTSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKKNL
                     DIPRPSFSNLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPI
                     LSKNKASHESNTVAEITNACFEPSNQMVKCDPKSGKYMANCLLYRGDVVTRDVQSAVA
                     QIKNKKTVQMVDWCPTGFKIGICYEPPTSTPNSQLADVNRAVCMLSNTTAIAEAWKRI
                     DRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYADEEF"
     gene            complement(<33784..>34200)
                     /gene="TPHA0I00190"
                     /locus_tag="TPHA_0I00190"
                     /db_xref="GeneID:11534483"
     mRNA            complement(<33784..>34200)
                     /gene="TPHA0I00190"
                     /locus_tag="TPHA_0I00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686912.1"
                     /db_xref="GeneID:11534483"
     CDS             complement(33784..34200)
                     /gene="TPHA0I00190"
                     /locus_tag="TPHA_0I00190"
                     /inference="similar to DNA sequence:INSDC:YML108W"
                     /note="similar to Saccharomyces cerevisiae YML108W;
                     ancestral locus Anc_8.830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686960.1"
                     /db_xref="GeneID:11534483"
                     /db_xref="InterPro:IPR015080"
                     /db_xref="UniProtKB/TrEMBL:G8BX98"
                     /translation="MAGESAPYRMLVLLEEPLEENIETLTRDGDVKEVNEHNVEKGET
                     QSKSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLMLDK
                     EIEHVVSKVKEFVSANQMLASDEEEQEYQKSAETGF"
     gene            complement(<34713..>37862)
                     /gene="TPHA0I00200"
                     /locus_tag="TPHA_0I00200"
                     /db_xref="GeneID:11534484"
     mRNA            complement(<34713..>37862)
                     /gene="TPHA0I00200"
                     /locus_tag="TPHA_0I00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686913.1"
                     /db_xref="GeneID:11534484"
     CDS             complement(34713..37862)
                     /gene="TPHA0I00200"
                     /locus_tag="TPHA_0I00200"
                     /inference="similar to DNA sequence:INSDC:YML109W,YMR273C"
                     /note="similar to Saccharomyces cerevisiae ZDS2 (YML109W)
                     and ZDS1 (YMR273C); ancestral locus Anc_8.831"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686961.1"
                     /db_xref="GeneID:11534484"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:G8BX99"
                     /translation="MSYKNETLRACTVEEKRKSAVLIAAQSLDLEVQNVKKLKRLSVG
                     SMDLLLDPEFEYTMGSTNDSNSNTNTNTNTKKNLRKSRLFDNDNSLMECEVSENYDDI
                     ANLDSTSDLTSANVSDLANDNSFDKTGIEYLHNEDFEHVHTNENNNYTLGEEPNINES
                     LFQSHKNNSQLRRGLSGVHSLNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPG
                     VKPENYVELLQDTLQNINLNLNETQNNVEDTSNKTSDKMVMDREVIRRRRISQDLNRN
                     HSSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKS
                     TYQMGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQS
                     ATQGNDDNKPRSSEVSEAGYASNILVRNGITMPTRSLRRSKFNTYKIRNPSGNILEQS
                     RISKSEPSSRNVTGSSNRASSFDIEHTQDVLRESAPLTFETISEEQVQDKSLDAIDIL
                     DKSLDISDKDFDSSHLSFSQGNITQSSDSSNDSVLVRPAYSHSIIQEKLDTDRGGDLE
                     FSSNKFSETLFAKESDIQDDPDFVNLSIPERTKSQRVRAEKSNHSKHRHSPIITISEE
                     TPFKINNKKQLSQPLLNESEINKGDHGSIIPENLKHKASVKEASSKEKEPSTNKKQRF
                     DKKIVSIFKRKSSKTSNNEIKNEKKTVLSQEDKRIMSSSSSKSTKQDISAAELQSDHL
                     DDSLRTVERELLSESVHPTEVNIPVGTQSNSLDSKPIEIANTSYEDKLNSSYDENAED
                     SFSYLEESLETQNSLQPAVCITSNRADVVVTETVDELSDGDDSQDITGGEFYTDNTQV
                     NTINTSYETSYNSTRIVEQEANTLPESSLPARKLTFKDVVKPERPNGPMEFTDSAFGF
                     PLPKLTTSTVIMFDHRLPVNVERAIYRLSHLKLSDPKRELREQILLSNFMYAYLHLVN
                     HSLYIEQAEQQAKESNMDTSEYDNSVVEVAYLDDSFTYSKQTKNNTGSDYLNNDVTND
                     YHTERNAADGSICIPDLSE"
     gene            complement(<38373..>39335)
                     /gene="TPHA0I00210"
                     /locus_tag="TPHA_0I00210"
                     /db_xref="GeneID:11534536"
     mRNA            complement(<38373..>39335)
                     /gene="TPHA0I00210"
                     /locus_tag="TPHA_0I00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686914.1"
                     /db_xref="GeneID:11534536"
     CDS             complement(38373..39335)
                     /gene="TPHA0I00210"
                     /locus_tag="TPHA_0I00210"
                     /inference="similar to DNA sequence:INSDC:YMR274C"
                     /note="similar to Saccharomyces cerevisiae RCE1 (YMR274C);
                     ancestral locus Anc_8.832"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686962.1"
                     /db_xref="GeneID:11534536"
                     /db_xref="GOA:G8BXA0"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:G8BXA0"
                     /translation="MVTISTLFVSLYISASYVGSIYSSSLNLEDFKMKRDDQRVIKAR
                     MGQVSKVLMLNCLLVPLLWHFMGHSSNGSLWASFMKMGLVPGYYLDGDFDLVSHCLDI
                     VKAVLLLCLLYVGVLADVFLYYCVVDSKSSMWEDLRYELDSLWGFRNYVFAPVTEELF
                     YTSMLITTYLSFNTKSDSSFKEYLWETPLYFGLAHIHHAYEEMQTGTNTLPSIMLSTL
                     FQLTYTTLFGSLTNYTFLCTGGNLWACIALHSFCNFMGFPQSSKVSQHYQYTAPLKND
                     DTSIKARIIRAWSKIYIALLIMGILLFKDYLPVLLNNSQHRITL"
     gene            <39858..>40991
                     /gene="TPHA0I00220"
                     /locus_tag="TPHA_0I00220"
                     /db_xref="GeneID:11534537"
     mRNA            <39858..>40991
                     /gene="TPHA0I00220"
                     /locus_tag="TPHA_0I00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686915.1"
                     /db_xref="GeneID:11534537"
     CDS             39858..40991
                     /gene="TPHA0I00220"
                     /locus_tag="TPHA_0I00220"
                     /inference="similar to DNA sequence:INSDC:YMR276W"
                     /note="similar to Saccharomyces cerevisiae DSK2 (YMR276W);
                     ancestral locus Anc_8.837"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686963.1"
                     /db_xref="GeneID:11534537"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BXA1"
                     /translation="MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRL
                     IYSGKILKDAETVESYKIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAV
                     PTNITSGQTNGFNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENP
                     VFQSQMNEMLSNPQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEM
                     ARMMGGEGVGIGGGLNGDSSFPAPGETSTESATAEDNAAARNPAATNPAAANPANPFA
                     ALFNPGMNPFAGLGNPAAAGSTGAPGTPQYPGFNPSMLASMLQQPRQPAQEDTRPPEV
                     RYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV"
     gene            <41435..>43279
                     /gene="TPHA0I00230"
                     /locus_tag="TPHA_0I00230"
                     /db_xref="GeneID:11534509"
     mRNA            <41435..>43279
                     /gene="TPHA0I00230"
                     /locus_tag="TPHA_0I00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686916.1"
                     /db_xref="GeneID:11534509"
     CDS             41435..43279
                     /gene="TPHA0I00230"
                     /locus_tag="TPHA_0I00230"
                     /inference="similar to DNA sequence:INSDC:YML114C"
                     /note="similar to Saccharomyces cerevisiae TAF8 (YML114C);
                     ancestral locus Anc_8.838"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686964.1"
                     /db_xref="GeneID:11534509"
                     /db_xref="InterPro:IPR019473"
                     /db_xref="UniProtKB/TrEMBL:G8BXA2"
                     /translation="MTAMVTNETIRTSDLLQGSDGDKAVEKFEHQDIGMDKEVTEQKK
                     YVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQ
                     LSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVT
                     LLNRLATDTNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTY
                     KFTPQFNKHITDATVIRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDT
                     AKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNK
                     VKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTL
                     NQNKKDTRERAMVEKKRRHDEWLKRREEKLKKLEQEKNLRAQAFGAIDLSSFTNIDDG
                     GFLDGFDSSENEQELEIRAKSSQNNSKDISSTGPGSWDKEEANPVAIGTSVNTKSLEI
                     KTSGQTNQNMEPVLSNEIESVTSEGLEVEKLEVQEDQMQGETDVVHTTGEEVIQEIKQ
                     SETPINFPTMATTTITTTETNISTTETTTITETTPNINSGLEESNDTN"
     gene            <43854..>46052
                     /gene="TPHA0I00240"
                     /locus_tag="TPHA_0I00240"
                     /db_xref="GeneID:11534510"
     mRNA            <43854..>46052
                     /gene="TPHA0I00240"
                     /locus_tag="TPHA_0I00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686917.1"
                     /db_xref="GeneID:11534510"
     CDS             43854..46052
                     /gene="TPHA0I00240"
                     /locus_tag="TPHA_0I00240"
                     /inference="similar to DNA sequence:INSDC:YMR277W"
                     /note="similar to Saccharomyces cerevisiae FCP1 (YMR277W);
                     ancestral locus Anc_8.839"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686965.1"
                     /db_xref="GeneID:11534510"
                     /db_xref="GOA:G8BXA3"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011947"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BXA3"
                     /translation="MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVE
                     IAKSPDELDVNGNVQDGEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVC
                     EVKRPCDHDIVYAGICTMCGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKS
                     RLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP
                     MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGS
                     LFGNRILSRDENGSLTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVG
                     IGDINSNFLPRQQATMLQMGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQE
                     ADLTHKSAALGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDD
                     DDELSYLKEILATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIP
                     LGTDIQKADIVLWTKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPD
                     WVFECLSTWKHVDEKSFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNG
                     TATMSSTDNVVDLFAGGSSWLVDDELEDVLDSEDDNEDDSDEDEDEYDEFADVISKRE
                     EKKRSGEALEESNNKKQHLQDDADAASAKSESESDLDLELLNALDDSDSE"
     gene            <46554..>48443
                     /gene="TPHA0I00250"
                     /locus_tag="TPHA_0I00250"
                     /db_xref="GeneID:11534332"
     mRNA            <46554..>48443
                     /gene="TPHA0I00250"
                     /locus_tag="TPHA_0I00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686918.1"
                     /db_xref="GeneID:11534332"
     CDS             46554..48443
                     /gene="TPHA0I00250"
                     /locus_tag="TPHA_0I00250"
                     /inference="similar to DNA sequence:INSDC:YMR278W"
                     /note="similar to Saccharomyces cerevisiae YMR278W;
                     ancestral locus Anc_8.840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686966.1"
                     /db_xref="GeneID:11534332"
                     /db_xref="GOA:G8BXA4"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:G8BXA4"
                     /translation="MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCV
                     NKSLDELHKRFDQRIVFGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLT
                     AVVGHDHRYHSKEFAQITAAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVM
                     ITASHNPEMDNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIEN
                     VKLIYSKEDVLQQYMLNLDKYIIPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISS
                     TCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDP
                     DADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVS
                     SQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYYVPFGFEEAIGYMFPKMECDK
                     DGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFD
                     NIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVPTLPVDPSSQMITMTIIP
                     TSLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKLTWDVLKREWFSSEKTG
                     LTTNF"
     gene            <49179..>50150
                     /gene="TPHA0I00260"
                     /locus_tag="TPHA_0I00260"
                     /db_xref="GeneID:11534333"
     mRNA            <49179..>50150
                     /gene="TPHA0I00260"
                     /locus_tag="TPHA_0I00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686919.1"
                     /db_xref="GeneID:11534333"
     CDS             49179..50150
                     /gene="TPHA0I00260"
                     /locus_tag="TPHA_0I00260"
                     /inference="similar to DNA sequence:INSDC:YPL273W"
                     /note="similar to Saccharomyces cerevisiae SAM4 (YPL273W);
                     ancestral locus Anc_8.841"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686967.1"
                     /db_xref="GeneID:11534333"
                     /db_xref="GOA:G8BXA5"
                     /db_xref="InterPro:IPR003726"
                     /db_xref="UniProtKB/TrEMBL:G8BXA5"
                     /translation="MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISF
                     VNDKFWDENIENTERKCIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYH
                     ELLRKITGFCRRCISDDDYLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDE
                     FNNDMNIDIIGFETIPNKHELEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMG
                     RLFAKYKGRNKNLVYVGGNCISYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQ
                     WSSTSAIKISWEEVVNEYADAGVKIIGGCCRTTPDDIKQIKKAVDAL"
     gene            complement(<50298..>53417)
                     /gene="TPHA0I00270"
                     /locus_tag="TPHA_0I00270"
                     /db_xref="GeneID:11534334"
     mRNA            complement(<50298..>53417)
                     /gene="TPHA0I00270"
                     /locus_tag="TPHA_0I00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686920.1"
                     /db_xref="GeneID:11534334"
     CDS             complement(50298..53417)
                     /gene="TPHA0I00270"
                     /locus_tag="TPHA_0I00270"
                     /inference="similar to DNA sequence:INSDC:YML117W"
                     /note="similar to Saccharomyces cerevisiae NAB6 (YML117W);
                     ancestral locus Anc_8.844"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686968.1"
                     /db_xref="GeneID:11534334"
                     /db_xref="GOA:G8BXA6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018835"
                     /db_xref="InterPro:IPR018885"
                     /db_xref="UniProtKB/TrEMBL:G8BXA6"
                     /translation="MKSPHKKMGNNNDQAHNNNENNAAHPFQQQGGKVPFQQTIQPVM
                     FSHRNMNPPPYNFQNRGYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPYHSQQT
                     PLPNPPPTPFDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRRNSNQM
                     VFPNPPIITSPHLVGDKSERAKSDNYEKVDTLDDEKRNREVFEEESAIAYKISYQILP
                     KGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSF
                     TSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNGKISVESQKNE
                     TDFELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLY
                     IVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDRTKHAVS
                     NSNRQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSELEIQT
                     HTFNLDISNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSPPSGYMENMWTTTPFLS
                     SHIVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFI
                     GNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILH
                     NNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYI
                     LPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKNEDNNNFHERY
                     KNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLEEERKRNDEIK
                     QIDNKRINLDSLGITTSPNQNIQEDETLSLAKLKLTSDTGFKNSENESDIDDSASNSS
                     TDVELIINSPGNGFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPMAPNKLSHDYHRT
                     HNTRVDNPRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYD
                     ENDIDFAKQ"
     gene            <54103..>55008
                     /gene="TPHA0I00280"
                     /locus_tag="TPHA_0I00280"
                     /db_xref="GeneID:11534685"
     mRNA            <54103..>55008
                     /gene="TPHA0I00280"
                     /locus_tag="TPHA_0I00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686921.1"
                     /db_xref="GeneID:11534685"
     CDS             54103..55008
                     /gene="TPHA0I00280"
                     /locus_tag="TPHA_0I00280"
                     /inference="similar to DNA sequence:INSDC:YMR281W"
                     /note="similar to Saccharomyces cerevisiae GPI12
                     (YMR281W); ancestral locus Anc_8.846"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686969.1"
                     /db_xref="GeneID:11534685"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:G8BXA7"
                     /translation="MGILFKLFKCYCILSILYIWLTPHIEDLNLKSFYSNVQLNISQQ
                     SLKSVNLIIAHPDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSN
                     EIMDSLTMLLGHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGL
                     KHWLLTFDAQGVSEHPNHIACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFL
                     PVVFKLLINIINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQ
                     MVWFRYGWWSFSRFVFVNDLHIIDL"
     gene            complement(<55148..>56857)
                     /gene="TPHA0I00290"
                     /locus_tag="TPHA_0I00290"
                     /db_xref="GeneID:11534686"
     mRNA            complement(<55148..>56857)
                     /gene="TPHA0I00290"
                     /locus_tag="TPHA_0I00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686922.1"
                     /db_xref="GeneID:11534686"
     CDS             complement(55148..56857)
                     /gene="TPHA0I00290"
                     /locus_tag="TPHA_0I00290"
                     /inference="similar to DNA sequence:INSDC:YMR282C"
                     /note="similar to Saccharomyces cerevisiae AEP2 (YMR282C);
                     ancestral locus Anc_8.847"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686970.1"
                     /db_xref="GeneID:11534686"
                     /db_xref="InterPro:IPR024319"
                     /db_xref="UniProtKB/TrEMBL:G8BXA8"
                     /translation="MGLHQNVQAMGVKNLSNFLQSSLSTCLSNNLFIRNANATILKYR
                     FQSRTLSSYTLSKDITAIDELSNIKRSGTGTTTLGMTPVQIHWGDLFQKSNLKTILEQ
                     LLQHNDNSYMFLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMV
                     FKLFQLYGNAIGSDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLY
                     DVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNR
                     YKILDPLGVLKIANKIITDDKWKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVD
                     ISMSDGNSDVGTQISNEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNL
                     ELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELY
                     TLVYYTKNSRIAAEVVSEFMPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFT
                     ASNFIEKWSMDNQNKEELFKYYKDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLG
                     RLW"
     gene            complement(<57211..>58692)
                     /gene="TPHA0I00300"
                     /locus_tag="TPHA_0I00300"
                     /db_xref="GeneID:11534656"
     mRNA            complement(<57211..>58692)
                     /gene="TPHA0I00300"
                     /locus_tag="TPHA_0I00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686923.1"
                     /db_xref="GeneID:11534656"
     CDS             complement(57211..58692)
                     /gene="TPHA0I00300"
                     /locus_tag="TPHA_0I00300"
                     /inference="similar to DNA sequence:INSDC:YMR283C"
                     /note="similar to Saccharomyces cerevisiae RIT1 (YMR283C);
                     ancestral locus Anc_8.848"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686971.1"
                     /db_xref="GeneID:11534656"
                     /db_xref="GOA:G8BXA9"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BXA9"
                     /translation="MVDDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP
                     YPLVPNERCGLWYCKRANFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIII
                     IDSTRRGKKIPDALSKTVPIWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYER
                     IKNKIPELVEKLCKLDVIDGKKLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSN
                     SSWEEPSKEEKIIPIVLCTVSYQVQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWD
                     NIELLNNLELSEEMLEDYVEEILLSESMKITNLEVDGVFKSIDKITEELYLGNIVDGL
                     EIKQNLMEMFNKSYSLVIILSNSIKLASDEQNEQSANAKTSKTNIIKLFRLQSGSKKS
                     SKELRSCLPEICDLLTDELSSSGSTKKPILVCCNNGSDMSIAVILVTLSKFYTQEWRR
                     TSEHTEINKITIRKHLTKVISHLGGRNVNPSRATLNSVNDFLM"
     gene            <59576..>61402
                     /gene="TPHA0I00310"
                     /locus_tag="TPHA_0I00310"
                     /db_xref="GeneID:11534657"
     mRNA            <59576..>61402
                     /gene="TPHA0I00310"
                     /locus_tag="TPHA_0I00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686924.1"
                     /db_xref="GeneID:11534657"
     CDS             59576..61402
                     /gene="TPHA0I00310"
                     /locus_tag="TPHA_0I00310"
                     /inference="similar to DNA sequence:INSDC:YMR284W"
                     /note="similar to Saccharomyces cerevisiae YKU70
                     (YMR284W); ancestral locus Anc_8.849"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686972.1"
                     /db_xref="GeneID:11534657"
                     /db_xref="GOA:G8BXB0"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:G8BXB0"
                     /translation="MENSSKLLSHNDEIYDDEDEFYIDYSSIDNPKASYRKYESHEGY
                     MFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGCFFFNCDNKES
                     KKRIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDKGNSLESLFLLI
                     QDRFSNNIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDISDNYIQFVTFF
                     INKIDSSDNFDDSFYSDILKLRNSNSIEFDGPSTKPISVAYIKNKVLRKKEIKRIMFQ
                     CPLILNADSDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVV
                     TKDDTEKIFQLGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKA
                     LFIVPDESRCVGSIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQN
                     EGFYLYKVPFLDEIRKIPSQYTHFPSDELIRNKDYENLKRVTRNILGYFNLTNGYSPL
                     EFKNPLLQKYYKLLHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKS
                     ASSTESHKQRLSANFNIWNDIYSKLEGNEIAVKEMKPKKQKN"
     gene            complement(<61470..>63059)
                     /gene="TPHA0I00320"
                     /locus_tag="TPHA_0I00320"
                     /db_xref="GeneID:11532834"
     mRNA            complement(<61470..>63059)
                     /gene="TPHA0I00320"
                     /locus_tag="TPHA_0I00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686925.1"
                     /db_xref="GeneID:11532834"
     CDS             complement(61470..63059)
                     /gene="TPHA0I00320"
                     /locus_tag="TPHA_0I00320"
                     /inference="similar to DNA sequence:INSDC:YML118W,YMR285C"
                     /note="similar to Saccharomyces cerevisiae NGL3 (YML118W)
                     and NGL2 (YMR285C); ancestral locus Anc_8.850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686973.1"
                     /db_xref="GeneID:11532834"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:G8BXB1"
                     /translation="MSTRRDDDGDGVTEVAEGLEKKVYVSEKPKLDGSTFIEKVVVKE
                     PFGDASAKKQKSKGKGKGKGKSIPSPEEIARIRAERAAAREEKQKKMLANGLDPDCPP
                     ELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYRRSRVLL
                     NEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKNNLFR
                     LTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIGTT
                     HLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFD
                     TPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQT
                     PVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS
                     NWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQ
                     PHQGEYPSDHLSMMCKIELNP"
     gene            <63570..>63836
                     /gene="TPHA0I00330"
                     /locus_tag="TPHA_0I00330"
                     /db_xref="GeneID:11532835"
     mRNA            <63570..>63836
                     /gene="TPHA0I00330"
                     /locus_tag="TPHA_0I00330"
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /transcript_id="XM_003686926.1"
                     /db_xref="GeneID:11532835"
     CDS             63570..63836
                     /gene="TPHA0I00330"
                     /locus_tag="TPHA_0I00330"
                     /inference="similar to DNA sequence:INSDC:YMR286W"
                     /note="similar to Saccharomyces cerevisiae MRPL33
                     (YMR286W); ancestral locus Anc_8.851"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /protein_id="XP_003686974.1"
                     /db_xref="GeneID:11532835"
                     /db_xref="GOA:G8BXB2"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:G8BXB2"
                     /translation="MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMA
                     GTLAMVKEIVKVEVTENQLSKEQQRELRKSNPGFTVQKRETISN"
     gene            complement(<64246..>65433)
                     /gene="TPHA0I00340"
                     /locus_tag="TPHA_0I00340"
                     /db_xref="GeneID:11532836"
     mRNA            complement(<64246..>65433)
                     /gene="TPHA0I00340"
                     /locus_tag="TPHA_0I00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686927.1"
                     /db_xref="GeneID:11532836"
     CDS             complement(64246..65433)
                     /gene="TPHA0I00340"
                     /locus_tag="TPHA_0I00340"
                     /inference="similar to DNA sequence:INSDC:YML119W"
                     /note="similar to Saccharomyces cerevisiae YML119W;
                     ancestral locus Anc_8.852"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686975.1"
                     /db_xref="GeneID:11532836"
                     /db_xref="UniProtKB/TrEMBL:G8BXB3"
                     /translation="MSTSRSLNNKIFFEKKSATGEYPKEWMNSAYGGNLTHHQDSSQL
                     QNQSYSKRNINSTVNNSFNYNNYDNNAANYGRENFHNNQAYSNNAYSLKGLNNTYILN
                     NMRNDNKIKRGQKPIMNGRSMPYKNMNKQNSRALKQTKNPPNNAKNFTNKNIKFTIVH
                     DESEIDNDKKHSNDDICNKYFSEPVDLNYYKDSDGKIKPVINLVSKKTQQSIKKVYKL
                     SVPINYKDTTYSGVSSLIETEYRPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNR
                     KETKENDANTTLEKIKLNKSSRVLKSINERSFINNTGLKLTSNNDSFELSFDGKALDR
                     SDILRMVDSFSVAFSDDDGDNDDYNEQAESTFDEEFGSKENKYLRTLTNKILPAEITG
                     GGF"
     gene            complement(<65929..>68760)
                     /gene="TPHA0I00350"
                     /locus_tag="TPHA_0I00350"
                     /db_xref="GeneID:11534355"
     mRNA            complement(<65929..>68760)
                     /gene="TPHA0I00350"
                     /locus_tag="TPHA_0I00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686928.1"
                     /db_xref="GeneID:11534355"
     CDS             complement(65929..68760)
                     /gene="TPHA0I00350"
                     /locus_tag="TPHA_0I00350"
                     /inference="similar to DNA sequence:INSDC:YMR287C"
                     /note="similar to Saccharomyces cerevisiae DSS1 (YMR287C);
                     ancestral locus Anc_8.853"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686976.1"
                     /db_xref="GeneID:11534355"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="UniProtKB/TrEMBL:G8BXB4"
                     /translation="MTVHLIRRNIQSSASALKLATRRTKYLEKRLPASFNLELVKSKF
                     LERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINETLI
                     SKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVDIPMSIEDP
                     RFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKENNAIKLPS
                     LPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISFLKLVHLVQ
                     NVDLNKLARNRADHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQQQQSQLWG
                     DIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDENINKFTEAINKHNLEKINEKFP
                     DFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDNCQKLYNELNPSNKIL
                     NSLLLSKDLCLPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLKVFCIDEKTAHE
                     IDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFRRAFTTYLPE
                     FVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFDKSSCSILEDTFEIQLGKVNNFPKNT
                     TYKEVDKILNSSIKRENDIERDLREMRFIANHLRKCRIDNSAVIFGEGFNKGAVNLIE
                     KKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPAIYKTYKGLNMK
                     PKASSQFKKILNVNKKRLPSIKEISKIGSLLSSSTFSSKPSIHEMIGTDQYATVTSPL
                     RRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFNKYWTLQYL
                     NEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIGEIIKNC
                     KIANIDCLGNSLEFAIDENQEHDRVNTFT"
     gene            <69096..>69749
                     /gene="TPHA0I00360"
                     /locus_tag="TPHA_0I00360"
                     /db_xref="GeneID:11534356"
     mRNA            <69096..>69749
                     /gene="TPHA0I00360"
                     /locus_tag="TPHA_0I00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686929.1"
                     /db_xref="GeneID:11534356"
     CDS             69096..69749
                     /gene="TPHA0I00360"
                     /locus_tag="TPHA_0I00360"
                     /inference="similar to DNA sequence:INSDC:YHR189W"
                     /note="similar to Saccharomyces cerevisiae PTH1 (YHR189W);
                     ancestral locus Anc_8.856"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686977.1"
                     /db_xref="GeneID:11534356"
                     /db_xref="GOA:G8BXB5"
                     /db_xref="InterPro:IPR001328"
                     /db_xref="InterPro:IPR018171"
                     /db_xref="UniProtKB/TrEMBL:G8BXB5"
                     /translation="MYTALSCRCTAITDGAFMRGAFGRCKKRWFQTIITGLGNPKNQY
                     QYTKHNAGVLMADLLKKELAQRQSWVKYGKKSLAEYVVLQDKNVILCKNTGGYMNLSG
                     ETFLPIWKSLEREHRPSDGVTECVVIFDDLDTPFGKVKLRKPGTSTKGHNGLKDIANK
                     LGHLNFYKLAIGIGRPAERDPQQVVNHVLSKFNNNELSILEQECLPETLRLLEPFLR"
     gene            <70346..>71671
                     /gene="TPHA0I00370"
                     /locus_tag="TPHA_0I00370"
                     /db_xref="GeneID:11534687"
     mRNA            <70346..>71671
                     /gene="TPHA0I00370"
                     /locus_tag="TPHA_0I00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686930.1"
                     /db_xref="GeneID:11534687"
     CDS             70346..71671
                     /gene="TPHA0I00370"
                     /locus_tag="TPHA_0I00370"
                     /inference="similar to DNA sequence:INSDC:YHR190W"
                     /note="similar to Saccharomyces cerevisiae ERG9 (YHR190W);
                     ancestral locus Anc_8.857"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686978.1"
                     /db_xref="GeneID:11534687"
                     /db_xref="GOA:G8BXB6"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:G8BXB6"
                     /translation="MGKLGELLAHPVELKSALILKFIRQPLYSNEASMSADVKKCYEL
                     LTKTSRSFAAVIMELHPELRNAVAIFYLILRALDTIEDDMTIDVDEKVRLLEEFDGKL
                     DTLDWSFNGNGPNEKDRDVLVEFPYILREYHNLKPEYQQVIKKITKEMAKGMVKYVLD
                     AEFTLNGVATVQDYDMYCHYVAGLVGDGLTELIVLANFGSPSLYESDGNSKLFESMGL
                     FLQKTNIIRDYAEDLRDGRTFWPKEIWAQHTDKLASLATDADNGVACINHLVLNALSH
                     VEDVLTYLSLIEEQSSFQFCAIPQVMAIATLSLVFNNATVLQKNVKIRKGETCYLILK
                     SRTLKGCVEIFTYYLRQIKQSLQVNDPNYLKINIQIARIEQYIEEMYQDNLPENVAPI
                     KTPVYLSTSKRTVQDNKVVPVIEEENYKFNIGLTILMTLAFAIVHRLMK"
     gene            <72432..>74168
                     /gene="TPHA0I00380"
                     /locus_tag="TPHA_0I00380"
                     /db_xref="GeneID:11534688"
     mRNA            <72432..>74168
                     /gene="TPHA0I00380"
                     /locus_tag="TPHA_0I00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686931.1"
                     /db_xref="GeneID:11534688"
     CDS             72432..74168
                     /gene="TPHA0I00380"
                     /locus_tag="TPHA_0I00380"
                     /inference="similar to DNA sequence:INSDC:YML123C"
                     /note="similar to Saccharomyces cerevisiae PHO84
                     (YML123C); ancestral locus Anc_8.858"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686979.1"
                     /db_xref="GeneID:11534688"
                     /db_xref="GOA:G8BXB7"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BXB7"
                     /translation="MSQAQQQNLTEGGNTAFHNFVNDFAHIDDPLERRRLALQKIDEA
                     AFGWYHIKAILVAGVGFLTDAYDIFAINLGVSMMSYVYWQGHMPSSTTTLLKVSTSVG
                     TVFGQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAVNFVAILTTYRIVMG
                     IGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQILGGIIAIILVAAYKGDLEG
                     ANTGLECGLECQRACDQMWRILIGFGALPGLIALYFRLTIPESPRYHLDVNLELNQTL
                     TAGSVDSIPTDDEKKPQFNTTVHSIGPEQTTRDIENLEGKKPKVSFRDFCHHFGQWKY
                     GKILLGTAGTWFMLDVAFYGLALNSAVILQTIGYASSNNVYQKLYNSAAGNLILICAG
                     SLPGYWCSVFTIDIIGRKPIQIMGFVLLTALFCIIGFAYDKLSDSGLLALYVLCQFFC
                     NFGPNVTTFIIPGEIFPTRYRSTAHGISAASGKIGAIIAQTALGTLISHNCARDGKPE
                     NCWLKHVMQIFALFMLVGTLLSFLVPETKRMTLEEIAEKYHDEVDPSKMRRVESSENE
                     SVDEQRIHSESV"
     gene            76006..76077
                     /gene="TPHA0Itrna2Q"
                     /locus_tag="TPHA_0Itrna2Q"
                     /db_xref="GeneID:11534689"
     tRNA            76006..76077
                     /gene="TPHA0Itrna2Q"
                     /locus_tag="TPHA_0Itrna2Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAG"
                     /db_xref="GeneID:11534689"
     gene            <77010..>77687
                     /gene="TPHA0I00390"
                     /locus_tag="TPHA_0I00390"
                     /db_xref="GeneID:11534672"
     mRNA            <77010..>77687
                     /gene="TPHA0I00390"
                     /locus_tag="TPHA_0I00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686932.1"
                     /db_xref="GeneID:11534672"
     CDS             77010..77687
                     /gene="TPHA0I00390"
                     /locus_tag="TPHA_0I00390"
                     /inference="similar to DNA sequence:INSDC:YML106W,YMR271C"
                     /note="similar to Saccharomyces cerevisiae URA5 (YML106W)
                     and URA10 (YMR271C); ancestral locus Anc_8.827"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686980.1"
                     /db_xref="GeneID:11534672"
                     /db_xref="GOA:G8BXB8"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:G8BXB8"
                     /translation="MPKVLEDYQKIFLKLAIECHALRFGSFQLKSGRESPYFFNLGLF
                     NSGKLLYHVATAYAIAIIHSDLKFDVIFGPAYKGIPLAAIVCVKLAEIGGSKYEHIQY
                     SFNRKEKKDHGEGGSIVGAELADKRILIIDDVMTAGTAINEAFDIIKAEKGVVVGSII
                     ALDRQEIVDLESRDGLSATQSVSKRYNIPVLSIVTLTDIIQYLEGRITPEKKDKIQEY
                     RQKYGVL"
     gene            complement(<77981..>81436)
                     /gene="TPHA0I00400"
                     /locus_tag="TPHA_0I00400"
                     /db_xref="GeneID:11534500"
     mRNA            complement(<77981..>81436)
                     /gene="TPHA0I00400"
                     /locus_tag="TPHA_0I00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686933.1"
                     /db_xref="GeneID:11534500"
     CDS             complement(77981..81436)
                     /gene="TPHA0I00400"
                     /locus_tag="TPHA_0I00400"
                     /inference="similar to DNA sequence:INSDC:YML104C"
                     /note="similar to Saccharomyces cerevisiae MDM1 (YML104C);
                     ancestral locus Anc_8.824"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686981.1"
                     /db_xref="GeneID:11534500"
                     /db_xref="GOA:G8BXB9"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="UniProtKB/TrEMBL:G8BXB9"
                     /translation="MLVFDDARLKDSIIFVIFLSGFHISISYLLPFKVQIFASVIFII
                     GIYLVLFKPDGEKKKVYPLKLKLRLHDVLIKEYGSKLKGQQLEPRERFIQEGIPFDIS
                     DELHNIINLIIESFVLTWFQRLNEDVEHTFVLAVKDLLINIIIKLQRGLVNTDVTEVL
                     LLKVIPLVTDYLNNYSDATQSVLLTSKRADISLNVAVEFNKRNKVHHALSLRATKHDQ
                     EIESYIKKRLEVILPQLLDEKEMNSPFVPVLLRDLITASICVPIIAKFSSADQWNLRI
                     IDISQRILEERYKIYAVREILLKEITEQDKLKLGFDADTAIQDVPNFNFLNDPSSNVF
                     EFYLKSLSLLDNVITIRFKLFQLIKLISKFEYEPELKRSKAVAYSRIVLSLNLIENKL
                     NYLQQNELADISYSKLTRYISKNLSKSVSMFNRYCHAIRIEDVVNDKSNFNIFKEFLR
                     DNYNESGYVLVEYCEIIDKIKNPLEHFNSNEFSVVFTKLNIAELLQIIATFFKGKRLE
                     MMRTLDAGLVENIILFSTCGEVTQESCILCRKSLLILQDEAEKVLAQKYFEIFKNTDM
                     FLIMISLPSFTYTSVYYNHFEETTPEKEHLTRKNDRTVLYNSKINQKLERVINDDSNN
                     ELHRKSYDPSNIMATSREENDVELYKDFLQQDEPHKINKRLISERILSTVQNISFGID
                     NNRLGNSVKEIKNKLAALTISIDGIEKEIHLLDHLILKANLTDNRKQLKLLQRSRSSL
                     IKELHEAETSKQQYLLEENFHRLYLRTNIAINSYYIDDLTEKNKAVTYYLIHVKYNMN
                     ESIRTWEIPRRFNEFVMLNSYLKNQHQTSMRNIVKSGIFPSKITLSLKYQVSKTLLIE
                     ERIVRLENYLSQLLSIPEICDDDIFRTFLTTATPFSLDEVSYVSTITSVDDISKTDNP
                     HGTNSIDGNKIHLAYSSENELDPDTLLNDSYEEAGDNMLANNGSSRGSKGSYQKLKQD
                     INSMNAADFQKSDLQGSKKSFIKPICDLFIAIYKYDSKGTTWIRGRAILTILKQLLGS
                     TIDKYLKVHIKKLESEQTIYHVLHMFKESIWGEEGVLKRKQTADYGIARDSIERERAK
                     NDSLIQLQKLMIELSGKVVGLNNSKIAAIRIHGMLQNRYLNTSLLLEIFDFFIDETIL
                     KNKGT"
     gene            complement(<81859..>82428)
                     /gene="TPHA0I00410"
                     /locus_tag="TPHA_0I00410"
                     /db_xref="GeneID:11534501"
     mRNA            complement(<81859..>82428)
                     /gene="TPHA0I00410"
                     /locus_tag="TPHA_0I00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686934.1"
                     /db_xref="GeneID:11534501"
     CDS             complement(81859..82428)
                     /gene="TPHA0I00410"
                     /locus_tag="TPHA_0I00410"
                     /inference="similar to DNA sequence:INSDC:YMR269W"
                     /note="similar to Saccharomyces cerevisiae TMA23
                     (YMR269W); ancestral locus Anc_8.823"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686982.1"
                     /db_xref="GeneID:11534501"
                     /db_xref="GOA:G8BXC0"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:G8BXC0"
                     /translation="MDSREYLKSYGWKEGEGLKKDSLKKPILVKHKRDKKGLGNAPGG
                     DDSEAWWERLFDGQLKSLDVTSDSKGKGITFNQNEVKATSVSNNVSPLYKWFVRGEPL
                     KGTIDDKFLKKNGIVIASIDEPKNNKRKRSDYDDDGDAKEYKKSKNRSKEAKKDKKSK
                     KDKKSKKDKKSKRDKKSKSNKSKKVKEHE"
     gene            <82903..>84300
                     /gene="TPHA0I00420"
                     /locus_tag="TPHA_0I00420"
                     /db_xref="GeneID:11532916"
     mRNA            <82903..>84300
                     /gene="TPHA0I00420"
                     /locus_tag="TPHA_0I00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686935.1"
                     /db_xref="GeneID:11532916"
     CDS             82903..84300
                     /gene="TPHA0I00420"
                     /locus_tag="TPHA_0I00420"
                     /inference="similar to DNA sequence:INSDC:YMR268C"
                     /note="similar to Saccharomyces cerevisiae PRP24
                     (YMR268C); ancestral locus Anc_8.822"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686983.1"
                     /db_xref="GeneID:11532916"
                     /db_xref="GOA:G8BXC1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BXC1"
                     /translation="MDNSMGVKRRNDDNETEHASDNSVISSEEQANGAKIRKTTKSHN
                     REVSTILVKNLPKSFNQGKIKKIFKDCGNILHIETAEPLDKVFRYARIEFEAHENALM
                     ALTKTNKKYGDNEIEVIVLQNMTVWITNFPPSFTVNDIKNLFLENGVVPISVRLPSLR
                     FNNNRRFAYVDITDPQDVNHIIEALNDKMVSNYKLVVRESNLLERQKRTDSAVIEKRE
                     IFVKMANSSALDEQILRGIFSKYGTIEAIKLSKDRENFPDNNGNNFGFAFITYSNSDE
                     AKKALELHRSILKDSQIFVTISDKKAYLERQEIKRIINSKHRSNDDMFISIFPLADKI
                     TKSQISKLINEKTNIPEHSIMKIYLVADYNGCIVKFNNSRYSAKCIMALDNSTYNNKN
                     IRCSNINGLKKSQDHKNDKKVTLGTTYRDSSNNLKAINKPPAISIDKNQEEISSDTHS
                     TKKMNNDDFRKMLGL"
     gene            complement(<84357..>85259)
                     /gene="TPHA0I00430"
                     /locus_tag="TPHA_0I00430"
                     /db_xref="GeneID:11532917"
     mRNA            complement(<84357..>85259)
                     /gene="TPHA0I00430"
                     /locus_tag="TPHA_0I00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686936.1"
                     /db_xref="GeneID:11532917"
     CDS             complement(84357..85259)
                     /gene="TPHA0I00430"
                     /locus_tag="TPHA_0I00430"
                     /inference="similar to DNA sequence:INSDC:YMR267W"
                     /note="similar to Saccharomyces cerevisiae PPA2 (YMR267W);
                     ancestral locus Anc_8.820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686984.1"
                     /db_xref="GeneID:11532917"
                     /db_xref="GOA:G8BXC2"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:G8BXC2"
                     /translation="MIRNTALRRLIQSKDILAGKKAFSSVTLGTKYTADFRQYLKLPN
                     GEIGSYFHDIPIELNETDCTVQMVTEVSRWSNGKFEISKELDFNPIVQDVKNENVRFV
                     HNIFPYHGYIHNYGALPQTWENPTKFSAIPGTETLKGDNDPLDCCEIGSRIQNIGDIS
                     TVKVLGSLGLIDDGELDWKVIVINVKDPMAQKLNDFKDVDKNFPGLLEATREWFRAYK
                     VPAGKPENSFAFDGHYKNAEETIQIIKECHKEWESLISGNLHKLHPDIPVIKRAGLGV
                     TLESENKTPNEIPNYVYKWHYINK"
     gene            complement(<85668..>88622)
                     /gene="TPHA0I00440"
                     /locus_tag="TPHA_0I00440"
                     /db_xref="GeneID:11534517"
     mRNA            complement(<85668..>88622)
                     /gene="TPHA0I00440"
                     /locus_tag="TPHA_0I00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686937.1"
                     /db_xref="GeneID:11534517"
     CDS             complement(85668..88622)
                     /gene="TPHA0I00440"
                     /locus_tag="TPHA_0I00440"
                     /inference="similar to DNA sequence:INSDC:YMR266W"
                     /note="similar to Saccharomyces cerevisiae RSN1 (YMR266W);
                     ancestral locus Anc_8.819"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686985.1"
                     /db_xref="GeneID:11534517"
                     /db_xref="GOA:G8BXC3"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:G8BXC3"
                     /translation="MQLAIGSCGSFVFWSRCVLDIDRPKTIILHTRSMSTTDVTGTST
                     QQVLTSLVSNGVIFGAFMTGFLLLRIKLKRIYEPKSSFALIAEEKRPEPLPSGLWQWF
                     LPLLKKSDNFIIKQAGLDGYFFLRYLFLIAAYTGCSIVYVFPILLSVNAANGGNSAGL
                     DVLAYQNVTDPKRYYAHVFVGWVFFWGFILLMYRELYYYNSVQQNVVSSNRYAKKLSS
                     RTVLFTTVPKQYLSETEFSKLFDGVKRVWIARAQNGVEKLVKERENMAMNLENILNNL
                     LKKKIKKIGKDIKKNKETDDIKLINRIRYANSIDKIVTVSEFLTDKERPKLRVQKWKF
                     WTKKVDALDYFKEQLPILNAKIGDLQSNQMDSSPFNSVFVEFESQYQAQVASQLVPYH
                     APLFLTPSYIGIHPQSIIWFNLRMMPYERLIRQTAATASMCALVIVWAFPVAFVGLIS
                     NITYLTNKLPWLNFIYKLPDVLLGLLTSLAPTVALALLMMCLPVIIRNAAKFAGAPST
                     QYVEYYTQQTYFAFQVIQVFLVTTIASAATSTVTQIVEEPTKAMELLAENLPKASNFY
                     IAYIILQGMSVTGSALLQIVPLAIYYTLGKVLDPTPRKKYNRFSKLASLSWGTTFPVY
                     TNLAVIIFSYAIISPIILLFATFGFFLLWVAYLYNLNYVYAEAPDARGIHYPRALFQT
                     MVGLYIGQICLLGLFVVGKGWGPIVLQIVCLVVTVLLHLFLNHCFDHLMKNIPIDTMK
                     PLDGESHTASFKNIYSQKHDDPFGDVKVLPNFPIRKYRSRSGSAGTDVERINSNTLDD
                     KFNIQYEVSNTNNNGLVEMFNGDISATPLLADGDDSAIPTAPFWKRFIFPHTYCSYKA
                     VKNRIPDIYHVPDPDEITDPDELEHAYDYPAVSAKCPYLWITKDPYGFSQSLITDLAE
                     VIKISDEGASLDENGKITWEGTPPSYEYNLDPLRDSDAKDIEINYADSPIDKDDPFTD
                     EGKSPREGEKSL"
     gene            <89882..>91564
                     /gene="TPHA0I00460"
                     /locus_tag="TPHA_0I00460"
                     /db_xref="GeneID:11534518"
     mRNA            <89882..>91564
                     /gene="TPHA0I00460"
                     /locus_tag="TPHA_0I00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686938.1"
                     /db_xref="GeneID:11534518"
     CDS             89882..91564
                     /gene="TPHA0I00460"
                     /locus_tag="TPHA_0I00460"
                     /inference="similar to DNA sequence:INSDC:YML102W"
                     /note="similar to Saccharomyces cerevisiae CAC2 (YML102W);
                     ancestral locus Anc_8.817"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686986.1"
                     /db_xref="GeneID:11534518"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BXC4"
                     /translation="MEAGNLQIYWHESQPIYSLCFQKHTKAKKLITAGGDNKIRVWNL
                     NMNADGTRVETIDFLTSLNQHEQAINAVRFNPAGDVLASAGDDGQLLLWTQSDSSNKD
                     TSINTNIQSLDAKNDGANGNESWFIYKRLNSQTAMSSEIYDIAWSPDGNYIITGSMDN
                     SLRVFDVNKSQQIILVNDNSHYVQGVTWDPQNKFVFVQSADRSLSVYELIFDKNETNK
                     LVNLKLKNKIWKCDLPKHTIDEATKKEKLDFDSTRSSYLFHNETLPSFFRRLDISPCG
                     NLIGVPAGVFRSANAETNSTANNNNQELSNAVYIYSRGYLSKNSNKPILRIPFLKKPA
                     IVVSFNPNLYKLVDPSNAPIKLQYKLIYAIATTNEVLIYDTESSKPIAVIGNLHYTPL
                     TDLAWSEDGNLLMVSSTDGFVSYVSTKNNILGEKLSKEERETICKLDVIIPESGSKDA
                     SLLKKEESKPIVNILTVKTKEVKPNEVNRKKLKTANLPNTDFSKNIQIPLFPINNREN
                     DNKKTYYLKKRRGYNLYYYKVNTISICYLKKPLENQQISYNLFNHHNFLKRK"
     gene            complement(<91951..>92541)
                     /gene="TPHA0I00470"
                     /locus_tag="TPHA_0I00470"
                     /db_xref="GeneID:11534519"
     mRNA            complement(<91951..>92541)
                     /gene="TPHA0I00470"
                     /locus_tag="TPHA_0I00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686939.1"
                     /db_xref="GeneID:11534519"
     CDS             complement(91951..92541)
                     /gene="TPHA0I00470"
                     /locus_tag="TPHA_0I00470"
                     /inference="similar to DNA sequence:INSDC:YMR264W,YML101C"
                     /note="similar to Saccharomyces cerevisiae CUE1 (YMR264W)
                     and CUE4 (YML101C); ancestral locus Anc_8.816"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686987.1"
                     /db_xref="GeneID:11534519"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:G8BXC5"
                     /translation="MDSSTLTFLLTLLFGFIFIKWTFQSEQHPSTQNLSSNSTTSTAN
                     LSRRTNNGATNRRRFKRRVTDDMIEVVLSLAPALHKEQIRYNLEETGSVEETVERFLR
                     GDEFPFPPNYTPTQTMAATGNDTNNENSNDPRKKSNIKPDNLIEKFNVDLDYDFAGKD
                     FNELDISDRKKYLVWKARKAMENVLENDKEMSDLLN"
     gene            complement(<92927..>93949)
                     /gene="TPHA0I00480"
                     /locus_tag="TPHA_0I00480"
                     /db_xref="GeneID:11532842"
     mRNA            complement(<92927..>93949)
                     /gene="TPHA0I00480"
                     /locus_tag="TPHA_0I00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686940.1"
                     /db_xref="GeneID:11532842"
     CDS             complement(92927..93949)
                     /gene="TPHA0I00480"
                     /locus_tag="TPHA_0I00480"
                     /inference="similar to DNA sequence:INSDC:YMR262W"
                     /note="similar to Saccharomyces cerevisiae YMR262W;
                     ancestral locus Anc_8.814"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686988.1"
                     /db_xref="GeneID:11532842"
                     /db_xref="GOA:G8BXC6"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:G8BXC6"
                     /translation="MFQWKRAGGYGKQNKSDCIEMTSFPYVDAHCHLSTDRIVSHGFG
                     YSNSDSFNYVEYRDVLRCVMSNNQFDLMKVKKIRNNSMLIRSFGIHPWYSHLFTLKDD
                     IGKLEHYREVLQWKDEQEFQKLVEALPPPLKLQQYIDDNFNANEFDVIGEIGLDKLFR
                     LPDNGFYTSVDTGRLTRTQVKISHQVNVFHAMLQLSKQYQLPISVHDVKCHQVLFESV
                     YDILGDQDAINICLHSYTGSVEMLGHFWFKKFNQNRVFLSFSGFINFSNSATAMPLLQ
                     SIPKESILTETDFPIDLQTEQELQLEIKKVYNGIREILQFESEDALRALVYNNTQRFL
                     KRDVEQ"
     gene            <94502..>97897
                     /gene="TPHA0I00490"
                     /locus_tag="TPHA_0I00490"
                     /db_xref="GeneID:11532843"
     mRNA            <94502..>97897
                     /gene="TPHA0I00490"
                     /locus_tag="TPHA_0I00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686941.1"
                     /db_xref="GeneID:11532843"
     CDS             94502..97897
                     /gene="TPHA0I00490"
                     /locus_tag="TPHA_0I00490"
                     /inference="similar to DNA sequence:INSDC:YML100W,YMR261C"
                     /note="similar to Saccharomyces cerevisiae TSL1 (YML100W)
                     and TPS3 (YMR261C); ancestral locus Anc_8.813"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686989.1"
                     /db_xref="GeneID:11532843"
                     /db_xref="GOA:G8BXC7"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8BXC7"
                     /translation="MTIIVASLFLPYQPQFVVQSNEFDANLVNPSLVKVKIPNENQKN
                     KRSDSVHTSPFAKAADVGSTEFHGSMNGISDQLAGPVNQGEMSGLGTPTISDGDMISG
                     DLFIENLTANASVIGSPRSAALPQKNANKTASIDEFFPSSSAQLPETTSLRKKAVTGS
                     GLDSNFHASNALNNDISPSLSVISSPASESSAHANIATHLANDMSTSTLLKNVNKSLL
                     YQNVLKGNSQTSLEGHTMKSASSHRNTVITPKSKTVPDFQSSAVVNFAKVRQQNQETS
                     LPSMRRVPLMTDKSGSLTPTSVTGGIGTRNVPSHLKYEIDSKYIATSESDEEDGKSDD
                     SDLENNSSTVYNVPGFGGYSNNEKIKSSLLKRSKYLFSQIPWDIVAGSKGNGALKNAI
                     ETAILEKTITEPVQWIGTVGMPTDEIPSDIIANISDTLSEKFASSAVITDDITFKGAY
                     KNFCKQILWPTLHYQIPDNPNSKAFEDHSWGYYQKLNQQFADKIVENYKVGDIVWVND
                     YHLMLVPAMVRAKIATANIGFFLHVSFPSSEVFRCFAHREDILRGIIGSNFVGFQTKE
                     YERHFKQTCSRLLLADITENGLKYKGNMISSNHIPMGVDVFRINQQIKNAKVVQWRQL
                     IRERWAGKKLIIGRDQYDRIRGLDRKLLAYERFLRENPHYIEKVVLIQICLGKANDPE
                     LERQIMMTVDRINAMSQNISISQPVVFLHQDLDFEQYLAINCEADAFFVDALREGMNL
                     TCHEFIACSEEKNSPLLLSEFTGSADVLKDGALLINPWDIKKVSENIKRALEMSFEEK
                     RRAWKKIMKSIIKNDSDNWITTISKNIKNSWEFNEEISRVFYVSTDEVFNDYLAAKKH
                     LFILKISEPPSARMISILNDLTTHNIVYILANFSKTTLESLYSRVTNIGLIAENGAYV
                     RLSKMWYNIVEEVDWMTEVVKILDDKVERLPGSYYKIAESMVRFHTENAEDKNRVAGV
                     VGEAITHINTLFSERGIHAYIHKDIMFVQQFGLSLSAAQFILRYYNSTTTSGDSNSTP
                     GTPRHYSSRSNSGLHNDYFGGTSQHHVDFFCVTGSSSPSIEPLFHLVSQESQKGLLKY
                     GHSIVYGNATSTFAKEHIDGYSELFTMLEHMTKTQHIRAYDYN"
     gene            <98551..>99012
                     /gene="TPHA0I00500"
                     /locus_tag="TPHA_0I00500"
                     /db_xref="GeneID:11532888"
     mRNA            <98551..>99012
                     /gene="TPHA0I00500"
                     /locus_tag="TPHA_0I00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686942.1"
                     /db_xref="GeneID:11532888"
     CDS             98551..99012
                     /gene="TPHA0I00500"
                     /locus_tag="TPHA_0I00500"
                     /inference="similar to DNA sequence:INSDC:YMR260C"
                     /note="similar to Saccharomyces cerevisiae TIF11
                     (YMR260C); ancestral locus Anc_8.812"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686990.1"
                     /db_xref="GeneID:11532888"
                     /db_xref="GOA:G8BXC8"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018104"
                     /db_xref="UniProtKB/TrEMBL:G8BXC8"
                     /translation="MGKKNTKGGKKGRRGKNETDGPKRELIYRDEGQEYAQITKMLGN
                     GRVEASCFDGIKRMAHIRGKLRKRVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARA
                     LKTQGELPENAKINETDNFGFESDEDVNFEFGNADEESEEEDDSEFDIDDI"
     gene            complement(<99220..>100872)
                     /gene="TPHA0I00510"
                     /locus_tag="TPHA_0I00510"
                     /db_xref="GeneID:11532889"
     mRNA            complement(<99220..>100872)
                     /gene="TPHA0I00510"
                     /locus_tag="TPHA_0I00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686943.1"
                     /db_xref="GeneID:11532889"
     CDS             complement(99220..100872)
                     /gene="TPHA0I00510"
                     /locus_tag="TPHA_0I00510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686991.1"
                     /db_xref="GeneID:11532889"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="UniProtKB/TrEMBL:G8BXC9"
                     /translation="MYTEIKKDNGIYDNATTSKPVHSVNDVYEVFLDSFGTIFDERRD
                     ESVFMQKVSPNCANYDSPNFAINDFLNLPNAHDKNNNNNDKTFELEKPIKNVSHTLSN
                     NTDELENVHTSETQELLDLLFEKKKLIIEITDRLIKHFEVPSVNECFSIEDINELLSP
                     AAIIGNLIDIIKHYVSNSAVTELLTSITTALINHLNNVMDHLIIDYGLFWLNNVKELY
                     FFIIEMIDTFQNSTKEKTEQYADTLAFMIEWKMMLNKLCSKVYFICISRVHSLILSIC
                     NPGGMLLKATPDINDDNFEKNFETLVTLEYPDTTDIVISLFNNLYWRMKCLQFKTTVI
                     NRIMLNVIQFFDCIYFNSIIMSVLILENDNDLYLFMNLVKLNSSVEYYNLPSPDPMPL
                     LNEIGRLRSLTLEELQQVDKIEDITNVLTQKQLQIVLVKWKGNEKSTQNMQDFLNKNL
                     RESADDATYLRELLTLVPSLEVINLFENLFKKVDFSVTYIPFVLDLNVIETLLKGLAE
                     KKCEVITSFIGIKKFFDTPINRIEDESHQNDSLLDDLDLRIL"
     gene            <102763..>103839
                     /gene="TPHA0I00520"
                     /locus_tag="TPHA_0I00520"
                     /db_xref="GeneID:11534346"
     mRNA            <102763..>103839
                     /gene="TPHA0I00520"
                     /locus_tag="TPHA_0I00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686944.1"
                     /db_xref="GeneID:11534346"
     CDS             102763..103839
                     /gene="TPHA0I00520"
                     /locus_tag="TPHA_0I00520"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686992.1"
                     /db_xref="GeneID:11534346"
                     /db_xref="UniProtKB/TrEMBL:G8BXD0"
                     /translation="MDYTRATEVANDTNLDVGTNQHKLVSPLGGLTRMDNDHSSSQVV
                     KETLQSNIEIPNENTDVFIRTFKNRLSTLEGLYEKTMMKHDEFLNSIEAGDYLSKITK
                     LEEEEKGLELNIEKLRTKIIDREGLLNNRTTAHTRTSINNTVTNGSNKEEGNQQTNLM
                     NNGSLMFKTLNGKEVVINKNYLPLNIEFKLINIEDLPLWIKEFVKFLNYYNLDNLNEL
                     PESTIIDPVEDQFIKGQLKENIKCEDIYDFIFMENSSIEILNEVKRIFLRKLNFAKRQ
                     KLWKQVSITEKSNNLALQLNLLNKLVGIEEFIDTNKMEIFNLTINRINNQVLQRINAV
                     PIDLSKITPTQYLGIIKKQRRGCF"
     gap             103997..104397
                     /estimated_length=401
     gene            <104925..>106061
                     /gene="TPHA0I00530"
                     /locus_tag="TPHA_0I00530"
                     /db_xref="GeneID:11534347"
     mRNA            <104925..>106061
                     /gene="TPHA0I00530"
                     /locus_tag="TPHA_0I00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686945.1"
                     /db_xref="GeneID:11534347"
     CDS             104925..106061
                     /gene="TPHA0I00530"
                     /locus_tag="TPHA_0I00530"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686993.1"
                     /db_xref="GeneID:11534347"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8BXD1"
                     /translation="MTPDIRQGIFRNHDYSIMIAVYVDDCVIAAKSQELLDEFVSTLR
                     NRFELKIIGKMNQGILRTDVLGMDLDYNIDEGKISLSLQSYIESIENDWLDKISHIKT
                     TSIPHVSSYEHNIKNIDSMDTKTRSKKINELQKINGVINYIRSRCRYDIEFAANKLAR
                     SVNFPADNVFYMADKLMNYIFQTKSEKIVFTRETTDNPAITLLSDASLGTEHDMKSRM
                     GIMLWYGENLYKVISRASSAVRNSSTEAELDAIYEGSKEAYYLKKILEEMNLQKDPTV
                     ISITDSKPSIQYLKNNYNSNRRDRFLDLKLAKLEERIRADDLLIYKIAGTDNIADVLT
                     KPVSCEDFKKLRSSMQNKLTPKDILTITDPGEFHSPSSSISTIS"
     gene            106614..106687
                     /gene="TPHA0Itrna1N"
                     /locus_tag="TPHA_0Itrna1N"
                     /db_xref="GeneID:11534348"
     tRNA            106614..106687
                     /gene="TPHA0Itrna1N"
                     /locus_tag="TPHA_0Itrna1N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11534348"
     gene            <107264..>108934
                     /gene="TPHA0I00540"
                     /locus_tag="TPHA_0I00540"
                     /db_xref="GeneID:11534539"
     mRNA            <107264..>108934
                     /gene="TPHA0I00540"
                     /locus_tag="TPHA_0I00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686946.1"
                     /db_xref="GeneID:11534539"
     CDS             107264..108934
                     /gene="TPHA0I00540"
                     /locus_tag="TPHA_0I00540"
                     /inference="similar to DNA sequence:INSDC:YMR258C"
                     /note="similar to Saccharomyces cerevisiae YMR258C;
                     ancestral locus Anc_8.810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686994.1"
                     /db_xref="GeneID:11534539"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8BXD2"
                     /translation="MVDNVLIDALRFVVSHLNQHDLLTLSTVSKEINEKVVKPQLYKN
                     IIVLEDPIIRSSRWAIDCDKTYVSGFNSVIKTKDQNDIFLYDKIQRLLDDEYVENLKY
                     VKTLLIAKHSFNDKETSIYLVQKLITEIIKYGNVESLKILDPVIFHKVYLKSLNLTTL
                     KEVKLLDINDITQLKTSKRLKSITIDGNIEKIAPETIAYMNENLCDNFSNLQELLINN
                     KENGSLRFFQIFSDLNISFKKVGIKKIKFSHMHSKTGYESIIQPLTIEYLDKVFDLSL
                     IKSLDISIGCENDGCDCLSKFYKDLSNKLLNLQKLSVTENTLITKGDHVTEEKWDILL
                     GRFLLSIPHVSTNLKELNIRHNPPLDGDQKNSVDGNYFRRRDLYKEILLNLRALKKLT
                     SPTILLTLSCYDILIGDLLWNGCTCEYCQKVLPILDNYCMKHLLYLERQASYIDISVT
                     NFFAYVNRVLNSRFSDQIDSDFEIATTAPMAKFWNLHGFDNIRHFEGYECKYNETVFQ
                     LIPTVVTHFFDGYMDTLVQILPNLEVVIFAGIYYEVDPITHEYDSIYD"
     gene            <109607..>112048
                     /gene="TPHA0I00550"
                     /locus_tag="TPHA_0I00550"
                     /db_xref="GeneID:11534654"
     mRNA            <109607..>112048
                     /gene="TPHA0I00550"
                     /locus_tag="TPHA_0I00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686947.1"
                     /db_xref="GeneID:11534654"
     CDS             109607..112048
                     /gene="TPHA0I00550"
                     /locus_tag="TPHA_0I00550"
                     /inference="similar to DNA sequence:INSDC:YMR257C"
                     /note="similar to Saccharomyces cerevisiae PET111
                     (YMR257C); ancestral locus Anc_8.809"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686995.1"
                     /db_xref="GeneID:11534654"
                     /db_xref="UniProtKB/TrEMBL:G8BXD3"
                     /translation="MIKVKQLLLPTSRIPEFYFGISRKSICEVHYRSFCNTEITSIKL
                     DQEQNKTNSSAHNPERSTQNLSKFNEVPNALLQMSYDMHHSTTKNNNTIQENNESRLI
                     SEVVFKEKWKLKFIEADPMTIKNILVMIRSNECIFSISQMLLLVKCLETYNKEYHIYV
                     LARAYLKLLPNLRDDSNEFHGLLVHFLRTASKLGDYRLCEELFSLYIKLPIIDPKIIR
                     IGLQAFIKNDNFDLAKEFYIQVLNNPETFPMFVDDLYSYLLDLFQYKDYEAMDYAYKL
                     WLLKKCSIKIESKFDPNRNVLSLMHKTYMKSSRSELLDEFLKDAFVKRQKYIDSTEFK
                     LIEFYNKLHQDHLSEPVNIEELHTNIDNFINLIGEDREILRGFYLSVLDILITKKNIQ
                     TIQYLTTKIHTNLDIAFDTEFLVLGAKYFVRTGSVQNLVDYYTHLMVNKHQNVNNNER
                     VQLNQELFLQFRDCLVNKYPFLVREITNELRIFTKDRKLLNELYWLKNVDKNLSRISK
                     KQALGGTEYQISYLNDIDYYRYDTFCNQLKLLDLKHTEETLNDIIRGRTRPSLELCYL
                     MLQDSLNMKLPRIINLLHNYLRDAYKQLPIKFDILWLKQNIKESEALGYYHNRGGGRF
                     GVIEEIKVREIVNKYKGNLTIFDYLKLAHIAINNNSFKIVPSLLESSYLLLNKDDSKN
                     WYYFYLASLKYTAREYNYKNFLFLLKNWNNNEQADYLTNGCIRQLKSFTKIFIKRMDK
                     IEDYDKNIMDKIDNEVEILKNRYINKKFEGLNDITLATSFLKKWIEHDIDLKFKALER
                     KKANNIQQYTVTKAE"
     gene            <112560..>113744
                     /gene="TPHA0I00560"
                     /locus_tag="TPHA_0I00560"
                     /db_xref="GeneID:11534655"
     mRNA            <112560..>113744
                     /gene="TPHA0I00560"
                     /locus_tag="TPHA_0I00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686948.1"
                     /db_xref="GeneID:11534655"
     CDS             112560..113744
                     /gene="TPHA0I00560"
                     /locus_tag="TPHA_0I00560"
                     /inference="similar to DNA sequence:INSDC:YOL054W"
                     /note="similar to Saccharomyces cerevisiae PSH1 (YOL054W);
                     ancestral locus Anc_8.808"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686996.1"
                     /db_xref="GeneID:11534655"
                     /db_xref="GOA:G8BXD4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:G8BXD4"
                     /translation="MSNTIHAVVHRSSDQCKDQLLIKFIDTLMCSICQDYMFVPMMTA
                     CGHNYCYGCLKSWFTSNETTELSCPQCRSSVGSEPNLNSVLQQGMNCLVEVMKQETGD
                     DDSGEKDYSSFFDAIKAAEIEYKADKDDNNLFGSVFSNSALAVVDEDDDGIARCSNCH
                     WELDPDFEEEDGNVCPHCNVRIRNRVTGGNSRSTREDGTRRTREGFDSDEYSDGELDA
                     LEDDLQRYQRDSDRVIEEFSAEESADNENSLTSQFNRRFPVPKRGRDLFNDEAEEASS
                     DEDDSDKDDNENDEDEIVTGYRKKRSIHHSSDVEQEDGRPNKEEELPHQPGVDGEEEI
                     DSDLASFIVNDDGEVSEVTSDDNDILDDFRDEDRTPNDDATDTSSPRRKRFQVILDSD
                     DE"
     gene            <114286..>114477
                     /gene="TPHA0I00570"
                     /locus_tag="TPHA_0I00570"
                     /db_xref="GeneID:11534365"
     mRNA            <114286..>114477
                     /gene="TPHA0I00570"
                     /locus_tag="TPHA_0I00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686949.1"
                     /db_xref="GeneID:11534365"
     CDS             114286..114477
                     /gene="TPHA0I00570"
                     /locus_tag="TPHA_0I00570"
                     /inference="similar to DNA sequence:INSDC:YMR256C"
                     /note="similar to Saccharomyces cerevisiae COX7 (YMR256C);
                     ancestral locus Anc_8.807"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686997.1"
                     /db_xref="GeneID:11534365"
                     /db_xref="InterPro:IPR014367"
                     /db_xref="UniProtKB/TrEMBL:G8BXD5"
                     /translation="MASPQRIIELQKIFQKSTKPLWMRHPRSAFYLYPFWGLFTVAVV
                     APCLYIPNAILGIKPKRAE"
     gene            <115287..>116339
                     /gene="TPHA0I00580"
                     /locus_tag="TPHA_0I00580"
                     /db_xref="GeneID:11534366"
     mRNA            <115287..>116339
                     /gene="TPHA0I00580"
                     /locus_tag="TPHA_0I00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686950.1"
                     /db_xref="GeneID:11534366"
     CDS             115287..116339
                     /gene="TPHA0I00580"
                     /locus_tag="TPHA_0I00580"
                     /inference="similar to DNA sequence:INSDC:YOL053W"
                     /note="similar to Saccharomyces cerevisiae YOL053W;
                     ancestral locus Anc_8.806"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686998.1"
                     /db_xref="GeneID:11534366"
                     /db_xref="UniProtKB/TrEMBL:G8BXD6"
                     /translation="MSQIFRKAHLTAKLGSSWGKNVNIQLHLKVVIAKRVYSIDNGKK
                     NDSKYMFSKPPFTPRNKETDTKHFFTKPRLFETFRFTRKNQGPVNESIANNESETIGQ
                     AISQHRKKNRQVISTIILGIFVTIIGYSIGYKVFYRGDDIFIPLYPAPRIRKPSQTDL
                     KKIDVDYIKRLSKIRVIEALSRHNMVKEEYGVPLHGEDNINPPKISDFDLWCEDRDPC
                     LTGIILRRYSPNKSSTHSWYHIPFIFQWRVTHRPIYISRGIGEMLQDLRIGYSKFYEY
                     VSPDNMYGSLKYEYPIQGDDHALSIWFLGELRLCNDTLIVYKGKYHVDVRLQRIDLLR
                     KEKGKLVRYILFEENE"
     gene            117139..117211
                     /gene="TPHA0Itrna1A"
                     /locus_tag="TPHA_0Itrna1A"
                     /db_xref="GeneID:11534352"
     tRNA            117139..117211
                     /gene="TPHA0Itrna1A"
                     /locus_tag="TPHA_0Itrna1A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11534352"
     gene            <117658..>122433
                     /gene="TPHA0I00590"
                     /locus_tag="TPHA_0I00590"
                     /db_xref="GeneID:11532819"
     mRNA            <117658..>122433
                     /gene="TPHA0I00590"
                     /locus_tag="TPHA_0I00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686951.1"
                     /db_xref="GeneID:11532819"
     CDS             117658..122433
                     /gene="TPHA0I00590"
                     /locus_tag="TPHA_0I00590"
                     /inference="similar to DNA sequence:INSDC:YMR247C"
                     /note="similar to Saccharomyces cerevisiae RKR1 (YMR247C);
                     ancestral locus Anc_8.799"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003686999.1"
                     /db_xref="GeneID:11532819"
                     /db_xref="GOA:G8BXD7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:G8BXD7"
                     /translation="MSFGRGVNAFQKYSNDVGLGHNGVIVSLNYFDGIPDQSLIRSLE
                     CNELILIFKYLLKRDEKTKEKALNDLLSHLNSVEEDNSTELRLYFENDIFTLCWSQVY
                     AKMTVSESKNIRTVSHIISIRLITILKKKISKFLPDLIPFVLLGCSDNDSSVSQSCSK
                     ELKKCFNDDSKKIVALWTMFQEQILTLIKNIVVIEDAASLSDKSYIDKDLSELRHTRL
                     LTSAMNLLNTFVELNEVKYEKHQIEQELFSDIISEESLWKKVSFKSTNNLKLCEVLLI
                     FLQKLYKSEILFKSSSNLKLIVRILLKALSQISSRNIRNLQTSIGPLLNDLTLLDTYK
                     EGKIWSYDKAENTREKLCTFLTVISENPFPGNFTDMYMFYEQTSKHALLNNDNEWLVI
                     WQKGLKSLVVLGARGRYSVQLYHEFWINYIKFLNSANLKGAEKYKENDLFKTLSTYKE
                     LKNQDDLKKNLSCLLSPSLLVNKLKELLEKNQSNDEKTNTIFEENILCLLMVSENNQS
                     ILNDLLDYIHDIIISKISSASANIKSLVDIFYFIVRSDIPNISKNIFKVINEIAASVD
                     ESNYDYLSNIVIAFSESNYIKAEEDNIDPIMIIEDFFIVANSININPIKIYQTLNGLN
                     KLVLRELAEKSDFILSTLISDYISLYDFDDSIPLLFNLITINNIVLLYENSKRKNKIP
                     EFIALLDQLDKTVIDGLLQSNTFLSETYLKLPSDLSNAIFDLSINSASENCIACSLAQ
                     SIKNAAIENVYAKTSDVISNAVSLIQANNIVAEYFFNSDISSLLNNYLVTIDSKLVTI
                     SNLGISSHLLNITDNSLDLQKLIKLINYISFVDKLLTKLPDFKDSYQVYLVTLVSEIA
                     TDYNCITSLPNDEFYAFNNTIYNSDLSSIDFISCINKLLLDDNTSTDDTPLTMFYADN
                     DNENDLSLYYRSKILYRILENTVDTISTSALSTIVPIIETSVTKLVRSKTTDNISRQY
                     IKCSIILKALEKFHSNQLFNKLRTMLLSELIGVNETDILNKSYRSLILLCDLLNSPDF
                     EESYVPVPLQRLNMAFGSINKLLDSEIIYEQSFSSVRLILLNLFERLICVPSFKDVNF
                     SVAYRLLADSLTMCQLDDTSFLFELRFSCMSLYQKIDNLDINFSNNEYGLEISDSIIE
                     LFFINFPQEENNQISKGFYYMLNKAVSKFDVKLLLECFDRFFEFYTTTGTSGNINQVR
                     CIVTILRKLIIEKQKNAIIEFEFEKQKAINEDEDEDADADADADDEELEIRNNLIKDK
                     MEINFGIPDALIKLLNDKMPEDYLEYENRLTYVSYLWNWVLVFCYFKDTSYNLRQLFL
                     DQLRKKNLIEKFFTFISEQLDFHDNEFIQSIESSDVVYYNIGKDGFIPYEGALTRECK
                     TLLVHLLYELFVHVGTYTNVWFLNIKDRSKQSDIDKMVSKHISPILISNELNNVENNI
                     SHLTAKDDVLTIRVNKITNEVKASYLIDEQKLEIALKLPSNYPLTNIQVHGISCVGVS
                     DQKWKQWIMSAQRTITNMNGSMVGALELFTRNVNLQFSGFEECAICYSTLHAVDRKLP
                     TKVCPTCNNKFHGSCLYKWFRSSNNNTCPLCRSEIALRR"
     gene            <122877..>124397
                     /gene="TPHA0I00600"
                     /locus_tag="TPHA_0I00600"
                     /db_xref="GeneID:11534353"
     mRNA            <122877..>124397
                     /gene="TPHA0I00600"
                     /locus_tag="TPHA_0I00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686952.1"
                     /db_xref="GeneID:11534353"
     CDS             122877..124397
                     /gene="TPHA0I00600"
                     /locus_tag="TPHA_0I00600"
                     /inference="similar to DNA sequence:INSDC:YOR320C"
                     /note="similar to Saccharomyces cerevisiae GNT1 (YOR320C);
                     ancestral locus Anc_8.798"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687000.1"
                     /db_xref="GeneID:11534353"
                     /db_xref="GOA:G8BXD8"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BXD8"
                     /translation="MILKRKLRIIPIAILVILAIVYFCNSVVHFQLHKEIKYYKKYFK
                     QRKNGIQGSYYPLAIKQIPAETIDHLYDTRLARAKSSKDKIDWKKLAYVNYVTEPSYL
                     CNTLIMFQSLITHGTQAKLLLLISPELLDPNSESSIEYNTVALIEHIKKLNTDEENPQ
                     IIIKSVDTILKQNDSTLWKNSLTKLAVFNQTEYDRIIYMDNDAYLTDSLDELFFIPDY
                     IKFAAPLTYWFLSEKDLKKAADEVENDDGEPTNLYFYLKQIDARIDKGQMIYNHLPSL
                     PHTLFLDSKDIADDIIHGTPSRSPLLDYVKTRRTSKLKFASNLMVIKPSEDDFNRIIT
                     EFLPELINKKDSYDMDLINDYLYNLKYIISEQFMIFRKLKSHFTPEVMVLPFSRYGLL
                     TGSIKNRNHYPMIANDILGYTKIEEKTKSDKIDGLNIATKPDDIKISDYISKNKYIHF
                     SDYPLGKPWQYEKFDDFKCVVDKKNSKHSEDDAEMCKVWNSVFELYMVERNICAKV"
     gene            complement(<124638..>126746)
                     /gene="TPHA0I00610"
                     /locus_tag="TPHA_0I00610"
                     /db_xref="GeneID:11534354"
     mRNA            complement(<124638..>126746)
                     /gene="TPHA0I00610"
                     /locus_tag="TPHA_0I00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686953.1"
                     /db_xref="GeneID:11534354"
     CDS             complement(124638..126746)
                     /gene="TPHA0I00610"
                     /locus_tag="TPHA_0I00610"
                     /inference="similar to DNA sequence:INSDC:YMR246W,YOR317W"
                     /note="similar to Saccharomyces cerevisiae FAA4 (YMR246W)
                     and FAA1 (YOR317W); ancestral locus Anc_8.796"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687001.1"
                     /db_xref="GeneID:11534354"
                     /db_xref="GOA:G8BXD9"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:G8BXD9"
                     /translation="MYSVEIDKPANEHETAIRRNVDAKNGLVTIPVGMKCTTVYEFAV
                     ERFNQIANKDAMGWRDVIEIHEEEKIIVKKVDGKDTEVKKTWNYFELSGYKYNKYSEL
                     LTIFETLGKGLLKIGLRSSIDDTIEADKIHIYASTSHKWMKIFLAAQSQNLPVVTAYD
                     TLGEKGLIHSMKQTNSKAMFTDNALLKSLVNPLAEATNLKYLIYSDTIDPNDKRFGGK
                     LYNEANEALEELKKIRPDVQFYSFDEIMEFGSNIPNDTTEFEFIRPKPEDLSCIMYTS
                     GSTGDPKGVVLKHKTVIASLGGCGVNTAFVGETDRIIAFLPLAHIFELTFELLVFLWG
                     ATIGYANVKTLTTASVRNCQGDLQEFKPTVMVAVAAVWESVKKGILQQVSNLPFITQK
                     IFWGAYKAKSTMNNYHIPGGNALGNLVFKKIKQATGGNLRFVLNGGSPVSLETQTFIT
                     NLICPMLIGYGLTETNASGAILRPKNFELGVTGDIVCGIEVKLVDVEELGYFAKKNQG
                     ELWIRGDPVTPEYYKNPEETKNAFTEDGWFKTGDIAEFTPKGFLNIIDRKKNLVKTLN
                     GEYIALEKLESIYRSNQYVANICVYADITKVKPIAIIVPNLPPLTTLAKKLGILKGNE
                     DIESYLNNKQLVKAAYDDIIKTGRAAGLVGIEMLQGIVFFDGEWTPQNGFVTSAQKLK
                     RKLILETVQKQVDKVYASSS"
     gene            <129124..>130386
                     /gene="TPHA0I00620"
                     /locus_tag="TPHA_0I00620"
                     /db_xref="GeneID:11532914"
     mRNA            <129124..>130386
                     /gene="TPHA0I00620"
                     /locus_tag="TPHA_0I00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686954.1"
                     /db_xref="GeneID:11532914"
     CDS             129124..130386
                     /gene="TPHA0I00620"
                     /locus_tag="TPHA_0I00620"
                     /inference="similar to DNA sequence:INSDC:YMR243C,YOR316C"
                     /note="similar to Saccharomyces cerevisiae ZRC1 (YMR243C)
                     and COT1 (YOR316C); ancestral locus Anc_8.792"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687002.1"
                     /db_xref="GeneID:11532914"
                     /db_xref="GOA:G8BXE0"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:G8BXE0"
                     /translation="MTHSLALVADSFHMLNDIFSLIVALWAVNVAKTRKPDEKYTYGW
                     KRAEILGALINSVFLIALCVSIFIEAIQRLFEPQEIGNPYLVLSVGAAGLASNIIGLF
                     LFHDVGHGAHSHSHGDSHDDLEDYGELHDESSHSHATSQPTEHSHSHSLSPTPEETPS
                     SSGSITNVIPQVIVDNEASHLLAGTNNNHNAHLEQRSNTHIGHSHGSMNMQGVFLHVL
                     GDALGNIGVIVAALFIWKTDYSWRFYADPLVSLVITVIIFSSAMPLSRKASKILLQAT
                     PSTIASQSVQTDILAIPGVVSVHDFHIWNLTESLFIASVHVKVDATPENFTSIAKLIR
                     NVFHNYNIHSATVQPEFINSSITADQNKKFSILAGSSTESSTALEITNGTQDVIRPSQ
                     NRYGSTQDQSNCLVDNLSNCNTDDCLPK"
     gene            complement(<130661..>131719)
                     /gene="TPHA0I00630"
                     /locus_tag="TPHA_0I00630"
                     /db_xref="GeneID:11532915"
     mRNA            complement(<130661..>131719)
                     /gene="TPHA0I00630"
                     /locus_tag="TPHA_0I00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686955.1"
                     /db_xref="GeneID:11532915"
     CDS             complement(130661..131719)
                     /gene="TPHA0I00630"
                     /locus_tag="TPHA_0I00630"
                     /inference="similar to DNA sequence:INSDC:YOR315W"
                     /note="similar to Saccharomyces cerevisiae SFG1 (YOR315W);
                     ancestral locus Anc_8.791"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687003.1"
                     /db_xref="GeneID:11532915"
                     /db_xref="UniProtKB/TrEMBL:G8BXE1"
                     /translation="MKYDFEPVVQMKSSTPLSKIRKSNTIPNAPLKACKVHGLMKLQL
                     EQGTDLVSTPCKKSSRLNKDLLAGRAITRQTIIVSHSHDIKALLNPDISEISQTNLDE
                     VSDDDTISLPDNEVNIFDNAPYCIPKERIVSPLSDIEDDEKESLKTLYDSLSRNSNRL
                     YRTEKNILRGLTSESEYTLTKDNIASHNCDGDGTFEQFEQEYKKHYPQHRNPNIRTKP
                     LLLYPKEHLNLLVTSSRGSVDDATIFATEVNSVTRFGKGTSDDQMLPMITNELQKISI
                     PVLTSLEERKNMIKNKYHIEEQYEQQYFGNSYSVCDNIDDQESESAIIRGYRFEHDQC
                     NNNTNVTVRKEKHIRWTN"
     gene            <134234..>134674
                     /gene="TPHA0I00640"
                     /locus_tag="TPHA_0I00640"
                     /db_xref="GeneID:11534661"
     mRNA            <134234..>134674
                     /gene="TPHA0I00640"
                     /locus_tag="TPHA_0I00640"
                     /product="60S ribosomal protein L20"
                     /transcript_id="XM_003686956.1"
                     /db_xref="GeneID:11534661"
     CDS             134234..134674
                     /gene="TPHA0I00640"
                     /locus_tag="TPHA_0I00640"
                     /inference="similar to DNA sequence:INSDC:YMR242C,YOR312C"
                     /note="similar to Saccharomyces cerevisiae RPL20A
                     (YMR242C) and RPL20B (YOR312C); ancestral locus Anc_8.789"
                     /codon_start=1
                     /product="60S ribosomal protein L20"
                     /protein_id="XP_003687004.1"
                     /db_xref="GeneID:11534661"
                     /db_xref="GOA:G8BXE2"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:G8BXE2"
                     /translation="MRIFAPNTVVAKSRYWYFLQKLHKVKKASGEVVSVNEISEAHPT
                     KVKNFAVWVRYDSRSGTHNMYKEVRDVSRVAAVETLYSDMAARHRARFRSIHILKVSE
                     IEKTADVKRPYVKQFLTKDLKFPLPHRVQKSTKTFSYKRPSTFY"
     gene            <135050..>136672
                     /gene="TPHA0I00650"
                     /locus_tag="TPHA_0I00650"
                     /db_xref="GeneID:11534662"
     mRNA            <135050..>136672
                     /gene="TPHA0I00650"
                     /locus_tag="TPHA_0I00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686957.1"
                     /db_xref="GeneID:11534662"
     CDS             135050..136672
                     /gene="TPHA0I00650"
                     /locus_tag="TPHA_0I00650"
                     /inference="similar to DNA sequence:INSDC:YOR310C"
                     /note="similar to Saccharomyces cerevisiae NOP58
                     (YOR310C); ancestral locus Anc_8.787"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687005.1"
                     /db_xref="GeneID:11534662"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:G8BXE3"
                     /translation="MFKRILKLLVKVLLFLKSKATARHQPIIELCKMAYVLTETSAGY
                     ALLKASDKKIYKSSTLIQDLDTSDKVLKEFKIAAFSKFSSAANALEESNAIIEGKVSS
                     QLQKLLEDIKKDKKSTLVVSETKLANSINKLGLNFNVVSDAVTLDIYRAVKEYLPELL
                     PGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRVKE
                     WYGWHFPELAKIVVDSVAYARIILTMGIRSKASETDMSEILPEEIEERVKTAAEVSMG
                     TEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAH
                     SGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIA
                     RVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRLSQIEGRDLRTTPKVVREAKK
                     VEITEARAYNADADAANATSDSSDSDDEEEVKEEKKDKKRKREDEEEEEKKEKKSKKE
                     KKDKKEKKEKKEKKEKKDKKDKKDKKSKKEKK"
     gene            <137526..>138911
                     /gene="TPHA0I00660"
                     /locus_tag="TPHA_0I00660"
                     /db_xref="GeneID:11534658"
     mRNA            <137526..>138911
                     /gene="TPHA0I00660"
                     /locus_tag="TPHA_0I00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686958.1"
                     /db_xref="GeneID:11534658"
     CDS             137526..138911
                     /gene="TPHA0I00660"
                     /locus_tag="TPHA_0I00660"
                     /inference="similar to DNA sequence:INSDC:YOR307C"
                     /note="similar to Saccharomyces cerevisiae SLY41
                     (YOR307C); ancestral locus Anc_8.785"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687006.1"
                     /db_xref="GeneID:11534658"
                     /db_xref="GOA:G8BXE4"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:G8BXE4"
                     /translation="MRYTEVVTEKHRRPSLNNLVSTVDITPVENLSFQLPNPSPIYNQ
                     RRASHGGLNTVTDVPIYTSVLKEFQVKTSLINQNLGKILEIRNSKISLLCASWYIISS
                     ICSNISKAILKRFPHAVVLTIMQFALVSSISLSFVILANYFHSPTYKNSQINKALKSF
                     PDGVLPNYLDGSFRDSIWDSFLKPTKLALATTFPMGIFQFLGHITSHKSTSLIPVSLV
                     HSIKALSPIITVVYYRFVHKKQYNTMVYCTLLLLICGVMTTCWKGSLQNKSENNESSL
                     QNLKGLIYAFLSMLIFVSQNIFAKGILTVKKSPGILSSSSSSSSISSVSSTDLKRISF
                     SPNQLDKLTILFYCSIMGTMLTMPAFITSELMKENNFYLDLNIELFLLILLHCVTHFI
                     QALLAFQLIGMISPVNYSVANIMKRIVIISVALIWEAQLNVRQIFGLGLTIAGLFGYD
                     RWGVCKKNTRN"
     gene            complement(<139133..>140059)
                     /gene="TPHA0I00670"
                     /locus_tag="TPHA_0I00670"
                     /db_xref="GeneID:11534659"
     mRNA            complement(<139133..>140059)
                     /gene="TPHA0I00670"
                     /locus_tag="TPHA_0I00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686959.1"
                     /db_xref="GeneID:11534659"
     CDS             complement(139133..140059)
                     /gene="TPHA0I00670"
                     /locus_tag="TPHA_0I00670"
                     /inference="similar to DNA sequence:INSDC:YMR241W"
                     /note="similar to Saccharomyces cerevisiae YHM2 (YMR241W);
                     ancestral locus Anc_8.784"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687007.1"
                     /db_xref="GeneID:11534659"
                     /db_xref="GOA:G8BXE5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8BXE5"
                     /translation="MTTGEQGKKKVSYSNLVLGAVLNLSEATTLGQPLEVIKTTMAAN
                     RNATSVQAIKQIWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSADVENRAKAGLGLG
                     NFAAGILGGISGGVVQAYATMGFCTCMKTVEITRSKTAAAGVIPKSSWAVFKEIFAKD
                     GIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRKITGKKNPEDQLTALEKITASAI
                     GGGLSAWNQPIEVIRVEMQSKKADPNRPKTLTVASTFKYIYQTNGIKGLYRGVTPRIG
                     LGIWQTVFMVGFGDMAREFVGKFTGDTPVNKH"
     gene            complement(<140531..>141187)
                     /gene="TPHA0I00680"
                     /locus_tag="TPHA_0I00680"
                     /db_xref="GeneID:11534660"
     mRNA            complement(<140531..>141187)
                     /gene="TPHA0I00680"
                     /locus_tag="TPHA_0I00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686960.1"
                     /db_xref="GeneID:11534660"
     CDS             complement(140531..141187)
                     /gene="TPHA0I00680"
                     /locus_tag="TPHA_0I00680"
                     /inference="similar to DNA sequence:INSDC:YCR020C"
                     /note="similar to Saccharomyces cerevisiae PET18
                     (YCR020C); ancestral locus Anc_1.439"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687008.1"
                     /db_xref="GeneID:11534660"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR026285"
                     /db_xref="UniProtKB/TrEMBL:G8BXE6"
                     /translation="MTTTTAQLIQKYSDLLKHATEHKLTSELCAGTLSDRTLCIYLAQ
                     DLKFFNTSFRLICKTTTECPNDKSMIYLGKKIGFFANDENDYFQKCLELLATAIKDDA
                     DKEKNCTNEIPSTTRYLKSIQAKLDDDKKLYDYPKLITALWTAEIVYYLWAHNTPRKE
                     NLHWKYQTWIDLHDGPHFEEWCDFLAKEVDQYSLEQVEDSFKQCVELEINFFNGCYNA
                     "
     gene            complement(<142051..>142785)
                     /gene="TPHA0I00690"
                     /locus_tag="TPHA_0I00690"
                     /db_xref="GeneID:11532860"
     mRNA            complement(<142051..>142785)
                     /gene="TPHA0I00690"
                     /locus_tag="TPHA_0I00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686961.1"
                     /db_xref="GeneID:11532860"
     CDS             complement(142051..142785)
                     /gene="TPHA0I00690"
                     /locus_tag="TPHA_0I00690"
                     /inference="similar to DNA sequence:INSDC:YOR305W"
                     /note="similar to Saccharomyces cerevisiae YOR305W;
                     ancestral locus Anc_8.782"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687009.1"
                     /db_xref="GeneID:11532860"
                     /db_xref="InterPro:IPR018828"
                     /db_xref="UniProtKB/TrEMBL:G8BXE7"
                     /translation="MLNKFLRRLPQRRYINNDNLVKYIKDNELIKDSKVFQGTLYEYT
                     VIRELEQKLLMNQLKKVGGAHDGGVDITGKWAVGKIFHSLQDRNLINIDNHTPKRFVI
                     NDRSAMPIYQKFIGQNAVKNPRPLDILVQCKAFSLSKIGPKHIRELVGTYWSKVSPKK
                     VNRTFMMICSPHLPTREGLKLLNSCNIPLLYVQVGMLNLMNNEYDLEKSGSLLNYYEN
                     EYASKLLQNIGIKEWLRLKGHKNWEG"
     gene            <143222..>143476
                     /gene="TPHA0I00700"
                     /locus_tag="TPHA_0I00700"
                     /db_xref="GeneID:11532861"
     mRNA            <143222..>143476
                     /gene="TPHA0I00700"
                     /locus_tag="TPHA_0I00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686962.1"
                     /db_xref="GeneID:11532861"
     CDS             143222..143476
                     /gene="TPHA0I00700"
                     /locus_tag="TPHA_0I00700"
                     /inference="similar to DNA sequence:INSDC:YOR304C-A"
                     /note="similar to Saccharomyces cerevisiae YOR304C-A;
                     ancestral locus Anc_8.781"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687010.1"
                     /db_xref="GeneID:11532861"
                     /db_xref="UniProtKB/TrEMBL:G8BXE8"
                     /translation="MSSDEISIHSVGTSLEKSEPKLATSGNQEPDTEAKDTITVYDLV
                     SQLQESLTELDKDLDTKNETLQQSIKKIENKLTELTKKKK"
     gene            <143903..>145363
                     /gene="TPHA0I00710"
                     /locus_tag="TPHA_0I00710"
                     /db_xref="GeneID:11534475"
     mRNA            <143903..>145363
                     /gene="TPHA0I00710"
                     /locus_tag="TPHA_0I00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686963.1"
                     /db_xref="GeneID:11534475"
     CDS             143903..145363
                     /gene="TPHA0I00710"
                     /locus_tag="TPHA_0I00710"
                     /inference="similar to DNA sequence:INSDC:YMR239C"
                     /note="similar to Saccharomyces cerevisiae RNT1 (YMR239C);
                     ancestral locus Anc_8.779"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687011.1"
                     /db_xref="GeneID:11534475"
                     /db_xref="GOA:G8BXE9"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:G8BXE9"
                     /translation="MGSTQKRDSEHLQDTFSSVHKKSKKIVVNNKDDGNIEAEDDNVG
                     AHAFSETILKVSDITQLEHAVTKLLESFQTIIQLAPNFKCFQEDYKQLEKIPVSLLPS
                     YSRYQLKLASELKSLYELEKVPILNDLYNYEENYNQATGTKSYLKDLTDIDIEKLSNK
                     YTVKDPDADKASFPNDDEEDENNEADDKKSQKKSSWPPKIPEIKNPAIRAKVFTHKSI
                     VKDKLYLKETEMVNTHNERLEFLGDSILNTVITMILYNKFPTFSEGQLSSLRRHLVSN
                     ECIKKWSYLYDLPGNLKTNLETEQDKLNFHYGHKKIHADVFEAYIGGLIEDDPKHNMP
                     KVRKWLSKLAKPIIDELTKKDISLQQPDNLNLNAKKELYSLIGYASLNLHYETTKKAS
                     YDSPICIVQCITGDGTVLGTGKGRNAKMAGINAAQNVLDNRELVEEYAKRRAAIPRED
                     SRIKGARGDHKDNQEKEIEKPKITLTEDGEFKFVLQ"
     gene            complement(<145599..>149669)
                     /gene="TPHA0I00720"
                     /locus_tag="TPHA_0I00720"
                     /db_xref="GeneID:11534476"
     mRNA            complement(<145599..>149669)
                     /gene="TPHA0I00720"
                     /locus_tag="TPHA_0I00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686964.1"
                     /db_xref="GeneID:11534476"
     CDS             complement(145599..149669)
                     /gene="TPHA0I00720"
                     /locus_tag="TPHA_0I00720"
                     /note="ancestral locus Anc_8.777"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687012.1"
                     /db_xref="GeneID:11534476"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="UniProtKB/TrEMBL:G8BXF0"
                     /translation="MIPKRKGQTKEVKRDVFGRDLSYFKSYSQYIENLKDINVYSADF
                     ESGYTPLHITLKRGYFKRAFQLFKKWKDEQEFLSHKLGGHVMNQIDREGFTPFELYMV
                     EYRRLIKKYPKYISYRVPGSTTASNKTQICYYEDINKLPLGRKLEYPNLPTSVEELIY
                     LKSSKASHALTFGVNINFQLGTGTTDARKNLFQLSVHQLEEDNIILSDIGLKNIFITR
                     YHSLIVTNGNNIFVTGSTGRGRVGNGVIDTPQTQYTKLRGLPTQNIKDICTSDHHTMV
                     LCNDNEIYTWGWNYFCQLGHSVTNKPSDKSYHTDCSSIPKRIGFLPGVEIISISCSKI
                     HSACATKTGRILLWGLNVGQMGTSNPVHLSHDSVYMDVEGYLTTKPVEINLGDEIIEQ
                     ILCTEFTTFVRTRNNILHVYSNYSSKTFRLLLPRPSRNIDRDNFTYFAPREIPSNVID
                     MKCKNPFGNNLTLKYSCGRIGTITSKEESIYLWSTMKNTPHISLCWTPNYDFKRCVDF
                     DVSSKGELIICTAGGEVYKYQDKDTPLEKIFSTKLTSGKIVRVSCDSQFGSFALLKNE
                     FDSIPIMFPKDSLLYDFSRFCDVVPGTTIKNDLGNEIAGVMARKYFDYNDYSLNKLQN
                     HELLDSDENAAKISYRSQQAAELNTKILSEIGKSNINGRKTFDIVFKDKITSKIVCTG
                     HKLLLMSRCSTLMNLLLKEKFFSLHDNQIVLELVNNIHESNWEIEISGKLGPDVIKEV
                     IYYLYTDIKPSNQKVSRLLLEMVDHSLHYSSLHNSLSNLYYDIVTHKSSDSLNFVDTK
                     ILLNNGCVFAHSLILSVRCSYFKIMFEENWYTIDSDGYKLLDLKSNFNVTKDIFAFVI
                     KYIYGFPYDLIFQDAAPLSYTENLQTLLDLLEITDFLNLQSFKTYLEAEIDKYIEGET
                     VILILLNAIAFNCDLLETKCNWFICKNIAILFSKNNIPLIEEHFTERIWDRLELCFSE
                     LSSDSNTVTEFMAWYYESHYDWLALFNGNLSKFNEKFIDPHNCFVPVFDLKCLKKKPI
                     EEKTKRRKSMNIHKPRSKTLPCSKSSLTCEEQQNLIENKETSSSWAQNNSHSMVIDDS
                     NEFVEVTRKAKRKNSKNTEKKPELRNIVNKETSSKVVLHKNVNKDNQTLVSLTDADNA
                     KREQHKNNSLNQKLWGTFRKTSQKDRKKIIDASLETNSKSEMSEQPVWGKAISTGTEP
                     IEKLKQAAIVSKKSNLPSLYDPNSPKIISDTKKSKNEIIKHLPQTDSIHMPYVRASQH
                     VPLNAIDTQFEKDQLKKRKSKKQMQEEMEAVQFERWFEEESERIQRQMKKDDKSVNNK
                     ENDCINTPRGKSKTKNQNKISQTTIEIRKKGTYTPE"
     gene            151770..151841
                     /gene="TPHA0Itrna2R"
                     /locus_tag="TPHA_0Itrna2R"
                     /db_xref="GeneID:11534477"
     tRNA            151770..151841
                     /gene="TPHA0Itrna2R"
                     /locus_tag="TPHA_0Itrna2R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11534477"
     gene            <154198..>156786
                     /gene="TPHA0I00730"
                     /locus_tag="TPHA_0I00730"
                     /db_xref="GeneID:11534673"
     mRNA            <154198..>156786
                     /gene="TPHA0I00730"
                     /locus_tag="TPHA_0I00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686965.1"
                     /db_xref="GeneID:11534673"
     CDS             154198..156786
                     /gene="TPHA0I00730"
                     /locus_tag="TPHA_0I00730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687013.1"
                     /db_xref="GeneID:11534673"
                     /db_xref="GOA:G8BXF1"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="UniProtKB/TrEMBL:G8BXF1"
                     /translation="MLKFASLFLLVQATLISATKVLSTRESAWTNTYTTTYSTEISVE
                     NGFLGLFKTTTTIYDVYVPAVQSTIYNSAVYTNAKDSSVVTYSTSQYQTQGANGAFTI
                     YTAYYISTPVRASATTSYSYGTFSGSVAQTAVTTSTATVSNVETIVTLYNVALPTDAL
                     KSYTTNEWDGSVTSTSTSAFVATDSYGLKVTSTVFDILTPRPSGVTSYAAYTGNSTVF
                     YSTIVNINFGFKGLLFGAWETTTYLVNTPIRNSIETVTLGTEVATERATVSSVVSTVI
                     GADSQATTVTYYFVAPVHHYATSTSFTQGTQTDATVTFTTDVSVVNGTNGIATTETVY
                     GVAIPTHFQKSTTFDYWPGTFVTTYATDIQTTVGTDGSSTANTVFYVYTPRDEGITSY
                     AAYTGNSTVFYSTIVNINFGFKGLLFGAWETTTYLVNTPIRNSIKTVTLGTEVATERA
                     TVSSVVSTVIGADSQATTVTYYFVAPVHHYATSTSFTQGTQTDATVTFTTDVTVVNGT
                     NGVITTETVYGVAIPTTYHQTTSFIEGSASVTTISTEYSTITGTDGKATEETIFHVET
                     PRASGIYSNVPYNGTETSVFSTSVDIEWGFQNLIFGLWSTSYYFVHTPSRVSTEYSTQ
                     GYFGNSTSTYSTGVSTITGTDKEATTVTLFLVQTPMHWEKTTVLSQGTQTSGEVTYGT
                     TTNTVTGTDGEQTTITTYSVALPTYHQRSISLVAGNNFIPTVISTQYVTGVGADSSST
                     ETTVYIVATHSDYFAATTTTTWDRDYTTTSHKVEVSWGFVGVLFAPWIIREYVVYVPE
                     DLSSQSYYETESSYETESYIPTSSSVYEDVTESFIGTSSFVASVSGTVSVLSGYVSYQ
                     NGTVVN"
     gene            complement(<157124..>157681)
                     /gene="TPHA0I00740"
                     /locus_tag="TPHA_0I00740"
                     /db_xref="GeneID:11534520"
     mRNA            complement(<157124..>157681)
                     /gene="TPHA0I00740"
                     /locus_tag="TPHA_0I00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686966.1"
                     /db_xref="GeneID:11534520"
     CDS             complement(157124..157681)
                     /gene="TPHA0I00740"
                     /locus_tag="TPHA_0I00740"
                     /inference="similar to DNA sequence:INSDC:YOR297C"
                     /note="similar to Saccharomyces cerevisiae TIM18
                     (YOR297C); ancestral locus Anc_8.767"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687014.1"
                     /db_xref="GeneID:11534520"
                     /db_xref="GOA:G8BXF2"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:G8BXF2"
                     /translation="MLARRFMKNSLGRVKSYEIAKKSINMKPRFISFNSNIDKFKIKP
                     TPPGGVIGDVNQAYKPPEADYFHGSYHWLYERSIAVALLPLSIYSIFTAVTGGVAYPM
                     IDVTTGLSALFYLQYEYLSCITDYIPKRKFQLWHNIAKSLLYSGSAVAAYGLYDIHTN
                     NNGFTNLIKKTFVDDESNLYIFGRY"
     gene            <158028..>159512
                     /gene="TPHA0I00750"
                     /locus_tag="TPHA_0I00750"
                     /db_xref="GeneID:11534521"
     mRNA            <158028..>159512
                     /gene="TPHA0I00750"
                     /locus_tag="TPHA_0I00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686967.1"
                     /db_xref="GeneID:11534521"
     CDS             158028..159512
                     /gene="TPHA0I00750"
                     /locus_tag="TPHA_0I00750"
                     /inference="similar to DNA sequence:INSDC:YOR298W"
                     /note="similar to Saccharomyces cerevisiae MUM3 (YOR298W);
                     ancestral locus Anc_8.768"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687015.1"
                     /db_xref="GeneID:11534521"
                     /db_xref="GOA:G8BXF3"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:G8BXF3"
                     /translation="MTLADSIETNVIGPRDQFKEWTLKDWITVGCRIIIIFKYIVLQT
                     ILLGFRQCLIWLTEGRVYERGIRINNSIWRSIPILGSSCITLLPSLLGKLRSKLIPFL
                     NNLIIMLQLLYQYHVVDMTFKNNNNVRIFITGQSDTLQLEENNQQMTSLLVANHRSLV
                     DYFLINYLLQENSTNKLTKYDIFKNFRNIERLEYHKTNFICWGSISNFPFVKFFINIF
                     YHDENVGISPIVLKENILQNGNQTFVIFPEVNIMSTELALVQRKINQEYSYTTKFYNV
                     LYPRFKTFVNIIDVFANLKNVKRQKCTNIFENGKNKLNEKLVNIIGNVSKSHLRNNCT
                     RNNNPQSVSTQGLNLGIDFLLKNKFISENSNDQSLNLRGVSNDEKKMKTIILNDNLYN
                     ITIVYYKLNYTEKGHDHMNGSLKLHKGYQLDQINPSLLQMLRPGRDNSSKENPPIIVI
                     VHISKHDINTILSSKETSLEKWLENLWKEKDILIDSIENGINLN"
     gene            complement(<159553..>160773)
                     /gene="TPHA0I00760"
                     /locus_tag="TPHA_0I00760"
                     /db_xref="GeneID:11532851"
     mRNA            complement(<159553..>160773)
                     /gene="TPHA0I00760"
                     /locus_tag="TPHA_0I00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686968.1"
                     /db_xref="GeneID:11532851"
     CDS             complement(159553..160773)
                     /gene="TPHA0I00760"
                     /locus_tag="TPHA_0I00760"
                     /inference="similar to DNA sequence:INSDC:YMR235C"
                     /note="similar to Saccharomyces cerevisiae RNA1 (YMR235C);
                     ancestral locus Anc_8.769"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687016.1"
                     /db_xref="GeneID:11532851"
                     /db_xref="GOA:G8BXF4"
                     /db_xref="InterPro:IPR027038"
                     /db_xref="UniProtKB/TrEMBL:G8BXF4"
                     /translation="MATLNFTPVYNDGEVFSIAGQARKLTTKEDIQFILDDLSSLEKV
                     SKLDVSGNTIGIEASQALARFIKENDHVKDNLKEVNFADLYTSRLVDEVVESLISLVP
                     VFLACPQLEIINLSDNAFGLRTIDQLEELISNAINLKHLILSNNGMGPLAGERIGKAL
                     FNLAQNKKKNNKSLLETFICGRNRLENGSALFLAIGLKSHASDLKVVKLYQNGIRPKG
                     VATLIHYGLKYNENLEIFDLQDNTFTATASTILAQVLPTWKHSLVELNLNDCLLKTEG
                     SHSVFEVFQNHVFEKLTTLKFEYNEMGQSTLEDVFIPILQKGENLPKLKILKINGNRF
                     EEDSEPLDLLQEFFDDELELDDLEEVDSEEESEDEEAGNEEIMEEHDIAALESELLAL
                     EIEDLTKELKDTHL"
     gene            <161090..>161632
                     /gene="TPHA0I00770"
                     /locus_tag="TPHA_0I00770"
                     /db_xref="GeneID:11532852"
     mRNA            <161090..>161632
                     /gene="TPHA0I00770"
                     /locus_tag="TPHA_0I00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686969.1"
                     /db_xref="GeneID:11532852"
     CDS             161090..161632
                     /gene="TPHA0I00770"
                     /locus_tag="TPHA_0I00770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687017.1"
                     /db_xref="GeneID:11532852"
                     /db_xref="UniProtKB/TrEMBL:G8BXF5"
                     /translation="MYEEALEDKTVSPICKRLSIYMSISIANLSANRPSTVDGGSHEK
                     QIKVYAAPELTERSNWVAGGNCPEGCADACIFVSFSVVLRLFSRFFRQRPAAPRVGKG
                     GGGGVNDANARGSRSRRAVSRSFRVPCCLAQRHRTVLFREETAFWKSFPSQDEPQDEP
                     QDEDADGAEHREAQRDRWRR"
     gene            <161912..>163087
                     /gene="TPHA0I00780"
                     /locus_tag="TPHA_0I00780"
                     /db_xref="GeneID:11534649"
     mRNA            <161912..>163087
                     /gene="TPHA0I00780"
                     /locus_tag="TPHA_0I00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686970.1"
                     /db_xref="GeneID:11534649"
     CDS             161912..163087
                     /gene="TPHA0I00780"
                     /locus_tag="TPHA_0I00780"
                     /inference="similar to DNA sequence:INSDC:YJL134W,YKR053C"
                     /note="similar to Saccharomyces cerevisiae LCB3 (YJL134W)
                     and YSR3 (YKR053C); ancestral locus Anc_1.217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687018.1"
                     /db_xref="GeneID:11534649"
                     /db_xref="GOA:G8BXF6"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:G8BXF6"
                     /translation="MSELEVQTSRRASAVGLDALSGKTMSINVNDPKYALMDPGTQPN
                     QYFKAKMSPFRYAVRQYLKPYTNKQSLQLFSWQQRLRTPGRDSFFKYTSLMGSHTFYV
                     LCIPMPPWLGHYELVKDLVYLLGYSIYISGFLKDYWCLPRPISPPLKRITLSKYTTRE
                     YGAPSSHTANATSVSILFLINCWNNTSSLSLQLRLLITLSIFGYYITLVAGRVYCGMH
                     GLLDLFTGAFCGVVCVVGRRVAQYVLKDFDVGKQNIWYPVFSILFANTLLFNHVKSID
                     PCPCFEDSVAFIGVVSGIECGDWFIHRYAFNYVFHTGGASNAPLNILFKILTGVTCVS
                     VWMYVISKPLLNSIAKNFENEKNMAKVDILKRFTRYFTVPVIVTVLTPFLFSKLSLI"
     gene            <163617..>168470
                     /gene="TPHA0I00790"
                     /locus_tag="TPHA_0I00790"
                     /db_xref="GeneID:11534650"
     mRNA            <163617..>168470
                     /gene="TPHA0I00790"
                     /locus_tag="TPHA_0I00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686971.1"
                     /db_xref="GeneID:11534650"
     CDS             163617..168470
                     /gene="TPHA0I00790"
                     /locus_tag="TPHA_0I00790"
                     /inference="similar to DNA sequence:INSDC:YKR031C"
                     /note="similar to Saccharomyces cerevisiae SPO14
                     (YKR031C); ancestral locus Anc_1.251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687019.1"
                     /db_xref="GeneID:11534650"
                     /db_xref="GOA:G8BXF7"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR015679"
                     /db_xref="InterPro:IPR016555"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:G8BXF7"
                     /translation="MSITKLKLSKKKILQERNKKGNGFDHVDGGEDNNAASVIPNDVD
                     SDKSATMTQDYPNLSNTESVDAEAELKNVTFQGIPNSVLKANLMVDPQATTDKLNASK
                     NSKKVNSTVNPLGKIMSNGSKKSVKNSKMDRSKSVGSIYQNSSLNLKKQLDGNGAKLN
                     PAERRRSFLSNAGELKLNLGNIPGVHETFQKIQSFSTPRTLRPSTDNFMENKSITKQA
                     IAVEEDSDLYTRQMASDLINTMLAGTPAALFASTQFMRDERHRKRAPLLLAMLGVSVE
                     PVDNNAMSDIFSITSQLDNSNIPNANQPNLEIQPNISSSSSVSSIFSSNEDREYGNTY
                     FRLKLEYGVGKNRMKWSIIKSYKELAQFNARLRLISFHQDTVNKLHYGSDKTAHMHLP
                     RFPKVTDKETFHRHRSKNKSSRDINIHSDENVTDENASLLSTNPSINIHLADRVHLKH
                     LNDSYESKNDINLPMHIRLQRYLRLLNVILTLRPQANRLFQFYEFSPISNLLSYENSY
                     KGKEGYMVVRSTAKAQGWRVFHFSPKGLKDMVERHTNKWFLVRESYIMYVADLYSNTP
                     LDVFLVDSNFKVRISGTKDPGYARDMYWNPNNVTNLPTKFMINLENGERKLQLITTSD
                     HVLKQWMLSILFMAKSTVWTNRNRFGSFAPIRKNAYCKFLVDGRDYFWSLSKALMQAE
                     DVIYIHDWWLSPELYMRRPLGGNQKYRLDRILKERAENGVKIFIVVYRNVGGIVGTDS
                     LWTKHSMLRLHPNIHIIRSPNQWIQNTYFWAHHEKMTVIDNSVAFMGGIDLCYGRYDT
                     PDHALTDNFSDLKDQFFPGKDYSNARICDFFGLDKPFESMYDREGLPRMPWHDVQMVT
                     VGESARDMGRHFVQRWNYLIRQKRPSRPTPLLTPPVDFKPEELINSSFFHMIKNGASC
                     ETQVLRSAGNWSLGLKETEKSIQNAYLKLIETSEHYIYIENQFFVTTSRWDGVVIENK
                     IGDAIIDRIIRASSEGKVWKAFIIIPLMPGFDSPVDRPEASSLRVIIQCQYQSISRGE
                     SSIMARLQKLDIDPTQYIQFFSLRKWSTIGNDKKLITEQLYVHAKLMIVDDRSCIIGS
                     ANINERSQAGNRDSEVAILIRDTDLIKSKMGGKHYMAGKFALELRQRLMREHLGCDVD
                     LIDIIERKFQRLKLLAELNCETLHVVDRKKNVTDKIDSAMIELGYREVFRRSATQKWL
                     ATHNVNDFKNYGLLQSLEGELQTEQEEILMDREDLLHGKIQKLPKKSFYNDNNEKNNY
                     HSFNYRAGEENVGLRDKKNISTDPRLTNNIIHDEEVAGLGADGWKKVTPDFLKSVSKQ
                     LQKWSTDSFSTKSIEGKEDPLVCNLPNESDLEDYITSDSISSRKKWDMLKRVSYLQHL
                     IYKKKHGSSPGKVHDEEVGDTEDSLANHRKHSIILEEQELDDEAIDSLLSQISPSFGD
                     IKNKNKSLFQFKFLDPYSFNDPLIDDFYDDLWFSVALKNTLLFRLVFHCQPDNAVQSW
                     SEYKDYQRMAAEFDENQEKLVKLEETYHTDNSVESINHSTENNLMAVSKNKQQARAKA
                     LKMNLSGSLLYGINNRMFDKYTAKRLLERIQGHLVIFPTEWLAKEIESKNWFYNTDRL
                     TPIDIYD"
     gene            complement(<168820..>169563)
                     /gene="TPHA0I00800"
                     /locus_tag="TPHA_0I00800"
                     /db_xref="GeneID:11534651"
     mRNA            complement(<168820..>169563)
                     /gene="TPHA0I00800"
                     /locus_tag="TPHA_0I00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686972.1"
                     /db_xref="GeneID:11534651"
     CDS             complement(168820..169563)
                     /gene="TPHA0I00800"
                     /locus_tag="TPHA_0I00800"
                     /inference="similar to DNA sequence:INSDC:YKR030W"
                     /note="similar to Saccharomyces cerevisiae GMH1 (YKR030W);
                     ancestral locus Anc_1.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687020.1"
                     /db_xref="GeneID:11534651"
                     /db_xref="InterPro:IPR007881"
                     /db_xref="UniProtKB/TrEMBL:G8BXF8"
                     /translation="MSGLPVTIQDVNTNSNNNSPKAYIPSMFYRLVKTPKNLDFETAI
                     YEMINLVFKPRKAFRSFYYQRQTKQQWAREDPSFFILQIALLTVSSVVWSIVYGHSFF
                     GFLKMMINMIFIDFFLFGFTVASFFWLLLNRPMFKFRSAMQSRVEWAYCFDVHSNAFL
                     IIWVTLYFLQFLLLPIIRLHKWIGIFVGNTLYCFSFAHYFILTFYGYSQLAFLKNINF
                     ILFPSLAFAVIYLISLLGFDLSKTFSFYH"
     gene            complement(<170005..>175326)
                     /gene="TPHA0I00810"
                     /locus_tag="TPHA_0I00810"
                     /db_xref="GeneID:11532883"
     mRNA            complement(<170005..>175326)
                     /gene="TPHA0I00810"
                     /locus_tag="TPHA_0I00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686973.1"
                     /db_xref="GeneID:11532883"
     CDS             complement(170005..175326)
                     /gene="TPHA0I00810"
                     /locus_tag="TPHA_0I00810"
                     /inference="similar to DNA sequence:INSDC:YJL109C"
                     /note="similar to Saccharomyces cerevisiae UTP10
                     (YJL109C); ancestral locus Anc_1.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687021.1"
                     /db_xref="GeneID:11532883"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012954"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022125"
                     /db_xref="UniProtKB/TrEMBL:G8BXF9"
                     /translation="MSSLRDQLTQVASSNATVAFDRKRRQKLHSTSLIYNPKTAATQD
                     YDTIFELATNALQELIEIDPNFEIFEKTLFSESSISIDRNVQTKEEIKDLEQSINGFL
                     MLASSKWHLTPTLYATEWLVRRFQIHILNAEMFLLSTLNYYQTPSFKRILDIVKLPPL
                     FQPLSAFVRSEKNPTNITMIKLFNDNDFIKLYTNYLNKCIKHKFTYTNQLLFTTCWFI
                     NVIAFNSNNEEKLTELIPILLEASAKLLGSTSNDCQIAAHTIMVIFATALPLNKNIII
                     AAVETILAGYNDKLIKKSVLISIFKLFQTLRGNDNVSQLPSNIYTLLNNKISLVELTE
                     FISTSDIPTNADKFITKYIRSVIRYDHSKLDDIVKLLEKVELENFEMRHIITDLIHLS
                     EIIDDKTKLIELFSYFVSKNETLVIKCLNSLNIATELFEIRLTTSLFTVKDKEQDNTD
                     GLNIKNIDSEKVLGKEITIEPFKEFLEKHSNLIYTKSLSFLTEKSEIFNKLLSLFIES
                     IGKGYSSGLFLSSFLSTIESKITFLLRVVISPAALTTVRIIAISNISKLLSNIDKDSN
                     LFTLVPCLVCALNDVSKNVRQNVRKLLFQISKRPSTKHYFMLKEIYGENKEVPFLDPQ
                     DCSSWLSKFLDGYFVDNLDFSKLLVPRANDKILSLFWANQALLIPLPYPKLVLLRNLM
                     NVSKTSSYSYLFETFISSYVESRGTWEQECKLNKTNFIDFETVIVNLISEKEKNNFMI
                     DFMIEALNSSHEGLAEITSDRLIKLFPTFKPPVQLHIVQSIVDSINSDDVSYDTAATL
                     QALPMNADIFVSLLGNVRITSDDGVSDIAKRRRRRSSTNKPVFQRDDVSLMAELHLRK
                     LTILLETLDKSKPVGTAQLLSTLFTVLSDLETLGEDGALPVLYAQETLASCMTNTIDS
                     LKSQNFTQLPNTRADSIISAIRNSQSPQVQNKLLLVIGSLATLAPETVLHSVMPIFTF
                     MGVHAIRQDNEFTAQVVEKTILTVIPALLESSQSNINEEIEFLLMTFATALNHVPKHR
                     RVKLYFTLVKTLGASNAIAPFIFLISQQYSNCINTFKLGDAKGFVEFTKSFLSSFDVA
                     DQLKGVCQFFDIVKLLISANSNEKTENSISSRTLFSNGICNYSDLELLSFYKNAFTFV
                     NKIVEDSDSDYYDFQSSLKLKLYSVLLDVTSDSTILESIQENFGSLLQTVVSFINGSK
                     LLVNKTIKEFEDSSSENEVADYQTDIKNTLFSVMSNVLTLLPINYFVNSTLPLLNSST
                     SAEIRYNLTSVIGKKFESESSKAVDSVKIVIEMLVNRVETDKSDAMMLQVDLKVLSSL
                     AAKFGEKLEGSTITNLLSLGTNLLQSDKFEVKIPSLNLITNCIQILGIKSLSFYPKVV
                     PQSLVLFKELQEGTNTYLRPQLQLSILLLFTAMVKRIPSFITSNLYDLIDIILFSNDV
                     EVSSRLSVVTLMIENIDQKEILKTLHKIWIKKLSKSSSSISISLFLSALESTVESISK
                     KSATSQSPTFFKLMLALFEFRSISEFDNNTISRIEASVHQIANSYVLKLNDKVFRPLF
                     VIVVKWAFDGEGVTNKEIKEVERLIAFYKFFGKLQENLKTIITSYFTYLLEPTNELLK
                     RFISRDLTDVNLRRLILISLTSSFKYDKEDYWNSTSRFELISTSLVSQLSNIDNVIGN
                     YLVKAIASLTTNNGRIDEHNKIMHNLLVEHVKSSTRSSEKLWTIRTMKLIYSKVGEQW
                     LILLPQLVPTIAELLEDENEEVENEVRTGLVKVVENVLGEPFDRYLS"
     gene            <177222..>179651
                     /gene="TPHA0I00820"
                     /locus_tag="TPHA_0I00820"
                     /db_xref="GeneID:11532884"
     mRNA            <177222..>179651
                     /gene="TPHA0I00820"
                     /locus_tag="TPHA_0I00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686974.1"
                     /db_xref="GeneID:11532884"
     CDS             177222..179651
                     /gene="TPHA0I00820"
                     /locus_tag="TPHA_0I00820"
                     /inference="similar to DNA sequence:INSDC:YJL106W"
                     /note="similar to Saccharomyces cerevisiae IME2 (YJL106W);
                     ancestral locus Anc_1.255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687022.1"
                     /db_xref="GeneID:11532884"
                     /db_xref="GOA:G8BXG0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BXG0"
                     /translation="MGIDSSTSTANSYSHDFLPPDIDDPPEDIPLVSIEDKYQLIEEI
                     GSGSFGTVSFAKAKYNLLEVQSVNCKKNTLLNPIGLEYDNFNNKLKGYVAIKTMINKL
                     STLNEYSKIREIKFILAIPSSKYLLQIFEIFIDNKNFNLHIVMEIMEQNLYQMMKNRK
                     KRIFSIPSLKSILSQILAGIKFIHENNFFHRDLKPENILISQTNKFYNKFYIQNENIK
                     DNYVVKLADFGLSRHINNRSPYTAYVSTRWYRSPEILLRSGFYSKPLDIWAFGCVAIE
                     VTLFKPIFPGANEMDQIWKILKLLGTPHKTKESFRTGYQPHGGFWEVSKDLANNLNLQ
                     FPYVEGYSIASIIGSSQLNDLTQVIEKCLRWNPNLRPTADELCKLDFFRNTVVNEEYI
                     KNKNLKKQMFGNKLPHDNSGDVDQHIQNDSKIKKLKTNLEQAMIFAGMKVNDSPLKPL
                     VFNEEENNNHMDIPKRNQKLSKAFSQKELFSNSNHNKIKAFNSKAFKNEIKPLHSLLE
                     DLVMSNRDTENTGTSNKLKRFPSKSKSQINSLKNSNYDVDISNLLNEYIDNNDEDIID
                     NVNKVLALHQFPDHFNFNDNDIDFQNNLDLYNGSNEKDSNYLSNKIEYLSEINKDDNI
                     DEFYDCCNDNFLQGRLEKSNTCATIDANELDDDDEIFIEESFFNDGKYKTNHNEVDDV
                     YLLSQTHPNIAEHNNLNNFDTDMNNYSHFKYNSIDDINKNSTPVVIPVNCLINNMSID
                     DDRSKTDYDNSFNNNIPRSFTFTNLTRETKQDRQSHDNNHFAYNEFFQNTDPNTTTCG
                     FQHHNNINLSF"
     gene            <182764..>184647
                     /gene="TPHA0I00830"
                     /locus_tag="TPHA_0I00830"
                     /db_xref="GeneID:11534485"
     mRNA            <182764..>184647
                     /gene="TPHA0I00830"
                     /locus_tag="TPHA_0I00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686975.1"
                     /db_xref="GeneID:11534485"
     CDS             182764..184647
                     /gene="TPHA0I00830"
                     /locus_tag="TPHA_0I00830"
                     /inference="similar to DNA sequence:INSDC:YJL105W,YKR029C"
                     /note="similar to Saccharomyces cerevisiae SET4 (YJL105W)
                     and SET3 (YKR029C); ancestral locus Anc_1.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687023.1"
                     /db_xref="GeneID:11534485"
                     /db_xref="GOA:G8BXG1"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:G8BXG1"
                     /translation="MSKNIEDKSILEDASTLLMFSKSKRDSSNDFAMSRNSSISLSPM
                     NNVNSNAKFDNDTTKEAAAAAAAALAKAATIPLPLKRKEKELTRINRKRSKLKENFNS
                     TKAKEARPSWPVPDYYIVDKDDGIITCICEINEENSATIQCHNCNRWQHKSCYKLNDE
                     DVIETLFFCNVCRPRLKKKDIISAKNLQKLKATKQPSLNTILTTNTQTTESDKGTEQS
                     TVSDIKTDNILHHPNFMKLEKSKYTDKYVKVFIKKHLDDDWVIQHNKNKDCLNLNMPV
                     EVKAYTNKSTNGSNGNTSNAGHTSNKVGLFIKTNCHTGDLIHEVTGEIDFQKSYLLDP
                     KNHYRIWATPKPKVFFHAHWPIHIDARLSGNLTRFLRYSCKPNVELATIRTTDSKENE
                     PPVLFALRALRDISMDEELHIAWQWDLRHPIWQIINESKNLDSLNEVDKYWLIHSVDA
                     VLRNCECACGSDPNCNLLKVKQYSENFYKQANSKMNNRYRLSELLNNFPKRKSTDQGS
                     FENKSVSQVPLLRSDDTHSTIGNSSVTYAREQTLSNALVKANETHKCHNKWLSGAKNN
                     ILKQNNTSTIIRGPVNDTEVVKTKIKEQNSSRSESFSSSSTAIASDGDDVKEDDLSSL
                     KMF"
     gene            <185173..>185598
                     /gene="TPHA0I00840"
                     /locus_tag="TPHA_0I00840"
                     /db_xref="GeneID:11534486"
     mRNA            <185173..>185598
                     /gene="TPHA0I00840"
                     /locus_tag="TPHA_0I00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686976.1"
                     /db_xref="GeneID:11534486"
     CDS             185173..185598
                     /gene="TPHA0I00840"
                     /locus_tag="TPHA_0I00840"
                     /inference="similar to DNA sequence:INSDC:YJL104W"
                     /note="similar to Saccharomyces cerevisiae PAM16
                     (YJL104W); ancestral locus Anc_1.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687024.1"
                     /db_xref="GeneID:11534486"
                     /db_xref="GOA:G8BXG2"
                     /db_xref="InterPro:IPR005341"
                     /db_xref="UniProtKB/TrEMBL:G8BXG2"
                     /translation="MAYRAFVHVVFTSAQVFGKAFTEAYRQAAAQSVKKGARAATGAY
                     NANAEYGGITLDESCKILDIENKNDINIDKVNEKFKYLFEVNDAEKGGSFYLQSKIYR
                     AAERLKWEIAQKEKKTEDQGSKEGQTNAQANTNSAQTKD"
     gene            <187043..>188536
                     /gene="TPHA0I00850"
                     /locus_tag="TPHA_0I00850"
                     /db_xref="GeneID:11532831"
     mRNA            <187043..>188536
                     /gene="TPHA0I00850"
                     /locus_tag="TPHA_0I00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686977.1"
                     /db_xref="GeneID:11532831"
     CDS             187043..188536
                     /gene="TPHA0I00850"
                     /locus_tag="TPHA_0I00850"
                     /inference="similar to DNA sequence:INSDC:YKR023W"
                     /note="similar to Saccharomyces cerevisiae YKR023W;
                     ancestral locus Anc_1.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687025.1"
                     /db_xref="GeneID:11532831"
                     /db_xref="GOA:G8BXG3"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:G8BXG3"
                     /translation="MTKTQAINFAIKKIPQIIPLEEEDVRNLSEQILQSANESPEAIA
                     EGFLNILGHEDLSFEFVIEFNNLLQQKDAPIKEVKSTPADISNVGIQKSVEEKKQKIS
                     KQSQINKPVINNGMTISKSLEKSQPKSKIKPVSKDKTKLSKKKTVHALKDIDEVVKML
                     ELERDNENSSSKYACNCQALRHPLFDPVPNCLKCGKIICAREGLNLNNCSYCGTDFIP
                     IEERLKIIELLKKEKEDLLNKNKLSKEEEFRYNEEKKKRNKGFKVSSGMGTNLFNEQD
                     MLFSKLEKENEKRLHDIDEANKNNEEAKNSENNKEILVTSSDSDLTEAQDRLDRLLHF
                     QDTSAERTRIIDNASDFSMSNDSGLWGSTVERALMLKNQQRNRRKFEKLEKERHGGRE
                     KYVMSLNIGKNGKVTVSELENNTETTPASIADDLDQLSDEADIKDLKDIRKLQDDLNE
                     QKNKQAMELENLKWNPDAYKLQFEDPVYITSDTTSNNNDEEKKGQQK"
     gene            complement(<188725..>190215)
                     /gene="TPHA0I00860"
                     /locus_tag="TPHA_0I00860"
                     /db_xref="GeneID:11532832"
     mRNA            complement(<188725..>190215)
                     /gene="TPHA0I00860"
                     /locus_tag="TPHA_0I00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686978.1"
                     /db_xref="GeneID:11532832"
     CDS             complement(188725..190215)
                     /gene="TPHA0I00860"
                     /locus_tag="TPHA_0I00860"
                     /inference="similar to DNA sequence:INSDC:YJL103C"
                     /note="similar to Saccharomyces cerevisiae YJL103C;
                     ancestral locus Anc_1.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687026.1"
                     /db_xref="GeneID:11532832"
                     /db_xref="GOA:G8BXG4"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BXG4"
                     /translation="MTKKLTDFEKKHRRPTVKACQMCHDKHIQCDKGRPCKNCIKRRT
                     ECHCKDIERKSTSSNLRHQINYKNASEMSLNSTVEVAVNNLQGQSSTAIVDINKIKHQ
                     PTDTNNALEALLNSTNSFLYNSYSDCDRPPKLPNVPYIESSSSTETAFPNSESNFDSR
                     WAKDEYKSLNNLITLQSASGNLILNSENNREKDILNDKNLLDKESELKTDMETTIINK
                     SFPRPHISLIIDEMQDKNAELTFNFKHKLLTEKNCLKNTRYTTPYAFRDLVKTREDLY
                     RKRELVKQHNYRLSYESLIDVLKHIFLNHEEVETVDCSDGKQDTYSIRSKQLQFILRS
                     ILDKFATHFIALSSSLIEEDIIMQEFILQRTLLNLESLTVLNNATPVAIWRRSGDILF
                     VSNEFLSLTNYDKKEILGKRRFIIEFMDPDSIVDYYATFHDSLSFSNDNRPNTSVYNN
                     MVYKKTNLLLKNGSYLKCGFCLTVIKDSFSIPLLSVGHFLPIFDSQ"
     gene            <190932..>193385
                     /gene="TPHA0I00870"
                     /locus_tag="TPHA_0I00870"
                     /db_xref="GeneID:11532833"
     mRNA            <190932..>193385
                     /gene="TPHA0I00870"
                     /locus_tag="TPHA_0I00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686979.1"
                     /db_xref="GeneID:11532833"
     CDS             190932..193385
                     /gene="TPHA0I00870"
                     /locus_tag="TPHA_0I00870"
                     /inference="similar to DNA sequence:INSDC:YJL102W"
                     /note="similar to Saccharomyces cerevisiae MEF2 (YJL102W);
                     ancestral locus Anc_1.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687027.1"
                     /db_xref="GeneID:11532833"
                     /db_xref="GOA:G8BXG5"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXG5"
                     /translation="MKGVFNLSLGRCSLRMLSTGSNGLSRIRNIGIIAHIDAGKTTTT
                     ETMLYYSGKINRIGNVDQGDTVTDFLPQERERGITIQSAAITFNWQNNYKINLIDTPG
                     HADFTFEVIKSLKVLDGCVTILDAVAGVEAQTEKVWKQSTGLPKICFINKMDRIGAGF
                     SRTVKEVIVKLKQRVAVINTPLFRTTTINGMKEDIFNGVLDIVNMKKITWDSENPDDI
                     KIEDVTGTINKDLYETLSRSRESLIEKLGEFDENIISYFLEEAEGDYFKVPPSILNES
                     IRKATLAGYVTPVLCGSSFKHIGVQPLLDAIVSYLPSPIEARPPEVNNKSMKLVIDPS
                     NGMVFDNNKNISVALVFKVIRDKIRGMMAFVRVYSGSLKNGHTVLNSSSKKSFKIGKP
                     VLMNANIPEDVQVLHTGEIGVLTGTSIIGNLETGDTLISDSIRKSGINASNKELLDLK
                     INPIIVPPPVFSVVVEPKTLGNKASMEASLQALIMEDPSLHVTRDEESGQTMLSGMGV
                     LHLEIARDKLLNELSADVNIGKLMVSYKETLETPTDIAEYVDDKGYSLSVKVEPVLCD
                     NDHKTQFTVNKIIEKPGEIWYPLGIDNNYLIIEKNNLTEARNLKFWPYLMSYDMILNA
                     LSSSSIAALQYGGKLGNFPLFSCAIRVSGDINIPKDVSKPNELLSISRKLILKTLNQL
                     NENSFSVLEPIMKIEVTIPQKAMGNVMQDLTGSRKAIILSIDDETEIIDGKNGSNVEF
                     KELAENEYLPSDITLKNANLNDDSSNLKIIKASAPVKEMMSYSTKLRGLTEGRGSVYS
                     TYHGMEKVPCDHLESILNE"
     gene            complement(<193539..>195608)
                     /gene="TPHA0I00880"
                     /locus_tag="TPHA_0I00880"
                     /db_xref="GeneID:11532858"
     mRNA            complement(<193539..>195608)
                     /gene="TPHA0I00880"
                     /locus_tag="TPHA_0I00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686980.1"
                     /db_xref="GeneID:11532858"
     CDS             complement(193539..195608)
                     /gene="TPHA0I00880"
                     /locus_tag="TPHA_0I00880"
                     /inference="similar to DNA sequence:INSDC:YJL101C"
                     /note="similar to Saccharomyces cerevisiae GSH1 (YJL101C);
                     ancestral locus Anc_1.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687028.1"
                     /db_xref="GeneID:11532858"
                     /db_xref="GOA:G8BXG6"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:G8BXG6"
                     /translation="MGLLALGTPLVWNESREYNDFIREKGVQYILNVFKNAGERDHDE
                     LYWGDEIEYMLIEFNEWSKQAKLDIVHDNLLTVLNTDTATDLNGVSDENINYYRLCLD
                     NDVNFHPEYGRFMLEATPLNPYLNLNGNYNYVEYNMKVRRELAEDIISNYNENSKSIK
                     YKPLTITSFPRLGTNNFINVDEKLVWNHKNNASRSLFLPDEVINRHIRFPTLTSNIRE
                     RRGEKVAMNIPMYKDMNTPDHDDTIYQRDWFPREDAEAAGASKKDHIYMDSMGFGMGC
                     SCLQTTYQAPNINAARYLYDSLVNFAPIFLALSSAAPFFKGWLADQDVRWNVISGGTD
                     DRTPRERDTESVLPQYNIGGLGNIAKDKYNKVQSLPKARYSHVDLFLGGNKFFKRTFN
                     DTNVPLNEDLLKVLLENDIAPMDYDMAKHFSHLYVRDPLVIFEENINDKTDGSLQNHF
                     ENIQSTNWQTLRFKPPTLDATPDNKSVPGWRVEFRPLEVQLTDFENAAYSIFIYLLVE
                     SILKFSDSLNPYLSMSKIWQNMDTAHKRDPISSQKFHWKTTFNNALNPEGKTEELVID
                     EIFHNKENGIFQIYINPILIDKKIIEKDWKELKHSSKYLRLYYYLKLISDRASKKLPS
                     VANYLRSFILSHPEYHQDSRISEIINFDLLEMCDRITHFDNSRNEMDSYFGKELTEYL
                     LNNDVSY"
     gene            <196230..>198767
                     /gene="TPHA0I00890"
                     /locus_tag="TPHA_0I00890"
                     /db_xref="GeneID:11532859"
     mRNA            <196230..>198767
                     /gene="TPHA0I00890"
                     /locus_tag="TPHA_0I00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686981.1"
                     /db_xref="GeneID:11532859"
     CDS             196230..198767
                     /gene="TPHA0I00890"
                     /locus_tag="TPHA_0I00890"
                     /inference="similar to DNA sequence:INSDC:YJL099W,YKR027W"
                     /note="similar to Saccharomyces cerevisiae CHS6 (YJL099W)
                     and BCH2 (YKR027W); ancestral locus Anc_1.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687029.1"
                     /db_xref="GeneID:11532859"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:G8BXG7"
                     /translation="MQYIWKNVSHGGSRSRHNSNASSSAIGNSVISDVAANALSGNIQ
                     LSNSGIDHAALPQPDTHKAPQIRIHNVADYNYGYVKYSANNTLDLQNFPRILEKTFGE
                     SLGNRSSVLNALAVGKCLSIGLPDLLHFTKIDRFYKNEVGEYLNITGIDFSNDVMPLS
                     FLNILDSVSNSDAGGKGMETGNDKVRLMTFCCCNIFSDIDIRIRYESPKKYQVSAIDL
                     HNPSLFVELDDDLWEETFVSCCIRSIIINEDKLWKSPGLVELPFLISEFKNAKRLVKS
                     MCERLPLYYKAGFDSTKANDLTILHNNLTKALLKYLSIVSNDLNDYTIKILESLMVKD
                     VQNNLIYQLVIIKILDQNEMNDIKLINLLNITIKELLNSVMKQKNKNDNLHLLNCTTE
                     ILIIQARFLMRRNDLEDALEVAKKVAALSSDSFESWFLLASIYVALEQYDNALYSINS
                     IPSLPKYDKQQLNIISQKSVIDSNYKRPYGRKIDRNLGTVIPSGCDLNSAELDNLSKI
                     HRNLKENELKCFIYGRTIMPFNDCKTPKSTYLDQSCSEIGPLYGVQSINLINFVSPNE
                     VKTITNTQLLQRNSIVNQYSWFETQVMNILLDIVCKIGWNDLLKLRSTIFIMEKEYIS
                     NKQSNIGMIPKHMREKRLCERWLDQLFLDIYEDLTIVNENDIFKSSENINSDDHSSVG
                     SIHNSLGTRKEIKYSGLEWELLGLTMLRTWNFEDAIICFRTSMLARFDIISCEKLLEI
                     YFDEDNHNFKDLIYLNNINLILILLSQKIYYESRFYNYLQISNIKFMLILCRRFGNDL
                     IKNKINLLESESNMDNQDNKRLMTSTLKLKEILQYASDILKEEEKDV"
     gene            <199637..>202780
                     /gene="TPHA0I00900"
                     /locus_tag="TPHA_0I00900"
                     /db_xref="GeneID:11534367"
     mRNA            <199637..>202780
                     /gene="TPHA0I00900"
                     /locus_tag="TPHA_0I00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686982.1"
                     /db_xref="GeneID:11534367"
     CDS             199637..202780
                     /gene="TPHA0I00900"
                     /locus_tag="TPHA_0I00900"
                     /inference="similar to DNA sequence:INSDC:YJL098W,YKR028W"
                     /note="similar to Saccharomyces cerevisiae SAP185
                     (YJL098W) and SAP190 (YKR028W); ancestral locus Anc_1.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687030.1"
                     /db_xref="GeneID:11534367"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:G8BXG8"
                     /translation="MSSSFWKFGQDFATESPISKILDRAFIKRENTQEIEKDDEQGTK
                     EEEFEEIDGDQIPKQQPDAASLDAVGTLDDSDASIKDGDYNKFDTQDQSVAETLPTTE
                     AEFVNYRPDLDALDDLLDDDELYTELMCSNFKLLIYLKYPEVLAKLIDYITNEDLLDE
                     KSDQLLVEDTVITKNDDKKEEQESDNIHLKLPEADSHEQVDDDDEIDNRSEISQETSV
                     TIPQEVEEQVELRRARMAAEILSADVWPISSAIIENTELLEKLWSVLDHTAPLSIIAS
                     TYFMKISERLLDMDISSMLEFILNQENLVDRFLTHIDNPPLIDFLLKVISTDKPDSPT
                     GVIERLKEQNFISDLLDRLNPEYSISTQSAAGDFFKAFVTISANSNNEIASGIGPNEL
                     TRELVSPEMIEKLIKIMLKGGTSLNNGVGIVIELIRKNNSDYDFVQVIYTTIQTHPPN
                     ERDPIYLGSLVTIFAKYMGEFEKMLVNSELPQLETPFGSIEPLGFERFKICELIAELL
                     HCSNMALLNEPDGDVIVNERDAERRRVLKTDRLSRSTNEAEIGDIETELNSLHLYSGD
                     DLDETKSNAVETQSTPEEKDNFDEQSVTSVELTEEALRETPLVGDRLKIALYDTHLVQ
                     TILKMFFDFSWNNFLHNVVFDIIQQIFNGPLKTGFNKFLLIDLLTKTKITDMIMKGDK
                     RCTDYENEAGLRLGYMGHLILIAEEVAKFTAYIEEVRSEFSDEESWNALHEPHWQEYT
                     ETVLAEAREKYNTVLGDFGEYDDENIDDLVEDGAEENKQRDDEITITGDNINFNSNEE
                     EDSPISFNDKTGVEDEDDYYAEYNDIDNPKFYEYIDANGNKTRLNLEPATELDKDKDS
                     EKIANSEESNKFTDYMSNQLVGGYDDETFNNDVNADENEWSSTKSFRFVPKHESSHSD
                     DNDAYRHQFRLDGDDDDYMDPNDDGQSYAKPDHPLYKSNVAPDVLNDLFHKEQLEDVD
                     NNDVNSDTSDNSDAELEETSDVYNVDDSENKFGEYQDDAGGYSLFRSKNSDSLSWDEN
                     EQDRLMNMVSYNKNNSK"
     gene            <203836..>204318
                     /gene="TPHA0I00910"
                     /locus_tag="TPHA_0I00910"
                     /db_xref="GeneID:11534368"
     mRNA            <203836..>204318
                     /gene="TPHA0I00910"
                     /locus_tag="TPHA_0I00910"
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /transcript_id="XM_003686983.1"
                     /db_xref="GeneID:11534368"
     CDS             203836..204318
                     /gene="TPHA0I00910"
                     /locus_tag="TPHA_0I00910"
                     /inference="similar to DNA sequence:INSDC:YJL096W"
                     /note="similar to Saccharomyces cerevisiae MRPL49
                     (YJL096W); ancestral locus Anc_1.270"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /protein_id="XP_003687031.1"
                     /db_xref="GeneID:11534368"
                     /db_xref="GOA:G8BXG9"
                     /db_xref="InterPro:IPR028909"
                     /db_xref="UniProtKB/TrEMBL:G8BXG9"
                     /translation="MFSRNIQKIVPLTRTSFTPTLLKVTSLRNFSCSSIWNRAVQQND
                     LAPLKLANELYAVFKVHERPYLVTEGDIVTLPFRMKEADVGDTLILNDVTTLGSRNFK
                     LIDKPIDPKFYSLKAVVVEKTKRAFQVREVTKRRNRKVRHATSKADLTVIRISELAIK
                     "
     gene            <204753..>209057
                     /gene="TPHA0I00920"
                     /locus_tag="TPHA_0I00920"
                     /db_xref="GeneID:11534324"
     mRNA            <204753..>209057
                     /gene="TPHA0I00920"
                     /locus_tag="TPHA_0I00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686984.1"
                     /db_xref="GeneID:11534324"
     CDS             204753..209057
                     /gene="TPHA0I00920"
                     /locus_tag="TPHA_0I00920"
                     /inference="similar to DNA sequence:INSDC:YJL095W"
                     /note="similar to Saccharomyces cerevisiae BCK1 (YJL095W);
                     ancestral locus Anc_1.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687032.1"
                     /db_xref="GeneID:11534324"
                     /db_xref="GOA:G8BXH0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BXH0"
                     /translation="MQFTKRLSNVSHSRSSSASSLAHNASGSPTSNSSKQSLNLNKHS
                     SKKTKEKIVLSITEQPILSHSQSSSMSSSNGNINTYLSNGGTIYEELDNEVNNTLRKS
                     INSNVLKPTTSGQYLHISPMERENSNSSNNIILPWDTTDPNKWTTERIVLWLKFYEFP
                     DLWIRFFEKHQINGNNFIRLLAKENFALYEKYLPESKAGSYNRFQHLLKETMSKNVTY
                     NYGRNKNSDKMKPTRSSSEANNIPTKLADPTTTRSTSDSIVNTTKVPTGSSKFKEANV
                     SINKHKKTKSTSSIYRRSFISLRSAANFSQPPTKSHNDINLKIPIQDVTNQNPKLLSS
                     KSATTPPMSPNIFRRHQKSNSSDSSLFNFLFGTTAGTTPNTSTAKLQPHFKGTNEPTV
                     SNKSTKSVIASSDSNNATLTSQKFDKNSQSKSQEYNSIIHPTKSADATLTRPSKITLP
                     QTNLSFENVTDTTADRIEINFNVEKKDEDKTENVKESKSSDFKDSSKNNGILLIDDKY
                     KPVPIESNIGSPYILITKDNSFFYPIPWNPEKSLEKFKEHILHVLSLKGKPVTIHLTD
                     YENDPGHSLPDTLVTKLLAELPKNDTLKFLIKDRSKPHLRSRAATVSSEPNVSLRSVK
                     SRGSVRSINSTNINSIDQFTITSSDTNSYDDRVSSSAKRYPQTPSHYYDYTNSEETNY
                     WNVKDNHDDASSLKLKSKQSLSNLHAEKSISYFSTPDSRTSDFVSKEDLTETDSRKLS
                     QSELAPKRDAPKAPGSISPQQRLSLSKKSSLKLKRAATKLTYSGSVNSPPKLQHGSPE
                     YKAQPIEATVSSYTPASTHVLVPQPYKGASDFSRKSKADDEIPTASILKQITANRKNS
                     MSSVLTKRPSIGSRANSKRIISSSSAADVFEENIINFSDAPNLSESDTDDSLDEIIWT
                     KKKDHDDNNDGRSNDTDDNSDSSDDIIWSNANSSKNSINKYHDATNILEDEGDIHASR
                     IKDGNNHLEQNSLQKGNDGLSRKMTLRPSPEEVYKNLEKFFPEANLDKPVLEGPTPPS
                     SPNIGNQSFPNRGHTANTDLSSTAGSSDTKADVMNKSFFSSKPLKRTKTIRTIAHEAS
                     KARKNSRKITRQNTKMWGTKIFEVTDTQGLPINKSKNSRGEYNEFAWMKGEMIGKGSF
                     GAVFLSLNITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLNIVQYL
                     GFEMKHNIYSLFLEYVAGGSVGSLIRMYGRFDDKLIRHLTNQVLEGLSYLHSQGILHR
                     DMKADNLLLDQDGICKISDFGISKKSEDIYSNSEMTMRGTVFWMAPEMVDTKQGYNAK
                     VDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNFLN
                     QCFHIDPKERPTAGQLLEHPFCYNDDSFIFNKTKLAEFIKSNDKINSTKLRITSQE"
     gene            complement(<209196..>211850)
                     /gene="TPHA0I00930"
                     /locus_tag="TPHA_0I00930"
                     /db_xref="GeneID:11534325"
     mRNA            complement(<209196..>211850)
                     /gene="TPHA0I00930"
                     /locus_tag="TPHA_0I00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686985.1"
                     /db_xref="GeneID:11534325"
     CDS             complement(209196..211850)
                     /gene="TPHA0I00930"
                     /locus_tag="TPHA_0I00930"
                     /inference="similar to DNA sequence:INSDC:YJL094C"
                     /note="similar to Saccharomyces cerevisiae KHA1 (YJL094C);
                     ancestral locus Anc_1.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687033.1"
                     /db_xref="GeneID:11534325"
                     /db_xref="GOA:G8BXH1"
                     /db_xref="InterPro:IPR004771"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:G8BXH1"
                     /translation="MSGGQHIGGVLSGVNPFHYNTSSPITLFLFQACLILLTCNLLHF
                     FIAKLRQPKVISEVIAGVILGPTVLGQIPNYLETIFPDESIVGLNLTSNLGIILFMFF
                     LGLEVDIDFIKKHIKTACSIGLVSLAVPFGCGCLIAIPLFHTYANQDPSEGVVKFTVF
                     MVFIAVSISVTAFPVLCRILNELRLIKDRAGIVVLAAGIINDILGWVLLALSVILSNS
                     ESSPVNTVYILLCTLGWFLLYAYPVKYILRWMLIRFHELDRPKPSTFATMCILFLMFI
                     SAYFTDIIGVHPIFGAFIAGLIVPRENNYVIKLVERMEDIPNIILIPIYFAVAGLNVD
                     LTLLNEGKDWGYVFATIFIAIGAKVISGTVMSKLHGLYFKEAAAVGVLMSCKGIVEIV
                     VLTVGLNAGIITKKIFGMFILMALVSTFVTTPLTQLIYTDEYRVLVRKRISQQKLQDE
                     KMDSEIPIIEVDTLSDSETDEFLKLKSFENIKDYKPRRIVNIINSAECISANLDLLTL
                     VLGGRTVDSTSKKFSHVNLGLSRKSSMTTMKSKSYKLRKLISHKDDNLNANSSNTIMG
                     GIIEHPSNFDEMIPLKAVHLRLLTERTTDLLQSSTFYNDDPDFTANTDALIQIYDIVT
                     RLSKIPFTSEVVFSTLKEKATNIISLDAKNSDIMLMTLKGASFEHRNNPLVQEQYGNF
                     EHIYSHILGCNELPSHFFNTLATSLKTNVMIHISNNGGMILSDRFRNKCYNLLLSNPY
                     LCSSDYLAIYTLVSICHREIKDGNIIDANIFMNSKIPNFSENLHNLMTYEAWFDESII
                     NIVPIEINDTSDKNSSDFIDLILQSGTIDMYNLEESTFIIPEIEFSINDPFSFNVKSL
                     ILHGANKKFNVVVSHYNNQQSSFTRSDS"
     gene            complement(<212534..>214642)
                     /gene="TPHA0I00940"
                     /locus_tag="TPHA_0I00940"
                     /db_xref="GeneID:11534326"
     mRNA            complement(<212534..>214642)
                     /gene="TPHA0I00940"
                     /locus_tag="TPHA_0I00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686986.1"
                     /db_xref="GeneID:11534326"
     CDS             complement(212534..214642)
                     /gene="TPHA0I00940"
                     /locus_tag="TPHA_0I00940"
                     /inference="similar to DNA sequence:INSDC:YJL093C"
                     /note="similar to Saccharomyces cerevisiae TOK1 (YJL093C);
                     ancestral locus Anc_1.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687034.1"
                     /db_xref="GeneID:11534326"
                     /db_xref="GOA:G8BXH2"
                     /db_xref="InterPro:IPR003280"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="UniProtKB/TrEMBL:G8BXH2"
                     /translation="MDHNDTEKYKFDYRSVDPSLKEALEFRSERVDIINANPDSKTFV
                     LWFIISCYFPVITACMGPIANALSVACAVEKWREKWEIVDGSYVSYELDDPAVIFTLN
                     IISFVIGICSNGVLILHFAQKVSYQTSQIINITGWTVSGLLLLVDVVVSSIRYTYRYD
                     YHLNIGFWFAVITCALYFCCALVLSLHYVGYKLRKYPARFNLVKNERAVMVFTVLFSI
                     WLIWGAGLFSGLLHINYCTAMYFSVVSLLTVGLGDILPKTVAAKIMILVFSLSGVLLL
                     GLIIVMTRDIIQGSIGPIFYFHRLEESRIILTKKIHNKELTVNSTKDAFRHMNRLRKQ
                     SKRKQVLFSLLLTICIFITFWLLGAVVFMFAESWSYFNSLYFCFLCLLTIGYGDFAPS
                     TGAGRAFFVIWAILAVPLMSAIISTVGDTLFTLAQKLDFTLGKRIFHQDLKALVISNT
                     YSNSKSILRFKTGELFTATNLSDVLLEEIDDDNDNSNEDIVDGSGSGNSLNSNVSKAE
                     NNSLTNQGSQQNSNTTSDSCALSIKPKTHFIPYHNIENPNLNSDRVVILTQEETHDRL
                     LKLQELLRHFSDIHNNRVNDHNCRLSYNDWKAIAEENLLDTQDCLPQDTSGQLHIDPM
                     FWVSSNTPLRFPIDESRFAMSKLFRKMVSLTNELIDSENCKIENDKSCNSSSIESSPI
                     STNDDTFNSTHENNIEMVLI"
     gene            complement(<215503..>216999)
                     /gene="TPHA0I00950"
                     /locus_tag="TPHA_0I00950"
                     /db_xref="GeneID:11534490"
     mRNA            complement(<215503..>216999)
                     /gene="TPHA0I00950"
                     /locus_tag="TPHA_0I00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686987.1"
                     /db_xref="GeneID:11534490"
     CDS             complement(215503..216999)
                     /gene="TPHA0I00950"
                     /locus_tag="TPHA_0I00950"
                     /inference="similar to DNA sequence:INSDC:YJL091C"
                     /note="similar to Saccharomyces cerevisiae GWT1 (YJL091C);
                     ancestral locus Anc_1.275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687035.1"
                     /db_xref="GeneID:11534490"
                     /db_xref="GOA:G8BXH3"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="UniProtKB/TrEMBL:G8BXH3"
                     /translation="MSTLKERKESFVSGLEGGTILEVNIVTSIALFAYFSYNLITIRG
                     QDYGIVAEFSLLWVTLLLSVTTYANNAYMLITLILVPCISLFLCVLINKKSTKLEDIS
                     KKDVMVHDEDASKKDLKKFELVKSPYLTAYRGGMLVLTMISIFAVDFNIFPRRFAKVE
                     TWGTSLMDLGVGSFVFSNGIVSARSLIKEKMDPKYQRSTLMGIILGFKSGLSLLILGL
                     LRLYFVKNLEYQEHVTEYGVHWNFFLTLALLPPFLSILNPIAEYIPRVVIALVISLVY
                     EWFLMRNDNRMLTFLILGERNNFFSANREGILSFFGYCSIFLFGQSTGFYILGNQPTK
                     NNLYKPSSTIVSKTNINNNKMSLWDRITTVSPLRGLFTWALLSMIATNIIFTLHPFDI
                     SRRFANISYTAWTISYNLAFLTCYCMIDSLFGNTFENYKSPLVYESVNRNGLFMFLLS
                     NVSTGLGNMAFSTIDASDSTAIAVLMGYSIFLVSVSILLHQRQIYIKF"
     gene            <217361..>218380
                     /gene="TPHA0I00960"
                     /locus_tag="TPHA_0I00960"
                     /db_xref="GeneID:11534491"
     mRNA            <217361..>218380
                     /gene="TPHA0I00960"
                     /locus_tag="TPHA_0I00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686988.1"
                     /db_xref="GeneID:11534491"
     CDS             217361..218380
                     /gene="TPHA0I00960"
                     /locus_tag="TPHA_0I00960"
                     /inference="similar to DNA sequence:INSDC:YKR022C"
                     /note="similar to Saccharomyces cerevisiae NTR2 (YKR022C);
                     ancestral locus Anc_1.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687036.1"
                     /db_xref="GeneID:11534491"
                     /db_xref="GOA:G8BXH4"
                     /db_xref="InterPro:IPR028211"
                     /db_xref="UniProtKB/TrEMBL:G8BXH4"
                     /translation="MSFRKRNKLNLNKSLGSETKSIKRIKTFVDYEDEEEVDSRILTR
                     DNIKFNKTKLPSIHNQKNSIPLLTSSDNEEYIIENNEESNLKYNQLYNRKNRLNEIPN
                     ENVANANDNSNEKTNAIIINIEEMEQNGLIEPDNDDRGPKMKPSVKKMDKYNSKSKLN
                     VMKEEKLYAKLLDDDDKIEIMEIIDKQGGLDKDNDKDASGFDFNMTEFEDDRLAVTDR
                     ERQIYKMKRKKLIEEALEVNHLEDNTRPNSNEWEDQQLTKVFNNEHLVAEKKDSRIKA
                     LQSQLPHPIILEDPTNIIEYIRSIQIDLEKKKQMLKIQQISLSNEVITLNEKIDSITK
                     GLNDL"
     gene            complement(<218510..>221005)
                     /gene="TPHA0I00970"
                     /locus_tag="TPHA_0I00970"
                     /db_xref="GeneID:11532849"
     mRNA            complement(<218510..>221005)
                     /gene="TPHA0I00970"
                     /locus_tag="TPHA_0I00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686989.1"
                     /db_xref="GeneID:11532849"
     CDS             complement(218510..221005)
                     /gene="TPHA0I00970"
                     /locus_tag="TPHA_0I00970"
                     /inference="similar to DNA sequence:INSDC:YJL087C"
                     /note="similar to Saccharomyces cerevisiae TRL1 (YJL087C);
                     ancestral locus Anc_1.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687037.1"
                     /db_xref="GeneID:11532849"
                     /db_xref="GOA:G8BXH5"
                     /db_xref="InterPro:IPR012387"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR015966"
                     /db_xref="InterPro:IPR019039"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXH5"
                     /translation="MVEERSAVMDLVKQLEKSSELPHKGKSFKRVCELFNSDKKVVSW
                     KFNEWDYGKNNIKLPCNARGLFISEDSTNPTIVARGYDKFFSVDEVPFTKWDALGCTT
                     KGPYEVSVKANGCIIFFSGLEDGTLITCSKHSTGPRDDSDRNHAEAGELFLKSQLEKL
                     NIDISSFAKELYKRNLTAVAEYCDDSFEEHILEYSGAKAGLYLHGLNLNTVNFKTLPM
                     TDVTEFALKYGFKLIDYVTILDIHSLRLFLEDCAKTGSYKNEEIEGFVIRTKDSNSGN
                     AFFFKYKFEEPYLMYRQWREATKDYIQSHTRVFNFRKHRFITNKYMDFVVPILDNDPV
                     LCENYLKGQHIIDLRNKFLKSYGMTGIEILDHEKIKELELRNSLDFSKVDEFTKFIII
                     PIAVIGCGKSTTARTLTNIFPGRWAHVENDDITSKDRSQLVKRSLELLSNDNIKCVII
                     DRNNHQYRERREILNWIEEFKEDYLAYDVNVKIIAVSFVTYDNLDLIRQLTIDRVKRR
                     GDNHQSIKATVYGEKKVLGIMDGFIKRFQEVQEGRSPDNLFDFIIHVHVKDYDSSLEN
                     TNVILTKLHQKYPILVPDLPSSNEIREAFQKALTYKPVITKTFGNTPKQKIQINKSEL
                     NSINDNKTKISPVFFSAHLLDDAIIFDIFKDFVNVPAFTKSEKLVIEDMLKNRSFQSE
                     LHVTLAHVASCKRGGPELQQIWQEYNNRYIPLIKKNLKLLRIKSEELPSQIKTDDILE
                     FSVKKICWDNKILSAIIELGDFKDSNGVILKGLKCANKVPHITLALLEPGTKPFYSNE
                     LCQNVQANNIGKNIRVYDISELKMYQAAISIHL"
     gene            <221627..>223501
                     /gene="TPHA0I00980"
                     /locus_tag="TPHA_0I00980"
                     /db_xref="GeneID:11532850"
     mRNA            <221627..>223501
                     /gene="TPHA0I00980"
                     /locus_tag="TPHA_0I00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686990.1"
                     /db_xref="GeneID:11532850"
     CDS             221627..223501
                     /gene="TPHA0I00980"
                     /locus_tag="TPHA_0I00980"
                     /inference="similar to DNA sequence:INSDC:YJL085W"
                     /note="similar to Saccharomyces cerevisiae EXO70
                     (YJL085W); ancestral locus Anc_1.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687038.1"
                     /db_xref="GeneID:11532850"
                     /db_xref="GOA:G8BXH6"
                     /db_xref="InterPro:IPR004140"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:G8BXH6"
                     /translation="MSYNNIDIDEADVLVYFQNLEKVNRLTSDINKSLRNIAFTSNES
                     SKLFTPIVTRNNLLSVMQKNIESTLNAVSSVKELATEASRYEVILIKSIHEVGLKPYI
                     QAIYKLDDMLEYIKSNNEANEQNAEFKGVLTHLKELIVKSDDKLKYYFIAVLNSMKPF
                     DPQINMNKKIPFPYFADEFINELSTILDYFENMSTNSNIHELFIKERTGLILKSMAYL
                     EPFTKQVTKSSNAPYEKGSSGLLSYTDALLGFISNEQSLIDDLYGQKNDYKSFVIGDI
                     IRPLLDAYVRIFNNNMELVKSNLENAGLFSFEMIDSINEVERALRSNVLHDYEPLGEC
                     LKKISKITQSLFKNVVVRIETKADQMSIIPADNGVTEVTVDTMSRLRRFSEYKSGCLS
                     AISHIDRQSWLPSDFSAKESTYSNKVDLSKPLVLLSCFLSDCIDLLCVSLERRVHKII
                     SPSVGSQVSNSNSSKTTQKPRIGFFIIMNLSLVEQIIEKSELSSMLGTEGSARLEKLK
                     KRYINYLVSDWKDLAANLLDQVFVDNTGKVASKDKDQLKEKFRKFNEGFEELVTKYKH
                     YSLSDPSLKNLLRSEITSLVLPMYERFYGRYNESFKNPRKHIKYTPSELTAILNQLGK
                     "
     gene            complement(<223720..>226734)
                     /gene="TPHA0I00990"
                     /locus_tag="TPHA_0I00990"
                     /db_xref="GeneID:11534675"
     mRNA            complement(<223720..>226734)
                     /gene="TPHA0I00990"
                     /locus_tag="TPHA_0I00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686991.1"
                     /db_xref="GeneID:11534675"
     CDS             complement(223720..226734)
                     /gene="TPHA0I00990"
                     /locus_tag="TPHA_0I00990"
                     /inference="similar to DNA sequence:INSDC:YJL084C,YKR021W"
                     /note="similar to Saccharomyces cerevisiae YJL084C and
                     YKR021W; ancestral locus Anc_1.282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687039.1"
                     /db_xref="GeneID:11534675"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8BXH7"
                     /translation="MLQPNSILSPVFPVEKDVDVSTEEIPLIQTVNVHVFIQLAEPAV
                     FIQGFSSQEIQQRPPSLLRGSLIVRVLKPSKLKSITLNFKGYARTDWPEGIPPKRQEF
                     VEINDIVNHTWPFYHAHSSSNNNRPHEHINLNPRSPRNSIIALQDMDNSLDELEDPII
                     QESGASVFRSLPTDVNVGELSHNPSLLSVNNAKQRTLKSEGSFSTTHSTPPTRSDSNN
                     KIHKSMSPFGFFKRDSSTVSATTELNSSGANNSNSNINTKNNRSSIFSDLLTNTFSTL
                     SDASPSANANAVNSSAMNKSFSSSNINTNNTSSTITNNDSFTFQPGDYIYTFEQAIPC
                     SYPESIKADFGLVEYTLTATIERHGAFKSNVIAKLPVNILRTPSDTSIEETEPIAISK
                     NWENHLHYDIMIASKDVILDAFLPISFSFSPLDKVTLHRIRIYLTETMEYYCKGKKVH
                     RVEPVKKYLLAEHNGPILKPLQPGEKSTKAKYLGNLLIDEKTGDVMNKDYSFEVFIPS
                     VFSNKQKLHPDTACDKIKASHWIKLSLRLSKITDGKRKHYEIVIDSPIHVLNRLCAHA
                     NTLLPCYDPHPLNMHLEDSSLDMFASENGTTDGQNNKGFSNPNVVDPPSVHESNIFFP
                     KEILLSPMLSPDVQTELHKTNHESVASALSSAHDSISVIPNEVFNTPKLKSNIYQPDS
                     LSRELTFAQAVPLSPINSPILQSSALSDDDIEPPTFDFDAMSLNSSKFDNNGLPLNPP
                     SYSKVDTANIHGSEGWFANGSNNGNLLTANNRISTLRLDQKPLSRSGSLLGVHKSNKV
                     FKDIDEDDADGDITSTFTSRSSTSALKLNQNSLSLNPKLWRTKQNGLQDNLPSTIRHA
                     NSSFNDLNNIFASDNETDETEVDDLSDEEISKTSSVINESVDDSNIEGASRLPLLNGN
                     DSTADMVGDESFFASADLSEELIRTQPINTLDFFIQNHNSHMVPNPIFGEQEKSRGVP
                     HDYSLQVANANHVLDDFKSTIHDSNKDETPLS"
     gene            <228251..>230521
                     /gene="TPHA0I01000"
                     /locus_tag="TPHA_0I01000"
                     /db_xref="GeneID:11534676"
     mRNA            <228251..>230521
                     /gene="TPHA0I01000"
                     /locus_tag="TPHA_0I01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686992.1"
                     /db_xref="GeneID:11534676"
     CDS             228251..230521
                     /gene="TPHA0I01000"
                     /locus_tag="TPHA_0I01000"
                     /inference="similar to DNA sequence:INSDC:YJL083W,YKR019C"
                     /note="similar to Saccharomyces cerevisiae TAX4 (YJL083W)
                     and IRS4 (YKR019C); ancestral locus Anc_1.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687040.1"
                     /db_xref="GeneID:11534676"
                     /db_xref="GOA:G8BXH8"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8BXH8"
                     /translation="MVIYLNKQRRAHPGITLTDTQKDNSLRAAQLMFHKHSTLEDAKR
                     LPAIAVRSGTPPPQKKINYVTNKNSGMKYVVMNSKPTLAKVPSTPHSTGIDAKKAAMQ
                     AQQKISENQEAVSQTKNSKYTSQLNSTRAATLAQSWSDEQERETQNSSKPQSPTMNSK
                     KAAALAHINLADMETEWDLPLNKQLPALFTQEPDKNPYYNTSKKVSNHSYRSSDENLS
                     ILSSSKNPDNKLRGTVTRASKDKFYLTVPTSALKLNENQYSNNSGAEMGDNESINSNT
                     NEIMSIMSSSSIINQRRSPSPDFNKNALNMEEQDYNPSVYSSNSNMKSLLKNNSIYSL
                     VPISTSSKAPKLINNCATNTYGAINKRSGGNVKYEGTLPDLIPNHLRQHSKVEKLKNK
                     FFKSHEGYNTAHSTTDLRKSMSVTSFDSNLHVPSYLSLNNIVEDPTGKEIIRTNQNTK
                     LKTTMRRDNESDNENVNRNGVYGNPNKNKSFDEFGNPINPTMHDYDFDSSDEFSEYDN
                     ASGSDNNDKIYKKKMKRRERLKSKFKKTTAVIPYGHHHSNSSHHYLSHITNNDTSTGN
                     NHFKGFNEDKPWKSHNDSYYITEQERKRYEGMWVSNRFLYLELLPWWGYLTGNETEQS
                     TIGSNPILAKLKFNIKGLPDDGLMLNLVAQDIWLRSCLPNDILMNIYDLVDLRNDGTL
                     DRKSFIVGMWLIDQCLYGRKLPKSIDQTIWDSIDKYMVNALTSGSTIKAIKKNKKKLI
                     KKEIKYIKKEMKSIHI"
     gene            <231563..>233929
                     /gene="TPHA0I01010"
                     /locus_tag="TPHA_0I01010"
                     /db_xref="GeneID:11534677"
     mRNA            <231563..>233929
                     /gene="TPHA0I01010"
                     /locus_tag="TPHA_0I01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686993.1"
                     /db_xref="GeneID:11534677"
     CDS             231563..233929
                     /gene="TPHA0I01010"
                     /locus_tag="TPHA_0I01010"
                     /inference="similar to DNA sequence:INSDC:YJL082W,YKR018C"
                     /note="similar to Saccharomyces cerevisiae IML2 (YJL082W)
                     and YKR018C; ancestral locus Anc_1.285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687041.1"
                     /db_xref="GeneID:11534677"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:G8BXH9"
                     /translation="MFRGVLGALTGNRGQVTLTQEEKVRRVLKQAHDFEIALKAMDYV
                     LDDRADEGLSLLANGESDIEKRLGGDESAEVNPNDKTIGVLAKGVIEFLEATLGFEAE
                     EMKKASATLAEAENLSLKSRQFAQKMDLRSSSIYPPGTVYAVTYTESCLLHALLMIFS
                     ESVLEGAKALLKLRKAYYMLQEIFQAIKKAEKLQKSADKPSRSRLGSLRAKHNSSSSA
                     RASAAGTGSPRVKSGSVSSARSSASYKNATNDSDASFISGTSHFTSSDIPYELNENEK
                     VDHDLLEFAEEVHKMRIKRLTGAHIGNSPAINRLRTDLGLDSSKVLPEGKESEAYDTL
                     TELDLSQATIDEFIHSGVNLCYGILQVVLSLLPSNIGAVLSIVGFRGSREDGLRLVWR
                     STKQRNIHGCIGLLGLMFYYDGPFQFTDDDFDIPVAKESTSLMKTETNSTIRSESDMD
                     GPTLLHPGKILENALLQSRALFPNSALWLLNESTMLAGKGRLYDAVTLMDSIDADQIR
                     MRQVKSLMIFNRAILLVHLHEYERAATDLLSLINISGWSHALYYYFAGCCYLEIYRMH
                     QMGIKEVEDAAKFKNLAYKYIFDSPIKDGKGFKSKPLPLDKFMMRKVSQFEATKLRLN
                     LEDPLDAIGTSPVRELQYFYNGYNRMTKEHLGITYKMLTEYHNPAVDEHNEDQELIKN
                     LLVSLTLRRLGNVEEGFTILDKAVIPHFFSVINGKTKYVKKTEDPWLYPTALYERALF
                     TWKLKEMDGLKEAREWLLRAQGYADDYELSSRVEMKIKAALDRVEHSL"
     gene            <234445..>236070
                     /gene="TPHA0I01020"
                     /locus_tag="TPHA_0I01020"
                     /db_xref="GeneID:11534469"
     mRNA            <234445..>236070
                     /gene="TPHA0I01020"
                     /locus_tag="TPHA_0I01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686994.1"
                     /db_xref="GeneID:11534469"
     CDS             234445..236070
                     /gene="TPHA0I01020"
                     /locus_tag="TPHA_0I01020"
                     /inference="similar to DNA sequence:INSDC:YKR017C"
                     /note="similar to Saccharomyces cerevisiae YKR017C;
                     ancestral locus Anc_1.286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687042.1"
                     /db_xref="GeneID:11534469"
                     /db_xref="GOA:G8BXI0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:G8BXI0"
                     /translation="MANDEDYQYSSSDDDFPEQQYYEPLEHRDITNNILDDYEYLNYD
                     TDSLESFNSDVDIVDGMAVSHVTNPNKKRSIEGAMVNLKYECFTTQDIFNNMLEKVDR
                     LQPMFSIPREDIILLLQKYGWDEDRLLEDWTNKMDGLLIEAGIHINNEQKELPKSQRG
                     ISNRDFFTCPICCEDQIKETYSLECGHEYCISCYRHYIEDRLNKGNIITCMSCSLALK
                     NTDIDELMNGPSSEKLMHSSIKSFVQKHNENYRWCPFTDCKCIVHIQDTTEFVEYIRL
                     HYSPYVLCNESHRFCFSCSFEMHSPADCEITSSWIKKAKKESDNLNWVLSHTKECPKC
                     SVNIEKNGGCNHMICSSCKYEFCWICNSDWKPHGSSFYQCTMYNNDELKTQTVIEDVS
                     KTLKRYTFFYRMFNEHEVSAKLDWQLGQTVGNKIKSLQEKMGVSWIEGQFLTESLKIL
                     NEGRTALKWSFAVVFYSDSSHNLTKIFVDNQALLANSVEDLSALLQIKSPETIMEKKV
                     EFYNKAGYVENRTYALMECGRELISKGIVKITN"
     gene            complement(<236150..>237661)
                     /gene="TPHA0I01030"
                     /locus_tag="TPHA_0I01030"
                     /db_xref="GeneID:11534470"
     mRNA            complement(<236150..>237661)
                     /gene="TPHA0I01030"
                     /locus_tag="TPHA_0I01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686995.1"
                     /db_xref="GeneID:11534470"
     CDS             complement(236150..237661)
                     /gene="TPHA0I01030"
                     /locus_tag="TPHA_0I01030"
                     /inference="similar to DNA sequence:INSDC:YJL081C"
                     /note="similar to Saccharomyces cerevisiae ARP4 (YJL081C);
                     ancestral locus Anc_1.287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687043.1"
                     /db_xref="GeneID:11534470"
                     /db_xref="GOA:G8BXI1"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027667"
                     /db_xref="UniProtKB/TrEMBL:G8BXI1"
                     /translation="MSSSSNQVYGGDEICAVVIDPGSFTTNIGFSGSDYPQSILPSCY
                     GAITEIEDQQADHNKPDESAANNTENASKIKIRKVFNEQSVGYPRANYEIKPIVQNGE
                     VVDWDAAQEQWSWALENELFLKSNEGVPALLTEPIWNTVENRKKSLEVLLEGMGFEAC
                     YLSATPTCVSFAAGRSNCLVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLIN
                     DFLKPREIVPLFEIKQRKPTLVKKTFDFPIHDSLKTYANDRGIYQEIKEALCRVSPNS
                     SLEKYKPELEKMSKRKYETLWNEDIVFDNETIYGFGEQLFIPKENDIPVDWNTSKDGI
                     VETWHNDYIPLKRNKPAGTVKTDKEATEELTPAVDNATPSEDTNDNGKRPIGNEGEEK
                     EKIIPGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALK
                     FRVLANGQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRFR"
     gene            complement(<238226..>239830)
                     /gene="TPHA0I01040"
                     /locus_tag="TPHA_0I01040"
                     /db_xref="GeneID:11534314"
     mRNA            complement(<238226..>239830)
                     /gene="TPHA0I01040"
                     /locus_tag="TPHA_0I01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686996.1"
                     /db_xref="GeneID:11534314"
     CDS             complement(238226..239830)
                     /gene="TPHA0I01040"
                     /locus_tag="TPHA_0I01040"
                     /inference="similar to DNA sequence:INSDC:YKR016W"
                     /note="similar to Saccharomyces cerevisiae YKR016W;
                     ancestral locus Anc_1.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687044.1"
                     /db_xref="GeneID:11534314"
                     /db_xref="GOA:G8BXI2"
                     /db_xref="InterPro:IPR019133"
                     /db_xref="UniProtKB/TrEMBL:G8BXI2"
                     /translation="MLRSGLALHAGRRLLTTYGPAIAKKSGTLKKIMFRTVIGTAVVY
                     GGGVALSDRNDQFAEYFTAYVPFAEPLLDKYETYKYLGSKNKTASYSSSGLREKINDI
                     IYGSNDKRFEETSDSAPPLVINEVVELVPIELLDLELIQLDESITEPKFFKLVEDLNS
                     TIKTIVDQNIKLTKPQIQSIINYYTALRETIHIYNNELQQNIDSFVIERVNQSLADLN
                     AEFNEKIQAKETELTTSFINEFNVLKDNLEQRHAAELSTELRASEQTLSAKHANEVTL
                     LSITQVEEFTKIIKEKVDKERDRRLGKLGELNKEVETLSTSVEKVNKLLLKKEATTQI
                     TLLLTSIKQKLLEPATPDNGISIKKELDKLTVLSSILCGANTNTACECPSKCKPTCKC
                     NGCLKKKNLFSITVNELNKIVKDKNILSNEQLLNRWSLLEKDFKTSSLLPQNPGILGH
                     MSAKIFSMLLFTKRGVSTDGTELDSIYANINENIRLSKLDIALTDAVSLQGWPHIVCQ
                     DWIEDAKLKLEVESLVDVLDSEVRTM"
     gene            <240637..>241053
                     /gene="TPHA0I01050"
                     /locus_tag="TPHA_0I01050"
                     /db_xref="GeneID:11534315"
     mRNA            <240637..>241053
                     /gene="TPHA0I01050"
                     /locus_tag="TPHA_0I01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686997.1"
                     /db_xref="GeneID:11534315"
     CDS             240637..241053
                     /gene="TPHA0I01050"
                     /locus_tag="TPHA_0I01050"
                     /inference="similar to DNA sequence:INSDC:YJL151C"
                     /note="similar to Saccharomyces cerevisiae SNA3 (YJL151C);
                     ancestral locus Anc_1.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687045.1"
                     /db_xref="GeneID:11534315"
                     /db_xref="GOA:G8BXI3"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:G8BXI3"
                     /translation="MVDYSELRNSEDSQNTESGTNGIFSVDKNDLVLLVVSLLLPPFA
                     VWIRKGFFTKDFFLNVIAYVCVFFPSTIHAAYIIYETSVIRTRTVTLESSGAGNAKKS
                     TNSFDHDLEASNVPPSYEDGFDVRPLNTPSDNKIQI"
     gene            complement(<241263..>244874)
                     /gene="TPHA0I01060"
                     /locus_tag="TPHA_0I01060"
                     /db_xref="GeneID:11534464"
     mRNA            complement(<241263..>244874)
                     /gene="TPHA0I01060"
                     /locus_tag="TPHA_0I01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686998.1"
                     /db_xref="GeneID:11534464"
     CDS             complement(241263..244874)
                     /gene="TPHA0I01060"
                     /locus_tag="TPHA_0I01060"
                     /inference="similar to DNA sequence:INSDC:YJL080C"
                     /note="similar to Saccharomyces cerevisiae SCP160
                     (YJL080C); ancestral locus Anc_1.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687046.1"
                     /db_xref="GeneID:11534464"
                     /db_xref="GOA:G8BXI4"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8BXI4"
                     /translation="MSDLTQEMSNTVVVDSELINNTEENENPVAIVQQGIDRASLPSL
                     KDLPQLGSSHAFANTKVNWGPNVKPNVVANAVSSNSSSPSPISASKPMRSNYVQEALT
                     LDLQSQLSITKPEFARIVQSIKQTHKVSLESTLSKNSRTFLISGKREDVQEAKRDLVK
                     KMTRPISTIFEIPSNCRSAIIGKGGQTIREISSKYDVKIDVAKEVNDNSYNEELNDYS
                     ANISLHGDVASVNLAKLRIMDIVKEETKNSTAKFTIDNEKILSLVDLSQFTNQNSDTI
                     KVQFFERSGDVIISGLREEVKATKQNIENYFKQLENDSTEEKIKIPAKFQILIDAQEI
                     KQLFNVIVTFPENVEDETVVFIGQRNKVAEAIAHARSSSKSYSCDTLDISKSHSKNID
                     HAKFLAFYFNKYGALDFIKKEYPNVNITLPSTQTLKSSNDVTIIISAKQEYVSDIKVV
                     RREIVNLVNTITPLDTLIVDDLDFELFHKEVRQILTGLEEETKFIQVGDYFSGDDRVI
                     LFCLTSADDFKPSAEEILESLKKANDALNPLRQKQNSLETAEFDLDDETQEKLLSKNS
                     FTRNILLNEVSSNDSNIQMKLHTPSANKLFIRGNEKAIKIARKAVKLIIDSPSLKTKI
                     SFEVPANTVSRLVGNKGSNLQSIREKFDCSIDVPNNVDSNSKEGVEVVLTGLEYNLNH
                     AKIYVLNEAKKWADIISKELIVPAKFHRSMIGSQGVYKNRLQDKYNVRIIFPHSGDVV
                     TIRGPSRGVSKAYEELKALLDFEVENGYKSIVKVPTEHVARVIGKSGETINDIRADFG
                     VELDFLQNASDENAVKAGFVELEITGSRSGIREAESRVNSIVNEASDFTNESLVVERQ
                     YHRFIVGSGGQNLRDIISKAGGDEIRNKSIQIPNADSNEEMIVVSGPKKFVDAAIKEI
                     KKIVDDFKKRVTKELEIPNDRQGALIGPGGIVRNQLESEFNITLDVPQKGQTGKVKIS
                     GLEENIEKAIKKITTEILRDNYDVEIQVPANVHEYVADRGSLIQQLRYDNFINVRHGN
                     DNRRATKLSNTEIVIPIEKVAGAETDKVKVTVEEVSSPTANEEGTISWRLTYEPLDDI
                     IMFDGEEQEQTKPKETPEQKAEKKKEVIAKVTKIIEDRISAAPSANYAGYVWSANPRN
                     FNKVVGPGGSNVKKIRNSTNTIISVPKRSDKVNNVIYVRGTKEDVTKATEIIVKTLN"
     gene            complement(<246020..>246667)
                     /gene="TPHA0I01070"
                     /locus_tag="TPHA_0I01070"
                     /db_xref="GeneID:11534465"
     mRNA            complement(<246020..>246667)
                     /gene="TPHA0I01070"
                     /locus_tag="TPHA_0I01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003686999.1"
                     /db_xref="GeneID:11534465"
     CDS             complement(246020..246667)
                     /gene="TPHA0I01070"
                     /locus_tag="TPHA_0I01070"
                     /inference="similar to DNA sequence:INSDC:YJL079C,YKR013W"
                     /note="similar to Saccharomyces cerevisiae PRY1 (YJL079C)
                     and PRY2 (YKR013W); ancestral locus Anc_1.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687047.1"
                     /db_xref="GeneID:11534465"
                     /db_xref="GOA:G8BXI5"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:G8BXI5"
                     /translation="MIFNKLAVASFLSLAATSVKASVTVYTIEGEVCVEDGTTITYGS
                     TVGKDTATHVITVVSNTDGSDINYSIASSGLYQWQQDLLDEHNLERAKHVDTPALTWS
                     SSLASIAQAEADAYDCSGTLTHADSPYGNNLAIGYSPVDAVDAWYNEIADYNFADPAF
                     STSTGHFTQVVWADTTEVGCGIKYCGAYYHDFITCYYNPPGNYIGEFAEEVHSLV"
     gene            <249786..>252647
                     /gene="TPHA0I01080"
                     /locus_tag="TPHA_0I01080"
                     /db_xref="GeneID:11534466"
     mRNA            <249786..>252647
                     /gene="TPHA0I01080"
                     /locus_tag="TPHA_0I01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687000.1"
                     /db_xref="GeneID:11534466"
     CDS             249786..252647
                     /gene="TPHA0I01080"
                     /locus_tag="TPHA_0I01080"
                     /inference="similar to DNA sequence:INSDC:YJL076W,YKR010C"
                     /note="similar to Saccharomyces cerevisiae NET1 (YJL076W)
                     and TOF2 (YKR010C); ancestral locus Anc_1.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687048.1"
                     /db_xref="GeneID:11534466"
                     /db_xref="InterPro:IPR018844"
                     /db_xref="UniProtKB/TrEMBL:G8BXI6"
                     /translation="MYKLQIELVPLNNASNAASVINDPYNQFYGNGNNNSISSDLKGR
                     VPSFQVSQLHQYQDRTFTNTNNSFVLPSHSSFNNNGNKKFLLFTKQSNSLYDLSQEII
                     AKCEKMYSDMKQTIDIESLQDCNGCDLDPDFIVKDVFLYDNNVRVILKHDIEFNNDKR
                     SVSSYGLSKKRKMNNGVAQQISAPLSSPYRDQSSKTNNKLRISTPLANQIYPNQTQQK
                     KEQLALATQVDTAAVDRSFLPPPFQPQSPGIVISSGADKSKRILSMDDQNNSVSKSET
                     VDPDKSKRQILLSGAPLMSTMTPNRVTLTGQRVVSEKSNINSKEVFTSMEKNGLKTPR
                     ITSGMLKIPEPKIQEAERALQEGPSSPASALPLKNNITPKKDKSDNITFSSEDEDRKD
                     SSSKPSNYHERSIANDNGSPVRQAQFDDKFQILNLKNLPSSNEAPAQLRKSSLEEKVQ
                     SKSNSDLFEKVEPRIINNFNEIKEGNTEAINPKISKLFSNSRSIVGSKADSSHFESKN
                     TESIDDKAATDEDEDDVGNETVRINKNITTNTAPVNSDAERRKLEQEEKKKLAQMRKK
                     AAEEKQILLEVEKHRLVEAAKQKAAEEKQRLLEEEKQKAAEAARKKIAEEKQRLLEAA
                     KKKAAEEKQRLLEEEKQKAAEEKQRLLEEEKQKAAEAARKKIAEEKQRLLQEKEKKAI
                     EEKQKLVQQKQRLDKVAKQKAMEEKYKLLEEEKKKSAGHQPASTSVATPVNSIAGVNI
                     LKELKAKYTDPQPRVSSGLKPNSNSSDDSSEDDSSNSSSSEQSSSSEESGEEENSHKK
                     VRRGIVGTPKGQLGTRTPPLRSTSSTATTSLLNNDDKSKMAVTKKSPSDKIEESLSIA
                     STQKSPIAISKLPPKMRPSLSSLSDLVSRGVPDVREKSFKFSQSPKQASIKEASYTSS
                     SSSNDSTTDYSSDSSDDSDSSSSSDDSEGYISIKFASQN"
     gene            complement(<252902..>256552)
                     /gene="TPHA0I01090"
                     /locus_tag="TPHA_0I01090"
                     /db_xref="GeneID:11532899"
     mRNA            complement(<252902..>256552)
                     /gene="TPHA0I01090"
                     /locus_tag="TPHA_0I01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687001.1"
                     /db_xref="GeneID:11532899"
     CDS             complement(252902..256552)
                     /gene="TPHA0I01090"
                     /locus_tag="TPHA_0I01090"
                     /inference="similar to DNA sequence:INSDC:YJL074C"
                     /note="similar to Saccharomyces cerevisiae SMC3 (YJL074C);
                     ancestral locus Anc_1.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687049.1"
                     /db_xref="GeneID:11532899"
                     /db_xref="GOA:G8BXI7"
                     /db_xref="InterPro:IPR002369"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:G8BXI7"
                     /translation="MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAA
                     IRFVLSDDYSNLKREERQGLIHQGSGSVMSASVEIQFYDPGNSMILPSGVAVNPDSTV
                     SIRRTVGLKKDDYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKE
                     RLQILEDVVGAKSFEAKLTASLKKMEETEKKRMQIAKEMKELTKKLDEMEEERKELEK
                     YNDLEGDRKVFQFTLYDRELNDIINQIEKLESEYTNILYTSEQYLQELDKREGIVVDI
                     TKTLQNTEASLKLKGTTELQQAKFHFTDLQNKVANYDVTINDIQSQINSQEEQTKIDQ
                     NNLNILSDAIKEKRKLVAECLPKFEELTKQENELRSVLASLQERQKNLMIKKGKYAKF
                     TTVEERNKWIDEEVANIKEEFTLLKTNKEQLTSEQEYNEQEVKKLDEDIEDLIDSTQG
                     PVVLGELDEVKEKIAKVKTEYSQKFDARRELWREEQRLQTILENMSEGVKRSERILNE
                     TMHRSVANGIKNVKEIVDKLNLPDDAVLGTLGELIKVSEKYKRCAEVIGGNSLFNIVV
                     DTDETASLIMDELYRMKGGRVTFMPLNRIRMDSNFTYPPNDQASCTPLIKKIKFDVRY
                     EKAVMHVFGKTIVVKDLGEGSKLAKRFKMNAITLDGDRADKRGELTGGYYDQHQKMKL
                     DALKDLKNANAQFKQITLELDTIHQKLNEMDSSIDQQNSLIKAETNKQETMLTNIDNL
                     NLKLNNKRGEKAIAEESIRKLKDKINNIEKHLDSSGKNLETFLKDREQPFDSELSEVE
                     KVDLENITISISERSEKLNEITEELDDVSGSLDKLRAQLDAKLIPQYNNLKAKISTSN
                     DSYVIGLKNELKSATSERDLLLEAYSRAKLEFTKLQNELEQLKSEKMNNQKILDKANS
                     QQKLLLKKLDNFQKDTEKIMIKKYTLASRRDEIQQKIRELGLLPEESLSKYQESSSDE
                     LLNELNNITKELSTLHNVNKRAFENFKKFSEKQNELVERAKELDDSKNSIQELITQLK
                     EQKITAVDTTFKKVSENFTKVFEKLVPRGTANLIIHRRSDDSLASMDINTDSQNISEL
                     VYTGVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAAL
                     DKQYRTAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRVKYENKISTVVEINRDSAI
                     NFIRGSNKIANI"
     STS             255069..256004
                     /standard_name="ha2747"
                     /db_xref="UniSTS:515592"
     gene            complement(<256970..>258283)
                     /gene="TPHA0I01100"
                     /locus_tag="TPHA_0I01100"
                     /db_xref="GeneID:11532900"
     mRNA            complement(<256970..>258283)
                     /gene="TPHA0I01100"
                     /locus_tag="TPHA_0I01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687002.1"
                     /db_xref="GeneID:11532900"
     CDS             complement(256970..258283)
                     /gene="TPHA0I01100"
                     /locus_tag="TPHA_0I01100"
                     /inference="similar to DNA sequence:INSDC:YBR287W"
                     /note="similar to Saccharomyces cerevisiae YBR287W;
                     ancestral locus Anc_1.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687050.1"
                     /db_xref="GeneID:11532900"
                     /db_xref="GOA:G8BXI8"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:G8BXI8"
                     /translation="MLEYVNNISFSEIAYSVFQSVLQVVIISLAGFWSAYMGLLPKNA
                     QKIVSSLNVDLFTPCLIFSKLARHLSLAKIVELGIIPIFYTVSTGISFLSGYLISKFF
                     SLDKDETNFVIANSIFGNSNSLPVSLTLSLAYTLPNLTWDDIPNDTRNNVASRGILYL
                     LIFQQIGQVLRWSWGYNKLMRWSGENHQHMPQSQIEAYIERTNSTILHESLTQQDLSF
                     VSLNDDDDETYDGDENDTGALANNISQLNNQTKSWIVKVFGKITSYLNPPLYAMMISV
                     IIAAIPKLQHELFQKNGFIKNTLSEAIIQLGSVSIPLILIVLGSNLYPNIETFPKTYN
                     HNKLVIGSIIGRMILPSMILLPIITLAVKYINKSILDDPIFLIVGFLLTVSPPAIQLT
                     QITQLNEFFEAEMASILFWGYVVLSLPVSIIVISGAIYVLQWANA"
     gene            <259489..>261489
                     /gene="TPHA0I01110"
                     /locus_tag="TPHA_0I01110"
                     /db_xref="GeneID:11532885"
     mRNA            <259489..>261489
                     /gene="TPHA0I01110"
                     /locus_tag="TPHA_0I01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687003.1"
                     /db_xref="GeneID:11532885"
     CDS             259489..261489
                     /gene="TPHA0I01110"
                     /locus_tag="TPHA_0I01110"
                     /inference="similar to DNA sequence:INSDC:YJL073W"
                     /note="similar to Saccharomyces cerevisiae JEM1 (YJL073W);
                     ancestral locus Anc_1.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687051.1"
                     /db_xref="GeneID:11532885"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G8BXI9"
                     /translation="MLADILFIFYVYLVQLVYCQDAVDLDTVDLRCDYDAFEVALREI
                     KYDKEASTMYNVLLENIQKCNAEKYSNEYVKKIKLINELLYKHGLLELSNGQELKSLR
                     KFQEIINNYSDINDTTESLRESDPYFTLAKERYSNINSLFGNWESIDALFSLNTKRED
                     RNLKDQSKIKELTYKNLLNEVENNLSQQNEQRNSEKIDQLFNELFQISPFNIKSRYLH
                     INYLLAELGESIDDLSISYDLIKSYQIIIEKNSLSLSLNERRDIRLNIAIIQTFLLGV
                     DSSRTIKSCLQLDMDFQPCKMIFSLQSKINKINPHRSLLLDSDEYKSGSYNDNSNINW
                     NQIIKLYLLDKKPVIKLNNEEKKEFENNYKLIQKISKVMLIILFENTNIDVLNSDKFN
                     DVELIKYIDALLCQSSTEDPDYKKLTNPYCKKALKNVMTKSQWTNFGKTLKNYEPFPI
                     DELRNIWNNYPHLAIHAIEVILKKLDNDKFKKYGELRDELKRFFDEIGAREANNQFIK
                     KQYENFEELQKNMYQNAHNQQQRQYQHQYQQQQQQQQQHQPPPQHGEFGNKDFYKVLS
                     IPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEILSDENKRR
                     DYDNSRGGSRNPSQGRPGGPGGPGGQGNPFDFGNNFNFNFRF"
     gene            complement(<261691..>263667)
                     /gene="TPHA0I01120"
                     /locus_tag="TPHA_0I01120"
                     /db_xref="GeneID:11532886"
     mRNA            complement(<261691..>263667)
                     /gene="TPHA0I01120"
                     /locus_tag="TPHA_0I01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687004.1"
                     /db_xref="GeneID:11532886"
     CDS             complement(261691..263667)
                     /gene="TPHA0I01120"
                     /locus_tag="TPHA_0I01120"
                     /inference="similar to DNA sequence:INSDC:YBR286W"
                     /note="similar to Saccharomyces cerevisiae APE3 (YBR286W);
                     ancestral locus Anc_1.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687052.1"
                     /db_xref="GeneID:11532886"
                     /db_xref="GOA:G8BXJ0"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR029514"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ0"
                     /translation="MLLKTGALFALSASISSGYVLPEIVQEAFQLDKTRDALLDQNHK
                     PDSNPPSLFSNILPHIPYFLKPQVDSNKLQESISIDDLNATAWDLYHIAEASEKHYGH
                     PTRVIGSKGHRKTIKYILKQFDQMKDYYDVSLQHFDALSGKINSFNLTDGVTGEPFIN
                     STALSLSPPVKPFTGRVVHIANLGCNEEDYKVALQALNAENSSNEKEDSIYFEKRSDK
                     KDKQSKKSTGKKSKKHNKHNKHEKKEKLIALIERGQCSFGTKSELAGKFGFEAAVIFD
                     NDPQSTGLHATLEKPKKHTVSTIGVTYQTGQLLITSIENDSNYTLNFAMDSYVKNIRT
                     VNVIADTKRGDPNNIIGLGAHSDSVEEGPGINDDGSGTISLLTVAKQLTHFKITNKVR
                     FAWWSAEEEGLLGSNYYADHLCPKENSKIRMFMDYDMMASPNYEYEVYDANNIDNPKG
                     SEELRDLYIDYYKSHNLNYTLIPFDGRSDYVGFINNGIPAGGIAAGAEKDNVFNGGVL
                     DKCYHLLCDDVSNLAWDAFLVNTKLIAHSVATYANSLEGFPVRENSTLIADDVVKTKK
                     KCNKHQEPSAKEDKHHKPSTKEAKHHKPSTKEAKHHEPSIKEDKHRKPSTKEDKHHKQ
                     STKEAKHHEPSANEYKMHRAVGQGFKYKGNQLVY"
     gene            complement(<264466..>265125)
                     /gene="TPHA0I01130"
                     /locus_tag="TPHA_0I01130"
                     /db_xref="GeneID:11532887"
     mRNA            complement(<264466..>265125)
                     /gene="TPHA0I01130"
                     /locus_tag="TPHA_0I01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687005.1"
                     /db_xref="GeneID:11532887"
     CDS             complement(264466..265125)
                     /gene="TPHA0I01130"
                     /locus_tag="TPHA_0I01130"
                     /inference="similar to DNA sequence:INSDC:YJL072C"
                     /note="similar to Saccharomyces cerevisiae PSF2 (YJL072C);
                     ancestral locus Anc_1.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687053.1"
                     /db_xref="GeneID:11532887"
                     /db_xref="GOA:G8BXJ1"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR016906"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ1"
                     /translation="MSLPPHLQETFSPDEIQFIVENENIKIFPRITTRQTVRNYRNLS
                     GNGDTNKTRWKLITSDENNLNNMVAMQTTEVALWVALLLKQQNKCSIIAPSWLTVKEL
                     SNKIRYEESYHDRFSPMPWDWLVLSNILFKKAADDFNDPIHELRTKIQDLREIRQLKV
                     MKGLEQLNESHLQLDNLSLMEINELRPFIADIMDKLREVHASANANETQSQSQDINMS
                     I"
     gene            <265662..>267416
                     /gene="TPHA0I01140"
                     /locus_tag="TPHA_0I01140"
                     /db_xref="GeneID:11532895"
     mRNA            <265662..>267416
                     /gene="TPHA0I01140"
                     /locus_tag="TPHA_0I01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687006.1"
                     /db_xref="GeneID:11532895"
     CDS             265662..267416
                     /gene="TPHA0I01140"
                     /locus_tag="TPHA_0I01140"
                     /inference="similar to DNA sequence:INSDC:YJL071W"
                     /note="similar to Saccharomyces cerevisiae ARG2 (YJL071W);
                     ancestral locus Anc_1.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687054.1"
                     /db_xref="GeneID:11532895"
                     /db_xref="GOA:G8BXJ2"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ2"
                     /translation="MWKKLLSGARFKLNQPNNSSKKLILSVLNSTATKREARDYLNKY
                     TDDPKKQNYCLLLVRNLSALHPFKVSQLSGTIEKINMLGLKFIFVIPPDSKNIDEDAE
                     VLDAITTLAGLNPLHLQNGLIKMKSGELQSIIESQRSIFTFENIYNNITHSKNSNNLV
                     PIIKPMLYDEKTSTNSLIESSNLFVKHICLNGVLNIDKFFIINDIGGIPSTERNSNSH
                     VFINLSQEYQHLNRDLEKVINLLEATKENKADLIEQLHVLKNGDVIESLIEKYKEHLN
                     DLQLMNSALSYLPNSSTGLITTISASNTSSDKKNPLVYNILTDRSLISSSLPMFKRKL
                     INDTPDYNLIEYDLYPQYRSENVLEDEKSTEDTALVTTVLKRGIDIKIFNYRTLTQYN
                     SKGIPPSFYSTIKENHLIDDLKIDLKKLNKMINRCFGRQLDLENYLKRINGQIATIIV
                     IGDYDGIAILTHEGPDNNKFVYLDKFAIVPEMKGSLGISDIIFNLMFKSFPKELLWRS
                     KKNNAVNKWYFQRSVGVLDLSMDFGNEDKTDRKDSEFKLFYYSEPEMQTEHFSNIERI
                     REYSKYIRDITPSWGKRM"
     gene            complement(<267520..>270270)
                     /gene="TPHA0I01150"
                     /locus_tag="TPHA_0I01150"
                     /db_xref="GeneID:11532896"
     mRNA            complement(<267520..>270270)
                     /gene="TPHA0I01150"
                     /locus_tag="TPHA_0I01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687007.1"
                     /db_xref="GeneID:11532896"
     CDS             complement(267520..270270)
                     /gene="TPHA0I01150"
                     /locus_tag="TPHA_0I01150"
                     /inference="similar to DNA sequence:INSDC:YBR284W,YJL070C"
                     /note="similar to Saccharomyces cerevisiae YBR284W and
                     YJL070C; ancestral locus Anc_1.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687055.1"
                     /db_xref="GeneID:11532896"
                     /db_xref="GOA:G8BXJ3"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ3"
                     /translation="MSSKRRNSLCLDDYEANIVAPQDELSTRIPKITHVKSSLTLDDL
                     DMVSLHTEFDQQMLLGFPMYADGIENATFNDKLSFNMFNKQNGSLEHGSSTSIVDESN
                     TNESVLNSDTYVDDDIQAMNTTINRVNQNRIKYIKRSMQDNLSDFKNDVNNWLMYPKP
                     LPKFWRFDRDKRFQNFRKSDNEIDPLFDLKHETNYAAEYGCNSDSNDDIREGDDDNEE
                     EDNFTANQKYQNDFFQFTLPVDRKTKSHIVEPYKKLGEVSYVGEYFSITHYQHLLKNY
                     NEKYDVKDFYCRDPDYLDKTSEIPSFEEFCEDFFNLLQVLQNRNFNVIAEKRLVYLNN
                     KFDLFQHLNQRREIQENKHVPYRDFYNCRKVDRNFYLSGCVQQKQLCDFIWEKINIEP
                     ERIVYVDEKLNKEYKLIDIFQLDLDERIDPNAIGFKIIDDEFLDWYKLFYLTNYHIIP
                     HSNFTKGNIETLPPLTPKHLKFYLIATTFLEFNNYMDGEYLAEIFIKYVIHYLELNKY
                     LLAQVTVDFQFYDIKSTSGKPLDPLTHYCHVNNWWIRFSNWISKWNVVSNNIRWNVNI
                     TRLYPRLFSLKLVENFKGFLDYIFKPLFDEDNINKNINLQYFLSTLAAMDLSVKNSDS
                     YIWKAFTNIRTTPNDWISKGDNPPVAYYMYYLFQKISKFNIMRNIRKQNSIVLRNSSS
                     TLRNRTSQFGTSMYFSEHAECLAANILLSNGGMLSSYPIWSATPLTQYFYYLLQIPMI
                     ASPLSSVSSLENNNFQNIDPTEEEAIYSLKMRDITLNESICYSKNPYMKLFQIGMKIS
                     LSCQSILFNKSYTREPLMEEYSVAASIYLLNAADVCELARNSVICSDFDGWYKRHWLG
                     VTIERTLYEHDTIGASNVWYDINGPYGRKGTSMRHNVPFIRRTYRNKTLNQEWIYVNE
                     QL"
     gene            <271371..>272861
                     /gene="TPHA0I01160"
                     /locus_tag="TPHA_0I01160"
                     /db_xref="GeneID:11532868"
     mRNA            <271371..>272861
                     /gene="TPHA0I01160"
                     /locus_tag="TPHA_0I01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687008.1"
                     /db_xref="GeneID:11532868"
     CDS             271371..272861
                     /gene="TPHA0I01160"
                     /locus_tag="TPHA_0I01160"
                     /inference="similar to DNA sequence:INSDC:YBR283C"
                     /note="similar to Saccharomyces cerevisiae SSH1 (YBR283C);
                     ancestral locus Anc_1.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687056.1"
                     /db_xref="GeneID:11532868"
                     /db_xref="GOA:G8BXJ4"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ4"
                     /translation="MANFSLIDTVKPFLPVLPEIELPYEKLEFDDKIVYTIASGLIYL
                     FSQFPLAGIPKDSETGKILTNVKDPIFFLRGVFAAEPNTLLEFGIFPIVSTSIILQLL
                     AGLKCIRVNFTVEKERETFQSFSKLLIIIQYFILANIFIFSGYYGDNLPIVSIVLLNL
                     QLVGAGIFATLLVEIIDKGFGFASGVMSINTLVVSTNLIADMFGVASIKINEESDVTE
                     SQGSVIYFLNAFRAKHLTIVQGIVNAFQRDYLPNLTSSVIVLAIAAVVGYLFSCTLEL
                     PVRSTRARAMQNVYPIRLIYVGALSIYFSYSLLFYIHIAAFALIQIVAKNDTSNILAK
                     VLGHYEIFNNILYVPSFPLSLLAPPRSFFAGIVEQPLTFITFTAFMVYTGMWFAHKWQ
                     RISGDSANDLAEQFKDQGITLAGRREQNIAKELEKVIPVAATTGAVVLALVTVAGEYL
                     GLKGKAAAAVVGVAGGFSLLEIISLEYQQTGGQSALTQVLGVPSTF"
     gene            complement(<273117..>273554)
                     /gene="TPHA0I01170"
                     /locus_tag="TPHA_0I01170"
                     /db_xref="GeneID:11532869"
     mRNA            complement(<273117..>273554)
                     /gene="TPHA0I01170"
                     /locus_tag="TPHA_0I01170"
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /transcript_id="XM_003687009.1"
                     /db_xref="GeneID:11532869"
     CDS             complement(273117..273554)
                     /gene="TPHA0I01170"
                     /locus_tag="TPHA_0I01170"
                     /inference="similar to DNA sequence:INSDC:YBR282W"
                     /note="similar to Saccharomyces cerevisiae MRPL27
                     (YBR282W); ancestral locus Anc_1.304"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /protein_id="XP_003687057.1"
                     /db_xref="GeneID:11532869"
                     /db_xref="InterPro:IPR019189"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ5"
                     /translation="MKATAARLFQESPISFLTRPWIKNRDGTLFYGISKTGNRRTALT
                     TKQGNKTMYKGTRSSGIGKHTTLGKYMIDWVKVRTFKTPSVMNTDLKPLVSDEVPELA
                     HTFKGYQKGPHDTKLYFDKLRNYIKNGEVQTAATDAKCYVERG"
     gene            <274330..>276999
                     /gene="TPHA0I01180"
                     /locus_tag="TPHA_0I01180"
                     /db_xref="GeneID:11534359"
     mRNA            <274330..>276999
                     /gene="TPHA0I01180"
                     /locus_tag="TPHA_0I01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687010.1"
                     /db_xref="GeneID:11534359"
     CDS             274330..276999
                     /gene="TPHA0I01180"
                     /locus_tag="TPHA_0I01180"
                     /inference="similar to DNA sequence:INSDC:YBR281C"
                     /note="similar to Saccharomyces cerevisiae DUG2 (YBR281C);
                     ancestral locus Anc_1.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687058.1"
                     /db_xref="GeneID:11534359"
                     /db_xref="GOA:G8BXJ6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017149"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ6"
                     /translation="MINQKRTHEMSSRDSLLPEPIHRWNHFYSILSIVSFPKKNLLVA
                     GTQDSKILVFDLTTYNLMTTKSLGIYNNLNETNTRSSVLCMTKARDENYLFTAGSDSL
                     VRIWSIGEAKDDQSPTINEEATVYSVSDIGDVFSIRYFDDLDTVLIGCQNASLLYLDD
                     LLVRIKDSSSMAAKNFERLPHRRFDKFFDSVGPTGKSFVSPGHPSITHDQHTFDRTVS
                     PIDSTGCILEIPSSHIISYAHNGFIYSIEELDLPHMANKVHGEYTYTAHMVTGGGDCL
                     SKVWSMSKTANGVIVTLTSETMDNEESVISQAFEYPFLYCGLSDGLIKIWDISTKQLV
                     STLKAEGDTDIISIAVYNDHIYAFNESGISHFHENKRQTWSSNQGKVLCSEIFQRVNF
                     PPNNFVSLLTGGNDGSLVLSNLCNDIDNKSKLVKQINIGQGRARKDSFAFYKPAVLSN
                     ELMLDTLRELISFNTVSENADTSQQLSSRRCATFIKQLLADFGAINSQLLPIKNGSNP
                     VVFAEFEGNAPRKDRKKILWYGHYDVVPAGDTSLWNTDPFVLTCENGYMKGRGVTDNK
                     GPLIAAIYSTASLFQEQKLQNDVVFLIEGNEEIGSPGLKDACIEHLKLIGPKIDWIFL
                     SNSSWVDETHPCLNYGLRGVINAEITLWHDGPNKHSGVDGGVFSEPTTELIRMLSKLQ
                     NNDGFINIPGFYDNISELSEEERERFEKVLMVSNLHKNLNLDELVANWTKPSLSITSI
                     DISGSGNITVISKSVSVGLSIRLVPGQDVEQVKANLIHFLQNLYKESNSKNHINIKIV
                     NVADVWLGDPKNHAYQILKHEVTKAWNIEPLFVREGGSIPCIRFLEQIFEAPAVQIPC
                     GQSTDNAHLDNESLRIINWSKMSKILTNVLNKL"
     gene            <277383..>279182
                     /gene="TPHA0I01190"
                     /locus_tag="TPHA_0I01190"
                     /db_xref="GeneID:11534360"
     mRNA            <277383..>279182
                     /gene="TPHA0I01190"
                     /locus_tag="TPHA_0I01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687011.1"
                     /db_xref="GeneID:11534360"
     CDS             277383..279182
                     /gene="TPHA0I01190"
                     /locus_tag="TPHA_0I01190"
                     /inference="similar to DNA sequence:INSDC:YBR280C"
                     /note="similar to Saccharomyces cerevisiae SAF1 (YBR280C);
                     ancestral locus Anc_1.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687059.1"
                     /db_xref="GeneID:11534360"
                     /db_xref="GOA:G8BXJ7"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR027046"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ7"
                     /translation="MSINHEENEDNSLLNPDIIQAALPFLSPTDLKNLSLTNKYFNKL
                     LNYSSSDTLWHELYHKVYNTRYTDDEPFQTALTNEYRNYPSMIMAGKFTDCSWHDIFK
                     LRSKNTHMYTWGCLKHGRLGYDVGSNPKLTEDQLNQSGFRVKSGVNQPVMVPWITINE
                     DNSNLNDFSVAEVSGGGFSFQILTKSGKLFSTGSTFSGGYNGPGPINDEIDYNPFRSL
                     IENLENSLPRIRIGGRMDINTTGVMGGRAMRNFGPTPASNVPQPTVIPGQPHSDIYSG
                     LMELEKTTNTTLDGNSNIRRMFPRNVFDFYTDTSNKVTRVNEKKMESVRFVAVSSGRS
                     HFLALDENNKLYSWDTKDLDHGVQLGFKDIDLNEHPIIKISCGWNFSCAYIYNIGLVV
                     WKAREALKKGQLISNVDYEIIPNTSDNCAENKILDFTCLKDNRVLFITNKGDKLFDYF
                     NGEITSSPVHLDNNIIKISSCFSSLVLFTTAQCFKIDIRGSILDFDNIMPIQLDDTDD
                     TIVSLASGDFHSLALTQKGNLYSWGLESQLSGCLGLGLPDSIVQEERVGIYENNGRNI
                     RVLNPSKIKLEDDCVAIAVAAGGWQSSALIVKK"
     gene            complement(<279404..>280372)
                     /gene="TPHA0I01200"
                     /locus_tag="TPHA_0I01200"
                     /db_xref="GeneID:11534361"
     mRNA            complement(<279404..>280372)
                     /gene="TPHA0I01200"
                     /locus_tag="TPHA_0I01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687012.1"
                     /db_xref="GeneID:11534361"
     CDS             complement(279404..280372)
                     /gene="TPHA0I01200"
                     /locus_tag="TPHA_0I01200"
                     /inference="similar to DNA sequence:INSDC:YJL066C"
                     /note="similar to Saccharomyces cerevisiae MPM1 (YJL066C);
                     ancestral locus Anc_1.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687060.1"
                     /db_xref="GeneID:11534361"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ8"
                     /translation="MGLYDKNQDINRFNETVIERELNNADDGFPNLGSDFFQEANEII
                     SHPFRWGIVNSQNGQLDKVLSRNYDGLGDFQNIFGLPTRSPTSTWFGELFDPSVYNNQ
                     LIRQGVTGLYSFTAPTTEQYSSCMETNGLSVWDSNGWWRCLFPRSTIERNIEKKNLQN
                     SIYGEQKNAILSKEDVLSDVDHKKYGIFFQEYTDLLNWKSQMNRIIKNRQQEQNTIAK
                     KNDELKSANSTDLVLADTPENLMMTDYSSLDDNIDNKSVIGSAKYTTYNSTREGKEKI
                     QLWKTYYDDDTVNIKSQKTIKPADGSKPKTEYSEKTVNRKDDNSSF"
     gene            complement(<280633..>281343)
                     /gene="TPHA0I01210"
                     /locus_tag="TPHA_0I01210"
                     /db_xref="GeneID:11534530"
     mRNA            complement(<280633..>281343)
                     /gene="TPHA0I01210"
                     /locus_tag="TPHA_0I01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687013.1"
                     /db_xref="GeneID:11534530"
     CDS             complement(280633..281343)
                     /gene="TPHA0I01210"
                     /locus_tag="TPHA_0I01210"
                     /inference="similar to DNA sequence:INSDC:YBR278W,YJL065C"
                     /note="similar to Saccharomyces cerevisiae DPB3 (YBR278W)
                     and DLS1 (YJL065C); ancestral locus Anc_1.311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687061.1"
                     /db_xref="GeneID:11534530"
                     /db_xref="GOA:G8BXJ9"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:G8BXJ9"
                     /translation="MPTAEHVNMMDLDDQSLDNLYKLKAPKLPISKVKKIARCDPEYV
                     ITSNSAFIATAFATEIFIKNFAEETIVLSQLSSTNGQKVKRITYADLAKTVQRHEKFH
                     FLTDVIPITKNLKTLVKQNKVRYSNVAPSSGNQRTLPFQSMSTNTNDSKDEVNSGDEI
                     YDENDDIEEAEEEEDDEDDDAEDEDELEAKTVQEQKDMQDELKKVEQLNYVIDLDKED
                     SNSNDEEINDHYGESDEE"
     gene            complement(<281541..>282314)
                     /gene="TPHA0I01220"
                     /locus_tag="TPHA_0I01220"
                     /db_xref="GeneID:11534531"
     mRNA            complement(<281541..>282314)
                     /gene="TPHA0I01220"
                     /locus_tag="TPHA_0I01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687014.1"
                     /db_xref="GeneID:11534531"
     CDS             complement(281541..282314)
                     /gene="TPHA0I01220"
                     /locus_tag="TPHA_0I01220"
                     /inference="similar to DNA sequence:INSDC:YJL063C"
                     /note="similar to Saccharomyces cerevisiae MRPL8
                     (YJL063C); ancestral locus Anc_1.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687062.1"
                     /db_xref="GeneID:11534531"
                     /db_xref="GOA:G8BXK0"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:G8BXK0"
                     /translation="MTKGLARKLSRTKAHRTALLKNLVSDLFQHGSIVSTHEKCMEAR
                     TLAERVVSMCNKDIALMKNDQATLDTVYRRNIQSRLFLSGDNSKLLKKVYSICNNNVE
                     LQEKARKSGFTRVLHLEPRLNDGARQSILELVDYPVIDTLDTDTDAVKLHRGNIKLWL
                     LVKTVLYNEAHSLPHDQLTLKNLHTIAAYKTKEAFAKEIGAIRSVLLQEIYNDKPIVP
                     EQETKTLDALITQIYNYTKPEALQRRGFQVMQERPPRSI"
     gene            <282603..>282848
                     /gene="TPHA0I01230"
                     /locus_tag="TPHA_0I01230"
                     /db_xref="GeneID:11534467"
     mRNA            <282603..>282848
                     /gene="TPHA0I01230"
                     /locus_tag="TPHA_0I01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687015.1"
                     /db_xref="GeneID:11534467"
     CDS             282603..282848
                     /gene="TPHA0I01230"
                     /locus_tag="TPHA_0I01230"
                     /inference="similar to DNA sequence:INSDC:YJL062W-A"
                     /note="similar to Saccharomyces cerevisiae YJL062W-A;
                     ancestral locus Anc_1.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687063.1"
                     /db_xref="GeneID:11534467"
                     /db_xref="UniProtKB/TrEMBL:G8BXK1"
                     /translation="MLAPSNYTDKRTWKMTPAMIRARKPFFVRNMVGLSALLGASLGI
                     YFYTYRVLHKDNDFADVPIPPIDKKELEALQKEFSTK"
     gene            <283537..>285210
                     /gene="TPHA0I01240"
                     /locus_tag="TPHA_0I01240"
                     /db_xref="GeneID:11534468"
     mRNA            <283537..>285210
                     /gene="TPHA0I01240"
                     /locus_tag="TPHA_0I01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687016.1"
                     /db_xref="GeneID:11534468"
     CDS             283537..285210
                     /gene="TPHA0I01240"
                     /locus_tag="TPHA_0I01240"
                     /inference="similar to DNA sequence:INSDC:YHR135C,YNL154C"
                     /note="similar to Saccharomyces cerevisiae YCK1 (YHR135C)
                     and YCK2 (YNL154C); ancestral locus Anc_2.105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687064.1"
                     /db_xref="GeneID:11534468"
                     /db_xref="GOA:G8BXK2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BXK2"
                     /translation="MNATSSNVNTMNNTNVTVHGTMAMNHTGNSNMVSGNTNASASVS
                     ASNANPSNTSTRDDSTIVGLHYRIGKKIGEGSFGVLFEGSNMTNGASVAIKFEPRKTE
                     APQLKDEYRTYKILRDTPGIPNAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVK
                     SVVQVAVQMITLIENVHARDLIYRDIKPDNFLIGRPGQQDENNVHLIDFGMAKQYRDP
                     KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLK
                     APNNKQKYEKIGEKKRSTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRNLLLS
                     VLDDINETQDGQYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSRRHRNKLQQQQ
                     QHHQQQQQQQQQQQQQQQQQQQLQQQQLQHQQQQHQQQLQQQQNLMNNNIHDDAFNAQ
                     QQRLDPTSYEAYQQQTEQKYAQQRQQKQQRSQQPYQAQNRMNGVDYRNNGGAMNNVQQ
                     PQQNKYHFQQEPSAANKNNNQNNNLQQNTNMDMTSLNSHKGFFSKLGCC"
     gene            complement(<285513..>286316)
                     /gene="TPHA0I01250"
                     /locus_tag="TPHA_0I01250"
                     /db_xref="GeneID:11532870"
     mRNA            complement(<285513..>286316)
                     /gene="TPHA0I01250"
                     /locus_tag="TPHA_0I01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687017.1"
                     /db_xref="GeneID:11532870"
     CDS             complement(285513..286316)
                     /gene="TPHA0I01250"
                     /locus_tag="TPHA_0I01250"
                     /inference="similar to DNA sequence:INSDC:YNL155W"
                     /note="similar to Saccharomyces cerevisiae YNL155W;
                     ancestral locus Anc_2.106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687065.1"
                     /db_xref="GeneID:11532870"
                     /db_xref="GOA:G8BXK3"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:G8BXK3"
                     /translation="MNEISLSDDANKTGMLDVGTHCGFCQQLDFLTFHCKHCNGDFCS
                     QHRSIKEHHCPHPPKTETQTEVPTSRGNGGDYLKILLPEDSATRVQKGHTLHSPQPTG
                     KDILGASTKNENALSKLIKFFQAKKKLSNYNEKISKSKNRSPVYMLASIKKSAKGDNN
                     IPVDKRMYIKCYVIDDNVDNEPTDIFINNTWSLGKTLDYLASSLGVSNNNTSFKTTDE
                     EQLFLCKNKKGGSDSFDMESIECLDLSLRVQKALVNLEVVYLVRGHKFR"
     gene            complement(<286437..>287006)
                     /gene="TPHA0I01260"
                     /locus_tag="TPHA_0I01260"
                     /db_xref="GeneID:11532871"
     mRNA            complement(<286437..>287006)
                     /gene="TPHA0I01260"
                     /locus_tag="TPHA_0I01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687018.1"
                     /db_xref="GeneID:11532871"
     CDS             complement(286437..287006)
                     /gene="TPHA0I01260"
                     /locus_tag="TPHA_0I01260"
                     /inference="similar to DNA sequence:INSDC:YNL158W"
                     /note="similar to Saccharomyces cerevisiae PGA1 (YNL158W);
                     ancestral locus Anc_2.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687066.1"
                     /db_xref="GeneID:11532871"
                     /db_xref="InterPro:IPR019433"
                     /db_xref="UniProtKB/TrEMBL:G8BXK4"
                     /translation="MLSYTYFALWVWCLHIVAGNTETFLVSLPADYPIFKYVGDVGAH
                     DYHVLSLNNTNNDKITINPIVSARTVTHYIELQSLKKFESYMVKTCWSAVSPISIHNM
                     DTMIVPPLQDFMGTTSEHPRFFIAFDITQDSYPTIDMLESLINVSVTNVKLGIPVDLY
                     STIIYILFTCGFVFALERYLNLVARITTI"
     gene            <288402..>290717
                     /gene="TPHA0I01270"
                     /locus_tag="TPHA_0I01270"
                     /db_xref="GeneID:11532872"
     mRNA            <288402..>290717
                     /gene="TPHA0I01270"
                     /locus_tag="TPHA_0I01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687019.1"
                     /db_xref="GeneID:11532872"
     CDS             288402..290717
                     /gene="TPHA0I01270"
                     /locus_tag="TPHA_0I01270"
                     /inference="similar to DNA sequence:INSDC:YHR131C,YNL144C"
                     /note="similar to Saccharomyces cerevisiae YHR131C and
                     YNL144C; ancestral locus Anc_2.113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687067.1"
                     /db_xref="GeneID:11532872"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BXK5"
                     /translation="MARARIDCTGDAPAMEPDVLRSLGSDHSIASSFDVAPDSLVSNS
                     NTTLYSDHNILNELALKNLQCYNANFDKIDNEFIYLIDPVPVHTPDYTSVFPYQVSKL
                     SQNPIYERVVKNESLPPYKHTIYKYTVVSVKQEFATPYEPSLNRNWVNLIVELNSTQL
                     NFYSIEESLTSSIKSYSSNVFETNDFRLNSNAKFHNFFKKTKTYMLDDVETKKILKKI
                     KKNPSKYLNNSNMVTSFSLQFGKVGIPKDYKKRSHALRLRLETQQFLIKFPTIDDLIY
                     WANYIHMGICISLDLDLRELPKYKFIPRRRRRRRDVISDEPHERNERRPQISGYIRSS
                     SGSALFMSNPNRDNYLSEHLNLLHSTPISDKSHSPLISQSLKSPTGLNDGRSNSLSIK
                     IKNIFKSNKSRPSSTSNTPSNSRSSTPVSLSRKEHFQNTRTRTTRSTSLPSSIRSPAL
                     TTKKSLSSIKVNIKQDRIENSSTCTIHAPAARHNTNMNSLLNSDSFNNERSSKNEVNS
                     FIDKPIDLIAFGEESPTTEQNISPNSMERRTLDPNLTIQNEKCKHSISLHQMDYLDVI
                     GEYNNEDDEYEEGEEIYSDGDYAEDEIMSRSNSTNRLSIYDVEGFFHESDDDDDYDFH
                     FNGVTNSQTRTTSMNETNQTPTSVPVNHQPSITIYDYHDEIKWYPPSKQMTRKRFIKH
                     SLRCLKTLNEKKAWVGKICIQPQNIKSSDGIKPIYIGDPKNNSKSLNGYHIDSPTRNH
                     PVKASIIGPVGFIHFSEKYTLLDKMESKHIE"
     gene            complement(<290869..>290973)
                     /gene="TPHA0I01275"
                     /locus_tag="TPHA_0I01275"
                     /db_xref="GeneID:11534665"
     mRNA            complement(<290869..>290973)
                     /gene="TPHA0I01275"
                     /locus_tag="TPHA_0I01275"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687020.1"
                     /db_xref="GeneID:11534665"
     CDS             complement(290869..290973)
                     /gene="TPHA0I01275"
                     /locus_tag="TPHA_0I01275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687068.1"
                     /db_xref="GeneID:11534665"
                     /db_xref="UniProtKB/TrEMBL:G8BXK7"
                     /translation="MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA"
     gene            complement(<292074..>292178)
                     /gene="TPHA0I01280"
                     /locus_tag="TPHA_0I01280"
                     /db_xref="GeneID:11534666"
     mRNA            complement(<292074..>292178)
                     /gene="TPHA0I01280"
                     /locus_tag="TPHA_0I01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687021.1"
                     /db_xref="GeneID:11534666"
     CDS             complement(292074..292178)
                     /gene="TPHA0I01280"
                     /locus_tag="TPHA_0I01280"
                     /inference="similar to DNA sequence:INSDC:YNL145W"
                     /note="similar to Saccharomyces cerevisiae MFA2 (YNL145W);
                     ancestral locus Anc_2.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687069.1"
                     /db_xref="GeneID:11534666"
                     /db_xref="UniProtKB/TrEMBL:G8BXK7"
                     /translation="MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA"
     gene            <293545..>295422
                     /gene="TPHA0I01290"
                     /locus_tag="TPHA_0I01290"
                     /db_xref="GeneID:11534692"
     mRNA            <293545..>295422
                     /gene="TPHA0I01290"
                     /locus_tag="TPHA_0I01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687022.1"
                     /db_xref="GeneID:11534692"
     CDS             293545..295422
                     /gene="TPHA0I01290"
                     /locus_tag="TPHA_0I01290"
                     /note="ancestral locus Anc_2.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687070.1"
                     /db_xref="GeneID:11534692"
                     /db_xref="GOA:G8BXK8"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:G8BXK8"
                     /translation="MSSSKRSLKEILNSEYVGDSDEDEYNSRVAEGLEIEDELEEEVD
                     PSLCIECKDMKCEIICNDCEERFCVVCFDMIHRGGKRRKHEYIKITSDNVEQLSNEAE
                     EDGKDKNTIDKPETEVEQQAIQDSINATESNQTSDDQSDISLSNKRESVEDKLLNILL
                     DSSSFIPMRLTYDERHLLRLLEAGLQVSEYTDRVDVLSYTSKTKRIVEQLKEMCSVLS
                     GLVIASNIKAGKKLLEMKNFSDNSSWFQNIFEIGRRYKIMNPERMRDTYGKLCYMVMD
                     SRLPQIEDHMEFHLFKPIKTVKSFLTAITEDNGKAMGIFKDKLIIHAITHISPIGKSR
                     AEINRLIRLKESAIEKLASKYSSKYYSKDDIFQALYSIGDYNAYVDMNRRPIRRMLER
                     LEVFRDTDIAQKYSIGIQYGRDGARLTHDHQRQWNYVQQSLTLWSVIQREMVKLWYIA
                     DQDLFDGSQYRLASTGHGLNRIKSCPGIYKEMHKIINECRSKCDTWVGSSVVHLGDDA
                     VPNALFFLDKYTQIPSILIPFDNTLLKINELVSDDPYLEDYIIKEYGSVNDLKLTILQ
                     DAFAHMFDGSGADNFYMSGSCIDGRLTSAWNHCNEISKKKYYNIFLLTSFSGFNGSEG
                     F"
     gene            <295950..>297089
                     /gene="TPHA0I01300"
                     /locus_tag="TPHA_0I01300"
                     /db_xref="GeneID:11534693"
     mRNA            <295950..>297089
                     /gene="TPHA0I01300"
                     /locus_tag="TPHA_0I01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687023.1"
                     /db_xref="GeneID:11534693"
     CDS             295950..297089
                     /gene="TPHA0I01300"
                     /locus_tag="TPHA_0I01300"
                     /inference="similar to DNA sequence:INSDC:YHR129C"
                     /note="similar to Saccharomyces cerevisiae ARP1 (YHR129C);
                     ancestral locus Anc_2.117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687071.1"
                     /db_xref="GeneID:11534693"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:G8BXK9"
                     /translation="MNNEGLYNQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFD
                     KVMIGGLDDNMYIGNKAQENRGLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHI
                     EEHPILITEAPLNSSKNREHMCEILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCG
                     EGYCSAVPIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFSSNEKEIVRTIK
                     ERACYVADDISKEEHKYILDSESNSSKFKLPDGKSLSIGNVRFRATELLFNPRLIGCE
                     SDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKELQILTKQDTKLR
                     IIASPERKYTTWIGGSILAGLSTFQKILVTKSNWNEDRSRVYSSF"
     gene            complement(<297243..>297787)
                     /gene="TPHA0I01310"
                     /locus_tag="TPHA_0I01310"
                     /db_xref="GeneID:11532881"
     mRNA            complement(join(<297243..297593,297776..>297787))
                     /gene="TPHA0I01310"
                     /locus_tag="TPHA_0I01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687024.1"
                     /db_xref="GeneID:11532881"
     CDS             complement(join(297243..297593,297776..297787))
                     /gene="TPHA0I01310"
                     /locus_tag="TPHA_0I01310"
                     /inference="similar to DNA sequence:INSDC:YNL147W"
                     /note="similar to Saccharomyces cerevisiae LSM7 (YNL147W);
                     ancestral locus Anc_2.119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687072.1"
                     /db_xref="GeneID:11532881"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR017132"
                     /db_xref="UniProtKB/TrEMBL:G8BXL0"
                     /translation="MSETVIQDKPIEQREKQQQPKKKFEGPKRDAIVDLGKYKDTEVR
                     VELMGGRLVTGILKGYDSLMNLVIDNAIEYVKGLDDQVDVGKEEKRELGLTVVRGTVL
                     SSISPVDGSNVIYISMEE"
     gene            <298151..>298909
                     /gene="TPHA0I01320"
                     /locus_tag="TPHA_0I01320"
                     /db_xref="GeneID:11532882"
     mRNA            <298151..>298909
                     /gene="TPHA0I01320"
                     /locus_tag="TPHA_0I01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687025.1"
                     /db_xref="GeneID:11532882"
     CDS             298151..298909
                     /gene="TPHA0I01320"
                     /locus_tag="TPHA_0I01320"
                     /inference="similar to DNA sequence:INSDC:YNL148C"
                     /note="similar to Saccharomyces cerevisiae ALF1 (YNL148C);
                     ancestral locus Anc_2.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687073.1"
                     /db_xref="GeneID:11532882"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:G8BXL1"
                     /translation="MSSISVFVSSNFSSLTKEMSKEISLSELCQKMYPITGVSSEDME
                     LTIESADGNKVKYQVNVMGSIDGIYPFKDFTGTNVTVHVVDPNKDSIVNQLLESGDNS
                     DKYTYTLLEEDYQRRTDSVLQWKKDNKLGKYDPKYQAGLLKQRELQNSIAEKLQVNVR
                     CSVKVSNKLERRGWLRYIGKLQAVANTDNSNDLWCGVEFDEPTGKNDGSINGVRYFGP
                     VLKNHGGFVKPLYVETGDQFTPLESDLDFSDEEI"
     gene            <299350..>300090
                     /gene="TPHA0I01330"
                     /locus_tag="TPHA_0I01330"
                     /db_xref="GeneID:11532892"
     mRNA            <299350..>300090
                     /gene="TPHA0I01330"
                     /locus_tag="TPHA_0I01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687026.1"
                     /db_xref="GeneID:11532892"
     CDS             299350..300090
                     /gene="TPHA0I01330"
                     /locus_tag="TPHA_0I01330"
                     /inference="similar to DNA sequence:INSDC:YNL151C"
                     /note="similar to Saccharomyces cerevisiae RPC31
                     (YNL151C); ancestral locus Anc_2.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687074.1"
                     /db_xref="GeneID:11532892"
                     /db_xref="InterPro:IPR016264"
                     /db_xref="InterPro:IPR024661"
                     /db_xref="UniProtKB/TrEMBL:G8BXL2"
                     /translation="MSNWGSRAGNGSNSKLSNLPFGLGYHDVDKEASKEVPTIQLPVN
                     NPVNERERSLSIRYIKFQESVREGPFFTGSLNVLLADEINQNGDKENAGNKSKKRTDI
                     IYEGSLNDGIERYSDKYLKKGKLGVSIDEFPFHLEHFPEELYKAMGINKKKILNLSKL
                     NDKDDLFTGNGDDDSKGISILEELKDLADDLDETEEGANDGDKAIESEDEDFDDDSDN
                     DDYNAEKYFDDGDDDFGGDEEFGDEPAF"
     gene            complement(<300508..>304839)
                     /gene="TPHA0I01340"
                     /locus_tag="TPHA_0I01340"
                     /db_xref="GeneID:11532893"
     mRNA            complement(<300508..>304839)
                     /gene="TPHA0I01340"
                     /locus_tag="TPHA_0I01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687027.1"
                     /db_xref="GeneID:11532893"
     CDS             complement(300508..304839)
                     /gene="TPHA0I01340"
                     /locus_tag="TPHA_0I01340"
                     /inference="similar to DNA sequence:INSDC:YNL139C"
                     /note="similar to Saccharomyces cerevisiae RLR1 (YNL139C);
                     ancestral locus Anc_2.125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687075.1"
                     /db_xref="GeneID:11532893"
                     /db_xref="InterPro:IPR021418"
                     /db_xref="InterPro:IPR021726"
                     /db_xref="UniProtKB/TrEMBL:G8BXL3"
                     /translation="MLASRLNALAHNNISFEQSRNIFSEAFINDWSSKSLELISQYLE
                     VTDVDEKHDWLRNFFIELFQILYLPNLPNNVTIQLLAQLINELVQKSNDSSELIGMAF
                     VSASSTYSKEDDNRLLLLAKEIPVLYDELFKFSPISSKLMTKDQMVLMRHLLKKTKFE
                     LKKYNLLFECSSGYGNLIALLYMAFHDIDKIDKIDFYSHELSHVMGKFSLDSMRSLDL
                     ILRISSEFVTEDYNFILKLLQATDFWPNEKLSNSNISNSDHLSENVIVSNVIAFTINS
                     FAMDDPTKLDSIRYIDMCCILIKSKFVHFSHIWIKLSPTSKEFVKQLQEYQDKLEKES
                     MQGVSNPLAMAAALSLEDDEDEEANGRKVDDNKLTQKSPNSSEGKKTSDDHESKAQNT
                     TNNNNIDITGSVHILFLERLLSIGCYDAVVQIFREHPSLMSVNKLIPKLFARLFEYRI
                     NSLYENTCLSQIENLTGALKDTVNESDLISHRSKLINYELTHDPYETTFLNTKFKFFY
                     EDWKSELAIIESIEKLFEESHSFFYTIGPYLSHATILLSKLVRLGISDIKDEKDDELR
                     VSKIDKWIDYTRKFIMPTLPLLENCPSVATNIYELLSMFSFEKRYFLYNEVLSKLSKD
                     DVNVKIGFNRAAREAKRLLKVLNTDNIEQEARNFSCVLSTNPLATLTNVVEQVENYDK
                     VTELVIITAKYFNNFAYDVLQYIILQRISQQRNTVQDDGVNPTSWVTRISSFIAGLTK
                     KCPNMNIDKIITFIIKTLHKGNIIAISILKELLHTVGGIRDLNEVNIKQLKMLNSAPQ
                     LQSIARSLIYDTRDQNSEQSQKLIKIFKEQNSLSEVIILLNNLILEANSLPLHYKILS
                     SNCDELNSLLWSFIELVQYTMSKDEFRETIIPFRLLSNNHRISVPWLFHLWRSNIGSN
                     KESNANIFLNMKDDVTFTDVDTSLIDYELFIYFWTFDLYNMHHDSALYKEAELILEKE
                     LKSETNSRKISHLKKQINELSNSSGVHQRDFNETTETLKNKSNTWENSLDEKGIEMFL
                     QYCIIPRSLFNPLDSLYSSYFLLQNFEVEKLLEIASTLFNSDILGTLLFSCTSLEAGN
                     LGIFFNSFLSKIEEIREKNGIDHPKAKDIYSWYYNFLKQIISTLLNNNYMSIRNGIEF
                     MKYVTNIFPIVDDHIHLLIKTLERRLSDEKREDIKLPSTALLGHLKARLKKAKTKFDF
                     YVLTGSEKESHDTYIQEVKEIEIAKSAEDNVKKQDTLRKRIEASKPSAVKSEISIHKE
                     PSSVLSTPSPVNNNVFQVVRLIKEISYHISADNFNRVLSLLDDNVMSQKIKDLSKRTN
                     SVNYYKSQLLNLLEDHFRNLSRGASDEQLELQLKDLKLLISKLDHILGRTSTPLYSEN
                     SSAHTSRYNRDSTNDQNIDSKRDFRTASNYRHNIGKSTIQVDQNKAHGDNRVPKRKLR
                     IVNLYIQ"
     gene            complement(<306732..>307271)
                     /gene="TPHA0I01350"
                     /locus_tag="TPHA_0I01350"
                     /db_xref="GeneID:11532894"
     mRNA            complement(<306732..>307271)
                     /gene="TPHA0I01350"
                     /locus_tag="TPHA_0I01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687028.1"
                     /db_xref="GeneID:11532894"
     CDS             complement(306732..307271)
                     /gene="TPHA0I01350"
                     /locus_tag="TPHA_0I01350"
                     /inference="similar to DNA sequence:INSDC:YNL133C"
                     /note="similar to Saccharomyces cerevisiae FYV6 (YNL133C);
                     ancestral locus Anc_2.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687076.1"
                     /db_xref="GeneID:11532894"
                     /db_xref="UniProtKB/TrEMBL:G8BXL4"
                     /translation="MSLEDDSISTQEQVNDNLNKLNFVSEGNTDLKSQQNKAEATQAK
                     LDLLKSHKNRKSLRTQLRNNAIKRQKKYNNLVKEKDIFNRMSTSEIEYYNKLKNDKAS
                     KEKELDEQVSKEALGYERKKLRLLNPKKTEAIPNTESPLTKRQNNFGNLGIVKKKKKI
                     NVRINIAKNSSLTDIKKDG"
     gene            complement(<307592..>309832)
                     /gene="TPHA0I01370"
                     /locus_tag="TPHA_0I01370"
                     /db_xref="GeneID:11534621"
     mRNA            complement(<307592..>309832)
                     /gene="TPHA0I01370"
                     /locus_tag="TPHA_0I01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687029.1"
                     /db_xref="GeneID:11534621"
     CDS             complement(307592..309832)
                     /gene="TPHA0I01370"
                     /locus_tag="TPHA_0I01370"
                     /inference="similar to DNA sequence:INSDC:YHR124W"
                     /note="similar to Saccharomyces cerevisiae NDT80
                     (YHR124W); ancestral locus Anc_2.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687077.1"
                     /db_xref="GeneID:11534621"
                     /db_xref="GOA:G8BXL5"
                     /db_xref="InterPro:IPR006141"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:G8BXL5"
                     /translation="MSAATMNDSHQIVDPEIVNETTEDDGNELKPKYEELDDEMKENF
                     KIMENYLRVNKCYQKKGLKNNIYNDNNNNENNHEVENVCDNDGEDNDDDVDYISDEKA
                     GMGNMQLKTLTHADGTTSTYFDKRKLKIAPRSTLQFKVGPSFELIGNYNEVFDLKNSS
                     KKINFQLIPRIDRGFDYIEEEWVGYKRNYFTLVSSFDMDGKDFNQVLKSSYLLKLYQD
                     GTNNNIFRKIKYFAIKIKAMSDEDFSEINLIQHTAKRDKGPQSSPQLCPVIPSPLPKH
                     QIIREASNVRNIAKKKKYDSTFYFHREQNLDGFDIESLVNSYPNDCIQKVARFERIQF
                     ASSINVKNPPQKNKYFRLHVILGAVIDGCEFPSDSQYYSNYENIGMNNGSIECFVPLQ
                     EMRTPQLIIRGRSPSNYTSYNKTNTVKEKLQSQNLSQLIIQKKVLNKISKSTIENNEN
                     IQKNNLHFKPLIDNEVDNKENIAPYFETKINCQEFKPRSNKRVITLGQIEEIILQENA
                     ATMKNSTENTLNYLNKKLQQPELDLPRPVYSRHYSIDPRDIDLKFEDMNVQEDNYIVG
                     SLIMHNVQLPNTIRDGTEITDANTIRTILTTPCTTATIAATRSVPMRIGTSLSTNVKK
                     TAYHLSNNFDTLNSSFDFESSSNDNYGDKSTLSYSEHINNINAGNLSNLRSLENIPRL
                     FNKGKTEKSFTSLQNDKILKYAENSASSTTHNLKLNNSVTLKSKLPSQLNDTRELYSE
                     PSFYNH"
     gene            <311109..>314285
                     /gene="TPHA0I01380"
                     /locus_tag="TPHA_0I01380"
                     /db_xref="GeneID:11534622"
     mRNA            <311109..>314285
                     /gene="TPHA0I01380"
                     /locus_tag="TPHA_0I01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687030.1"
                     /db_xref="GeneID:11534622"
     CDS             311109..314285
                     /gene="TPHA0I01380"
                     /locus_tag="TPHA_0I01380"
                     /inference="similar to DNA sequence:INSDC:YNL132W"
                     /note="similar to Saccharomyces cerevisiae KRE33
                     (YNL132W); ancestral locus Anc_2.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687078.1"
                     /db_xref="GeneID:11534622"
                     /db_xref="GOA:G8BXL6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:G8BXL6"
                     /translation="MAKKAIDSRIPSIIRNGVQTKQRSFFVIVGDNARNQLPNLHYLM
                     MSADLKMNKSVLWAYKNKLSGFTSHRKKREQKIKKEIKRGTRDVNEQDPFETFISNQS
                     IRYVYYKETEKILGNTYGMCILQDFEGLTPNLLARTIETVEGGGMIIILLKSMTSLKQ
                     LYTMTMDIHSRYRTEAHNDVIARFNERFILSLGSNPNCLVVDDELNVLPISGGKNVER
                     LPPPDTDELTPKQLELKDLKESLEDVQPAGSLVALSKTVNQAHAILTFIDAISEKTLN
                     STVTLTAGRGRGKSAALGISIAASVAHGYSNIFVTSPSPENLKTLFEFVFKGFDALGY
                     QEHIDYDIIQSTNPDFNKAIVRVDIKRDHRQTIQYIMPNDNHLLGQAELVVIDEAAAI
                     PLPVVKKLLGPYLIFMASTINGYEGTGRSLSLKLIQQLRTQSATSGRENSQTELSSRD
                     NKKSDGMYATSRQLREISLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPKFAARGTPH
                     PSQCNLFIVNRDTLFSYHPVSENFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVL
                     LPPVDPKDSGRIPDPLCVIQIALEGQISKDSVRNSLSRGKRAGGDLIPWLVSQQFQDE
                     EFAGLSGARIVRIATNPEYSSMGYGSRAIQLLRDYFEGKFADMSENTKPKDYSLKRVN
                     DHELAKTNLLKDNITLRDAKTLPPLLLQLSEQPPSFLHYLGVSYGLTQELHKFWRNNK
                     FVPVYLRQTANDLTGEHTCVMLSVLEGRESNWLTQFAKDFHKRFLYLLSYDFSKFTSV
                     QALSVIESSKKASSLFDSENSTLDTQLTKKQLDEIFSPFDLKRLDSYANNLLDYHVIV
                     DMLPMLSMLYFGGKFGTEVKLSSVQSAILLAIGLQHKRIDDISKELNLPANQSIAMFA
                     KVMRKVSIYFRQVLSDSIEEELPALKDDNLDEMNGEEIKTYDAAGTMDQLEEDLEEAG
                     SEAVKAMKERQHELINSLNLDKYAINDDSTDWNESKKSLEKAVKTKGVVSVKTGKKRS
                     TEKSDDIYKSEMNSLRKAKKSKKSSKKN"
     gene            <315009..>315572
                     /gene="TPHA0I01390"
                     /locus_tag="TPHA_0I01390"
                     /db_xref="GeneID:11534514"
     mRNA            <315009..>315572
                     /gene="TPHA0I01390"
                     /locus_tag="TPHA_0I01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687031.1"
                     /db_xref="GeneID:11534514"
     CDS             315009..315572
                     /gene="TPHA0I01390"
                     /locus_tag="TPHA_0I01390"
                     /inference="similar to DNA sequence:INSDC:YNL131W"
                     /note="similar to Saccharomyces cerevisiae TOM22
                     (YNL131W); ancestral locus Anc_2.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687079.1"
                     /db_xref="GeneID:11534514"
                     /db_xref="GOA:G8BXL7"
                     /db_xref="InterPro:IPR005683"
                     /db_xref="UniProtKB/TrEMBL:G8BXL7"
                     /translation="MLLSNNVNSLTYENLMSKVVLSEQKDIIDYIEDIEYESELDYLS
                     YEKELFYDDIGDEYYDYLGNQEIYDLFDVEHELVEGSHCLNRKRKSSCAFQHIVSDNE
                     SQSISSYKFLNIFPLKYRETVEILLNNLSTSTRCFFNMSKRIVWNISMSSLLLGMPLY
                     LTIMLERQTLENERYFELLPYTNLSGI"
     gene            complement(<315926..>317098)
                     /gene="TPHA0I01400"
                     /locus_tag="TPHA_0I01400"
                     /db_xref="GeneID:11534515"
     mRNA            complement(<315926..>317098)
                     /gene="TPHA0I01400"
                     /locus_tag="TPHA_0I01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687032.1"
                     /db_xref="GeneID:11534515"
     CDS             complement(315926..317098)
                     /gene="TPHA0I01400"
                     /locus_tag="TPHA_0I01400"
                     /inference="similar to DNA sequence:INSDC:YHR123W,YNL130C"
                     /note="similar to Saccharomyces cerevisiae EPT1 (YHR123W)
                     and CPT1 (YNL130C); ancestral locus Anc_2.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687080.1"
                     /db_xref="GeneID:11534515"
                     /db_xref="GOA:G8BXL8"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014472"
                     /db_xref="UniProtKB/TrEMBL:G8BXL8"
                     /translation="MGFFVPSKSIENLSQYKYQSEDRSLITKHILKPFWLKFSNVFPL
                     WMAPNVVTLLGFSFIAINVLTALYFDPTLTQGSPRWAYLTYAIGVFMYQTFDACDGIH
                     ARRTGQSGPLGELFDHCIDSLNTTLSLIPYASTTRMGFSYMFLLAQFSLLCNFYLSTW
                     EEYHTHKLFLSEFSGPVEGILSVVISFILCAIFGDEAIFQKVLFELKLSGSVFPITTL
                     YGAYVFSTIALMFNVYSARNNVVEYYKGNTENEKTIEKNIRTATIGLSPFFTYFGSIF
                     ALTVVEPRFISLPFILTIGLTVAFVVGRIIVNHLTKQKFPLVNVPMLIPSVQSVLYVI
                     FIHIFNYNDVDTIYNLVWLSFGVSLGIHGMFINEIIYEFTTYLDVYALSIKHPKQV"
     gene            <317814..>318563
                     /gene="TPHA0I01410"
                     /locus_tag="TPHA_0I01410"
                     /db_xref="GeneID:11534516"
     mRNA            <317814..>318563
                     /gene="TPHA0I01410"
                     /locus_tag="TPHA_0I01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687033.1"
                     /db_xref="GeneID:11534516"
     CDS             317814..318563
                     /gene="TPHA0I01410"
                     /locus_tag="TPHA_0I01410"
                     /inference="similar to DNA sequence:INSDC:YNL129W"
                     /note="similar to Saccharomyces cerevisiae NRK1 (YNL129W);
                     ancestral locus Anc_2.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687081.1"
                     /db_xref="GeneID:11534516"
                     /db_xref="GOA:G8BXL9"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR026681"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXL9"
                     /translation="MKASNQKVILIGLGGCSSSGKSTIAKIANSLITNSVLIHQDDFF
                     KHDNEIPINSKYNIQDWDTPDAIDFDLFKQELISIKKDGKIKTELIHNDNVEDPFKKF
                     SLPYGFINSISSKFNKIIEAQQTTSKCELKIVIVEGFMLYNDPNIAKLFDISLLVRSS
                     YNTLKERRAGRPGYQTLDSYWVDPPYYFDEFVYKSYADTHSYLFINSDVESGMLKPEF
                     KDTIFLFDNNNDTKIEDAVSWIFDAVAKSLN"
     gene            complement(<318817..>319443)
                     /gene="TPHA0I01420"
                     /locus_tag="TPHA_0I01420"
                     /db_xref="GeneID:11534330"
     mRNA            complement(<318817..>319443)
                     /gene="TPHA0I01420"
                     /locus_tag="TPHA_0I01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687034.1"
                     /db_xref="GeneID:11534330"
     CDS             complement(318817..319443)
                     /gene="TPHA0I01420"
                     /locus_tag="TPHA_0I01420"
                     /inference="similar to DNA sequence:INSDC:YHR121W"
                     /note="similar to Saccharomyces cerevisiae LSM12
                     (YHR121W); ancestral locus Anc_2.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687082.1"
                     /db_xref="GeneID:11534330"
                     /db_xref="InterPro:IPR016521"
                     /db_xref="InterPro:IPR019181"
                     /db_xref="UniProtKB/TrEMBL:G8BXM0"
                     /translation="MALNLENVVGFKVQITNVLDAVTEGFIYSFNSQNNTITLQVSRK
                     NQSRKSFKIINCQFIKTLKVIGEKPPNNLNTFKKTSIRPSQVNLNRVDQYLNEQLTKN
                     ALSYRLKGKNVSIEGQAIFDALYKTFSDTKWIGSKIIVLDNVEIVEPYKFDSVKALNE
                     NDHTSADSIDMVKRIVQRSWEDLNAAYMNNNVLENDDVYDDDDNRKGG"
     gene            <319975..>322929
                     /gene="TPHA0I01430"
                     /locus_tag="TPHA_0I01430"
                     /db_xref="GeneID:11534331"
     mRNA            <319975..>322929
                     /gene="TPHA0I01430"
                     /locus_tag="TPHA_0I01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687035.1"
                     /db_xref="GeneID:11534331"
     CDS             319975..322929
                     /gene="TPHA0I01430"
                     /locus_tag="TPHA_0I01430"
                     /inference="similar to DNA sequence:INSDC:YNL127W"
                     /note="similar to Saccharomyces cerevisiae FAR11
                     (YNL127W); ancestral locus Anc_2.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687083.1"
                     /db_xref="GeneID:11534331"
                     /db_xref="InterPro:IPR012486"
                     /db_xref="InterPro:IPR021819"
                     /db_xref="UniProtKB/TrEMBL:G8BXM1"
                     /translation="MNDDKRIVITSDNHNNNIGRSISFDNISSLNNNRSSNQIFLDDT
                     RADISRRLVNRQQIEARFTSQKLSYSNGNVQDIIDPPDKNHLLLGLDVKIRNKLNSMD
                     INKNNSTDKNERLISHKIESPTENPQFQSLLDNDMSQNNNEVKGFSESQLEDELFDEE
                     NFTNVDEIDGPIAGQILPPLQKSDKSKLKEPVGLTDATKDHDFNMPIDSGLQESLERR
                     ASEIGSSTIDSMAEPIPKIEVNYLGSYNLEEELPMWFSLSDYTYLPQTKSQFKQKNID
                     KTLFMRDVDYARLQIKVLVNGLSTNLQTCIMALLFICLGIDKSNSTTKEQVLSIKRNI
                     FLLLEDENNLITIVKRFYDISNNCRDKTSNLNLQTTLFFYTMTIIFLIATVCIEERFN
                     EARKPIIDNTINIFEDMKLLLYLVKYIEHWRWNSRLSMKIRNIINLLSKVIILQFGDD
                     AVFKKTKREIYKLHKVTFYEDEEENITESANCIKSKLGISPLSYEAFREDIISRYPDL
                     VIPNDKLPNSIDNSNSLSQFIEIPRSKIRNSMNQLLSMPNQHLATPAPSPPGSPTLSP
                     ISPLQKQRRSFQTNMSFPCLYPSDDESGTDDLTKRLSFMGDFNVNDNTSSDITIPYSI
                     SEATQILNESLRVGLCNKQLWYERDLFMMKERGWKSKIDDNPYDYITMKNSNNIEGVD
                     IMKRVENFYKDCFPSLNSLIFVLIQIMESNVNNLCYNEVDVRDKIPLDVLIPKLEVTR
                     AKEIALRSSTGIIYDLLKWFKLNHVLKYEHLCVLLYDSQYINTSTLVLNNYSEIYVDR
                     LFKKTASSNHSIWIELQALAGNLSTTTEKATYNFDPMILSSFTYMFNTLSHITRDKTQ
                     RLKDLPLSIGILFKRYYRVFNLPMYHAILKIVKELTPFKNKRWKAEHMDLISGVYLYE
                     RLELTENWVTGKDISNELSDACGQELALRALLQFYNFFHYKASMLDLGYTTRTNANQT
                     LLNNESENINSL"
     gene            <323368..>325875
                     /gene="TPHA0I01440"
                     /locus_tag="TPHA_0I01440"
                     /db_xref="GeneID:11532907"
     mRNA            <323368..>325875
                     /gene="TPHA0I01440"
                     /locus_tag="TPHA_0I01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687036.1"
                     /db_xref="GeneID:11532907"
     CDS             323368..325875
                     /gene="TPHA0I01440"
                     /locus_tag="TPHA_0I01440"
                     /inference="similar to DNA sequence:INSDC:YNL126W"
                     /note="similar to Saccharomyces cerevisiae SPC98
                     (YNL126W); ancestral locus Anc_2.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687084.1"
                     /db_xref="GeneID:11532907"
                     /db_xref="GOA:G8BXM2"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="InterPro:IPR015697"
                     /db_xref="UniProtKB/TrEMBL:G8BXM2"
                     /translation="MNFELNLQTLVEGTVPQDLTPSSIHSLTHDIAEFLLSSNKSISL
                     LNSLINIYRHEVPHTLENDKRWKIFTDSIEKLLPFNNQDDILKYISGIQQSPTRNMHS
                     TFNDEMLGNHANLSLLQSNADYAESFENMDMYSDRRSYISSHKNFLNSSNNVGTTLER
                     LTKPYYTKLIPQEDIIKFISYTLLATTSDMFPIRQNCISIPKNISNGDSGILHHIFEA
                     GLLYQKLNSIVEQNKKSNISPMKKALLIQISLYLRNYTGYINTLVFNKVENSESTTKQ
                     VYYKLFEKIIELRYLYVLLKDFDETDGYQYLKKLNELKNHGDLLVRETSLLLFNNLLS
                     FYSEYLIDWLTLGKVNLNLNEFFIKINKDVEFSIYVDEDKLPTFIPKHVSIEIYIIGK
                     TYLYLQHYFKDIQWTNTFSKRYNLKYTKYSHNIDRLFFDTIHDQYTEIVNHTNELLLH
                     KFYFRETIYLVRDILLMGKADFIDVLIMNSNDILLSPSDSLSSYELTRYLQDSVHHSS
                     MNNLLNRCDNNTLINKLDARVLDLGHGSIGWDVFTLDYLLDEPLLKILNVNREGGRKE
                     YLRIFNFLWRFKKNTFFHNTETSRSTMLIRELRKISNKDPLIRDIVSKFSKCNVLKSQ
                     VYQFNISLETHTFQNIIENNFKELSAVLGINDESMEDNVMDQNNTQSLSITKLSSGLV
                     APDGLLKPKGAAFKTDINPKINVLKNYNIDEIEKLHNEFLSNILNNKLLSSSSNDNGT
                     YSGNAYSTSIILLLNTIFEFLTYYNALNDITYEVLIQLNLQNSPNEINLLLGRFNTVL
                     RNIVRQYKNFREQKNLFLRDLKSDGDDELFRLQKILK"
     gene            complement(<326094..>327992)
                     /gene="TPHA0I01450"
                     /locus_tag="TPHA_0I01450"
                     /db_xref="GeneID:11532908"
     mRNA            complement(<326094..>327992)
                     /gene="TPHA0I01450"
                     /locus_tag="TPHA_0I01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687037.1"
                     /db_xref="GeneID:11532908"
     CDS             complement(326094..327992)
                     /gene="TPHA0I01450"
                     /locus_tag="TPHA_0I01450"
                     /inference="similar to DNA sequence:INSDC:YNL125C"
                     /note="similar to Saccharomyces cerevisiae ESBP6
                     (YNL125C); ancestral locus Anc_2.145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687085.1"
                     /db_xref="GeneID:11532908"
                     /db_xref="GOA:G8BXM3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BXM3"
                     /translation="MVDNESSPTDQESMVSSLASESEIDGQDPDHEMNKILTSHFDVG
                     DALQMDGNASRMNPEQSTDLEASPVVDNIESHDGAQRQDIETSSEAHSVKSIDSKAHL
                     YEGQIGQHRIQEIKSSNNCTESLSRNSTRRSKSQHNEDNQSIVQRVYTNQTTGKLDLP
                     PDGGYGWVSLVCVFLTMFSSWGCNSSFGVFLAFYLNNDTFPGASKYDYALIAGLPVFI
                     GQVLCPIVTVIMKVIGIKPTMLIGVTISFAGFLLASFATKLWHLYVTQGMMIGISIAF
                     VFIPATTIIPGWFLKKRAVAMGLSLSATGVGGVVYGLSVNKLIQDDHETKWALRMLCI
                     VTTITLLLAITFIKQAFPTKPLGIRSFTVIRNEFVKMFKVNLLEKPFIALIAFWFTFA
                     LFGYNLMIFTLSSYAVARGLSSHDGSTLTAVLNACQAIGRPMLGLLGDRYGRTNITTL
                     FTVIILILLFAFWITAHTFLQLLFFVIMLGSCVGVANVMSTVLIADMVGPTDFLPAWS
                     FVNYAGSGMFLVCEVIAQALVDEQNVSNPYIHTQIFAGLCFVVALILVLLLRQINVTQ
                     KMEQIRKNIVIKLNEYESEVSDDDYEEQKLMVAEKQKLLEDKAHYDQHLESGIKAFFV
                     RMTYPMKV"
     gene            <329216..>330655
                     /gene="TPHA0I01460"
                     /locus_tag="TPHA_0I01460"
                     /db_xref="GeneID:11534511"
     mRNA            <329216..>330655
                     /gene="TPHA0I01460"
                     /locus_tag="TPHA_0I01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687038.1"
                     /db_xref="GeneID:11534511"
     CDS             329216..330655
                     /gene="TPHA0I01460"
                     /locus_tag="TPHA_0I01460"
                     /inference="similar to DNA sequence:INSDC:YNL124W"
                     /note="similar to Saccharomyces cerevisiae NAF1 (YNL124W);
                     ancestral locus Anc_2.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687086.1"
                     /db_xref="GeneID:11534511"
                     /db_xref="GOA:G8BXM4"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:G8BXM4"
                     /translation="MSEDLFSKALQDDGLEVELPKLDQNDMDNITVDEAELEEDRKEI
                     DTGSKSHWESESDSDSDSESEESSASSDASSDNESNDEIEDDIEEENMEGPIKSKHET
                     LEEESAEIPADYQISETTVLKSIGTIKSLYNNNVIVETSTSGENRVLKDGSIFCLSKE
                     KKLLGRLVEVFGKLTSPLYRVLLPKDADMSEWKEKVGEDVSIIVSDSAWVDTFMIRKF
                     KGTDASNAFDEELPESEQEFSDDEKEMNYKKMKKQQRKSNKNENNATKKVQKPNANNN
                     SNRRNIPKSQHPATRFPSYQAQPSNENTRVSSYKPRNSRNQNVDSSQTNYDAIQQNTT
                     PVYPPVSQFNPQNNFNNFNPNMNMNMNLMNTNMYLNAGQSISANFNTQQPQMYPLLGN
                     QFSTPAMPPIQPLIYQNQPSFNNNNNNINNQNSSQSHMNQVLQLHSLLLQQQQQQQQQ
                     QQTYTMNGDKHKDNGNSYKNNNEKSNFYQ"
     gene            complement(<330761..>333625)
                     /gene="TPHA0I01470"
                     /locus_tag="TPHA_0I01470"
                     /db_xref="GeneID:11534512"
     mRNA            complement(<330761..>333625)
                     /gene="TPHA0I01470"
                     /locus_tag="TPHA_0I01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687039.1"
                     /db_xref="GeneID:11534512"
     CDS             complement(330761..333625)
                     /gene="TPHA0I01470"
                     /locus_tag="TPHA_0I01470"
                     /inference="similar to DNA sequence:INSDC:YHR120W"
                     /note="similar to Saccharomyces cerevisiae MSH1 (YHR120W);
                     ancestral locus Anc_2.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687087.1"
                     /db_xref="GeneID:11534512"
                     /db_xref="GOA:G8BXM5"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXM5"
                     /translation="MYRCITARLCPYRSIIHYRNFAKVNTKPSVSKIKIQTTSPKLNA
                     QNKLDSYINTTNTLPDLNKDIATATPDVDEKLSDIPPSLKYVRELIDHHKGSVVLTQM
                     GSFYELYFEQAEKYAPELNIQLTSKQFSHGKVPFAGFPVGQLSRHLKVLVNDHEYSVA
                     IAQQFKKDGVADNEVSKFYRRVTRIVTPGTFIDEAFENFEENNYLLSINFPENCFNKL
                     ADSDSKLGLSWCDVSTGEIFVQQVRLKDAVSAITRIQPKEILLEESIADFTIESGSWY
                     PEFVELKKYFLKYHKLPAAHITLDSLYSLFANGTEESTSRLFKIQFQTFTQKELAALR
                     DLLIYIKEHLPDFRMNLQFPQKQSVTSIMQIDSRTSSALELHATVRDRSKKGSLLSCI
                     RRTVTSPGTRLLSQWLSGPSLDLAEINSRQDIVAFFLEDLDSTKDMISNLKTVSDLTR
                     IIQRFSFNQGDASELLQLVESLKTAKAVKKNIETINSELEDNKLPDELYNRLISDLEF
                     DGSLISEVESCINEVALRKINSATSEGIEKDESMNSSGIHDTNNEIWIIDPNYNNSLK
                     KYHEEYQNCKREKEKLQEIYNNKLVNDIGCRRVAMKQKPNGDYTLHIHASTNNMKKVL
                     DFINTKELINGHPLVITQKSVQTCWVSHKSWNDLAHLSELAKFRIKQEEDFILNNLKT
                     KFVNKSESIRLITHKLAYIDVLSSFAILATDNRLKRPKLNNTTSFNIKGGRHLMVEEG
                     LKISSLSTFVKNDCKLAKGDLWVITGPNMGGKSTFLRQNATIIILAQIGSYCPCDKAT
                     IGLVDKIFSRVGSADDLYNEMSTFMVEMIETSYILHGATNRSLAILDEIGRGTSSKEG
                     TSIAFATLKYLIEKNSCRTLFATHFGSELKEIIDKNYYDSLKNNLKFYETSVVEISED
                     NYYYDHKLKEGVCTKSDAIKVAKRAGFPETALNDAKRFLN"
     gene            complement(<333960..>337052)
                     /gene="TPHA0I01480"
                     /locus_tag="TPHA_0I01480"
                     /db_xref="GeneID:11534513"
     mRNA            complement(<333960..>337052)
                     /gene="TPHA0I01480"
                     /locus_tag="TPHA_0I01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687040.1"
                     /db_xref="GeneID:11534513"
     CDS             complement(333960..337052)
                     /gene="TPHA0I01480"
                     /locus_tag="TPHA_0I01480"
                     /inference="similar to DNA sequence:INSDC:YHR119W"
                     /note="similar to Saccharomyces cerevisiae SET1 (YHR119W);
                     ancestral locus Anc_2.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687088.1"
                     /db_xref="GeneID:11534513"
                     /db_xref="GOA:G8BXM6"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR017111"
                     /db_xref="InterPro:IPR024636"
                     /db_xref="InterPro:IPR024657"
                     /db_xref="UniProtKB/TrEMBL:G8BXM6"
                     /translation="MSGYYNRRPTNGSSRPPKRSYNHYSQYNHSYDSTGGKRYYQNNG
                     YSDEHYQDNSYSSRDNFHQSRDYNKYSSNNQTYTSKQNGNSSNVSIKSALRRPSPKLK
                     YNTKFFMDKLHYFDPFKKALIHQNKMKPWKDMDSKNEYPKNGFVIAQEKIENKLRTVM
                     KEITVNKGIKHSLDPRKNISKKAQSTSRTKCKSTLKDIPKILYDKYSIGPPPPSEIVV
                     YPKGAVNSISEASVKNYFKSFGGISNFESFNDPNSAISLNIYLIKFDSPNGKIQDAIK
                     SANNAVDKHTKNDCIIMGSGFNVTLNKNDFLKTIISKTIAKNELKAKELKIEMLTNER
                     TAKLNGSNSNNTTVEQADRKHIFNDRKIPVDIVETVNNRPTLFVPKTFTINHNFSVED
                     FKIKLRRYRWARILDHKYGFYIVFNDMKHARECLTNESGSLKIVSRTRNYPVPIRFKL
                     ISSELTPAPAISRKHDLVFPTKPAMKVYGNKKELFEATTNILLRDLHNALDVDLRRKI
                     IGPIIFDELNPSNYPDLLVKKKEKEAQLKNEKLKSTVTPDVKKSTDELGLFELYGGYV
                     KSKANRRRLSYKSNHPSKRQRRDNTEEKPSAHILNEDETREDSQSIDSIRNIIKESDE
                     EVSSEEISSAEENEYENIYDTSDMEMKDIADEEASELLTLVKEETSAKGSIIPPISSK
                     SIFAPSISEIPLPVYEYEDFEKDPSKVLSISQFQDLIKDTEDIKILKSILDTYETKNN
                     FSPYLLEYLLWKSNENRQNFDQATAWQTQLNGAPFDYSLLPKDTAFKANGFFTVSDKH
                     KNSYLPHRRSLHTPLNTVNHHNESLVKQDHITKESSVEPDFMDNNNTDVSSSRVNRAM
                     NRRFQQDIEAQKAVIGSESELLTLNQLNKRKKPVTFARSAIHNWGLYALQPIAAKEMI
                     IEYVGERIRQPVSEMREIRYIKNGIGSSYLFRIDENTVIDATKKGGIARFINHCCDPS
                     CTAKIIKVGGKKRIVIYALRDIDVNEELTYDYKFEREEDDQERLPCLCGAPNCKGFLN
                     "
     gene            <337635..>339029
                     /gene="TPHA0I01490"
                     /locus_tag="TPHA_0I01490"
                     /db_xref="GeneID:11534344"
     mRNA            <337635..>339029
                     /gene="TPHA0I01490"
                     /locus_tag="TPHA_0I01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687041.1"
                     /db_xref="GeneID:11534344"
     CDS             337635..339029
                     /gene="TPHA0I01490"
                     /locus_tag="TPHA_0I01490"
                     /inference="similar to DNA sequence:INSDC:YHR118C"
                     /note="similar to Saccharomyces cerevisiae ORC6 (YHR118C);
                     ancestral locus Anc_2.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687089.1"
                     /db_xref="GeneID:11534344"
                     /db_xref="GOA:G8BXM7"
                     /db_xref="InterPro:IPR008721"
                     /db_xref="InterPro:IPR016811"
                     /db_xref="UniProtKB/TrEMBL:G8BXM7"
                     /translation="MSSRQIQSCIKDILNVNGDASQKLDWNSGRLKKIQAATSTLYNA
                     SLGKVMLKQDEELARCHISAYIAVERLVEKYGTTDENGDDMMYYLDMIPMEPKKARGM
                     VELFKQNIFQTSPVKKFSWTPSPKKRSRISPIKNDTFTSQNPSDLRKKLFSSPTMSLG
                     ETGETQQHVTPTKQVLDKTDDEEDSEADRTPRRKLIFEEDIENDEAELSPIKKPKLDG
                     VNVQKSNFKHGEAADHISHSEMITRNENEDSTKEDRNDSTDSNNQSLVRNVKKTKEKN
                     VNPSKRKTVNTQKFSYNLLKLGTSNMLTRKYSKIAPASVILLCNMFELPKTVAYNLLD
                     QFMMLSSYLVCPWQLVCGLVISCAKIVHSEKRKNDPRIDYRILERMCLAMNTVEVEEI
                     LECIGIVEELISGEEWYRKLKVEYNDFDGNKYEESLSKEIGSMLQSKSTLVSDEQYSN
                     WESKIKQDLSLKHD"
     gene            <339471..>342422
                     /gene="TPHA0I01500"
                     /locus_tag="TPHA_0I01500"
                     /db_xref="GeneID:11534345"
     mRNA            <339471..>342422
                     /gene="TPHA0I01500"
                     /locus_tag="TPHA_0I01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687042.1"
                     /db_xref="GeneID:11534345"
     CDS             339471..342422
                     /gene="TPHA0I01500"
                     /locus_tag="TPHA_0I01500"
                     /inference="similar to DNA sequence:INSDC:YNL123W"
                     /note="similar to Saccharomyces cerevisiae NMA111
                     (YNL123W); ancestral locus Anc_2.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687090.1"
                     /db_xref="GeneID:11534345"
                     /db_xref="GOA:G8BXM8"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR025926"
                     /db_xref="UniProtKB/TrEMBL:G8BXM8"
                     /translation="MKRRSSNLEDVDDIEHNNKSHHNHNFSDKEIDNSELSIEDIEVI
                     GPVPTVSDAQNYIKWQNTISSVVQSVVSIHFSQVAPFDGESALVSEATGFVVDSKLGI
                     ILTNRHVVGAGPFVGYAVFDNHEECDVTPIYRDPVHDFGFLKFNPKDIKYMEVKSLQL
                     KPNLAKVGLEIRVVGNDAGEKLSILSGFISRLDRNAPDYGELTYNDFNTEYIQAAASA
                     SGGSSGSPVVNSDGHVVALQAGGSTEASTDFFLPLDRILRALICVQNDKPITRGTIQV
                     QWLLKPYDECKRLGLTPEAESNARKMFPDKIGMLMAETILKEGPGDVKIAEGDVLISI
                     NNELISSFITVDDILDRNVGNTITLVIQRSGVDKTIQCVVDNLHRITPDRYVEVCGAT
                     FHELSYQMARFYGIAVRGVFISSASGSFNIDLSERVGWVVDSVDNKETPNLNTFIEVM
                     KDIPDRKRVTLRYHHLSDQHTIHVTSIYIDRHWCNEFRMYIRNDVTGIWDYQNIKEPI
                     PAEEIKPHSAKFIEIPVENKNIAKLSYSLCHVTTIAVIPLDSQSVETVKISGLVVDAE
                     EGYVLTSRRAVPHDCCDVFVTFADSVMVPASLKFIHPTQNYAILKYDVKLVNAPIVTP
                     RFSTSYLKRGDKANFVGYTHNHRLVTADTTITDISSVSIPSNIIPRYRATNIEAISID
                     CNISTKCNSGIIADQEGVIKALWLSFVGERSDNKDKIYLMGLDIMDCLEVIKYFKEGK
                     RPIVSIVDAGFGSISILTSRVRGVPEEWIERMERESSNRLQFITVTRVSCTNDDVKLE
                     TGDVILSVNDQLVTKMNQLNGIVSEYGSERSQTLTFKVVREGKIIDLPIKTVYVKETD
                     QFVVFAGCIVQAPHHAVKQAMLNLPSEVYVTFRGESSPALQYGISGTNFITHVNEVET
                     KDLESFLTVIKQIPDNSYCKIRLMTFDNVPFAISLKTNYHYFPTTELKKNTLTGEWIE
                     NDIKKTEEIKQ"
     gene            complement(<342661..>344472)
                     /gene="TPHA0I01510"
                     /locus_tag="TPHA_0I01510"
                     /db_xref="GeneID:11534636"
     mRNA            complement(<342661..>344472)
                     /gene="TPHA0I01510"
                     /locus_tag="TPHA_0I01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687043.1"
                     /db_xref="GeneID:11534636"
     CDS             complement(342661..344472)
                     /gene="TPHA0I01510"
                     /locus_tag="TPHA_0I01510"
                     /inference="similar to DNA sequence:INSDC:YHR117W,YNL121C"
                     /note="similar to Saccharomyces cerevisiae TOM71 (YHR117W)
                     and TOM70 (YNL121C); ancestral locus Anc_2.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687091.1"
                     /db_xref="GeneID:11534636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8BXM9"
                     /translation="MSASDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQRQID
                     DSSSSKKKKKKHSKKKKSTSTDEKSNSKNETAKVIYPVASNGEPDLSGKDSFSDELKE
                     KYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVES
                     STEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLN
                     KQAMQVLKEKIAENKPQLLPSNTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNL
                     YSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYAIALEYNGILKFLKNDPLD
                     AHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAINLDATNAATYYHRGQL
                     YFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCETLFSEARRKFPTA
                     PEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIGKATLLARNPIVE
                     NLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEEAAFLARNMDEKLQ
                     ATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM"
     gene            <344952..>346370
                     /gene="TPHA0I01520"
                     /locus_tag="TPHA_0I01520"
                     /db_xref="GeneID:11534637"
     mRNA            <344952..>346370
                     /gene="TPHA0I01520"
                     /locus_tag="TPHA_0I01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687044.1"
                     /db_xref="GeneID:11534637"
     CDS             344952..346370
                     /gene="TPHA0I01520"
                     /locus_tag="TPHA_0I01520"
                     /inference="similar to DNA sequence:INSDC:YNL119W"
                     /note="similar to Saccharomyces cerevisiae NCS2 (YNL119W);
                     ancestral locus Anc_2.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687092.1"
                     /db_xref="GeneID:11534637"
                     /db_xref="GOA:G8BXN0"
                     /db_xref="InterPro:IPR019407"
                     /db_xref="UniProtKB/TrEMBL:G8BXN0"
                     /translation="MVQEQKCQRCKEHSAIIISRKELFCSGCFKKFLSLKQRKTMMLD
                     QYYQDIFKVLHKDKFRTEEEALLLNSNSKILVPLSFSSSSSLVMLDILVDTLNEQRLQ
                     HHNMVGFKIELLLLFNGKEEFDLVNKKLTDLIDNRYSANKDCIQPHFVEISKFYETST
                     VLKQLLLQHTDFKTFKDTIQHDDYTIKNLLKECPNRSVREDLLTFIKRHLIKKFTYQN
                     KFKAIVWPFSMTQLADEIISMIVKGRGSSIANFLDMESFDENYGTNVFKNLFPLRNAL
                     LSEIDAYCHSVNLEKYLIDYKVQDTLLLNKLYDANNKRSNESTLVKNMTMNELASKYF
                     DDIETDYSNVISTVLRTGEKLGTPTANGLKNKKCEVCLQIIHNDPSEWLNTITENVGH
                     CIENDEEQSYFNVWTENNEKKVATKNYNKLMELDKDENNNLDICYGCLILLNSMDNKS
                     INWPVNEKEEIDEILEEFIISD"
     gene            complement(<346533..>349286)
                     /gene="TPHA0I01530"
                     /locus_tag="TPHA_0I01530"
                     /db_xref="GeneID:11532824"
     mRNA            complement(<346533..>349286)
                     /gene="TPHA0I01530"
                     /locus_tag="TPHA_0I01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687045.1"
                     /db_xref="GeneID:11532824"
     CDS             complement(346533..349286)
                     /gene="TPHA0I01530"
                     /locus_tag="TPHA_0I01530"
                     /inference="similar to DNA sequence:INSDC:YNL118C"
                     /note="similar to Saccharomyces cerevisiae DCP2 (YNL118C);
                     ancestral locus Anc_2.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687093.1"
                     /db_xref="GeneID:11532824"
                     /db_xref="GOA:G8BXN1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:G8BXN1"
                     /translation="MSLPLRHSLDNLDSLDRILEDLLVRFIINVPPEDLSSVERELFH
                     FEEASWFYIDFIKLLNPSLPSLKIKSFATNIIRICPIVWRWDIKADEALQKFSLYKKS
                     IPVRGAAIFNEKLNKILLVQGTESDSWSFPRGKISKDEDDVQCCIREVKEEIGFDLTG
                     YIDENQFVERNISGKNYKIYLVSNVPEATQFKPQVRNEIDKIEWKDFKKIMRSIFKQS
                     GSTKYYLINAMIRPLSIWCKRQKEGKDNSELIRNAEKQLKELLGITSSTEITDKYAQI
                     SAKDFNAHNNSTSGSSISDSQNGQPIDIDPGRALLNSLQSAFNVNSNNINNTQQNTFM
                     PPPMPILVNGNGNANNMFPPMMNGGFQPFAPFPIVNNNHGVLPLMNNNFHPTSDSAQF
                     HIMNMNNINPRDIMDDATATPNTASLSKPSLVDGATHDNAKQLLTLLNDKKPEQFGTS
                     PQVANAALVSQVDSSNSKDLLHLLKHEPQSEMQSLGIKISSGVDIPDDNTYEEFESSS
                     EEGNDEDSYMNINHSDMGEYNRASVLRDNFNDKTDQQKLENLDGEEFSTTEMPNSAAL
                     VGNSFGSNGGDIPHVDEVNESTRGVASLSIAGKAKNVNNTPKIKLLKRGEQLSNNALS
                     PPKVSPESIPYQKNTNFEESSGSPNELLKILKAPLDDKKSYSTQSQQSTNPLLDMLKK
                     PSLSDSPTNRYDSNLIDNPNSSNSQIGTPVEFANQIPSMVPNNKSSSPLIQTNGSPQS
                     QSHANEFLNVLNDPNARNNSKFGPPSGQPFNEQGIPVDMPQQILTPNGSQPPGMSHNQ
                     HQFNNLQFNQFYPSPMEQPPHLVPNQYVPSQMHAPKYMDALNNHSPQSSAHMSLSQSQ
                     SPTHRGLAPAGNELLNMLKGPNVKMGLDQTMNGSPLNNNAQSVPQMGQTASNQLLNLL
                     HKK"
     gene            complement(<350121..>353315)
                     /gene="TPHA0I01540"
                     /locus_tag="TPHA_0I01540"
                     /db_xref="GeneID:11532825"
     mRNA            complement(<350121..>353315)
                     /gene="TPHA0I01540"
                     /locus_tag="TPHA_0I01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687046.1"
                     /db_xref="GeneID:11532825"
     CDS             complement(350121..353315)
                     /gene="TPHA0I01540"
                     /locus_tag="TPHA_0I01540"
                     /inference="similar to DNA sequence:INSDC:YPL115C"
                     /note="similar to Saccharomyces cerevisiae BEM3 (YPL115C);
                     ancestral locus Anc_8.605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687094.1"
                     /db_xref="GeneID:11532825"
                     /db_xref="GOA:G8BXN2"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8BXN2"
                     /translation="MSRRKIGGGSHAFDLLQAYDDHREIKDQLIKDIEQNTVPMEDER
                     HGVETKTGDSEQDTQTVKLLEEIKMLRNTIEKKDAEILKLNRVINEYEENKMLELLPP
                     RSLSRSKRGVDESKSVTDIEEGKPGLPSNDLDFHSPATSVAYTTSRITITSPTKIKSD
                     SKNTNALQSSSNNNNNNNSNNRSNNNQHQHQHQHHDGTIEFTPTSKQQLTSFNDLLVK
                     SFDGEVPAISKNVNDNNNDGMEIDEDISDAGTPDALPQPFFNRLQKTEQPPLPPQDEQ
                     MLLTPIRTSFKFDEPKYDGTNESVELSSPIVVGSDIKNELEDSIRSLEDSEGTTTINE
                     NYQIQINDSNNINGNSTREPSLTSVLSSSSNNIVTNGRINSVNSANKYRNPSNEATPN
                     RNISNSRINTALSNQINSPNSFVNTPISVIKSDIPLFIQPNDFHTIDPIVLTTLYFNE
                     TNENFCLVSVVDKSSRKEMFKFKKTIEQIYELDSYLKSTISVYSLQELPMLPEKHSFN
                     NYIPAKVNGRLDTLNDYFKTLFQTNNLPNNAIIKILQFISTDTFIPPLSVDDMNSSSL
                     MKDGVLIVRKSKTLGTGINWRLRHAQLLKDMLLLCNQRNSQVLESIKLKQATIELMPN
                     LPDDKFGTKNGFIITEQKKSTLSNPNKYYLCTEKPKERETWVQVINKLLMDVDSSGAS
                     YNGNTIDNNNDNNNYTNSTNISAKSSMQKVSNMRSITPVSRTSENSSEHIYVTDLTLD
                     NKTFNNKENDSNLVNTESSNGSPLENKKIVTELEICSHSKKTAPNGNDDENLNKPSTR
                     NYPSDVKFSDSSINNALEAMTLGSLEKSDSGSNFNSSFGTRNLVFGNSLDACIALSSN
                     TYQGQYVIPSVFFRCLEYLYKNRGLQEEGVFRLSGSSSLIKLLQEKFDKEYDVDLCNF
                     DPSTIGDGTIATRNIDVNTVTGILKLYLRSLPHLIFGDSNYQTFKNIVDENYNKPSII
                     AQEFRNVINSGSVPDTSIAMMYALFELLVRITQNNKINKMNLKNLCIVFSPTLNIPIN
                     ILQPFIVDFGCIFKNEEPVPDSERSEVDIHIPQL"
     gene            <354501..>355277
                     /gene="TPHA0I01550"
                     /locus_tag="TPHA_0I01550"
                     /db_xref="GeneID:11532826"
     mRNA            <354501..>355277
                     /gene="TPHA0I01550"
                     /locus_tag="TPHA_0I01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687047.1"
                     /db_xref="GeneID:11532826"
     CDS             354501..355277
                     /gene="TPHA0I01550"
                     /locus_tag="TPHA_0I01550"
                     /inference="similar to DNA sequence:INSDC:YOR194C"
                     /note="similar to Saccharomyces cerevisiae TOA1 (YOR194C);
                     ancestral locus Anc_8.603"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687095.1"
                     /db_xref="GeneID:11532826"
                     /db_xref="GOA:G8BXN3"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:G8BXN3"
                     /translation="MSNKEASKVYEIIVNNVISDVREEFENVGIDEQTLQDLRRVWRE
                     KLSEVKTTTLSWDNAPMDNIQQQIQDQAQLAKDGGEITVKSETQGLVLPGLDPSSTTT
                     TNGIQQNTNKSEVPSVVKTEEGHQEIKAEENIEDPNKLEKGQQFELEIETQLNPMSST
                     TSLDGDLKVSDEKEKAQKTKRSALLDTDEVGSELDDSDDDYLISEGEDEGPDENLLLC
                     LYEKVTRTKARWKCSLKDGIATINRRDYTFQKAHVEAEWV"
     gene            complement(<355378..>356364)
                     /gene="TPHA0I01560"
                     /locus_tag="TPHA_0I01560"
                     /db_xref="GeneID:11534505"
     mRNA            complement(<355378..>356364)
                     /gene="TPHA0I01560"
                     /locus_tag="TPHA_0I01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687048.1"
                     /db_xref="GeneID:11534505"
     CDS             complement(355378..356364)
                     /gene="TPHA0I01560"
                     /locus_tag="TPHA_0I01560"
                     /inference="similar to DNA sequence:INSDC:YPL112C,YOR193W"
                     /note="similar to Saccharomyces cerevisiae PEX25 (YPL112C)
                     and PEX27 (YOR193W); ancestral locus Anc_8.601"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687096.1"
                     /db_xref="GeneID:11534505"
                     /db_xref="GOA:G8BXN4"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:G8BXN4"
                     /translation="MFIERVVSMSGRYGLNNKDAVTIEKITVLKDIVNTISGKDKIIK
                     IIKNILDLIRVSLLTLTEKYRLSEALRDSILKRKLAYLIRNPILVLKYFILNLNLKNE
                     KRLAFISSNLSLFRYILRFGSLPFQVPYFITIFKSLVKDNSLGNVRKIVCNQHFLSKA
                     IEVYYTVCDELDLLYKLKFYSNATVYNKIVYHESLSWQLDIMLSLKNNFIQLKELKKQ
                     IVENEVELRIRTQAVELANGLPKRNHIKASGASNLIELENKVNGLCEQLKLTKLEMYK
                     LIFDCLANTTDLFGIKTPRGTYNTLSLISGVLGFIKIWKTTENKLRLMRKKD"
     gene            <357184..>358161
                     /gene="TPHA0I01570"
                     /locus_tag="TPHA_0I01570"
                     /db_xref="GeneID:11534506"
     mRNA            <357184..>358161
                     /gene="TPHA0I01570"
                     /locus_tag="TPHA_0I01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687049.1"
                     /db_xref="GeneID:11534506"
     CDS             357184..358161
                     /gene="TPHA0I01570"
                     /locus_tag="TPHA_0I01570"
                     /inference="similar to DNA sequence:INSDC:YPL111W"
                     /note="similar to Saccharomyces cerevisiae CAR1 (YPL111W);
                     ancestral locus Anc_8.600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687097.1"
                     /db_xref="GeneID:11534506"
                     /db_xref="GOA:G8BXN5"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:G8BXN5"
                     /translation="MTFDMLEKQETPHYNFIKGHALTVIKAPFSDGQSKKGVEKGPDY
                     LLKQGLVHDLENLGWTTEIVNPLAEVTGSVQNVTTYKNIHNIDSVACSTELIYKTVRD
                     TTKDGRFALTLGGDHSIAIGTILGALKTYPDLGLLWIDAHADINTLDTTESGNIHGCP
                     VAFAMGLNEVVPAPFSWLNSLRKLKKNRIAYIGLRDIDEGEKQVLKENNITSVFTMYH
                     IDRYGMNNVIEMALKALNKDGDSPILCSYDVDSVDPLYVPATGTPVRGGLTLREGLFL
                     AERLAETGNLVGLDIVECNPDLATNDIHVVDTISAGCAVARCALGETLF"
     gene            complement(<358279..>362019)
                     /gene="TPHA0I01580"
                     /locus_tag="TPHA_0I01580"
                     /db_xref="GeneID:11532901"
     mRNA            complement(<358279..>362019)
                     /gene="TPHA0I01580"
                     /locus_tag="TPHA_0I01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687050.1"
                     /db_xref="GeneID:11532901"
     CDS             complement(358279..362019)
                     /gene="TPHA0I01580"
                     /locus_tag="TPHA_0I01580"
                     /inference="similar to DNA sequence:INSDC:YPL110C"
                     /note="similar to Saccharomyces cerevisiae GDE1 (YPL110C);
                     ancestral locus Anc_8.599"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687098.1"
                     /db_xref="GeneID:11532901"
                     /db_xref="GOA:G8BXN6"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BXN6"
                     /translation="MKFGKSFPRYQVPSWSSKYINYKLLKRKIKKVEEEQDLLFAEEN
                     GLKRNNDGDSIGKSLPRINTRRNPTDVNHYYLNNKKVKQLISEFNESLNISIKKVEDF
                     YNVKTAEYEARLVKLLTSKQFRIIDTLFKEYNERGEELTIDKADLPQYLIDDLKEIKT
                     QLVRLIGHFQDLKSFCEMNKKACYKILKKADKKLRVLDRDKYYDEQIRSLNFESYVTI
                     RDGISKIERIMKSLVPLLLDLEKNSITEVSTIFNEGSETERNNTPKPIKLNSNVIGHG
                     DVLNAIKSDDQEELLILLNAEYGTIENIPIRYFLNLLNTSAIFLAFNCMKTILQNISS
                     LEDDSDINNRNFFHYHIISLGENSHLMNEFTQGMSLYRASSNEETKNYLLTKEVSRTF
                     DTESLQDSSSKISIALLYILDNLPEKFRSLLSNRDVYGKTPLHYSAEFGIAEFIDNII
                     LKLQKWSIWNESYSIDDSRYWSDVDNHTPMHLAVLGDHPLTVTKLLPYVLKDSCDDTI
                     IYLCIKANLLEVLRALFSMNCYNIDVTNDESGETALYLASKLNNFEIAKVLLQNGAST
                     EVPEKLFSWTPLFIAAVENNLEIAKLLIEYGAHVYVFDESGWTPLEQAVLHGNLELAD
                     YLKLDGYDNIMKPEFGANIRDKLNEGIYNTLQDNAILNNNTSLNEVDNSGLIITEEVE
                     ENKEIGHMYLHNDESVLLITLGSNDSRIDTPAVNLNQEAITKFVPEFLKNKFTLEIRC
                     NNAKGKKSEKIDLPIEFGSGAIKFNVPYSDDNSQSLYFDLLLNDVTSDEQQIQDDKSV
                     TQGKRDFNPDSISNDCIVGRGISFLKRNATFVGVNKCSLYEKETIPILAKNSLELLGH
                     IIFEYMTVNPFHHPNMLFRKTERYWKSLISTRVIGHRGLGKNVNTNKTLQLGENTVES
                     FIAASSLGASYVEFDVQLTKDNIPVIYHDFLVSETGVDIPMHELTLEQFMDLNNVQKH
                     ISDNSKAGRRNSVGPTNFDVSKPWDIELDSNGEKPNDTMKNSNVYRSFSHNHDFVDSE
                     KYTDRMKLTKTFKKINFKGNTRGSSIASSFVTLEELFQKLHKKVGFNIECKYPMVDEA
                     EEEDTGSIMIEMNHWVDTVLKVVFENNKHGRDIIFSSFHPDICIMLSLKQPSIPILFL
                     TESGVMKMADARASSLQGAIKFAREWDLLGLVSNVIPILKAPRLAKIVKNNGLVFVTY
                     GVENNGPENVVLELNAGVDAVIVDSVLAIRKGLTREYEKGNK"
     gene            complement(<362732..>364612)
                     /gene="TPHA0I01610"
                     /locus_tag="TPHA_0I01610"
                     /db_xref="GeneID:11532902"
     mRNA            complement(<362732..>364612)
                     /gene="TPHA0I01610"
                     /locus_tag="TPHA_0I01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687051.1"
                     /db_xref="GeneID:11532902"
     CDS             complement(362732..364612)
                     /gene="TPHA0I01610"
                     /locus_tag="TPHA_0I01610"
                     /inference="similar to DNA sequence:INSDC:YPL109C"
                     /note="similar to Saccharomyces cerevisiae YPL109C;
                     ancestral locus Anc_8.598"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687099.1"
                     /db_xref="GeneID:11532902"
                     /db_xref="GOA:G8BXN7"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BXN7"
                     /translation="MSSRAFGSRFWKYSGPFFKHSRAYRHKYNFSNKITLSTCRCILL
                     VGASNTDSFTGFSFKDLLSPIIHNETLSPDSKGDTLEMGLYIASQRELEESKARDAEL
                     AIMQSKNILTRQLRRLVYYVTDLLEPLFVTIRFLELSIIFVPILITYPISFFGKRIYY
                     GNDIVETQGSLVWYRLFRKALELAGPSFIKLGQWASSRTDIFPHGFCNEFSNLHSNSK
                     PHPTKYSISKICETLNIEEDEFNTVFEEFQSKPLGIGAIAQVHLGKLSQDYFLKEHDS
                     LGLDFYQLSSSWVAIKIIHPNARSKIRRDLKIMENFANAINALPTMEWLSLPDEVYNF
                     SILMNLQLDLRIESLNLDKFNQNFKNSIQVKFPKSIKELSNKDVLFEEYMDAMPMDTF
                     LKYKDLIKDIDLRKKVSDVFIDAFLQMLVLDNFVHADLHPGNVMIRFIKTNRYETKLE
                     STESEISDIMRNLKSSMKNDDTDIFVKNLSNALQSYAAQICLIDTGLVTELNSLNRVN
                     FIDLFNALARFNGYKAGELMIERSKSPETAINKEIFAFKVEKLVSKVKQRTFTLGTVS
                     IGDLLDQMLGMVRAHHVRLEGDFVSVIVAILLLEGIGRRLDPHLDLFERFVSYSLIEG
                     LI"
     gene            <365443..>366216
                     /gene="TPHA0I01620"
                     /locus_tag="TPHA_0I01620"
                     /db_xref="GeneID:11532813"
     mRNA            <365443..>366216
                     /gene="TPHA0I01620"
                     /locus_tag="TPHA_0I01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687052.1"
                     /db_xref="GeneID:11532813"
     CDS             365443..366216
                     /gene="TPHA0I01620"
                     /locus_tag="TPHA_0I01620"
                     /inference="similar to DNA sequence:INSDC:YBR165W"
                     /note="similar to Saccharomyces cerevisiae UBS1 (YBR165W);
                     ancestral locus Anc_8.596"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687100.1"
                     /db_xref="GeneID:11532813"
                     /db_xref="UniProtKB/TrEMBL:G8BXN8"
                     /translation="MVSVFQRKLLREWKYIQTQRLRNRYNCNASESSRYAFYIKPQDS
                     NLHMWHLVVYDSLHMQEIYIMIYIGKWKNRDESFGSTGIISDEMDFDIILNCLTPNSY
                     LPLNRNISFTHFNQILIRDGLHKFIETLLDMIFTADTQKIENIYSIMRCWNRVMIKSF
                     KQHFPELIGKLEYGDYKIFQEFMRKNNYKQDIVTKTTLMCSNGISNNTLACDDYSTSL
                     SSSGKRKFNSIDPTEQSKYDDHSGLNPNLILDRKRSRNK"
     gene            complement(<366502..>367848)
                     /gene="TPHA0I01630"
                     /locus_tag="TPHA_0I01630"
                     /db_xref="GeneID:11532814"
     mRNA            complement(<366502..>367848)
                     /gene="TPHA0I01630"
                     /locus_tag="TPHA_0I01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687053.1"
                     /db_xref="GeneID:11532814"
     CDS             complement(366502..367848)
                     /gene="TPHA0I01630"
                     /locus_tag="TPHA_0I01630"
                     /inference="similar to DNA sequence:INSDC:YBR166C"
                     /note="similar to Saccharomyces cerevisiae TYR1 (YBR166C);
                     ancestral locus Anc_8.595"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687101.1"
                     /db_xref="GeneID:11532814"
                     /db_xref="GOA:G8BXN9"
                     /db_xref="InterPro:IPR003099"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012385"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8BXN9"
                     /translation="MEVPTVSQTQIDDWKIDMKIGIIGLGDMGLLYARKFSEHGWKVI
                     CCDQEKFYTENKKLYIDEDFEVVLNGHHVSRQSDYIIYSVEAANVSKIVAEYGPSTKV
                     NAIVGGQTSCKDPEIKAFEKYLPKDVDIISVHSLHGPKINPEGQPLVIIDHRSSRPSS
                     FLFVNTLMSCLKSKIVYLSYEEHDKITADTQAVTHAAFLSMGTTWAKLKYYPWTLGLD
                     KWYGGLENVKVNISLRIYSNKWHVYAGLAITNPAAHKQILQYATSVTELFSLILGGHS
                     EEFRDRIMKAKEFVFGDHNGKLLLDSSLLDKYSLNKADHTSEENAGKKPLPNSHLSML
                     AIVDSWYQLKINPYDHMICSTPLFRIFLGISEYLFLTDGLLEETLDAALYDNSFRKDD
                     LEFVVSARSWSSIITSGNFELYQEKFEETQEFFRPMFPEATAIGNDMIKTILSHSK"
     gene            <368271..>368768
                     /gene="TPHA0I01640"
                     /locus_tag="TPHA_0I01640"
                     /db_xref="GeneID:11532815"
     mRNA            <368271..>368768
                     /gene="TPHA0I01640"
                     /locus_tag="TPHA_0I01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687054.1"
                     /db_xref="GeneID:11532815"
     CDS             368271..368768
                     /gene="TPHA0I01640"
                     /locus_tag="TPHA_0I01640"
                     /inference="similar to DNA sequence:INSDC:YPL108W"
                     /note="similar to Saccharomyces cerevisiae YPL108W;
                     ancestral locus Anc_8.594"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687102.1"
                     /db_xref="GeneID:11532815"
                     /db_xref="UniProtKB/TrEMBL:G8BXP0"
                     /translation="MESLKIDDSNTDNEVFTKQNGKKDQAVTKPIAIDSTTGEVVVRK
                     STGKAKIRKGQSEEEYQNQLDHYFNVEKGPTITEDNWMDSIDPLDMLNDNIENDLSIK
                     NVRHKLTSFCERYYYYKRYQECYNLAIKLREKYQAINKKNKMDREIEGLDYLIDKCIL
                     KGDIS"
     gene            <369266..>370486
                     /gene="TPHA0I01650"
                     /locus_tag="TPHA_0I01650"
                     /db_xref="GeneID:11534492"
     mRNA            <369266..>370486
                     /gene="TPHA0I01650"
                     /locus_tag="TPHA_0I01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687055.1"
                     /db_xref="GeneID:11534492"
     CDS             369266..370486
                     /gene="TPHA0I01650"
                     /locus_tag="TPHA_0I01650"
                     /inference="similar to DNA sequence:INSDC:YBR168W"
                     /note="similar to Saccharomyces cerevisiae PEX32
                     (YBR168W); ancestral locus Anc_8.592"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687103.1"
                     /db_xref="GeneID:11534492"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:G8BXP1"
                     /translation="MPDSSQRQNKNGIYRPRFVIPHTQKSSLTMITPNELTKTLFKFY
                     PILIMLECTLNYALWINDDLCLPFIHLILFCLISELFNKSNEEQTYLQYSILEVLSKN
                     IAFLFKRWIGLVSACILLCSSFYYISTVYEDINSYEKPTLDDIVIVLESVLNKLEIIK
                     NESLGKRIRVSNFKTFVKLLFILTPLQFTIFKYISTTTYVTCFIILSLIYYSIWFQAM
                     LKLFWRMIFVRRMYYFASSIFSNNNFPIGKTLCMEDVVKYEPLKFQVPFSKTINLMEK
                     SAAKEILLKLYPIASDLPKLKLDLSPSQSINIIELKIIEKQRRWGVDDWDNYMLPSDG
                     YTFSINVNDSPKKIENPIHLNILKTNDWEWLDDNWVISDWCYSDSNWNYIGNYESLET
                     YTRFRLWKKRLYQS"
     gene            complement(<370745..>372787)
                     /gene="TPHA0I01660"
                     /locus_tag="TPHA_0I01660"
                     /db_xref="GeneID:11534493"
     mRNA            complement(<370745..>372787)
                     /gene="TPHA0I01660"
                     /locus_tag="TPHA_0I01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687056.1"
                     /db_xref="GeneID:11534493"
     CDS             complement(370745..372787)
                     /gene="TPHA0I01660"
                     /locus_tag="TPHA_0I01660"
                     /inference="similar to DNA sequence:INSDC:YBR169C,YPL106C"
                     /note="similar to Saccharomyces cerevisiae SSE2 (YBR169C)
                     and SSE1 (YPL106C); ancestral locus Anc_8.590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687104.1"
                     /db_xref="GeneID:11534493"
                     /db_xref="GOA:G8BXP2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8BXP2"
                     /translation="MSTPFGLDFGNNNSVLAVAKNRGIDIVVNEVSNRATPSVVGFGP
                     KNRYLGETGRNKQTSNIKNTVENLKRIIGLNYKDTEFDQEAKHFSSKLVELEDGKIGS
                     EVRFAGKVETFSATQVAAMFIDKVKNTVIEDTKASIKDVVIAVPVWYTEEQRYHISDA
                     ARIAGLNPVRIINDVTAAAVSYGIFKTDLPEGEEKPRIVAFVDIGHSSYTCSVVSFKK
                     GSAKVIGTAYDKHFGGRDFDRAITEHFADEFKSKFKIDIRENPKAYNRVLTASEKLKK
                     VLSANTAAPFSLESVMNDVDVSSQMTREELEELVKPLLTRVTEPITKALAQAQLTAED
                     VDFVEIIGGCTRIPTLKNSISEAFGKELSTTLNQDEAIAKGAAFVCAIHSPTLRVRPF
                     KFEDIHPYSVSFSWDKQVEEEESMEVFPANSAYPSTKIITLNRTGDFEMKAFFTNPSD
                     APAGVSPQIASWKLSNVNVPEGEQSVPVKVVLRADPSGLHIIEEAYTTEDIIVQEQLP
                     LPEDAAEDAEPEFQDVTKTVKKDDLVITASTFALSADELAKLTEKEAELHAQDKLVAE
                     TEDRKNTLEEYIYNLRSKLEEEYKDFASDAEKSRLGDMLNKAEEWLYSDGEDSTKGKY
                     IAKYEELAMLGNMIRGRYLSKEEEKKQALRAKSESSKMAELAEKLAAQRKAEAEKK"
     gene            complement(<373263..>375977)
                     /gene="TPHA0I01670"
                     /locus_tag="TPHA_0I01670"
                     /db_xref="GeneID:11534522"
     mRNA            complement(<373263..>375977)
                     /gene="TPHA0I01670"
                     /locus_tag="TPHA_0I01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687057.1"
                     /db_xref="GeneID:11534522"
     CDS             complement(373263..375977)
                     /gene="TPHA0I01670"
                     /locus_tag="TPHA_0I01670"
                     /inference="similar to DNA sequence:INSDC:YBR172C,YPL105C"
                     /note="similar to Saccharomyces cerevisiae SMY2 (YBR172C)
                     and YPL105C; ancestral locus Anc_8.587"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687105.1"
                     /db_xref="GeneID:11534522"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:G8BXP3"
                     /translation="MNYQQYQFENNLETMNSDFANMGIARQSNTPLSNSHVDGPGQPM
                     LATRLPLSRESSLLDTIGIQTNSSHFANSPQIQQPQPQSNDGFRVNQEFYVRNGGNHP
                     AWLDTGAANAGQGSATKNIVGQLSMPARPQFGASMQQTTSNHSTIFNGSVSNAATPVQ
                     SHSSLNMFSQFGQQGINQPQPQQHQANAAQMAYAPGIPPGVTMPISVQESLWNYIDTM
                     GQIQGPFESRKMDYWLSGGYFPPTLQVTRVTNGVADPLNLNDKFITVGEILKMSGSYY
                     NPFSAIDNLIAASIGRSSMLNSGMSTPLSSQAPLSMLSDTLENNDAVKIGMSNVGAKK
                     NDAISKSKQRQEEPSQKLKNVKDISSAALLTDRTFTYDELLKWKGDDGSYFTETAVPI
                     PVGKTKKETVDPNFVIPEALPYKEETEELLAKLAQLPETSNSSQTSVDKNVEEKSSEA
                     NKSASKLIEEERFENLRKQEKEVKSQKRKQEGNQIEQQTSVISENIASGVSTPSQLKP
                     SVAPWAHVSSKIEFSSVISSSIADLKKNTPSKKQEEQARLNEMKIRQQQIIEEEKRNE
                     SSVLENKSFAAPTTPVSNLAPWANKVNKVEPVNIPSLEELKKNEKSKMKADKLDMATT
                     LKWSADLYSSDKKEQELKSMLTWAQKPQTKIPATKIEVPVSIKKKQNNVLISNKKTET
                     TPLYLQDFEDSDFVEEQKKMWAQAQTNKKSSASTPGSTGSDSWITVTSRTSKAAVAPK
                     VVNQPTSYISPDQLRNISTTPVGKGKQIGSSTTIPTMKSKTVMTPAAPQVTYAGNSSS
                     ALRQEFIRWCKSQMKLDSGIQANTVLEVLFSLPSSHDSVEIISDTIYSNTSNMDGKRF
                     AIEFIKRRIEVESKISDPLTWSEALNLPEGEADDWEFQVVKKKKGRKH"
     gene            complement(<376692..>377144)
                     /gene="TPHA0I01680"
                     /locus_tag="TPHA_0I01680"
                     /db_xref="GeneID:11534523"
     mRNA            complement(<376692..>377144)
                     /gene="TPHA0I01680"
                     /locus_tag="TPHA_0I01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687058.1"
                     /db_xref="GeneID:11534523"
     CDS             complement(376692..377144)
                     /gene="TPHA0I01680"
                     /locus_tag="TPHA_0I01680"
                     /inference="similar to DNA sequence:INSDC:YBR173C"
                     /note="similar to Saccharomyces cerevisiae UMP1 (YBR173C);
                     ancestral locus Anc_8.586"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687106.1"
                     /db_xref="GeneID:11534523"
                     /db_xref="InterPro:IPR008012"
                     /db_xref="UniProtKB/TrEMBL:G8BXP4"
                     /translation="MNLVPSKDFKSHISTADADTLASNALPSLPDTLRQQQGAVPIAT
                     QVNDRHPLESRIRNWDQTQQNRQLEQYREIFGIAEPLKRVMDLKLVEQADFNPLHAGK
                     NTTTTSLHRDVLLNKECNVDWEDVYQGGLQNNMIGNDVHTMIEKKLGI"
     gene            <377629..>378651
                     /gene="TPHA0I01690"
                     /locus_tag="TPHA_0I01690"
                     /db_xref="GeneID:11534524"
     mRNA            <377629..>378651
                     /gene="TPHA0I01690"
                     /locus_tag="TPHA_0I01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687059.1"
                     /db_xref="GeneID:11534524"
     CDS             377629..378651
                     /gene="TPHA0I01690"
                     /locus_tag="TPHA_0I01690"
                     /inference="similar to DNA sequence:INSDC:YBR175W"
                     /note="similar to Saccharomyces cerevisiae SWD3 (YBR175W);
                     ancestral locus Anc_8.585"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687107.1"
                     /db_xref="GeneID:11534524"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:G8BXP5"
                     /translation="MLRLLRNIALASPGSGGQVTSVKFSPNGELVAVCKSTVIELFEL
                     ASIEQHDEVVPVPFKTVLTSHIKPISEICWSPDGQCIASGSDDFTVEITHLQFGQIYR
                     LVSHTAPVVSLCFNVKGNLLCSSSMDESIKIWDTLNGVLLRTISAHSGAVVSIDMPQL
                     DSSIISSGSFDGLIRIFDTASGHCLKTLTYDKDWKIDTGVVAIANVRWSKNGKFLLVK
                     SLDGIVKIWDCIRGYVVRTFKIDQSDDQEANGASHSTDAYRMRYAFGMDFLYPENDHS
                     PIVISGYENGDIYLWDSSNKKLLQLIKANEFKYSSSPIIDINTHQNYVCTVTMDGECL
                     FWKWES"
     gene            <379013..>380998
                     /gene="TPHA0I01700"
                     /locus_tag="TPHA_0I01700"
                     /db_xref="GeneID:11534628"
     mRNA            <379013..>380998
                     /gene="TPHA0I01700"
                     /locus_tag="TPHA_0I01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687060.1"
                     /db_xref="GeneID:11534628"
     CDS             379013..380998
                     /gene="TPHA0I01700"
                     /locus_tag="TPHA_0I01700"
                     /inference="similar to DNA sequence:INSDC:YPL104W"
                     /note="similar to Saccharomyces cerevisiae MSD1 (YPL104W);
                     ancestral locus Anc_8.584"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687108.1"
                     /db_xref="GeneID:11534628"
                     /db_xref="GOA:G8BXP6"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004115"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004524"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G8BXP6"
                     /translation="MICGRRLFSSCAKLYAELPSFENIAHKFEFKKGSKTIKELSSVD
                     IDETVVINGWIDKKPKHMGKNLIFCSLRDINGDTIQLVDTKRILKNATVEDVVQAEGK
                     VKAKINKLGADGQGSVQGPKEISIDLIRTLNKSNEKPTQLLDLKSKEKYPPEYRYLQL
                     RLPKYHNILRKRYDILTNIRAILNEKNFMEVATPVLFKSTPEGAREFLVPTRKTSTDD
                     VSPLFYALPQSPQQYKQLLMSSGIQNYFQVAKCFRDEDLRADRQPEFTQIDMEMAFST
                     KTEVIETVNNLVTQSWHKFSSKQKLLTMSDSGKLVPVNQEQSINKITYQKAMELYGID
                     KPDLRFPELKITNLSDFNVHGIENSDFPVFEVIVIRGAFSTNEDLRRRWSFLGDKSNY
                     NYRTPIVVPLESDEAILNWHEKFLEIASFENPKIINKYLKLRKGDIICGSTREPNSSI
                     FENPTPLGRLRQLLLENKEITSFLNVESNDAAIWVVDFPLFSPVEVDSPSSEKPKYPI
                     YEKNKFTSTHHPFTMVNLEDYNKLSSKPLDCRGLHYDLVMNGVELGGGSTRVHDPVLQ
                     NYIFENILNIQNSKELFGHLLNAFEMGTPPHSGFAIGFDRMCAMLCDTTSIRDVIAFP
                     KSASGVDLVVDSPSKVSQTNLKEYNLSYSNHQQQTSK"
     gene            <381356..>382783
                     /gene="TPHA0I01710"
                     /locus_tag="TPHA_0I01710"
                     /db_xref="GeneID:11534629"
     mRNA            <381356..>382783
                     /gene="TPHA0I01710"
                     /locus_tag="TPHA_0I01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687061.1"
                     /db_xref="GeneID:11534629"
     CDS             381356..382783
                     /gene="TPHA0I01710"
                     /locus_tag="TPHA_0I01710"
                     /inference="similar to DNA sequence:INSDC:YPL101W"
                     /note="similar to Saccharomyces cerevisiae ELP4 (YPL101W);
                     ancestral locus Anc_8.581"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687109.1"
                     /db_xref="GeneID:11534629"
                     /db_xref="GOA:G8BXP7"
                     /db_xref="InterPro:IPR008728"
                     /db_xref="UniProtKB/TrEMBL:G8BXP7"
                     /translation="MSFRKRSEVLNRGVGQPSGVPGRTPTNSLRAPIGMQRSIDGAPR
                     GIGRAPVGRSVPDSTVPNLNNLSLRNNNPAGLQGSDISPESELIENHPGVRPSPATSH
                     PTTSTGCFDLDKLLLHSGLPLGNTLLLEEMGSTEFNSIISKLFIAQGVVYNRTEPTKN
                     NTHTILVSLNHGLAKDIPGIYKGSKRDIKKSKISEEESKVTVQNITGHSSAQRSRDLK
                     IAWRYGLNDKKDADAEESAPVGDYKNYNHQFDITTRLMPLPTSTDITFISPAQPIKTI
                     LSKLLETIEKHPKKLIRIVIPSLLHPAMYPPNMFKLQNIIPFLHGIRSTVKQYSQRSV
                     LLTTLSSDILDPIIISQMENLFDSVIVLEPFEQEMLQFLERAYKTQPNKVQHGLVHIK
                     KRAIFSDFGEMHVVKSEWAFKNGRKKFEIEEWGIPVEDEDAESAKKDKTDDVLNTVDL
                     NVPSSHGDHDHNHSSTSNTKIGIDF"
     gene            complement(<382954..>383511)
                     /gene="TPHA0I01720"
                     /locus_tag="TPHA_0I01720"
                     /db_xref="GeneID:11534478"
     mRNA            complement(<382954..>383511)
                     /gene="TPHA0I01720"
                     /locus_tag="TPHA_0I01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687062.1"
                     /db_xref="GeneID:11534478"
     CDS             complement(382954..383511)
                     /gene="TPHA0I01720"
                     /locus_tag="TPHA_0I01720"
                     /inference="similar to DNA sequence:INSDC:YPL099C"
                     /note="similar to Saccharomyces cerevisiae YPL099C;
                     ancestral locus Anc_8.579"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687110.1"
                     /db_xref="GeneID:11534478"
                     /db_xref="UniProtKB/TrEMBL:G8BXP8"
                     /translation="MTLYKIASNVPVLGLKITNKTTVKGGLLKIQHAKSLSTFRTLRL
                     PTKQKELRTLEDLAELKSLDDVDPQLIRKLINEKTSELNMKNEMNFLKQMQIEQDNNQ
                     SVPLKQYNRAIWVFLLMSSSFYLMFHLVWWKLEYNEKELKLKQESEELEHELQSILNE
                     KEEQKSNIIPNNKDVTKQKPWYKIW"
     gene            complement(<383865..>384218)
                     /gene="TPHA0I01730"
                     /locus_tag="TPHA_0I01730"
                     /db_xref="GeneID:11534479"
     mRNA            complement(<383865..>384218)
                     /gene="TPHA0I01730"
                     /locus_tag="TPHA_0I01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687063.1"
                     /db_xref="GeneID:11534479"
     CDS             complement(383865..384218)
                     /gene="TPHA0I01730"
                     /locus_tag="TPHA_0I01730"
                     /inference="similar to DNA sequence:INSDC:YPL098C"
                     /note="similar to Saccharomyces cerevisiae MGR2 (YPL098C);
                     ancestral locus Anc_8.578"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687111.1"
                     /db_xref="GeneID:11534479"
                     /db_xref="InterPro:IPR018450"
                     /db_xref="UniProtKB/TrEMBL:G8BXP9"
                     /translation="MPPPPQVYGQGMQQSNWDKFKMGLMMGTTVGVCTGILFGGFAVI
                     TQGPGPDGVVRTLGKYIAGSAGTFGLFMSIGSVIRSDDGYDERNLSVQKLSELQQRAR
                     FEVWRVRSQYGIHRD"
     gene            complement(<384649..>386019)
                     /gene="TPHA0I01740"
                     /locus_tag="TPHA_0I01740"
                     /db_xref="GeneID:11534502"
     mRNA            complement(<384649..>386019)
                     /gene="TPHA0I01740"
                     /locus_tag="TPHA_0I01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687064.1"
                     /db_xref="GeneID:11534502"
     CDS             complement(384649..386019)
                     /gene="TPHA0I01740"
                     /locus_tag="TPHA_0I01740"
                     /inference="similar to DNA sequence:INSDC:YBR177C,YPL095C"
                     /note="similar to Saccharomyces cerevisiae EHT1 (YBR177C)
                     and EEB1 (YPL095C); ancestral locus Anc_8.574"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687112.1"
                     /db_xref="GeneID:11534502"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ0"
                     /translation="MSAVYSSYPLLYPLRWGHNSTVRQITGSSSVSLVLKDSQTKTNF
                     QTFISQNIPSLADGSQFKLKSILFTGYLQTLYLAVADFSKAFPVFYGREIRTFSDDGI
                     ASIDWVMNSRWDGIYGMDVKTGNYNKNKFAEDEANTHAGNWPPLHPRTRFLTNSEFTE
                     IQKDERPLVLVLHGLAGGSHEPIIRSLTFDLSRVSDGKFNVAVLNCRGCSRSKISNRK
                     LFTGLFIDDIKEFIAVEKKKQPNRKIYAVGFSFGATQLANYVGGVDAENTGLESVVFL
                     SNPWDMVESAIKIRDDWWSHNLFSKNLGQFLFKLVKSNFKELEVPNGSKPEHEPSVEH
                     PDYYSFTPENLEKGSRIQSTIEFDNLFTAKSLGLDDAFSYYAIASSYQRVKNFEIPSL
                     VIGSHDDPVTGALSLLESVFTENPNVVVCETDLGGHLAYLDDNNNSWATRQIANYFDK
                     FEELVQ"
     gene            complement(<386542..>387384)
                     /gene="TPHA0I01750"
                     /locus_tag="TPHA_0I01750"
                     /db_xref="GeneID:11534503"
     mRNA            complement(<386542..>387384)
                     /gene="TPHA0I01750"
                     /locus_tag="TPHA_0I01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687065.1"
                     /db_xref="GeneID:11534503"
     CDS             complement(386542..387384)
                     /gene="TPHA0I01750"
                     /locus_tag="TPHA_0I01750"
                     /inference="similar to DNA sequence:INSDC:YPL094C"
                     /note="similar to Saccharomyces cerevisiae SEC62
                     (YPL094C); ancestral locus Anc_8.572"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687113.1"
                     /db_xref="GeneID:11534503"
                     /db_xref="GOA:G8BXQ1"
                     /db_xref="InterPro:IPR004728"
                     /db_xref="InterPro:IPR011553"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ1"
                     /translation="MSDISPDTPLAVAKLLRRNSALKQRVGLLQGKPVEFFRYKRFVR
                     AIKSNIYTKKSLNQPELYPIIVKNPDTEKAEDYIFDEDKIKGLFVTLIRTQLIVPIIK
                     LHSNEAKEHGLKPNKDHPNLIITQKAALNDDAYYSWNYNPKTWKDIASLLGIVAFILT
                     LVCFPLWPLSMRRGSYYLSLAALGLLGLFFIVAILRLVTYLVSLVFIKSKGGFWLFPN
                     LFEDCGVLESFKPLYGYGDEGNYTYIKKLKRKKKKQASKNASTTKKAIKSKTSKKLEE
                     IKDE"
     gene            <388160..>390121
                     /gene="TPHA0I01760"
                     /locus_tag="TPHA_0I01760"
                     /db_xref="GeneID:11534504"
     mRNA            <388160..>390121
                     /gene="TPHA0I01760"
                     /locus_tag="TPHA_0I01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687066.1"
                     /db_xref="GeneID:11534504"
     CDS             388160..390121
                     /gene="TPHA0I01760"
                     /locus_tag="TPHA_0I01760"
                     /inference="similar to DNA sequence:INSDC:YBR180W"
                     /note="similar to Saccharomyces cerevisiae DTR1 (YBR180W);
                     ancestral locus Anc_8.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687114.1"
                     /db_xref="GeneID:11534504"
                     /db_xref="GOA:G8BXQ2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ2"
                     /translation="MASNSGKETEGNAGCNRNNTIKSLKSYGTVDTTYNKNIETPLEL
                     LPTNNSLIDLSKDSELKDKNSDNNNDRNNVNEIDNDDTSDVDLEKCTKEAGDIDIEYS
                     FFTKTQRMVMFFIVIYVGFLGPMSGNIYIPALPTLQKAFHTNTTVINATVSAFMGVFA
                     VGPIFWGVYADVCGRKWLYLCSLILVTVINLLLAVLPANLASLFVLRVFQAFGSSSVI
                     TLGSGTVTDITPMKHRGKAIAYFMLGPNMGPILGPIIAGLILINGDYWRWLFGFTCIM
                     SAIGFLLVLIFLPETLRCIVGNGDPRWRNSKEISQQTKSGTRADSLVESEKQPETVVT
                     NSNVESKSTTLSSLNLNPKKMTNSSEQVFGTGDDKEDNNKPISEEMSACVAGEKDLEA
                     QGHAVKLGDNYHKWQLFANIGIQKPVCDDEIFKALYPRPTKPTLVAYYNIFKSPPVFI
                     SSIGTALLFANYYAFSVTFAKFLTDYYHFSRLGSGLAFICPGVAMIFGSQIGGHLSDY
                     LRNRWLLKNSTDCKYPIEKRLQLQIIAIVVNSLGIIGYGWSIEKRLDIVLVFFFAACI
                     SFSLTWCSNTTMTYLTELLARRTSAAISISSFFRNTAAAISSVIIVILCDKMGIGWCF
                     TGLGLLNIVPFLGVLYLLQYGYKFREIEV"
     gene            <390939..>392306
                     /gene="TPHA0I01770"
                     /locus_tag="TPHA_0I01770"
                     /db_xref="GeneID:11532897"
     mRNA            <390939..>392306
                     /gene="TPHA0I01770"
                     /locus_tag="TPHA_0I01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687067.1"
                     /db_xref="GeneID:11532897"
     CDS             390939..392306
                     /gene="TPHA0I01770"
                     /locus_tag="TPHA_0I01770"
                     /inference="similar to DNA sequence:INSDC:YPL092W"
                     /note="similar to Saccharomyces cerevisiae SSU1 (YPL092W);
                     ancestral locus Anc_8.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687115.1"
                     /db_xref="GeneID:11532897"
                     /db_xref="GOA:G8BXQ3"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ3"
                     /translation="MKLHIKKTFNNVIDEFDPTSFIYVTGTAMASSLLHTFPFPAYWL
                     RVCSYIMFALGVLIFFYFHIIGTLQLLKYIRTRNIKGFFNKQFMNFDTNVFWGIYIIA
                     FTGLINYLIQLSENELLHLKSGKGMIIFIYVLWWLDLSAALFVTWGITFINWRIACNP
                     SGLGKHANCKQKILSDNFKSSLFLSVIPIVVVAASGGLLAGSKLFLETVNRNNQLLII
                     VITLLLWTHVFTFVIVVLALFYLNLYINKLPPANAVFSLFIVLGPLGMGGFGILLITK
                     NIQTYVNIHYPLSAQSQVTLTLEDVTKIAVPWAFRIVGLVFSLLELTTGFFFTIISVL
                     SVLSYIRISNKANRSTIVPLYQYHKGWWTLAFPCGSMALGVKEIYEQYNPYTPIDAIR
                     IISVIYYGSSIVWCIVCLLGSLRYQILPFVFQIFGYDGTNLSLIKHKSKIQLYKSSLE
                     KAGSD"
     gene            complement(<392497..>393207)
                     /gene="TPHA0I01780"
                     /locus_tag="TPHA_0I01780"
                     /db_xref="GeneID:11532898"
     mRNA            complement(<392497..>393207)
                     /gene="TPHA0I01780"
                     /locus_tag="TPHA_0I01780"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_003687068.1"
                     /db_xref="GeneID:11532898"
     CDS             complement(392497..393207)
                     /gene="TPHA0I01780"
                     /locus_tag="TPHA_0I01780"
                     /inference="similar to DNA sequence:INSDC:YBR181C,YPL090C"
                     /note="similar to Saccharomyces cerevisiae RPS6B (YBR181C)
                     and RPS6A (YPL090C); ancestral locus Anc_8.567"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_003687116.1"
                     /db_xref="GeneID:11532898"
                     /db_xref="GOA:G8BXQ4"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ4"
                     /translation="MKLNIAYPVNGTQKTVEIDDEHRIRVFYDKRIGQEVDGESVGDE
                     FKGYTFKISGGNDKQGFPMKQGVLLPTRVKLLLTKGVSCYRPRRSGERKRKSVRGAIV
                     GPDLAVLSLVITKKGEQELEGVTDATVPKRLGPKRANNIRKFFGLTKEDDVRDFVIRR
                     EVTKGEETYTKAPKIQRLVTPQRLQRKRYQKSLKIRNAQAQREAAAEYAQLLAKRLAE
                     RKAEKAETRKRRASSLKA"
     gene            <394517..>395470
                     /gene="TPHA0I01790"
                     /locus_tag="TPHA_0I01790"
                     /db_xref="GeneID:11534663"
     mRNA            <394517..>395470
                     /gene="TPHA0I01790"
                     /locus_tag="TPHA_0I01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687069.1"
                     /db_xref="GeneID:11534663"
     CDS             394517..395470
                     /gene="TPHA0I01790"
                     /locus_tag="TPHA_0I01790"
                     /inference="similar to DNA sequence:INSDC:YBR183W,YPL087W"
                     /note="similar to Saccharomyces cerevisiae YPC1 (YBR183W)
                     and YDC1 (YPL087W); ancestral locus Anc_8.564"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687117.1"
                     /db_xref="GeneID:11534663"
                     /db_xref="GOA:G8BXQ5"
                     /db_xref="InterPro:IPR008901"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ5"
                     /translation="MVHLIWPYPDTPIQGIWGNVTATIDWCEENYVVSKYIAEWSNTL
                     SNITYFITALYATYSAYKNNLERRFILIGIGFAIVGFGSWLFHMTLLYHFQLLDELPM
                     IYATTIPTWSMVCEFYECKHMKDRDFKRFSTKIQWYVGSIITLASLVITVVYVIIRNP
                     LIHEFAYAFFTGLVVIFAGLLCHSYVSDPRSKRNLTYCMGLGIVLFATGFVAWQLDVN
                     FCPFWTNIRRSYLQLPLGVFLELHAWWHVFTGLGVYYYVIFLQYLRIITSNSQDRFQF
                     IWRWKIIPEVINKDNAINTPYSLEFLGNYVDPAEFSEETQT"
     gene            <396106..>401949
                     /gene="TPHA0I01800"
                     /locus_tag="TPHA_0I01800"
                     /db_xref="GeneID:11534664"
     mRNA            <396106..>401949
                     /gene="TPHA0I01800"
                     /locus_tag="TPHA_0I01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687070.1"
                     /db_xref="GeneID:11534664"
     CDS             396106..401949
                     /gene="TPHA0I01800"
                     /locus_tag="TPHA_0I01800"
                     /inference="similar to DNA sequence:INSDC:YPL085W"
                     /note="similar to Saccharomyces cerevisiae SEC16
                     (YPL085W); ancestral locus Anc_8.562"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687118.1"
                     /db_xref="GeneID:11534664"
                     /db_xref="GOA:G8BXQ6"
                     /db_xref="InterPro:IPR024340"
                     /db_xref="InterPro:IPR024880"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ6"
                     /translation="MAKKKQQKKKVKQKAKKPQQNPNLDTVAGQMVAGQHDNVETSQE
                     VGDGVEMEDHNENTVEEVLETALNVASELGKEETTAQVGLPLEQVIEPVIEENFIEQQ
                     PIPEFPIHIDEPVQQYTEEAQQNFAQDSVDFSEVLMERTHTAVVEEPGLSPIKEYIAE
                     PALEEQELQPETFQNNIEETAQYTQTGNTELEPELATELTQDIRAVQDYVTEQTDIPY
                     LPENEEIIEEVVQPVELQSAEINQKPIFTEEIGKSNEFASISIDNDALGNDSNLAQGE
                     TNISHSNENLSEQDIPPSTDLIEHPTQNADLTSENLERDIVNVHSQSSIGVVRVESAD
                     EIPASLGDSQFTHETSIKNNEEIITFEENLSENDADNFFTVMAKSQEDELLEPQLSEQ
                     LNENDLQKVEPDLHVPEPEPAVVNNDPLSFLIEEDDDFLDDDDDENDKEKEDDTENIN
                     EIENHDVDTNNTNITHTNNKNNIDLLSDDDSLISSDEEIELDFQNIAKPLTEETTETT
                     ALPSKYIPTANTSTSAITLPVSQKYEPRIKTVKQASITKLEIPGINAAGIVPPKPNFQ
                     RDISNDIASNSPSSTVTKKLNDEKKKSDAYDFPMDLVGSTIQKGHAKPVSLPTPQLSD
                     MNSVAIPLNRNPSSNHTINTGSKIHLRTTSKGTIPPNPYAISTQMKAPINQYVPSLDS
                     LNTSAIPQKQPRMYAPNVVNAQAPPVTNIVPKVNVPLIVNPQAPLVANPPQGMYAPQM
                     VNAQASPITSPLQATYAPPFVKSQEPDVVIGKYAPVQNLAPSNNVVNANIHQPQQFTF
                     PAKNDMDNQEKINDLAIPIAGRQTRKKSISRSGADMYNPIKTKGKIRYSLSGRSQSGI
                     QVEENNINMQQSYLPYVPTTQAANATSFSASRYSNEPQLKPEENVALLGRQFPLFKWG
                     PSRKISYGVPPAINQSSYMMNTISNEMTINIIETEEMIKPDQLLNSFIGPLFKGKTKE
                     KDISKWINDITNNIANQFTSDEILVYKLLDLKLSSKRSMKDVAELLYTNRSSLGIVSR
                     TQVNEPFEFNSHKLGANSQKTIADQLQTGQHHEALSFALKEKDSTMALLIASMMGKDR
                     ITQVVKQYFTEEYGDSSSGILLSLLFQVFVGNPSDAVASLYNDQLKSSWAINNWQLLV
                     SSILNNIGSTDSNEQVLHNSDLPINVIEFLIEFGIFLNGKQLELASHILFIIVNMPLN
                     SKPITNTSNVVFNYIGTSTTAQSSIWSEIYEFLYSKDPKHRFFYDILPQKLYHATILY
                     ESGQVPLATKYADSLLASLKILSKKDPMYINLNAHLQDLNNSMSSSSSWLGKPKFSSV
                     WDQLDKSFNRYIGGDDDSSLHQNGEKKIFDRFTPVNSRNSSTLDLTQPTFTPYQNKLN
                     PISKIESISIGEMVRHGRTSSLKTNVLMNDNYLPHSQSRDVQHEHAAHVSSQNPAQQM
                     KIPNLNNDLSLSKVSNDQSSKSKQVSIDGLNNSPPPKMNSQYDGSERQTPQDIPLKNL
                     DGNASFKPPLNRAYSDTNSSIQSTHSSAHLSTFDVKTAIVTARSESQEAYTKVNQALS
                     DVSKSSTLVLDRNNLDLNGTGMISSIHTSTKYDVIAATSTNTTDELRNVQNPIESSLV
                     NNEMPQNSEIMQGNDKSTISKPILSPPLKQLTPSNNTIENIVPQSVSKPVMANSYIPS
                     NSLVPNSTADTVLAKQNLPSADMNTASFGGYAPTYDHGIKREGNKKFSPIKNDSNTFL
                     KEANNTSNYANFEERKSSAPNPVTVSMESTKKKQYRFTSVSDATITNIDSIPQRIRSR
                     FEPIQESEVLTEALFEPVIKISNNLNFKPRSSIVSEEMPLYEDDVEDESDDEGEQQLP
                     DAKLKEESSRNEAREQSELAEKNFKKVAESENCRDKDQVGSSGWFTWLKKDPNAKKPI
                     KAKLGNKKSNFYYDEELKRWITKNATEEEKQQITAPPPPPPMSKKRT"
     gene            complement(<402446..>403840)
                     /gene="TPHA0I01810"
                     /locus_tag="TPHA_0I01810"
                     /db_xref="GeneID:11532839"
     mRNA            complement(<402446..>403840)
                     /gene="TPHA0I01810"
                     /locus_tag="TPHA_0I01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687071.1"
                     /db_xref="GeneID:11532839"
     CDS             complement(402446..403840)
                     /gene="TPHA0I01810"
                     /locus_tag="TPHA_0I01810"
                     /inference="similar to DNA sequence:INSDC:YPL083C"
                     /note="similar to Saccharomyces cerevisiae SEN54
                     (YPL083C); ancestral locus Anc_8.559"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687119.1"
                     /db_xref="GeneID:11532839"
                     /db_xref="InterPro:IPR024336"
                     /db_xref="InterPro:IPR024337"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ7"
                     /translation="MEKRNGSPIKYTHNKLNKETDGATSELEEDEVIQDWSQLAKLSK
                     KNSLKTLPKRGEKDYEPDGTIIQEGRLFQVRKAMFDTLYNSIRGSTIKNQSKAFLVPE
                     LHSAFILHAKGNFLQTVGKVDKQSRCWLNFLEFVYLAERGTITPFLCSEYHNSMTTED
                     DMDIVPLSIEDIYTFFESQVEINEFFVYGYLKRLGYIVNLKKMQVPDPTSFFPSTLNK
                     WTGYFNVINLLSFTDRLFTDTSKMLRKMVFFSSYNFKIFKYLSNSMIYNGLQTLINCQ
                     NVPKNKSELYSQRIKYNRKPTLHNKQKISFDVWKPQSNYKKKSPGLPDYQIMVMNKND
                     PKQHFPSKKELDDLFDSLDYKFEFLNNSEDTNFWERNSYTCNIPREDYLLKSHYKAKQ
                     VNSSLNSVKQKKVKRPISSYNTNIQQILRLKHGYRNILIAVIDNGIISFIKIGEADFG
                     KENIWYVPNSKLNK"
     gene            <404763..>406530
                     /gene="TPHA0I01820"
                     /locus_tag="TPHA_0I01820"
                     /db_xref="GeneID:11532840"
     mRNA            join(<404763..406295,406384..>406530)
                     /gene="TPHA0I01820"
                     /locus_tag="TPHA_0I01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687072.1"
                     /db_xref="GeneID:11532840"
     CDS             join(404763..406295,406384..406530)
                     /gene="TPHA0I01820"
                     /locus_tag="TPHA_0I01820"
                     /inference="similar to DNA sequence:INSDC:YBR186W"
                     /note="similar to Saccharomyces cerevisiae PCH2 (YBR186W);
                     ancestral locus Anc_8.558"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687120.1"
                     /db_xref="GeneID:11532840"
                     /db_xref="GOA:G8BXQ8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ8"
                     /translation="MVVFVDVKLNLNSLSLAQTFLKEINSEVKFSDRGYGKVEFMLGQ
                     VLLLIKYVIGKKIAKLLNSNLNVEQFTSNDLLGDKHLKFNVVEPLTDIQAKILKSLLK
                     VVCYQQDSNKKVEEFIIQEGQENMILSLFVEAIQFETCLHYTDTREKTFDLVNIHENI
                     KNITAALSKTSFFDGKDLNARENYVIYLFYCLKDSEIQTKIANKDSVESYDENESDVS
                     EDETAYSNSQSNMTNTGIALSNHILNLTTITLLPSKSFENLWESLHFDTNIKQKLFNY
                     ATISLKLGKYISKSGKNQQLTNNNSNRLILLHGPPGTGKTTLCKALFQKISMRCQIND
                     ATLIIDNQGSGILIELSCSKIFSRWFGESAKNLEILFTEIKNIIKHYNSMGKFVCLLI
                     DEVEAIAYSRTDLLNKNETTDSIRVVSTLLTLLDSLRTFENILTLATSNLIGSLDAAF
                     VDRADWIFYVNNPSERGITLILDSSIRELLNLNILSSPLGNGTLNDTQYQEILKTIAH
                     TCFAKNMSGRILKKLPIKCISEYFFDLPVKLDDFLLAFAHTVVKLSDKESV"
     gene            complement(<406647..>412241)
                     /gene="TPHA0I01830"
                     /locus_tag="TPHA_0I01830"
                     /db_xref="GeneID:11532841"
     mRNA            complement(<406647..>412241)
                     /gene="TPHA0I01830"
                     /locus_tag="TPHA_0I01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687073.1"
                     /db_xref="GeneID:11532841"
     CDS             complement(406647..412241)
                     /gene="TPHA0I01830"
                     /locus_tag="TPHA_0I01830"
                     /inference="similar to DNA sequence:INSDC:YPL082C"
                     /note="similar to Saccharomyces cerevisiae MOT1 (YPL082C);
                     ancestral locus Anc_8.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687121.1"
                     /db_xref="GeneID:11532841"
                     /db_xref="GOA:G8BXQ9"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022707"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXQ9"
                     /translation="MTSQVSRLDRQVILIETGSTQLVRNMAADQLGDLAKQHPEDILS
                     LLSRVYSFLLSKKWETRVTAARAIGEIVLHSELWDPNQDADDVLDEAIEEQNNIKIEE
                     IEENAQVKLEHEIQLKLKDAKENHLLDDDERLLSLSSWNLHELLKTGKILLAESSEDN
                     TSIEENKKKVLKTELTQAEETTAPTTQEDLPTQNANGTKKSARMLAMAKRKQKMQTKH
                     VSTKPINLAESSISKSLIEESKKNDINIKTESTALVNPKLEITEQSDENKIMLESVVE
                     PMLEKQERVSGLVWQCQGIYELLVNNLMHDNWEARHGAAMGLRELLKRHGSCVSKIRG
                     KTKAENFIRNKKALDDLATRLISIFALDRFGDYVNETVVAPVRESAAQTLATMLLHLD
                     NDLSILIFKKLEELIMQDSTLVVQPNKIWEATHGGLLGIRYFVSIKTQFLLENNLLDK
                     VVDIVLYGLNQHDDDVQSVAASVLIPILDEFVSHNSSKIDIILTTIWSSLSRLDDDLS
                     SSIGSVMNLLAKLCSHDIIIESLKVKATRDPAKWSFKSLLPKLYPFLRHSITSVRESV
                     LNLLLSFLSIKDESTKSWLNGKVFRLIFQNIIFEQNPEILELSYKVYLKLLEEYKHKH
                     TEKTLDHVLSKHLQPMLHLLNTPIGENDKNYAMESQYILKPSHNYKLHVDKKRSVSEA
                     LSENDIPGLTSSDHINIDIPMISGDVMLLGKEIILNTRIMGARAFGITLSYFQVSTLD
                     SFVSNVLVRCLTLPFATPRMLAGIILTEVCSHWKKINPAQDEVPEFLYEKINPILNEQ
                     LENPSSLPPFRELVPSLKALRTQCQNLLTTFVDVGMLPQHKLPSIAIIVQGETDAGPQ
                     AFGIETAEKVYNECYEKLFRSLGNSFKVLAQKPLEDVRYRILLAIKLTKEVKASRESS
                     ILANYASVILHFKGLPSKLNPIIRSLMDNVKSEENEKLQSLTGDSITHLIKKLIHNGK
                     ANVANKVVKNLCGFLCVDTSEVPEFEANSNLKEPILTLVKEVSVNVNDDVLLKRKTHE
                     AHIKRRGGIYVLGNLFKEYGDSIFSDVTQLKSIVMDPISNTNTVFQEDKIEASQGQIL
                     VDALGILRVLYKYMSKEIQTTQISLLYPNILLLLKSEFSVLRYSAARTFADLSKISAV
                     SIMTFIIERVLPLMNNAGNTTEREGATELIYHLAITMDTDILPYVIFLIVPLLGRMSD
                     ANRDIRNLATSTFASIIKLVPLEEGIADPEGLPENLMKGREREREFIQQMMDPAKAKP
                     FKLPIAIKASLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRS
                     EEYKKSQSVEHRPLPSLIICPPSLTGHWENEFEQYSPFLNVVVYAGGPSTRQSLQGKL
                     SSADLIVTSYDVARNDLSVLKQLDYNYCVLDEGHIIKNAQSKLSKAVKEIVANHRLIL
                     TGTPIQNNVVELWSLFDFLMPGFLGTEKMFQERFGKPIAASRNSKTSSNEQEAGVLAL
                     EALHKQVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYQDFATKQKGEVAKDI
                     QNTADVDNNQHIFQALQYMRKLCNHPALVLSPNHPKLKEVQNYLQQTKTNLHDITNAP
                     KLNALRNLLFECGIGEADMDKKTSNQIMPTTNVISQHRALIFCQLKDMLDMVENDLFK
                     NYMPSVTYLRLDGSVDPRDRQKVVKRFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFI
                     EHDWNPMNDLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIVNQQ
                     NNGLASMDTHQLLDLFDTENVPSQESEVDTSKSNKALDDVANETGLTGKAKEAVGVLS
                     ELWDKSQYEDEYNLDNFIKTLK"
     gene            <413824..>414914
                     /gene="TPHA0I01840"
                     /locus_tag="TPHA_0I01840"
                     /db_xref="GeneID:11532853"
     mRNA            join(<413824..413830,414343..>414914)
                     /gene="TPHA0I01840"
                     /locus_tag="TPHA_0I01840"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_003687074.1"
                     /db_xref="GeneID:11532853"
     CDS             join(413824..413830,414343..414914)
                     /gene="TPHA0I01840"
                     /locus_tag="TPHA_0I01840"
                     /inference="similar to DNA sequence:INSDC:YBR189W,YPL081W"
                     /note="similar to Saccharomyces cerevisiae RPS9B (YBR189W)
                     and RPS9A (YPL081W); ancestral locus Anc_8.554"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_003687122.1"
                     /db_xref="GeneID:11532853"
                     /db_xref="GOA:G8BXR0"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:G8BXR0"
                     /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYR
                     ISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKNIDFAA
                     TSPFGGARPGRVARKRAGNAAASEEAAEEEEE"
     gene            <415576..>416584
                     /gene="TPHA0I01850"
                     /locus_tag="TPHA_0I01850"
                     /db_xref="GeneID:11532854"
     mRNA            join(<415576..415586,416113..>416584)
                     /gene="TPHA0I01850"
                     /locus_tag="TPHA_0I01850"
                     /product="60S ribosomal protein L21"
                     /transcript_id="XM_003687075.1"
                     /db_xref="GeneID:11532854"
     CDS             join(415576..415586,416113..416584)
                     /gene="TPHA0I01850"
                     /locus_tag="TPHA_0I01850"
                     /inference="similar to DNA sequence:INSDC:YBR191W,YPL079W"
                     /note="similar to Saccharomyces cerevisiae RPL21A
                     (YBR191W) and RPL21B (YPL079W); ancestral locus Anc_8.553"
                     /codon_start=1
                     /product="60S ribosomal protein L21"
                     /protein_id="XP_003687123.1"
                     /db_xref="GeneID:11532854"
                     /db_xref="GOA:G8BXR1"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="UniProtKB/TrEMBL:G8BXR1"
                     /translation="MGKSHGYRSRTRYMFQRDFRKHGAIALSTYLKVYKVGDIVDIKA
                     NGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYIEKRLSLRVEHVKHSKCR
                     QEFLDRVKSNAAKKAEAKAQGVAVQLKRQPAGPRESRIVSTEGNVPQTLAPVPYETFI
                     "
     gene            <417014..>417403
                     /gene="TPHA0I01860"
                     /locus_tag="TPHA_0I01860"
                     /db_xref="GeneID:11532816"
     mRNA            <417014..>417403
                     /gene="TPHA0I01860"
                     /locus_tag="TPHA_0I01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687076.1"
                     /db_xref="GeneID:11532816"
     CDS             417014..417403
                     /gene="TPHA0I01860"
                     /locus_tag="TPHA_0I01860"
                     /inference="similar to DNA sequence:INSDC:YBR194W"
                     /note="similar to Saccharomyces cerevisiae YBR194W;
                     ancestral locus Anc_8.550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687124.1"
                     /db_xref="GeneID:11532816"
                     /db_xref="UniProtKB/TrEMBL:G8BXR2"
                     /translation="MSSTSQNRKDQPKVTKKRKILNLDSKEKRRNATNISAEKHLSSK
                     ESFGSDFDSESITNTQKHNTTNDVVKLGDKSIFYEEEWNPNGFAPLNVRNLSYNPSTF
                     VRRGKEVITKLCGLQNIQIPKTHESKK"
     gene            <417692..>418558
                     /gene="TPHA0I01870"
                     /locus_tag="TPHA_0I01870"
                     /db_xref="GeneID:11532817"
     mRNA            <417692..>418558
                     /gene="TPHA0I01870"
                     /locus_tag="TPHA_0I01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687077.1"
                     /db_xref="GeneID:11532817"
     CDS             417692..418558
                     /gene="TPHA0I01870"
                     /locus_tag="TPHA_0I01870"
                     /inference="similar to DNA sequence:INSDC:YPL076W"
                     /note="similar to Saccharomyces cerevisiae GPI2 (YPL076W);
                     ancestral locus Anc_8.545"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687125.1"
                     /db_xref="GeneID:11532817"
                     /db_xref="GOA:G8BXR3"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:G8BXR3"
                     /translation="MGKVEWKRLLWLQQDYPDNYTDQKFLEKVKDYENKKLDYANSPY
                     LSVENYRVVRSDFLNFFQTVLNTSIIYIIFAYIYIYDKDPTVVTVLVTSVIASIVLFK
                     EHDKDQLSSLLNLKSVIIIIFSMLTLSPILKSLSKTTASDSVWTLSFWLTLWYISSIS
                     SSKEIKTSNVSTNLLVAVVSILSSRLSTSTHVFCFLFLCIQINVVLPNLLISSTVLFM
                     LSNSFAYMFITHALGWMYTFCITLTTLLYIWLLPKWFIYWQVHYRMLDDANTSSKEAL
                     LTSWDAKKPILD"
     gene            complement(<418620..>421724)
                     /gene="TPHA0I01880"
                     /locus_tag="TPHA_0I01880"
                     /db_xref="GeneID:11534383"
     mRNA            complement(<418620..>421724)
                     /gene="TPHA0I01880"
                     /locus_tag="TPHA_0I01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687078.1"
                     /db_xref="GeneID:11534383"
     CDS             complement(418620..421724)
                     /gene="TPHA0I01880"
                     /locus_tag="TPHA_0I01880"
                     /inference="similar to DNA sequence:INSDC:YBR198C"
                     /note="similar to Saccharomyces cerevisiae TAF5 (YBR198C);
                     ancestral locus Anc_8.544"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687126.1"
                     /db_xref="GeneID:11534383"
                     /db_xref="GOA:G8BXR4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR007582"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8BXR4"
                     /translation="MSRVNGNTGKDVNNVADKYIAGSSMAGMNNLPSKTVPGKRIPNK
                     MVPSKTVPGKRIPGKSIPGKTIAGKTVVGNSMVQNNPSMPNANKIRGDNTTPADKNFT
                     LQANNPNVNDKVRQGNTINNNKNNNARNNNMENNQSQLHSQYPSNDINRLLLEFLNKK
                     GFHRMEVMLRTESSRTLTPHNYNSPALPKYSNFISPEENSQLLSKYKSTIRPVTNPYQ
                     STPTKRDSEGNPIRNKSGDSINVDDYRTYLRSFILLKNWISKSLSIHKPILTDLVLYP
                     VFVIMLIKFYRLKNIEILKKFYEENVKLVIGESNKLIIINLYDDLIKSSNDNLEDEKK
                     EKTNEFDQYNFQISISQQLFFSLISHLMNNYKLGGQIILGCIFSRIEVQLVQSLKNNS
                     IELVKHNHENETKDSKQVQSDHTFENLSKEGEEISKTEASEKLENESGNDLNIKADKE
                     NDEAATDENIQDDDIADKDEKVKSEIQVDEKTSNSEVKVNEDDRNSPINNDKKVNSGE
                     KGEQRPMKEPKSEGNANLNPNNEKNAAPEDQNEAHTSLQRSKEDLEKESESRVLENEL
                     NDKHRMQVDDNKEKENAEKENKDTLTESLPSSSDLQDEMNGANQVNDNTEDVVNVKKS
                     PNSLEQSVYIQDKEDPSNDNSNATVNLNTKTATKESIKSTISVSKLQGKIKKFQELAK
                     SLHYLGCQTSLPSVSMYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSIN
                     ENEQNYSQINSIFKTLVGHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSY
                     KGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPN
                     GQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVW
                     DIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIKKNTHEPSLEPEE
                     IYPGLGNDNVTSMNQDIKEYGRRRTIVATNDLMATYFTKKTPVYKVKYTSANLLLAGG
                     ASIA"
     gene            <423724..>427086
                     /gene="TPHA0I01890"
                     /locus_tag="TPHA_0I01890"
                     /db_xref="GeneID:11534463"
     mRNA            <423724..>427086
                     /gene="TPHA0I01890"
                     /locus_tag="TPHA_0I01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687079.1"
                     /db_xref="GeneID:11534463"
     CDS             423724..427086
                     /gene="TPHA0I01890"
                     /locus_tag="TPHA_0I01890"
                     /inference="similar to DNA sequence:INSDC:YPL075W"
                     /note="similar to Saccharomyces cerevisiae GCR1 (YPL075W);
                     ancestral locus Anc_8.543"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687127.1"
                     /db_xref="GeneID:11534463"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G8BXR5"
                     /translation="MDLNFYNTSIDYNSITNNADNNLRHHFDVLADTSNHNTNNNSNN
                     KLTSSLSNIELPLLNRKKLPGKSMYLNDLTELAKTFINNNTNNNTNNTSKDPSTNYLQ
                     ALIYKQDKTLNYNGNNDSAQIDEISKNFYSIAQYIFQICFKVKKFHDLSSLKLIDLIV
                     DQTFPNSLTLRRLNDNNSNTPYEYFNTISRDEDISKCPIFALSVNFLIRFSSINNSIT
                     INDYQDIHLLEPDYLSIVALNYLNKSSPNTSVNDINTKLQRDQDFEVADELIYIVYPW
                     LKQFDNDIKILDKDNYKLNSLCELFKFMGKTIIQDIRYLILNGNSNLPNLISFIKKLV
                     PDLFFTETFKSFEKNEKLNFMDSNSNTNNHNSNNYTNSQPSNYNYSSNTTTTNNHYKD
                     NNKSGGLFLVMATHSIENNNNNDKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNYMTLH
                     SDNKSSSGIINMTNNDIAHVNFSNLLPNVTNDDIIDSPHKLEVNILNLAKNLTTENVR
                     LNQQISMIKSDLNIVNKVCNQILETQKELLTNYNNNRNNGNNNNNPKNLDNFNNSFYN
                     NQNKNDNGLIILDKNNINQNLLNNLIQYIEEMKQQSNGFNNNLNGNNGTINIASNYNN
                     GNRIPQNVQENQNIFSMGSNNQRLDYQMQQDGLSRGLKNVLSINADVNNNEKNYNSNN
                     NMNININGISEKMSPHPYSVSTQSRSNMFSPPPSNNSNDLNYISLVNKRMKLADKQTP
                     SRTALDALLSSSINTPKYQEKNDDKSEANNYQSRTVDNGNAIGVGHGGYGNNTVMNVA
                     VAVNKTDKIDDNDNDNDDDDDDDDDDDDDDDDDDDDDDDDDGDDDDDGDDDGNDDDDE
                     DNEDSAISNAESESESMEIEPIIRTSRKAPIGNNRNILLDATNDNAIADDIGNNTNNS
                     EESNNINLEISSEMVKTTSNKSDSDRGNRRTKQSRKKNKKKLGKGNTIKPSPNADIKY
                     KLSRDNKTIWDLYTEWYIGFNGKESVIELINKYGWRRWKVHDDSHFFPTRRIIMDYIE
                     TEIDRGMKYGRFKNPNQSREDIRKILVGDLEKFRINNGLTLNSLSLFFRNLSKDKKEI
                     CIFKDFKTWDVNQMTDDEKIKYCKRKHTDIKT"
     gene            <427715..>429883
                     /gene="TPHA0I01900"
                     /locus_tag="TPHA_0I01900"
                     /db_xref="GeneID:11532909"
     mRNA            <427715..>429883
                     /gene="TPHA0I01900"
                     /locus_tag="TPHA_0I01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687080.1"
                     /db_xref="GeneID:11532909"
     CDS             427715..429883
                     /gene="TPHA0I01900"
                     /locus_tag="TPHA_0I01900"
                     /inference="similar to DNA sequence:INSDC:YPL074W"
                     /note="similar to Saccharomyces cerevisiae YTA6 (YPL074W);
                     ancestral locus Anc_8.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687128.1"
                     /db_xref="GeneID:11532909"
                     /db_xref="GOA:G8BXR6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXR6"
                     /translation="MVNRTLIKNSKFTIPNQFTLTQALELLYIIIEKQYGNLKIRYAK
                     MEEGIDVSVDDVTKLYKATTSLLDDLYVSLFVIEDCFKCDNLLNRETWANTEVSHIID
                     DFFILNEDIRVARLNSKAFLLEHRNRYNFLQKFNALGINKSNFKKDDEEEEYIFREAR
                     EIRRYREIKQTNEIKNEREKQVLLEKTIELRLRNELQKEFEKKLETERKKLINKYASL
                     SKAMEPIKPKSTVKNSKGSGSLPPPPPPPSANMDRASNVKLTRRSLEVSKALNDQTNN
                     INSQRTSFDIHDIGRAANLAWTSNSGVERSNINKSKNTSLPRRTRSSEAIKSNYEAIK
                     VGIQGKSISSQNKVATKTKQENLISETRKISKQSVKPKTKGNPSKLISDNKTNGNVAM
                     TGGKEDTTKSLLEIRIAQVMKSLVGVDKGACELILNNILVQNDVVHWDDIAGLNSTKE
                     ALKEAVEYPFLRPDLFMGLREPISGLLLFGPPGTGKTMVAKAVATESNSTFFSISASS
                     LLSKYLGESEKLIKALFYLAKKLAPSIIFIDEIDSLLTSRSANENESSRRIKTELLIK
                     WSSISNATTKEVDDESEDNRVLVLGATNLPWEIDEAARRRFTRRLYIPLPGLETRLYH
                     LKKLLQHQKHHITDEQFLKIAEYLDGYSGSDITALAKESAMGPIRELEGNLLDVNVTS
                     IRGVTEEDFLNALNIIKKSVSSKSLDDYERWSSSFGSSGD"
     gene            <430549..>431961
                     /gene="TPHA0I01910"
                     /locus_tag="TPHA_0I01910"
                     /db_xref="GeneID:11532910"
     mRNA            <430549..>431961
                     /gene="TPHA0I01910"
                     /locus_tag="TPHA_0I01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687081.1"
                     /db_xref="GeneID:11532910"
     CDS             430549..431961
                     /gene="TPHA0I01910"
                     /locus_tag="TPHA_0I01910"
                     /inference="similar to DNA sequence:INSDC:YBR199W"
                     /note="similar to Saccharomyces cerevisiae KTR4 (YBR199W);
                     ancestral locus Anc_8.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687129.1"
                     /db_xref="GeneID:11532910"
                     /db_xref="GOA:G8BXR7"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BXR7"
                     /translation="MRLFPPSKRLSRYIIILLIILATASIGIYHHEKVKEHLANIPLE
                     SFPGFQIFDASSDANKDSAIEETNPDSWMDTKYENIFRRLNTPLIDNITNSEEDKEKQ
                     IISIGIEESYMKKTLKTPVIEPKIDNLVRPGDPLAGKANAAILSLVREEDLKELVLAI
                     NRLEERFNSKFNYPYVFLNDGDFSDKFVTRIKDILPKDRIIEFGKIDPEVWNMPDNID
                     RDLFKEAIEKNKNVQFMAKESYHNMCRFFSKNFYKHPLVKKYKYTWRLEPSTSVFCDI
                     EYDVFQFMEMNDKYYGYTISVYDSPESVATLWNHTMDFLKMHPDYIDPNGAFEWLKDN
                     GQKPENYEIANGYSTCHFWTNFEITNLEFLRSKPYEQFVEYLDSKDGFYYERWGDAPV
                     RSLALALFLDKKKIHWFQDIGYLHTPYTNCPASPVGSKRCQGNCIPGRVSAWEPLSIE
                     NCQGLWLEYSMDDKTNLYTP"
     gene            <433220..>433744
                     /gene="TPHA0I01920"
                     /locus_tag="TPHA_0I01920"
                     /db_xref="GeneID:11532911"
     mRNA            <433220..>433744
                     /gene="TPHA0I01920"
                     /locus_tag="TPHA_0I01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687082.1"
                     /db_xref="GeneID:11532911"
     CDS             433220..433744
                     /gene="TPHA0I01920"
                     /locus_tag="TPHA_0I01920"
                     /inference="similar to DNA sequence:INSDC:YLR109W"
                     /note="similar to Saccharomyces cerevisiae AHP1 (YLR109W);
                     ancestral locus Anc_8.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687130.1"
                     /db_xref="GeneID:11532911"
                     /db_xref="GOA:G8BXR8"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="UniProtKB/TrEMBL:G8BXR8"
                     /translation="MASLQNKPLETKGYKFQYISILPSDQDQEACKFPVNINWAQFIK
                     DNKTVVITGAPAAFSPTCSVSHIPGYISKQKELLAKADQVVVLTVDNPFANQAWAKSL
                     GVKDTTHFKFGSDAGCQFIKSLGLELAVGDDVFWSGRWALVVKNGVVVYAGKEENPAT
                     DVTVSSVDSVLAHL"
     gene            <435881..>437581
                     /gene="TPHA0I01930"
                     /locus_tag="TPHA_0I01930"
                     /db_xref="GeneID:11532890"
     mRNA            <435881..>437581
                     /gene="TPHA0I01930"
                     /locus_tag="TPHA_0I01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687083.1"
                     /db_xref="GeneID:11532890"
     CDS             435881..437581
                     /gene="TPHA0I01930"
                     /locus_tag="TPHA_0I01930"
                     /inference="similar to DNA sequence:INSDC:YBR200W"
                     /note="similar to Saccharomyces cerevisiae BEM1 (YBR200W);
                     ancestral locus Anc_8.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687131.1"
                     /db_xref="GeneID:11532890"
                     /db_xref="GOA:G8BXR9"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:G8BXR9"
                     /translation="MLKSLGLRRKNTSSPASSTPSPKNDPKVPKKLNYDPNSLPLTVT
                     SYNSDGRHMHAIEKVIKALSTNVSKNRKELSYAEGDFFHVIKETKHSYYATNPITGSV
                     GKVKKENFEEFGKSTPTLLDLQDIFSTAKSICSSRDRKSQHSADMDTFGSLNAIASYD
                     FVADNEEELSVEVGQTFVIWAHHDFEWFVAMPTENTNKIGLVPTSYLCITDLKTGIVS
                     ENEIRDDIINSNLPNIEEWKYNLKSQTAYTITLDSIEQTTENTDLDDLDDPFEYSYYD
                     NSSRKSAVPLSKIYTKCKITAVTYEKGHYWFEIKCRSVDNSTTIMLKRFYEDFFELQA
                     KIFERFPEESGTLKNAKGEYSKRIIPNIPSPVAKVNEEVAFSRKYQLNKYLGNLLGLP
                     EYILQSSDILQFFEVKNNGYDFSIEPEKCQYILLPGSEKSKTERRNSNKNADDINFDE
                     ADNILTGEDLKLFEKLSLQQQRVDSDSSACSSPRQFNLPNDNKTKIKFYYQDDIFVIR
                     LHDNTSLDDLKMEIFQRINKANFKIAVKLTDGEGQEIKSDAHVSQVIQGKMRISVIDT
                     "
     gene            complement(<437807..>438820)
                     /gene="TPHA0I01940"
                     /locus_tag="TPHA_0I01940"
                     /db_xref="GeneID:11532891"
     mRNA            complement(<437807..>438820)
                     /gene="TPHA0I01940"
                     /locus_tag="TPHA_0I01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687084.1"
                     /db_xref="GeneID:11532891"
     CDS             complement(437807..438820)
                     /gene="TPHA0I01940"
                     /locus_tag="TPHA_0I01940"
                     /inference="similar to DNA sequence:INSDC:YPL069C"
                     /note="similar to Saccharomyces cerevisiae BTS1 (YPL069C);
                     ancestral locus Anc_8.536"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687132.1"
                     /db_xref="GeneID:11532891"
                     /db_xref="GOA:G8BXS0"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:G8BXS0"
                     /translation="MNDIRTLVGSEPYWNEDYEGIVQLPYNHLAQQPGKNFRTKLINT
                     FNIYYGIDKVRLEQLSELISILHTSSLLIDDIEDNSETRRGIQTSHLKYGTPMTINSA
                     NYMYFKAMAVLERIASVRVDGSTEKEENVDGSLLKDLLVIFNAELINLHRGQGLDIYW
                     RDSFPSIIPTESMYFNMVMNKTGGLFRLAVRIMERLKDETDSDSKSLVPLANLIGILF
                     QVRDDYQNLTDETMIKNKGFAEDLSEGKLSFPVIHGLRYALDNEDEGTILFHTIKAKP
                     KELKPKKETIDYLRDVTKSLEYTELKIKEISDLILDPEFVPDNNQEFNTHIISIVKNL
                     SEI"
     gene            <439395..>440204
                     /gene="TPHA0I01950"
                     /locus_tag="TPHA_0I01950"
                     /db_xref="GeneID:11534534"
     mRNA            <439395..>440204
                     /gene="TPHA0I01950"
                     /locus_tag="TPHA_0I01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687085.1"
                     /db_xref="GeneID:11534534"
     CDS             439395..440204
                     /gene="TPHA0I01950"
                     /locus_tag="TPHA_0I01950"
                     /inference="similar to DNA sequence:INSDC:YBR201W"
                     /note="similar to Saccharomyces cerevisiae DER1 (YBR201W);
                     ancestral locus Anc_8.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687133.1"
                     /db_xref="GeneID:11534534"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:G8BXS1"
                     /translation="MDAIFFNLLGDVPAVTKTWTLGCLALSILTTAEIIEPTRIMYNY
                     ELAFKKGQYERILFSLFDFGQLDIKSLVNLYISCSNLSILENSFQDRNSYLWVLFLIF
                     LSTITMTAFEQPIFSLGSLMNENLVYYRLRKNPDNINFQILAGFNISPLVVPLYMNAM
                     LYFVYEKSLFQVSMNFIPGHLMFFMDDIVGKIYDIDFTKSPYTRFIEKNDTSDEEVEE
                     VEEVEEVGEELEGNTLQNDITSEETPLLAEEVQEVSESDNQAREPNDNGDE"
     gene            <440990..>443485
                     /gene="TPHA0I01960"
                     /locus_tag="TPHA_0I01960"
                     /db_xref="GeneID:11534535"
     mRNA            <440990..>443485
                     /gene="TPHA0I01960"
                     /locus_tag="TPHA_0I01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687086.1"
                     /db_xref="GeneID:11534535"
     CDS             440990..443485
                     /gene="TPHA0I01960"
                     /locus_tag="TPHA_0I01960"
                     /inference="similar to DNA sequence:INSDC:YBR202W"
                     /note="similar to Saccharomyces cerevisiae CDC47
                     (YBR202W); ancestral locus Anc_8.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687134.1"
                     /db_xref="GeneID:11534535"
                     /db_xref="GOA:G8BXS2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008050"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8BXS2"
                     /translation="MNTALPSIQLSVDYTSLTDEINDFLLHFKEDALDKVNENVGSDE
                     IDEESFKGPKYLGLLQKVANRELDTVTVELDDIFKYQSEKFLEGGRSNSDLLVAIENN
                     TNHFTELFCRSIDNIMPLPTKEMNYKDDVLDVILNQRRLRNERLVSDRTNEIRSENLV
                     DSDNNNTSLSQALRDVASSETDLFPPELTRRYFFYFKPLSLNNAARRRNAKSPSAIPM
                     SVRQIKGGSLGKFITVRGIITRVSDVKPSVMVIAYTCDTCGYEVFQEVHSKTFSPLSE
                     CSSRECQQNQAKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRTLTIHINGSLVR
                     SVTAGDIVDISGIFLPSPYTGFKALKAGLLTETYLEAQYVKQHKKKFSNFTLSTDIEE
                     RIEKITRSGNVYENLAKSIAPEIFGNLDVKKALLLLLVGGVYKQVGDGMKIRGDINVC
                     LMGDPGVAKSQLLKAILKITPRGIYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVL
                     ADNGICCIDEFDKMDENDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGR
                     YNPRLSPLENINLPAALLSRFDILFLMLDIPNKDDDAKLAEHVAYVHMHNKQPTLDFE
                     PIDSDSMREFIALAKTKRPVMSAEVNEYVINAYINLRQDSKREMDSKFSFGQATPRTL
                     LAIIRLSQALAKLRLADTVDVEDIEEALRLIRVSKESLYSEVNGKKDDESPTTKIFTV
                     IKKMALEDSKEVKSLSYEAVVKSIRARGFTMLQLNNCIQEYTYLNVWHLINEGTILKF
                     VDDEYLEPQQEVSSNSSSFKGLSAEERDVIMED"
     gene            <443995..>445317
                     /gene="TPHA0I01970"
                     /locus_tag="TPHA_0I01970"
                     /db_xref="GeneID:11534316"
     mRNA            <443995..>445317
                     /gene="TPHA0I01970"
                     /locus_tag="TPHA_0I01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687087.1"
                     /db_xref="GeneID:11534316"
     CDS             443995..445317
                     /gene="TPHA0I01970"
                     /locus_tag="TPHA_0I01970"
                     /inference="similar to DNA sequence:INSDC:YPL066W"
                     /note="similar to Saccharomyces cerevisiae YPL066W;
                     ancestral locus Anc_8.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687135.1"
                     /db_xref="GeneID:11534316"
                     /db_xref="UniProtKB/TrEMBL:G8BXS3"
                     /translation="MTKPIISFKPSYNSVIRGCPGLPDTLPRIEYELRIRSNDGKEFK
                     IERIEVIFKTIEALHATHTFSSKPKVEKTSIHYKKNIKLSDSVLLGIDLPLTIGLPDQ
                     IKETNFNPNFGYTVNFLDCNVYYYVGDASELLVESYSEPINIERYTYLPSKQLFPSIK
                     KKFHSPDKKFSVDLSIENPCVTTDDLLKTKISIKQSSSSYPISPQKGLFNKKTKLKSV
                     SYEIKEQLEVLDADNVDSKDNTIMHFSQAVNETLSFNEIKLKANLRVLTKNEYFKEFE
                     TTMQEPAFLYKIPDDIKIDNTINSNSMMETKLIQNSTGDKIPFQYHTSISTNGSLFSV
                     NHILRIKFKISNGRDFEIHYPITISQWSITQVRYVEEIINQERETAGFAQQFYESYGG
                     IKRNKNTRLLEYPSLPPAVYLNNEDTLQKLNILFNIEHKKPLRIPLIG"
     gene            <445872..>446573
                     /gene="TPHA0I01980"
                     /locus_tag="TPHA_0I01980"
                     /db_xref="GeneID:11534317"
     mRNA            <445872..>446573
                     /gene="TPHA0I01980"
                     /locus_tag="TPHA_0I01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687088.1"
                     /db_xref="GeneID:11534317"
     CDS             445872..446573
                     /gene="TPHA0I01980"
                     /locus_tag="TPHA_0I01980"
                     /inference="similar to DNA sequence:INSDC:YPL065W"
                     /note="similar to Saccharomyces cerevisiae VPS28
                     (YPL065W); ancestral locus Anc_8.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687136.1"
                     /db_xref="GeneID:11534317"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="InterPro:IPR017898"
                     /db_xref="InterPro:IPR017899"
                     /db_xref="UniProtKB/TrEMBL:G8BXS4"
                     /translation="MAHYHSALSDEIPLFNNTITLEEKENIESLADIYSIIITTDNVE
                     KAYLKDSISNEEYTTYINKLLVQYKTYLSEGNTNLLTQFGDLTAFKDKYDIIAPNAIT
                     RLERGIPVTVEHALEPTRDRNSDGDENHSSQTIINTNSGKDIAEATGNFITVMDALKL
                     NYRAKDQLHPLMSELLLSINKVTRSEFKNRSKLVEWIVKINKMKMKDLLSEDEARELL
                     FELDLAYKAFYTLLR"
     gene            complement(<446670..>447683)
                     /gene="TPHA0I01990"
                     /locus_tag="TPHA_0I01990"
                     /db_xref="GeneID:11534318"
     mRNA            complement(<446670..>447683)
                     /gene="TPHA0I01990"
                     /locus_tag="TPHA_0I01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687089.1"
                     /db_xref="GeneID:11534318"
     CDS             complement(446670..447683)
                     /gene="TPHA0I01990"
                     /locus_tag="TPHA_0I01990"
                     /inference="similar to DNA sequence:INSDC:YPL064C"
                     /note="similar to Saccharomyces cerevisiae CWC27
                     (YPL064C); ancestral locus Anc_8.528"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687137.1"
                     /db_xref="GeneID:11534318"
                     /db_xref="GOA:G8BXS5"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8BXS5"
                     /translation="MSMSVEPQTTAKCVVSTSKGNLNIEFWAKECPLITKHFLEVCVT
                     GNINKNKFVKLSNNNDLLVLEQSENNGSELDEVKIRKEKNNRLKFNRGGLVAWDLRNN
                     NMVITVNELDFMKKNDVIKDLVIFGKLVDQTIYTFRDICDTELNDASEFMYPVDIKST
                     EITIPYFKDLNKLESRLSPFDNSNKAIPPKPVNKNKSYKIRVLYDEDSDEDLDANLNN
                     TKALPLRKKMKIKLSSSIQDSKGRMSDRNRNTNINKNDDDVNIDSHNADGPIKGDRKS
                     EKDIALSNDSKELKSRPDKLNSEQSTIYENHEQTERELETLKLFKQFQNDVTGKNILR
                     RNK"
     gene            <448172..>449608
                     /gene="TPHA0I02000"
                     /locus_tag="TPHA_0I02000"
                     /db_xref="GeneID:11532877"
     mRNA            <448172..>449608
                     /gene="TPHA0I02000"
                     /locus_tag="TPHA_0I02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687090.1"
                     /db_xref="GeneID:11532877"
     CDS             448172..449608
                     /gene="TPHA0I02000"
                     /locus_tag="TPHA_0I02000"
                     /inference="similar to DNA sequence:INSDC:YPL063W"
                     /note="similar to Saccharomyces cerevisiae TIM50
                     (YPL063W); ancestral locus Anc_8.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687138.1"
                     /db_xref="GeneID:11532877"
                     /db_xref="GOA:G8BXS6"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027111"
                     /db_xref="UniProtKB/TrEMBL:G8BXS6"
                     /translation="MLSTIIRTTRASTLVHASRPLVLRSSSIFGTRSLMYSHRLLAEE
                     KDSKSKDAKSILTDDMLFKAGVDLDAKDAGKESKEETTSAGETASSDPVSPKKKKKRQ
                     SSTDIKREKYANWMYIFSFSSLTGLGLYMTRDWDADEPKELKESVENGYTIGLMYQRF
                     KARLNSTFSYFQDPPFPDLLPPPPPPPYQRPLTLVLTLEDFLVHSEWDQKHGWRTAKR
                     PGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLYKEHCVYKEGTHI
                     KDLSKLNRDLDKVLIIDCDPNNYKFQPENAIPVKPWNGQADDELLKLIPFLEYLATQQ
                     VSDVKPILNSFHDKSHIPVEFNERVDKLKTKFYNDQKNKQNNWLLKALSVSMGNTVSG
                     NSTKFPLDMIREEGEKNYVRFMKLIEEEKEKMKLQQEQLSGQTFTLKDYVEGNIPTPE
                     EQMQLQMEKQKEIEEMFETRKKENNQKV"
     gene            <450595..>452295
                     /gene="TPHA0I02010"
                     /locus_tag="TPHA_0I02010"
                     /db_xref="GeneID:11532878"
     mRNA            <450595..>452295
                     /gene="TPHA0I02010"
                     /locus_tag="TPHA_0I02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687091.1"
                     /db_xref="GeneID:11532878"
     CDS             450595..452295
                     /gene="TPHA0I02010"
                     /locus_tag="TPHA_0I02010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687139.1"
                     /db_xref="GeneID:11532878"
                     /db_xref="GOA:G8BXS7"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BXS7"
                     /translation="MLLFLPFLGNVVFKKKKKKQTEAVNFEQVDIEVCNFLETLIKRS
                     ITSNSLSCSYTHIFSLRINRISIGLTPYLSLISTIFTQTMSDNESITANKKVADSIPS
                     VEKSKTDNGGWNFLNISLLGIVLALLATVSVLYQANSNVAPVIEKIYVTETVTATTTE
                     TSISTSVSISTSVSVSSTTAYETKTVEKRAESSGNTSPKRDSDIIEMKFHKDPRMINA
                     GRDEDYQMPSSDKSQKVVHPLDDGVKVKAAMVTLCRNGDLWTLVKTIRDIEDRFNGRY
                     HYDWVFLNEVEFTEEFIDVVSSLVSGKVKFGLIEEKQWSIPDFVDEDILDNVRDEMFD
                     NEVLYGESVSYRHMCRFQAGFIFQHPLLAEYDYSWRVDSDINIFCNIPYDIFKFMQVN
                     KKKYGFILSLVEYESTIPTLWTHVKKFIGMHPEYLNDNNLMEFISDDDGETFNGCHFW
                     TNFEIIDLNFFRSQAYQDYFNYLDRTGNFFYERWGDAPIHSIAAALFLDREEVHFFDG
                     LGFYHPDFLSCPTEESIRFQNACTCEPAKDVTWWTFYFCTRQFFRVNGLDLPPDVLEV
                     "
     gene            complement(<452729..>452929)
                     /gene="TPHA0I02020"
                     /locus_tag="TPHA_0I02020"
                     /db_xref="GeneID:11534507"
     mRNA            complement(<452729..>452929)
                     /gene="TPHA0I02020"
                     /locus_tag="TPHA_0I02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687092.1"
                     /db_xref="GeneID:11534507"
     CDS             complement(452729..452929)
                     /gene="TPHA0I02020"
                     /locus_tag="TPHA_0I02020"
                     /inference="similar to DNA sequence:INSDC:YBR162W-A"
                     /note="similar to Saccharomyces cerevisiae YSY6
                     (YBR162W-A); ancestral locus Anc_8.516"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687140.1"
                     /db_xref="GeneID:11534507"
                     /db_xref="UniProtKB/TrEMBL:G8BXS8"
                     /translation="MASNALKQKLGNEKFKKRNEHHRKLGKKKIELSKKKDQPPISKV
                     WIYILAFLIVGGGILEIISLLF"
     gene            <453623..>454846
                     /gene="TPHA0I02030"
                     /locus_tag="TPHA_0I02030"
                     /db_xref="GeneID:11534508"
     mRNA            <453623..>454846
                     /gene="TPHA0I02030"
                     /locus_tag="TPHA_0I02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687093.1"
                     /db_xref="GeneID:11534508"
     CDS             453623..454846
                     /gene="TPHA0I02030"
                     /locus_tag="TPHA_0I02030"
                     /inference="similar to DNA sequence:INSDC:YBR162C"
                     /note="similar to Saccharomyces cerevisiae TOS1 (YBR162C);
                     ancestral locus Anc_8.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687141.1"
                     /db_xref="GeneID:11534508"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:G8BXS9"
                     /translation="MIHRYLQILKNLLNYINLYCNLETRILAMFLYTLIAIYCSISFF
                     FDIHCLATDAIVYSNVGYSGSYMDVVSMDESSCQCSQTSTSFSGTFAPFNEELSVHFR
                     GPITLLQFGVYTPGGGSSYKKREEQDNEQGHEHRKREASAVLTSTVESQLPSSSSSSS
                     TGSSSSGTSSSWNQVAYFSPGSCSNVVFMNHKGDWSNCFGSALTYCASNGVDTASSAQ
                     ALDEVQVGSNNEFIIFSSTECSGNDCGCCRSSSVPYYHGFGGTSKMFVFEFKMPNDSG
                     SSTTENVDMPAIWLLNAKIPRTVQYGSSSCSCWSTGCGEFDIFEVLSSGSSALSNDIH
                     DGQGSDGTCSGGGGSSATFDRPTSNSMKAVVIFNEESGTINIVKVSDDTTFGGSIDAS
                     TVSGWLSTSGNSVSL"
     gene            complement(<455158..>456282)
                     /gene="TPHA0I02040"
                     /locus_tag="TPHA_0I02040"
                     /db_xref="GeneID:11532821"
     mRNA            complement(<455158..>456282)
                     /gene="TPHA0I02040"
                     /locus_tag="TPHA_0I02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687094.1"
                     /db_xref="GeneID:11532821"
     CDS             complement(455158..456282)
                     /gene="TPHA0I02040"
                     /locus_tag="TPHA_0I02040"
                     /inference="similar to DNA sequence:INSDC:YBR161W,YPL057C"
                     /note="similar to Saccharomyces cerevisiae CSH1 (YBR161W)
                     and SUR1 (YPL057C); ancestral locus Anc_8.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687142.1"
                     /db_xref="GeneID:11532821"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BXT0"
                     /translation="MKRELIYLFLVNFAFVVVTLYYTFDVLTLAVDDTVKDSFRDYEL
                     NPDNYRNLSNDELPSFLTPSMLNKPQLIPKIIHQTYKTNDIPEHWKEGQQRCKDLHPD
                     YEYILWTDAMAEDFIAENYSWFLETFKNYQYPIERADAIRYFILSHFGGVYIDLDDGC
                     QRKLDPLLTAPAFLRKTSPTGVSNDVMGSIPGHPFFLKVIESLKKYDRNWFVPYITIM
                     SSTGPLFISMVWKQYKRSSLYNKNLNSVVKILQPADYKMHKNSFFTIAKGSSWHAGDA
                     NFIKSLAVHILACVVAGFILAFSILYSEYLFYCWLCATNRKNNKFSRLQSRYNDIEQI
                     QIENSISSKNKFSLKRSLKKLSNLKIARKDSNLSYLPIAN"
     gene            457378..457450
                     /gene="TPHA0Itrna1T"
                     /locus_tag="TPHA_0Itrna1T"
                     /db_xref="GeneID:11532822"
     tRNA            457378..457450
                     /gene="TPHA0Itrna1T"
                     /locus_tag="TPHA_0Itrna1T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11532822"
     gene            complement(<458058..>458984)
                     /gene="TPHA0I02050"
                     /locus_tag="TPHA_0I02050"
                     /db_xref="GeneID:11534540"
     mRNA            complement(<458058..>458984)
                     /gene="TPHA0I02050"
                     /locus_tag="TPHA_0I02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687095.1"
                     /db_xref="GeneID:11534540"
     CDS             complement(458058..458984)
                     /gene="TPHA0I02050"
                     /locus_tag="TPHA_0I02050"
                     /inference="similar to DNA sequence:INSDC:YIR018W,YOL028C"
                     /note="similar to Saccharomyces cerevisiae YAP5 (YIR018W)
                     and YAP7 (YOL028C); ancestral locus Anc_7.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687143.1"
                     /db_xref="GeneID:11534540"
                     /db_xref="GOA:G8BXT1"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BXT1"
                     /translation="MDSVILKERLKPGRKSKKDGNSSVVLSEQEMKARKLLQNRKAQR
                     AFRERKTSRISELADEVGSLKKTIKEWEKKYAELNLKYEIALKEVDLWKSGISSLREK
                     AAAVTLPSITIPEVITPSATPDIVRNHTFKDANLTTIIDNFKPMKAVSLKRQMINNEK
                     LLDESMGDIQQERCVFADDPNNKDFICVCKSLKVPKGDYKHIPSTMPITSITTMKRKF
                     NADGERVKPPLYFNNGSYELDFNEIQDAKSKECCQKKVKGNEWSCEKNCTKLFDEDST
                     TNDDSCETKKTEIIRDIQSKAMTPTRTESRNS"
     gene            <459670..>460068
                     /gene="TPHA0I02060"
                     /locus_tag="TPHA_0I02060"
                     /db_xref="GeneID:11532823"
     mRNA            <459670..>460068
                     /gene="TPHA0I02060"
                     /locus_tag="TPHA_0I02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687096.1"
                     /db_xref="GeneID:11532823"
     CDS             459670..460068
                     /gene="TPHA0I02060"
                     /locus_tag="TPHA_0I02060"
                     /inference="similar to DNA sequence:INSDC:YIR015W"
                     /note="similar to Saccharomyces cerevisiae RPR2 (YIR015W);
                     ancestral locus Anc_7.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687144.1"
                     /db_xref="GeneID:11532823"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:G8BXT2"
                     /translation="MSAENAEIIATKPPKNASNKEQFQRINYLYQLSMHYKNANLDIS
                     RTYVNLLDTISKKTNTKISPNIKRSYCKKCKRLIDYKDPKMFKVVKSKNKKNDKFIIN
                     CKCGSKKTFPIGLNRDYKTYTEKEGNLLEI"
     gene            <460632..>461402
                     /gene="TPHA0I02070"
                     /locus_tag="TPHA_0I02070"
                     /db_xref="GeneID:11532903"
     mRNA            <460632..>461402
                     /gene="TPHA0I02070"
                     /locus_tag="TPHA_0I02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687097.1"
                     /db_xref="GeneID:11532903"
     CDS             460632..461402
                     /gene="TPHA0I02070"
                     /locus_tag="TPHA_0I02070"
                     /inference="similar to DNA sequence:INSDC:YOL038W"
                     /note="similar to Saccharomyces cerevisiae PRE6 (YOL038W);
                     ancestral locus Anc_7.120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687145.1"
                     /db_xref="GeneID:11532903"
                     /db_xref="GOA:G8BXT3"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8BXT3"
                     /translation="MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVL
                     GCERRSTLKLQDTRITPSKISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLED
                     PVSIEYLTRYIAGVQQRYTQSGGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWT
                     AQTIGRNSKTVREFLENNYNKDEPPKNKEECIKLTVKSLLEVVQTGAKNIEITVVRPN
                     NDIITLDNDEIDKYVQEIEQEKKQQQEEDKKKKKPSST"
     gene            <461761..>462291
                     /gene="TPHA0I02080"
                     /locus_tag="TPHA_0I02080"
                     /db_xref="GeneID:11532904"
     mRNA            <461761..>462291
                     /gene="TPHA0I02080"
                     /locus_tag="TPHA_0I02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687098.1"
                     /db_xref="GeneID:11532904"
     CDS             461761..462291
                     /gene="TPHA0I02080"
                     /locus_tag="TPHA_0I02080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687146.1"
                     /db_xref="GeneID:11532904"
                     /db_xref="UniProtKB/TrEMBL:G8BXT4"
                     /translation="MSVPGAIVEDSNNIFESHRIWQATYPNSNLTEVSLTERDSLFDN
                     DEFKLVDDFDLHYQHFMSDTTTSNGKSSTESTIRKRDRITLRLKEFKDKVIGNFRRIK
                     EDKTRKHSGIKNTTSQNMNIKNYKTDIDKYEDLFSDTDNMNVPIRTDAYQCPQDINML
                     QELSPKPMENVELLET"
     gene            complement(<462463..>462993)
                     /gene="TPHA0I02090"
                     /locus_tag="TPHA_0I02090"
                     /db_xref="GeneID:11534496"
     mRNA            complement(<462463..>462993)
                     /gene="TPHA0I02090"
                     /locus_tag="TPHA_0I02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687099.1"
                     /db_xref="GeneID:11534496"
     CDS             complement(462463..462993)
                     /gene="TPHA0I02090"
                     /locus_tag="TPHA_0I02090"
                     /inference="similar to DNA sequence:INSDC:YIR017C"
                     /note="similar to Saccharomyces cerevisiae MET28
                     (YIR017C); ancestral locus Anc_7.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687147.1"
                     /db_xref="GeneID:11534496"
                     /db_xref="GOA:G8BXT5"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8BXT5"
                     /translation="MSQLLNVKNSDISERLKDLIKNNSELGSQLLSLLIVSSENSKEI
                     IDAINNNSVQTKANLDEYSIPRSLTVSERDLEVDSEVVKSDDPVEYEKCQEELLLEKR
                     RKNIEASARFRQRKKLREQETKKKRDMLNRRVAELYSKIEDLTIENKYWREKIEKINE
                     QKSNELLNEIKLKNTN"
     gene            complement(<464168..>468394)
                     /gene="TPHA0I02100"
                     /locus_tag="TPHA_0I02100"
                     /db_xref="GeneID:11534497"
     mRNA            complement(<464168..>468394)
                     /gene="TPHA0I02100"
                     /locus_tag="TPHA_0I02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687100.1"
                     /db_xref="GeneID:11534497"
     CDS             complement(464168..468394)
                     /gene="TPHA0I02100"
                     /locus_tag="TPHA_0I02100"
                     /inference="similar to DNA sequence:INSDC:YER008C"
                     /note="similar to Saccharomyces cerevisiae SEC3 (YER008C);
                     ancestral locus Anc_7.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687148.1"
                     /db_xref="GeneID:11534497"
                     /db_xref="InterPro:IPR019160"
                     /db_xref="InterPro:IPR028258"
                     /db_xref="UniProtKB/TrEMBL:G8BXT6"
                     /translation="MVGPKSPFKRSSNNDSNHKRNNSTNSATHDGYTHSRNTSVGATP
                     PISNANNNTHKRNVSTSSTNSNFLAEQYDRDRRNIIHYCFSANTKNPNGQPNSYITHV
                     RIIEDAKFPSSKPVGPVKLDQKKKRCLILSSKAENKDLIQIHKARENPDGSFQIGRTW
                     DLKSLTRIEREPEVNEGFMLTIGKKYYWETNSSKERLVFIKSLVKIYLQAFEGHVPEL
                     VHWDLSLFYLDERSYERAVIHPKESELAIQQSTIATTTLTTTTTTTTTTTTTTTTTTT
                     TTTTTTTTTTTTTTTTTIQQQQLEQQQLEEHQQNNIYDRTFQGETASNRPSSNSTANM
                     VYDPVIPRSVDRTSNRSNLNSGYIADEVTHGSINNSKNRSMSPERNSLNKAPYSSSST
                     INQLNKQYLSPVRQQTTEYDNNVNGGAYANEEEDFNFQKIESRQVYNSELGTNEEEDY
                     EQLVKHDNMLDNLNAVLSDKQTIHSSLTDDDDEKETQPLTILSRNKSNAEIESDNVVD
                     LYGDNDENESNIYDDYNYKLDLNEDLNQTKEISMNGYQSSQISNESSARQSKYRITNG
                     PESTEFDDTYEDTNEDTNDISYEQGDEIRYSQMIDTESKNRLAENLAEEPEYINEQQA
                     DHQYHAVSTIQEEAPLVGNFSSMEDNELENKKRDSTKMFLTPLEVDDQALEEILMDVN
                     WELDDDTDNVLQKLDNQLSDTRYTFNNRLISLGKTDTTVKEYEEILSTECEKVQPIFS
                     LFLMEMNNLSSDIDYVECQANGLQVESANKKVLWKLLTELLNSVSLNENDLNELLSSP
                     ISERNLPRIELQLKGLYKAIVAIKGQTDNDMTTPFKSSDSTDLGKMQALAPRRKAYEK
                     VTTVFLQRVEKELIRKFESFHTDISSDDQLTNILNRILIFSSLTSFCKNISPESYDTI
                     IEQWNNNIKDVYLTRFNNIIKNLDDKLSDYQNELENSPLNHQQEESFLKQWKYYKKNN
                     KLTIDIPRTSIYMSNFIQAVNSIENLCIIYQNFVDDFFHISEFKDFDEYLQDHSDYNI
                     KTGSLKILKDVSSDRDSNLIRTNLVSKIFSPILSKFTNEIQRVFNLDKTIIPSILLFF
                     EIQIKKLESSNQDFLLTVLTRLSTTIKQLWSEFIDDRVIYYERVLVNINNSTENSITP
                     AILSMPIFIKNSSDLISFVFNELKTEHNIDTNIANYNVNEIVNTSFAKISMAVTEILS
                     RNSVHSNESQENVKADDISTDINKIIVLLLNSYWLGEMLPIVSLNLNNNVFEKPILKA
                     KQIFDYEKTMYAKFLLLQLMPKLTSFVNGATTIIANSQKNSNGNVMVNPSRWAVYSKQ
                     NLDNILSAYTSQEIRLLVKALHDEMLDKLISNDTDFGVSLCNKLWSSIQGETVSLYLK
                     LYTLVDKHYQGTSIQFSKNDLITAFDHYKE"
     gene            <468942..>469313
                     /gene="TPHA0I02110"
                     /locus_tag="TPHA_0I02110"
                     /db_xref="GeneID:11534487"
     mRNA            <468942..>469313
                     /gene="TPHA0I02110"
                     /locus_tag="TPHA_0I02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687101.1"
                     /db_xref="GeneID:11534487"
     CDS             468942..469313
                     /gene="TPHA0I02110"
                     /locus_tag="TPHA_0I02110"
                     /inference="similar to DNA sequence:INSDC:YER009W"
                     /note="similar to Saccharomyces cerevisiae NTF2 (YER009W);
                     ancestral locus Anc_7.155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687149.1"
                     /db_xref="GeneID:11534487"
                     /db_xref="GOA:G8BXT7"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:G8BXT7"
                     /translation="MDFNGLAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETTQLQG
                     TKNIVEKLTSLPFQKVTHRITTLDAQPASPSGDVLVMITGDLLIDEEQNAQRFSQVFH
                     LIPEGNSYYVFNDIFRLNYSA"
     gene            <469624..>472350
                     /gene="TPHA0I02120"
                     /locus_tag="TPHA_0I02120"
                     /db_xref="GeneID:11534488"
     mRNA            <469624..>472350
                     /gene="TPHA0I02120"
                     /locus_tag="TPHA_0I02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687102.1"
                     /db_xref="GeneID:11534488"
     CDS             469624..472350
                     /gene="TPHA0I02120"
                     /locus_tag="TPHA_0I02120"
                     /inference="similar to DNA sequence:INSDC:YOL063C"
                     /note="similar to Saccharomyces cerevisiae CRT10
                     (YOL063C); ancestral locus Anc_3.163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687150.1"
                     /db_xref="GeneID:11534488"
                     /db_xref="InterPro:IPR014839"
                     /db_xref="UniProtKB/TrEMBL:G8BXT8"
                     /translation="MNFDSDLFQKWLFTRRVKNVNCIGSPVSENGAGGREDIPNEIEE
                     LKKIYDVLYMKDVRDVKTEFSDLTVASAMEYQNNLANLSVSSNFKANNNELYDEFIKR
                     VKREKVNREPVLCKSRIQDPAMLLLPPNERLLVEDLENDISEMPGALDIINVYGNTFC
                     CYKNWCFTAIKGKISIHNIDELTDGKHISTTIDLNKFYQSNNFNELYSSLGMSRYAPM
                     KRNDELDLDIDMDIDNELNEHITFMKISKLMDIDVLCVTTELSHAFIISIQDILEQTN
                     INNKSNKLCNFSSDIKPENLNIWIFKVSESCWSIDIFDNLSDGMAFIAIGHNKPGITI
                     FSIPFEKLKRNYRPSVEYSKSRKINVQEILCGHNIPSLKFLPEQVDSNGNILLVFASI
                     FGNVATMKIKLDKDFNKIVCNIHDYQLFDEYCWNIINLKRTDFLKVSKFEFLTLNYQN
                     NYKKSIISSIYQDSTLFGLVPESVLVSDDLGIGTLTTQISVPLSNISHRRTDYIDSDI
                     KLRYTCFDDDNSIIEGTLKPEIALTYDPLSEYYDYNYDNSLTWDDKVKYSTRIQSLCH
                     YHPFMDYSKFDFGSNFNQTFEKWIISNEKLDDNNRNGNGKTESNYLLEYAFTFTDGNA
                     EANLGRSQKLKLCQEMIEDNKYENNKPSQLLYISNDWYESSDDENHIDITTRLPNELI
                     KNKNSQKEIQIDSHAKKVKKLLFELIDKEKSLISLRGYELKEYDDDFLLVTTKNKIYL
                     TKLHPLIITSFTTDDIFPISDMSFCEYKEIFQAIHGIKYVVHLKEVNAVAVASSAGLI
                     SILRLTEFKGLYSFRQEYIMGWEVQDPRTMDRTNFYCILETILRDGYSNRYYCMTDDL
                     HLPFRNILGMDYRYMPGNKIEDYEPYVILYVYYESYIHRFKISVNSESNIPI"
     gene            <472771..>474378
                     /gene="TPHA0I02130"
                     /locus_tag="TPHA_0I02130"
                     /db_xref="GeneID:11534489"
     mRNA            <472771..>474378
                     /gene="TPHA0I02130"
                     /locus_tag="TPHA_0I02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687103.1"
                     /db_xref="GeneID:11534489"
     CDS             472771..474378
                     /gene="TPHA0I02130"
                     /locus_tag="TPHA_0I02130"
                     /inference="similar to DNA sequence:INSDC:YIR003W"
                     /note="similar to Saccharomyces cerevisiae YIR003W;
                     ancestral locus Anc_7.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687151.1"
                     /db_xref="GeneID:11534489"
                     /db_xref="InterPro:IPR021582"
                     /db_xref="UniProtKB/TrEMBL:G8BXT9"
                     /translation="MSEDIPVVPKRPTRRQTASEIPIASQEENVDQEIARARAMGKSK
                     TEVDIIGTKQDVTLPNIPARRPIRTSTTQELNDLIDSTNEQLDEIQAIVQPNLQGQLA
                     TQVGAEEEEIKEEEVKEEGEPEEEIEAVETEESVTLEEPLVPKRPSKVRTEVKESDSN
                     GTEETVASVEGTIVSNELEKVTTEPEIGIENESNEEEPIVPKRPKKVASDSNGATAEA
                     LEKETASVEPEEPIIPKRPSKVEDNENANDAPTTENKTEEPTIPKRPVKVNNEVNENA
                     NEETPIVPSERPVQKKKSSAPPPPVPKKPSSRIAAFQKMIEEQQMQNIQSSSRGVATN
                     TSQENLNGQTTDPTTKTNNGTSSIGSKAQQLTGLFALPGMMPMGGIPDSLAKKLQPPS
                     STSEGVTASVVTSVTRRAKGPRGRKLPKAVASIEKINVDIHKNDIEIIPMWRFTFGEP
                     ADTATVTDTTPSPPPQPLEVDELNESDGPNVDNNDNGTETEIETDSIQDRDQLAPTES
                     LEKDLEEEIETQMQHEILDSEPASHEQ"
     gene            <475414..>476148
                     /gene="TPHA0I02140"
                     /locus_tag="TPHA_0I02140"
                     /db_xref="GeneID:11534471"
     mRNA            <475414..>476148
                     /gene="TPHA0I02140"
                     /locus_tag="TPHA_0I02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687104.1"
                     /db_xref="GeneID:11534471"
     CDS             475414..476148
                     /gene="TPHA0I02140"
                     /locus_tag="TPHA_0I02140"
                     /inference="similar to DNA sequence:INSDC:YER011W"
                     /note="similar to Saccharomyces cerevisiae TIR1 (YER011W);
                     ancestral locus Anc_7.161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687152.1"
                     /db_xref="GeneID:11534471"
                     /db_xref="GOA:G8BXU0"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8BXU0"
                     /translation="MAGIKYLLLSALISLVAADTNSAQLAEIQLLVNDITSNQQEYLS
                     LIANGQITLPADLLALYGVYATATDSAYTTLFTQINPTEVQSLVTQLPWYSSRLESGF
                     ESIQAAASGAVSGASSASAASSSASSSSSSSSSASAVSSAVSAASSRASSVSAAASSR
                     SSSVSSRLSSISAAVSSRLSSASAASSSETSSASSEASSASSSRASSASSSSSASSSA
                     SSTSNAGNAVGVSVGAGLAAVAAMLI"
     gene            complement(<476635..>477951)
                     /gene="TPHA0I02150"
                     /locus_tag="TPHA_0I02150"
                     /db_xref="GeneID:11534472"
     mRNA            complement(<476635..>477951)
                     /gene="TPHA0I02150"
                     /locus_tag="TPHA_0I02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687105.1"
                     /db_xref="GeneID:11534472"
     CDS             complement(476635..477951)
                     /gene="TPHA0I02150"
                     /locus_tag="TPHA_0I02150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687153.1"
                     /db_xref="GeneID:11534472"
                     /db_xref="GOA:G8BXU1"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8BXU1"
                     /translation="MKLSNIALLSAAAATASAYDHKSAAIVELEVYMTDIVNNMDQYL
                     AMQEANPGQAFPSEIMSAYIQIAIGNTISYTSFFSTIDESEVEFMMTGVSWYSARLAP
                     SVSAALLEAGIDTNDENVATTSSAVTPAASSTVASSTIVSSSAVASSSASSSSAVASS
                     TVSGDMTVSQVTVTETSTDSATVQETVTLCSSSPSSAEASSVAGHYAEASSVAGSSAR
                     ASSVAGFSSEASSAASSTSSSSAASSTSSSTSSSSAASSTSSSSAASSTSSSSAAAAS
                     ANEAGATVVTLTDLSTTLATITSCDDHACTEIVKNQTITSTIHRTVKETVVVPCETTS
                     TTNPGETTASPVTLYSTITDGATTTLITITSCEDNKCSEVVSTKAVNANADNKASATT
                     LAQVSSISSEGSGAHSSSPIVLENTNGAFKYGVSFGSIIVALVALL"
     gene            <479620..>480291
                     /gene="TPHA0I02160"
                     /locus_tag="TPHA_0I02160"
                     /db_xref="GeneID:11532846"
     mRNA            <479620..>480291
                     /gene="TPHA0I02160"
                     /locus_tag="TPHA_0I02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687106.1"
                     /db_xref="GeneID:11532846"
     CDS             479620..480291
                     /gene="TPHA0I02160"
                     /locus_tag="TPHA_0I02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687154.1"
                     /db_xref="GeneID:11532846"
                     /db_xref="GOA:G8BXU2"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8BXU2"
                     /translation="MQMSIAKFAALLAVAASASALTTEQQIQEMEILLTDVGANLNDY
                     VGLVGQMDIPDALFDIYGEMLTATDDSYTTLLAQLDMSQISTMMTALPWYSSRLLPLV
                     STFNDVAAAAATSSTAAAATTSSSVAAETTSSSVAAVTTSSSVAAATTSSSSAAETTS
                     TSAAAETTSSAAAAKTTVAAVSQITDGQIQATTGATINEQLENGAARNVAGLGAVAFA
                     AAMLL"
     gene            <481078..>485013
                     /gene="TPHA0I02170"
                     /locus_tag="TPHA_0I02170"
                     /db_xref="GeneID:11532847"
     mRNA            <481078..>485013
                     /gene="TPHA0I02170"
                     /locus_tag="TPHA_0I02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687107.1"
                     /db_xref="GeneID:11532847"
     CDS             481078..485013
                     /gene="TPHA0I02170"
                     /locus_tag="TPHA_0I02170"
                     /inference="similar to DNA sequence:INSDC:YIR006C"
                     /note="similar to Saccharomyces cerevisiae PAN1 (YIR006C);
                     ancestral locus Anc_7.160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687155.1"
                     /db_xref="GeneID:11532847"
                     /db_xref="GOA:G8BXU3"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR026812"
                     /db_xref="UniProtKB/TrEMBL:G8BXU3"
                     /translation="MFNSYKQGGMQPQGNSYFNPQQQQQQQQQQQLNNGAYNNFNSGS
                     QPQLQNQQSFDNNMFQQPQQPQQQSQFGNGLMSSGTPSNNYMQVPGVQQQASSMSSLQ
                     QQQLGGFSYNFQNQPMQQVTNPKMSQHFNQVGSTPLNLALSASQNENMNMGFNTPVQD
                     FQSQSQAPLQGQMTNATSATMPNGIQSMNQPQPLQPLQPQSTGMFQQPLQPQSTGMFQ
                     QPLQSQGTGMFQQPLQSQGTGMFQQSPMPTQPLQPQQTGFYVQQNAAPLEPLRPTATG
                     FVNSFANNGINNDLNIPAVRLSFITAQDQAKFETLFRSQVPKGSNTISGEKCRNILTK
                     SGLEPSKLARIWTLADTNKAGELLFPEFTLAMYLVNQVLKGDSIPYELSSKTKNEVEH
                     FIDVINSHIVNTNDKQSTPFDNLMGLSQNFQLQPQSTGMIPPTSFGMPMQVTGGTLQP
                     QSTGFMPQTSFGMPMQATGGALQPQLTGFMPHTSFGAPLQNQVTGGFTSNMGTRQIQP
                     QTTGSMVPGISQNTTGNFGAVGQPFLQSQPTGFLPPSNFQATLPLTAQKTGMGNNEIY
                     THSNFINNLNQPEQETITPEEKSLFYKIFETYDVQKKGLLDAPTAVEIFRKSGLNRSD
                     LEQIWNLCDINNSGQLNKQEFALGMHLVYNKLNGKVIPNSLPPSLVPSSNKILDNVKN
                     QLKTAPGASNKNSTSGINGLSYKNNDEENSLPSFRNRRKTFNAVTPAVEQNNAEAQTA
                     PTDQNSAKLPTANTSDDKATKLQHLIRERRSQLEIEISKSRQLLNQSSQSQQSDLRII
                     QSLQNKIRDIPAIVESINSDTPADINERIDMILTKLPVLFDQISEIENSISSAKISLY
                     NIQNPSVIVASGKNGEITEEDRKKAKSKALLKSRMASLTGKGADVSPSIEEEESRYNE
                     AISNIRAENVKNKNIISDIRRSISEIFSSMMSTVSGGTIGASPAQFERWEFGVGLESE
                     VTNFIKELKNKTQVNSTELNSSKEDTSYLQEQANKKMEQKLAELRLSQPGSNIQNFVK
                     DHSNMTISQNDTASPFNKSEEESDDEEEKRLQQELDSLKEQKKYEKEKKLAQLRQQLK
                     EERESENVNVSVDETPISAVSVPTYNSPQPIQDTLATHQQNISQQTAEPKKQYFKSEK
                     TESSQFDANAAEVQRRLQRGLDDDDDGWSDDENAAKAAAPVVPAPVAPTIPNQLNVEV
                     PVSIAPPPPSISTETSAPIPVAPPIPNQSNVEVPVAMIPPPPSISTEKSAPIPIAPPL
                     PQVSVSLPDVIAAPPPLPNINGGESAMDSDHDDVLSIPESVESNDANFE"
     gene            complement(<485471..>486259)
                     /gene="TPHA0I02180"
                     /locus_tag="TPHA_0I02180"
                     /db_xref="GeneID:11532848"
     mRNA            complement(<485471..>486259)
                     /gene="TPHA0I02180"
                     /locus_tag="TPHA_0I02180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687108.1"
                     /db_xref="GeneID:11532848"
     CDS             complement(485471..486259)
                     /gene="TPHA0I02180"
                     /locus_tag="TPHA_0I02180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687156.1"
                     /db_xref="GeneID:11532848"
                     /db_xref="UniProtKB/TrEMBL:G8BXU4"
                     /translation="MQFSKLSTILALSAATFARADDLTTTSTSVITVYETITKDATST
                     TFTTTTPVTTIVAASVEVLSVESSSSSSSTTVEPVTSSTTVEPVTSSTTVELTTSSTT
                     VEPTTSSTTVEPVTSSTVIESSSFTEATSFTSAYADLQAFGFYNSSSTYDNSTTSSYS
                     NETTTLTQLSTELATITSCSNNACDAKTTSASSSSSVESTTYVTETNIISTTLTTLQM
                     SHTSSSSAAAETSVASVLVAENAGFKLTAVSAGSLLTAIAALLL"
     gene            complement(<487838..>488509)
                     /gene="TPHA0I02190"
                     /locus_tag="TPHA_0I02190"
                     /db_xref="GeneID:11534626"
     mRNA            complement(<487838..>488509)
                     /gene="TPHA0I02190"
                     /locus_tag="TPHA_0I02190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687109.1"
                     /db_xref="GeneID:11534626"
     CDS             complement(487838..488509)
                     /gene="TPHA0I02190"
                     /locus_tag="TPHA_0I02190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687157.1"
                     /db_xref="GeneID:11534626"
                     /db_xref="GOA:G8BXU5"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8BXU5"
                     /translation="MQMSIAKFAALLAVAASASALTTEQQIQEMEILLTDVGANLNDY
                     VGLVGQMDIPDALFDIYGEMLTATDDSYTTLLAQLDMSQISTMMTALPWYSSRLLPLV
                     STFNDVAAAAATSSTAAAATTSSSVAAETTSSSVAAVTTSSSVAAATTSSSSAAETTS
                     TSAAAETTSSAAAAKTTVAAVSQITDGQIQATTTATIHVQTDNGATRNAAGLGAVAFA
                     AAMLL"
     gene            <490236..>491036
                     /gene="TPHA0I02200"
                     /locus_tag="TPHA_0I02200"
                     /db_xref="GeneID:11534627"
     mRNA            <490236..>491036
                     /gene="TPHA0I02200"
                     /locus_tag="TPHA_0I02200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687110.1"
                     /db_xref="GeneID:11534627"
     CDS             490236..491036
                     /gene="TPHA0I02200"
                     /locus_tag="TPHA_0I02200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687158.1"
                     /db_xref="GeneID:11534627"
                     /db_xref="GOA:G8BXU6"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8BXU6"
                     /translation="MKLSNIALLSAAAATASAYDHKSAAIVELEVYMTDIVNNMDQYL
                     AMQAANPGQAFPAEIMSAYVQMARGNTISYTSFFSTIDESEVEFLMTGVSWYSARLAP
                     SVSAALLEAGIDTNDENVAAATSQAATASQAAATSQTAATSQAAAAANTINSSNLVIS
                     SNLYSNYNSTVTANVTDISTTLATITSCDDGKCTEETTTVKVTDNGTILETVTSCGET
                     GCTASASIKVQSSATASTTPVVAENLNGSSKLNFGMGAILAAAIPMLL"
     gene            complement(<491382..>492128)
                     /gene="TPHA0I02210"
                     /locus_tag="TPHA_0I02210"
                     /db_xref="GeneID:11534683"
     mRNA            complement(<491382..>492128)
                     /gene="TPHA0I02210"
                     /locus_tag="TPHA_0I02210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687111.1"
                     /db_xref="GeneID:11534683"
     CDS             complement(491382..492128)
                     /gene="TPHA0I02210"
                     /locus_tag="TPHA_0I02210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687159.1"
                     /db_xref="GeneID:11534683"
                     /db_xref="GOA:G8BXU7"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:G8BXU7"
                     /translation="MPSFKQLAVLLAVAASNVAAYDIDSIDVIEFQACLDDVQNNLMD
                     YISYAENNANFVLPAGVLEVYTQMTTYKKDDDAYTSLFTQLDFSAIEDVMTQLPWYTT
                     RLAVVLASYFSSNGISTDSNGLPIHNAAATGAAASSSATASSSTVASSSTVASSSVAA
                     SSSAAASSSTSSSSSSSASHSSTSASSSSSASHSSTSASSSSSASHSSTSASSLSSAS
                     HSSTSTSANNAAALGAGVGAMVAGAAAMLL"
     gene            complement(493584..493656)
                     /gene="TPHA0Itrna2T"
                     /locus_tag="TPHA_0Itrna2T"
                     /db_xref="GeneID:11534684"
     tRNA            complement(493584..493656)
                     /gene="TPHA0Itrna2T"
                     /locus_tag="TPHA_0Itrna2T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11534684"
     gene            <496020..>499136
                     /gene="TPHA0I02220"
                     /locus_tag="TPHA_0I02220"
                     /db_xref="GeneID:11534674"
     mRNA            <496020..>499136
                     /gene="TPHA0I02220"
                     /locus_tag="TPHA_0I02220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687112.1"
                     /db_xref="GeneID:11534674"
     CDS             496020..499136
                     /gene="TPHA0I02220"
                     /locus_tag="TPHA_0I02220"
                     /inference="similar to DNA sequence:INSDC:YIR002C"
                     /note="similar to Saccharomyces cerevisiae MPH1 (YIR002C);
                     ancestral locus Anc_7.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687160.1"
                     /db_xref="GeneID:11534674"
                     /db_xref="GOA:G8BXU8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXU8"
                     /translation="MIDNEDQFSDFEDDEFDSLWQKNINKEVTTVVTKRAIPAQRNLY
                     GEVLPGQKTFYEEVQTSTVFKPTHHKLKSDQLGYYVYPTNFEVREYQYNIVKKALTEN
                     VLCAIPTGMGKTFIASTVMLNFFRWSETGKIIFTAPTRPLVAQQIKACLGITGIPYDH
                     SAILLDKSRKNREEIWKEKRVFFTTPQVVENDLKRGVLDPRDIICLIIDEAHRATGSY
                     AYCKLVQFIDRFNSSYRILALTATPGSEITNVQEVVNNLNISKIEIRTEESMDIAKYM
                     KKRYKEKIEVSLTTEIEDIIEQIGIAITPTLQQAVELGIYDDCPPSYINAFVALQKSQ
                     QIILNPSLPEGIKWRNYFILQLLNHVGQMMKRIKIYGVITFYKYFQNKHKEFTTKYSL
                     GKSTNKIAASFYYHPMIKTMMDACDKHVKNSNFVSHLKFQHIQEELHNFFIDGRSDSR
                     VIIFTELRDSALEIVKYIDNLNIKTIIPHIFIGQAKGKEGFDEVEYNKKHKPKGRKKA
                     ERLKQREEFVALEEEKKKKLEKESAERSARRTFSSEEAQLKGMTQKQQKEVISDFKKG
                     IYNVLVCTSIGEEGLDIGEVDLIICFDTTSSPIKNIQRMGRTGRKRDGKIVLLFASNE
                     SKKFEKAMESYYDLQKQIGQNFVLYKDSDRILPKDIEPECIKEFIQVGAENEEINNIN
                     DSDEVIRYATQCMNGKKPKKTKSSVYKKEKAASQKRFFMPDNVVTGIISANSLVRKVQ
                     VVKDPEIYIPSEHKPKEEFTLLDEIEDELFASQSPQKNDAYTNDVFLSDMPLNLVTSI
                     VSKYDIPKIEPSNFTAFKKQTMTINKLESNSLTDTHELMTIDNVESNKTEKMIENVSL
                     LSDDEEIKSIPKDSFVKVNALELDNKSIERSASKLKDSRMDSTLFKNKFRSSDGLLTK
                     IEKLYFSDNYSPKYTVSIDTIPNLKITTERNYVAHNTHVQKILNIFKKMNENDTQTQI
                     DINRSKCIARGIMGGNINLIDETDCNSSIISNSDISFNMRTSDDSTKLSSTQNEKLNE
                     LLDSDSDF"
     gene            <499559..>500213
                     /gene="TPHA0I02230"
                     /locus_tag="TPHA_0I02230"
                     /db_xref="GeneID:11534638"
     mRNA            join(<499559..499569,499679..>500213)
                     /gene="TPHA0I02230"
                     /locus_tag="TPHA_0I02230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687113.1"
                     /db_xref="GeneID:11534638"
     CDS             join(499559..499569,499679..500213)
                     /gene="TPHA0I02230"
                     /locus_tag="TPHA_0I02230"
                     /inference="similar to DNA sequence:INSDC:YER007C-A"
                     /note="similar to Saccharomyces cerevisiae TMA20
                     (YER007C-A); ancestral locus Anc_7.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687161.1"
                     /db_xref="GeneID:11534638"
                     /db_xref="GOA:G8BXU9"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016437"
                     /db_xref="UniProtKB/TrEMBL:G8BXU9"
                     /translation="MFRKFTKEDIHSRSKVKSSVQRNLKSKLVSQFPQLEEVIDELIQ
                     KKSQIELIKCEDKIQLYTVDGEVYFFQQFDELIPTLKLIHKYPQAFPTIQVDRGAIKF
                     VLSGANIMCPGLTSPGARLPETPGYEKDSIIIINAENKEHALAVGKLLMSTDDIASIN
                     KGHGVEMIHHLGDPLWNFNID"
     gene            complement(<500290..>501795)
                     /gene="TPHA0I02240"
                     /locus_tag="TPHA_0I02240"
                     /db_xref="GeneID:11534639"
     mRNA            complement(<500290..>501795)
                     /gene="TPHA0I02240"
                     /locus_tag="TPHA_0I02240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687114.1"
                     /db_xref="GeneID:11534639"
     CDS             complement(500290..501795)
                     /gene="TPHA0I02240"
                     /locus_tag="TPHA_0I02240"
                     /inference="similar to DNA sequence:INSDC:YER007W"
                     /note="similar to Saccharomyces cerevisiae PAC2 (YER007W);
                     ancestral locus Anc_7.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687162.1"
                     /db_xref="GeneID:11534639"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BXV0"
                     /translation="MFKVGERLSINNELCTIKYIGEIKNWPGEETYGLEWDNTSRGKH
                     SGTIDGIEYFSVRIPGSASFMRGTKLLREHQPPRTFDQALRVKYGDDLNDIGELKFGS
                     KTVIGYGFESLTEKNKLFSKLQFVSLRKLQISDQTLTEKDLQIIEYHCSSIISLDISF
                     NLITDISFTIKLLHRLKNLDSINISGNKLNKGWENISNITLNKVKHVTMQNCEIKSEN
                     LTNIFRSFPNLIKLDISNNPLNEFKLNNVIFPQSLEELHLSGCLLTDIPLSLCKTNIK
                     ILNISNNLIKSFNDTLLPSVFHLNISDNGLIEWDLIDMINVKFNNLTSLNIQRNPIFK
                     ANPENFQDFYQLIARFDNLTALDGSDFDLLTRKEAELFFISKVSSGEILINENLQRYK
                     TLVKLYNCSKREKSDSISWLSDQIMELRLTFENSSHFDTRVTTLANCSIRYLKSVICS
                     KHKLNVLETELYLISDLGSMENLHREFVQLSDYGIRNNDIIHVGTRELDFS"
     gene            complement(<502096..>503652)
                     /gene="TPHA0I02250"
                     /locus_tag="TPHA_0I02250"
                     /db_xref="GeneID:11534349"
     mRNA            complement(<502096..>503652)
                     /gene="TPHA0I02250"
                     /locus_tag="TPHA_0I02250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687115.1"
                     /db_xref="GeneID:11534349"
     CDS             complement(502096..503652)
                     /gene="TPHA0I02250"
                     /locus_tag="TPHA_0I02250"
                     /inference="similar to DNA sequence:INSDC:YER006W"
                     /note="similar to Saccharomyces cerevisiae NUG1 (YER006W);
                     ancestral locus Anc_7.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687163.1"
                     /db_xref="GeneID:11534349"
                     /db_xref="GOA:G8BXV1"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXV1"
                     /translation="MRVRKKQSKRTSTRMKEGIKKKAAAQNRKERKLAKKDVTWKSRG
                     KKDPGIPANFPYKNKIIEEIEAKKMKDLEEKELAKQQRLEAKKLALEQGETIMEDGME
                     EDDGQNGLAALVASAQEAASKYDGHSNFDEPEEELDVVDYNIDFYNDNDEGNTELEKS
                     RKAYDKIFKTVVDASDVILYVLDARDPEGTRSRRVEQAVLQSQGKRLILILNKVDLIP
                     PHVLEQWLNVLKSSFPTIPLRAASGATNATSFNKKLTQTATASALMEALKKYSNNSNL
                     KRSIVVGVIGYPNVGKSSVINALTSRRGGSSKACPVGDQAGVTTALREVKVDNKLKIL
                     DSPGICFPTDNKRKTRKEQEAELALLNAIPAKHIIDPYPAVLMLIKRLSKSDEMTDSF
                     KKFYELPALPSNDPDTFTKHFLIHVARMRGRLSKGGIPNLESAGISVLSDWRDGKFYG
                     WVLPKASKDSMATGTISTISSGATQEPAKSEQTTIVSDWSKEFDLDGLFASLDNAISS
                     SKENEDSLME"
     gene            complement(<504104..>504721)
                     /gene="TPHA0I02260"
                     /locus_tag="TPHA_0I02260"
                     /db_xref="GeneID:11534350"
     mRNA            complement(<504104..>504721)
                     /gene="TPHA0I02260"
                     /locus_tag="TPHA_0I02260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687116.1"
                     /db_xref="GeneID:11534350"
     CDS             complement(504104..504721)
                     /gene="TPHA0I02260"
                     /locus_tag="TPHA_0I02260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687164.1"
                     /db_xref="GeneID:11534350"
                     /db_xref="GOA:G8BXV2"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="UniProtKB/TrEMBL:G8BXV2"
                     /translation="MEHQLVEIEEFNLISKLSLIKSLDKVHFHGFCVINESVLIESDV
                     KLKPSYNRSQGNRLIYTISFGYMCYLDRGCIITPPIIGYELIANNVTKKRVPLCSPMK
                     FQSYIYIGKSSLINCIEIGSYVLIYNNVTLGRGSKIGNCVVIDEQVTIPDKTIIPSYS
                     FVFKTLKKAGEGFKIVTLPIGIKNKIKEQFKRRYLGLPITISDII"
     gene            complement(<505077..>505781)
                     /gene="TPHA0I02270"
                     /locus_tag="TPHA_0I02270"
                     /db_xref="GeneID:11534351"
     mRNA            complement(<505077..>505781)
                     /gene="TPHA0I02270"
                     /locus_tag="TPHA_0I02270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687117.1"
                     /db_xref="GeneID:11534351"
     CDS             complement(505077..505781)
                     /gene="TPHA0I02270"
                     /locus_tag="TPHA_0I02270"
                     /inference="similar to DNA sequence:INSDC:YER002W"
                     /note="similar to Saccharomyces cerevisiae NOP16
                     (YER002W); ancestral locus Anc_7.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687165.1"
                     /db_xref="GeneID:11534351"
                     /db_xref="InterPro:IPR019002"
                     /db_xref="UniProtKB/TrEMBL:G8BXV3"
                     /translation="MTSVRKRKMNRSSIGKATRRTKDKKKQINIRSNAIIAENWDYSL
                     TLAQNYKKLGLRAKLQTPAGGNEADFTKIIKKQPLQSNYFKDDDEEEEEEEDENDQDE
                     LNSDGYYDENKILEGEARIQRDEDGNILKIVYGKMKKFDEDENVAQLKVRLEKSEPEK
                     TEVVKLLEEYANRPENVRERLQSSREEEWLERLYNKHGDDYRKMFYDTKLNIYQQSQG
                     DLRRRIEKWKKVHNIK"
     gene            <506869..>507537
                     /gene="TPHA0I02280"
                     /locus_tag="TPHA_0I02280"
                     /db_xref="GeneID:11534498"
     mRNA            <506869..>507537
                     /gene="TPHA0I02280"
                     /locus_tag="TPHA_0I02280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687118.1"
                     /db_xref="GeneID:11534498"
     CDS             506869..507537
                     /gene="TPHA0I02280"
                     /locus_tag="TPHA_0I02280"
                     /inference="similar to DNA sequence:INSDC:YEL001C"
                     /note="similar to Saccharomyces cerevisiae YEL001C;
                     ancestral locus Anc_7.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687166.1"
                     /db_xref="GeneID:11534498"
                     /db_xref="UniProtKB/TrEMBL:G8BXV4"
                     /translation="MQFFFLLWLAIINNIFVRAETANSTDFDNEISDDVSSNGREFIN
                     LNVTYTILEKPNANFTELLEFAPEQGLTLKYNLYNGEDSSVNIVGVSGNVYTYPDGYF
                     AANITESAVDTIVVAFNETTTFQQGVRLALEEGRYFVEPIVIVEKDEQVLRVAVQPVM
                     VEIVPLPLSFFNLEFLSILVALFAIIAGTYYFFIGKSTKVSKSKNAKPIKVDESWLPD
                     NYKN"
     gene            complement(<507646..>509232)
                     /gene="TPHA0I02290"
                     /locus_tag="TPHA_0I02290"
                     /db_xref="GeneID:11534499"
     mRNA            complement(<507646..>509232)
                     /gene="TPHA0I02290"
                     /locus_tag="TPHA_0I02290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687119.1"
                     /db_xref="GeneID:11534499"
     CDS             complement(507646..509232)
                     /gene="TPHA0I02290"
                     /locus_tag="TPHA_0I02290"
                     /inference="similar to DNA sequence:INSDC:YIL001W"
                     /note="similar to Saccharomyces cerevisiae YIL001W;
                     ancestral locus Anc_7.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687167.1"
                     /db_xref="GeneID:11534499"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8BXV5"
                     /translation="MSDNKKDFEKLCFACRTGDVDIIESLISNGVNLNSVDKFDNSPL
                     FLASLCGHESVVTLLLQRGAVCDRDRYEGARCIYGALTDRIRDILLAYDVSKAVDVVQ
                     PFATHISSLLREPIVPTSDLAVFFEGSDAAYNLHKFIIQANCSVMVTDFHIESLTDKL
                     ILNNFPIKNENEVMKMEDRLLSLIIKFIYLVPILYEIKPLDYSILRKYADHFKLDILS
                     QFIDQIYHVADPSTKSALMIEFQTRITETSRANFNDFLNRYILQSYKEYSTEDTINHE
                     DIHNVISSNCGFPDTIIKVMDFHSKVRFYPCHIAMISRCHYFEMMFALPMSENNQYYF
                     KTKLNFQDNKTMPILAFPQCNFDVFETIIKYFYCDDANIPWSCALDTLKVADFLMDDR
                     LKSMAAVSVTQSEEILKIHSIYDILYTAWNARIERLEHYVAKIFADNLNYYHSMPEFY
                     DAILMSSNRISERQDTDTIELVDDIRYYLLEKYSFEPDDIEFFEEETDVALLKSSGIL
                     EYKNDIRLIEKVLEKLKLNA"
     gene            <510505..>511800
                     /gene="TPHA0I02300"
                     /locus_tag="TPHA_0I02300"
                     /db_xref="GeneID:11534362"
     mRNA            <510505..>511800
                     /gene="TPHA0I02300"
                     /locus_tag="TPHA_0I02300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687120.1"
                     /db_xref="GeneID:11534362"
     CDS             510505..511800
                     /gene="TPHA0I02300"
                     /locus_tag="TPHA_0I02300"
                     /inference="similar to DNA sequence:INSDC:YEL002C"
                     /note="similar to Saccharomyces cerevisiae WBP1 (YEL002C);
                     ancestral locus Anc_7.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687168.1"
                     /db_xref="GeneID:11534362"
                     /db_xref="GOA:G8BXV6"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="UniProtKB/TrEMBL:G8BXV6"
                     /translation="MLHVFLLLLSLCSFIQAASVRSSKTLVLYDERITELKKYFKYFE
                     SLNSRSYEIDYLKIKNSTSSVDLFENEYNTYDNLIIFPIKGKHLNKLVPVKSLLKFYE
                     NGGDILAITSPDAVVDSVRLFLNELGIYPSPKDYRLVDYSSKSSTDIEISTNELQSKV
                     VFSTTEDKLLRFGNAGAALLDNREQIVPILRAPRGSVTVSTSEKKKNDEPWTVGSQGY
                     LASGFQSLINARATWVGSQDLFNDKNSKENNDFVQEVSKWTFREKAIIKSFGFNHKHA
                     DGTTYARTPYKVKDDVVYEIGLAEWKGDKWEPYMADDIQFELRLVDPYYRLTLTPSYI
                     KKGVQYYTTGEFKLPDHHGVYTFITEYKRNGISFISESDVKAIRHLANDEFARSFEIS
                     NAWVYITSIYGVIISWVLFIFLFVIISIQKKVTVEKKKN"
     gene            complement(<512055..>512510)
                     /gene="TPHA0I02310"
                     /locus_tag="TPHA_0I02310"
                     /db_xref="GeneID:11534363"
     mRNA            complement(join(<512055..512371,512495..>512510))
                     /gene="TPHA0I02310"
                     /locus_tag="TPHA_0I02310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687121.1"
                     /db_xref="GeneID:11534363"
     CDS             complement(join(512055..512371,512495..512510))
                     /gene="TPHA0I02310"
                     /locus_tag="TPHA_0I02310"
                     /inference="similar to DNA sequence:INSDC:YEL003W"
                     /note="similar to Saccharomyces cerevisiae GIM4 (YEL003W);
                     ancestral locus Anc_7.139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687169.1"
                     /db_xref="GeneID:11534363"
                     /db_xref="GOA:G8BXV7"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:G8BXV7"
                     /translation="MNQNNSFQVKYNDYKLTLEQLQSKVIELTHEKDEHEIVLSTLND
                     TDSERKCYRMVGGALVESDVKTTIPVLTSKKENLTKTIDNMKKTLITTAEEFEKWKKD
                     NKIQVVRS"
     gene            <512963..>514018
                     /gene="TPHA0I02320"
                     /locus_tag="TPHA_0I02320"
                     /db_xref="GeneID:11534364"
     mRNA            <512963..>514018
                     /gene="TPHA0I02320"
                     /locus_tag="TPHA_0I02320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687122.1"
                     /db_xref="GeneID:11534364"
     CDS             512963..514018
                     /gene="TPHA0I02320"
                     /locus_tag="TPHA_0I02320"
                     /inference="similar to DNA sequence:INSDC:YEL005C"
                     /note="similar to Saccharomyces cerevisiae VAB2 (YEL005C);
                     ancestral locus Anc_7.137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687170.1"
                     /db_xref="GeneID:11534364"
                     /db_xref="UniProtKB/TrEMBL:G8BXV8"
                     /translation="MKAIESSIPYKELKSIPQINLSKRLKLNNIFSEVAPEIKNVQND
                     IISIHSIIQKDIEMESNQINTVESQLKESLKKIRSLYRRTNEHRSCSDDATFKPNKFF
                     QKVENLEKTVDSLDSDIHKIIENLLNIDLKLSTKSKTLTKDSINNQHYPLLFEIIEKN
                     YAQHLELSGISSMLHLGEANSVVQNNELRLAQEETIDDSKLTKLKLEDVEPTFSLQSN
                     EIDNDKSNSIHLDLSKNHNKNGSDGVDDRNSSHEDMDKKNSSSSVHALKYTTYIDRKN
                     HENDVEHTSINDHKNNEISKQVSDKIGSLILEHQDRTFTKTNAIKNNQNLFIPHGLKN
                     AKPSTAVTFETVEHLKF"
     gene            complement(<514126..>516159)
                     /gene="TPHA0I02340"
                     /locus_tag="TPHA_0I02340"
                     /db_xref="GeneID:11532875"
     mRNA            complement(<514126..>516159)
                     /gene="TPHA0I02340"
                     /locus_tag="TPHA_0I02340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687123.1"
                     /db_xref="GeneID:11532875"
     CDS             complement(514126..516159)
                     /gene="TPHA0I02340"
                     /locus_tag="TPHA_0I02340"
                     /inference="similar to DNA sequence:INSDC:YIL005W"
                     /note="similar to Saccharomyces cerevisiae EPS1 (YIL005W);
                     ancestral locus Anc_7.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687171.1"
                     /db_xref="GeneID:11532875"
                     /db_xref="GOA:G8BXV9"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8BXV9"
                     /translation="MHFPFLDSLLNILLVLILFFTKSSFVKADEIQVPEPLTTNNYKK
                     ELSKGLHIVDFYSPYCSHCKALEPIWNDAYREFYEESQKLNIHFSKVNCIESGDICDM
                     EQITFFPNIRLYGPSGFIKNYPNEAKRSKESLIQFARESAANKDNFKKTKVKSSSKNI
                     SGKELEGLIENMNSKEEGILVSFWPSKNMNKSDQETVFEGCESCLTFQRTWSAVSKFA
                     PNKNVEVYHVNCEAYKSFCAKYGFKHLTERSFSEKDPGVAFILPNNHMKRFWKYCKPL
                     SFEPSTYIDWATRLISNSKVPEISIEDILKKENTNVITSLLSNNLETFNTRVTYVKDR
                     NNLALSKESMESISSLDVELLQTNYEFLDNIEEIFAPVEKMINYNETEGLKKFDRNYI
                     NLIKNINLPAYMIWKEGNFIPAIVSADIACSESCLLDLLLKKLDQLRYSTYSKLPKTT
                     KEMKKLFSNRHNRYVVLQVIDNNEENESIKFLGNLSVAACDYFYTYSNYIVDQLMLTD
                     NHIKSLFEKMSTKIELSINEKNDLKSSFDKIEKQDIDFMFVDIKEDLTFKDRLKLPER
                     PEGYIDGDIIIIDKKRRIFYTKNALGNNLNSLSKYDLKESLLTLTLPSYSHSKIALDS
                     RMPLNAFHPVICIVGVFLLFFLYKFRRSITKIHLGKKKQEGIILGNFKGTLKD"
     gene            complement(<516709..>519075)
                     /gene="TPHA0I02350"
                     /locus_tag="TPHA_0I02350"
                     /db_xref="GeneID:11532876"
     mRNA            complement(<516709..>519075)
                     /gene="TPHA0I02350"
                     /locus_tag="TPHA_0I02350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687124.1"
                     /db_xref="GeneID:11532876"
     CDS             complement(516709..519075)
                     /gene="TPHA0I02350"
                     /locus_tag="TPHA_0I02350"
                     /inference="similar to DNA sequence:INSDC:YEL007W"
                     /note="similar to Saccharomyces cerevisiae YEL007W;
                     ancestral locus Anc_7.132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687172.1"
                     /db_xref="GeneID:11532876"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:G8BXW0"
                     /translation="MNIQPSYQGYIENEQDALLILQAVIDGFLVHVPRRLYDIERPYL
                     IISGNIFIFIEEISGIKRWTDGITWSPSRISTKFLVYREYYRASNNNNNNNNNTINNN
                     NIDLFSSSSSSSSSSSASSSLSNKIKNRHPSRSLNDLEINSKNSSETNSNAVKRYIIY
                     TGFVKKTISVKFNNQTFHIVSYYNVDDINNKKFIPLKKDIFFKYINPSKQLITAINNI
                     KLTFTPNTNNSNSSNNNNSRSSRSSRSDNASVSMGGTSSSSKNEDHNKNDISNSTKAK
                     KENKSNKQKKTGSNELPKSSYLNSSYSSSLSSSSASVSNSPSPPESPSKQQYGKRRNR
                     KSRRKNKSSTNSSRSSTDINTNINGNSISSQGTISGVSTASASTESSSASTSSVPFLT
                     SPSYKTLNMFDNNKKYKSNYNNSITKLNENTQVSTPASSINNKNSQLAGMTGKFYNLS
                     ANSANSSSNTINLTKFDMDSLVDDYKTKNLNKNLNAFQHSKTLNEYNNMMMSSYNNEL
                     NNGKWTNQNSQNNNNNMLRNQVNNEGTNAYISDDIQTRQQMQLPQTISTDQLFNQMNQ
                     NSVNNNFTQIPIAMNNYQNINQVDPINQKGIPYDNSNNIQYAPTVDPNFPISQNVNSI
                     GALPLYHQPGTQSQGNFYPQNSIPMAYPLISQPNNHARYQQLSNNPDIGTPLGPVYQI
                     TRENLNTNNINMMNYDNKLKSANSMSNGNSTNFQPYLNQQFSTVTSESISSLQNQIGK
                     NPDPVMSLNKNSNFSIGSEYNENFMTRNDITSNSISTEEAAKSSSSDN"
     gene            <521773..>522585
                     /gene="TPHA0I02360"
                     /locus_tag="TPHA_0I02360"
                     /db_xref="GeneID:11532873"
     mRNA            <521773..>522585
                     /gene="TPHA0I02360"
                     /locus_tag="TPHA_0I02360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687125.1"
                     /db_xref="GeneID:11532873"
     CDS             521773..522585
                     /gene="TPHA0I02360"
                     /locus_tag="TPHA_0I02360"
                     /inference="similar to DNA sequence:INSDC:YIL007C"
                     /note="similar to Saccharomyces cerevisiae NAS2 (YIL007C);
                     ancestral locus Anc_7.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687173.1"
                     /db_xref="GeneID:11532873"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:G8BXW1"
                     /translation="MWFYFLYFSTVWNLIYAFFFCFCSVRVSVWQKKLVLENYFSTAL
                     SKRENQNIHIIMSLSSEISRKFEIDKTITAQLAAIDKLSIDNLIELKKQIEFQLDGHI
                     GQLEILENDGNSTNGTGNYLVDGFPRSDLDLISIRFVRRNIIMLKNDLEKLINILYEK
                     LNNNSKLSSNKPIPQQLKSFILFSGIVKGSPSEKSGLKENDKLITINQLNYKNYKNLN
                     DIKLILQSNLNKNVHLKILRESSGKYHDLILMPTDKWNGQGILGCRITEIST"
     gene            525776..525849
                     /gene="TPHA0Itrna3V"
                     /locus_tag="TPHA_0Itrna3V"
                     /db_xref="GeneID:11532874"
     tRNA            525776..525849
                     /gene="TPHA0Itrna3V"
                     /locus_tag="TPHA_0Itrna3V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11532874"
     gene            complement(<526030..>527571)
                     /gene="TPHA0I02370"
                     /locus_tag="TPHA_0I02370"
                     /db_xref="GeneID:11534525"
     mRNA            complement(<526030..>527571)
                     /gene="TPHA0I02370"
                     /locus_tag="TPHA_0I02370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687126.1"
                     /db_xref="GeneID:11534525"
     CDS             complement(526030..527571)
                     /gene="TPHA0I02370"
                     /locus_tag="TPHA_0I02370"
                     /inference="similar to DNA sequence:INSDC:YHL017W,YKL039W"
                     /note="similar to Saccharomyces cerevisiae YHL017W and
                     PTM1 (YKL039W); ancestral locus Anc_2.552"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687174.1"
                     /db_xref="GeneID:11534525"
                     /db_xref="GOA:G8BXW2"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="UniProtKB/TrEMBL:G8BXW2"
                     /translation="MMLLLYFFTLINFLIAFTNANKIKLSDNSYRVCSGMYSKEDYGG
                     KVDPFISFNLKEISDLAAGDPGLVVAIFDFQDYEHLGVRLPDGEYYYICDDYAIDMKL
                     CNATNKNQFIIQDVVYDPYTSKNRTIVHQIMNFSQSSLGLHETKYPITKTGYYCVTAF
                     TYSSTTKFNAVVNFRNAFGHLPAAEINKLPLYGLLGVCYVIAMSLYSFSFWKHKHEIL
                     PLQRYLLAFFFFLTLESIFTWAYYDIKNEKGLTAGVTVYMVFLSILTAGKVTFSFFLL
                     LIVGLGYGIVFPKLNKTLMRRCQLFAALTFSLTTANFIQNYLSDPESTSPLILITFIP
                     MGLSFFVFYYMVLRSMSNTIGYLKEQRQVVKLNMYKKLIAIIYASLMLVLVGTAFSSF
                     FFIGHNTIDMIEQHWRTKFFYTDFWPTLVYFGVFVTLAFIWRPTSTSYMLASSQQLPT
                     DPSNVADFDLDDLQSLGEVIESPRNNGNPDDLDLDFTDDEEQNDHTKTNSAEHQTTDG
                     ITSPK"
     gene            complement(<528328..>528654)
                     /gene="TPHA0I02380"
                     /locus_tag="TPHA_0I02380"
                     /db_xref="GeneID:11532912"
     mRNA            complement(<528328..>528654)
                     /gene="TPHA0I02380"
                     /locus_tag="TPHA_0I02380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687127.1"
                     /db_xref="GeneID:11532912"
     CDS             complement(528328..528654)
                     /gene="TPHA0I02380"
                     /locus_tag="TPHA_0I02380"
                     /inference="similar to DNA sequence:INSDC:YHL018W"
                     /note="similar to Saccharomyces cerevisiae YHL018W;
                     ancestral locus Anc_2.554"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687175.1"
                     /db_xref="GeneID:11532912"
                     /db_xref="GOA:G8BXW3"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:G8BXW3"
                     /translation="MYNKILKVKPSLLSKTELAEKLLELPKWRAHEGHLIRQTIEVKD
                     FEICHSLFNNIAMRSHLWGHHPRITMNYNKLDLTLTTHDIGTQISDIDIKLAKRIDTY
                     VERYSK"
     gene            <528997..>530676
                     /gene="TPHA0I02390"
                     /locus_tag="TPHA_0I02390"
                     /db_xref="GeneID:11532913"
     mRNA            <528997..>530676
                     /gene="TPHA0I02390"
                     /locus_tag="TPHA_0I02390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687128.1"
                     /db_xref="GeneID:11532913"
     CDS             528997..530676
                     /gene="TPHA0I02390"
                     /locus_tag="TPHA_0I02390"
                     /inference="similar to DNA sequence:INSDC:YHL019C"
                     /note="similar to Saccharomyces cerevisiae APM2 (YHL019C);
                     ancestral locus Anc_2.555"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687176.1"
                     /db_xref="GeneID:11532913"
                     /db_xref="GOA:G8BXW4"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR027200"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8BXW4"
                     /translation="MSSCLFILDELLEPLISKNTKPVRNLPDIIKSFKESWTPTSPPI
                     ITVSNWHYVYVKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKL
                     LIIDNALLVTELMDESIDFGIIQMTDPSIIRDYIRVKINNSIATGNNSNDDSDDSDTE
                     SASSKKNAKSLGSYMPSANNLTNLWKGYSTKDETLNENVNNDNFENNDDETYINSHIA
                     RTTTMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGM
                     PTLRIALNKILQDDKQFLGHAKFHQCVSLNSINIKDLEKDLEGPNDISNKNFVNKKEI
                     EFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQISLKIETHFKRQNST
                     SLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKGGHGENEK
                     GMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTALKMKT
                     QYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAFIV"
     gene            complement(<530860..>531540)
                     /gene="TPHA0I02400"
                     /locus_tag="TPHA_0I02400"
                     /db_xref="GeneID:11534697"
     mRNA            complement(<530860..>531540)
                     /gene="TPHA0I02400"
                     /locus_tag="TPHA_0I02400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687129.1"
                     /db_xref="GeneID:11534697"
     CDS             complement(530860..531540)
                     /gene="TPHA0I02400"
                     /locus_tag="TPHA_0I02400"
                     /inference="similar to DNA sequence:INSDC:YKL041W"
                     /note="similar to Saccharomyces cerevisiae VPS24
                     (YKL041W); ancestral locus Anc_2.558"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687177.1"
                     /db_xref="GeneID:11534697"
                     /db_xref="GOA:G8BXW5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8BXW5"
                     /translation="MDYLKKAIWGPDQKEQQRIIKGILRKNNRCIDKSLRELSALQAK
                     TQQIIKRSAKKNDIRAVKIYAKELYQINKQYNRMYTSKAQLESVGMKIEEAFKMNMIS
                     TQMAQSTGLMMEVNQLVRLPQLQGTMIELEKELMKSGLISEMIDDTMELVGEGEEELD
                     DEVNEEVNKIVEQYTNEIFEKVQDTSGTTFKIPESQKDSEVPEDQIDGEADNMIKEMR
                     ERIKALQS"
     gene            531876..531947
                     /gene="TPHA0Itrna2E"
                     /locus_tag="TPHA_0Itrna2E"
                     /db_xref="GeneID:11534698"
     tRNA            531876..531947
                     /gene="TPHA0Itrna2E"
                     /locus_tag="TPHA_0Itrna2E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11534698"
     gene            complement(<532158..>533753)
                     /gene="TPHA0I02410"
                     /locus_tag="TPHA_0I02410"
                     /db_xref="GeneID:11534671"
     mRNA            complement(<532158..>533753)
                     /gene="TPHA0I02410"
                     /locus_tag="TPHA_0I02410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687130.1"
                     /db_xref="GeneID:11534671"
     CDS             complement(532158..533753)
                     /gene="TPHA0I02410"
                     /locus_tag="TPHA_0I02410"
                     /inference="similar to DNA sequence:INSDC:YMR013C"
                     /note="similar to Saccharomyces cerevisiae SEC59
                     (YMR013C); ancestral locus Anc_2.560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687178.1"
                     /db_xref="GeneID:11534671"
                     /db_xref="GOA:G8BXW6"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR026566"
                     /db_xref="UniProtKB/TrEMBL:G8BXW6"
                     /translation="MTSYTVTKSNRSQNPEVSIIELKSSLINEDISRIGLGTNDKVNR
                     AFSMFKGSNLIIQFLTLCITVYIAYRNPHILLLNSELLIAFMTVLFVCLITILLTFNK
                     TELKFDMIYLIYLSLLVSVVFYNHSIINIEASISNVIINLVLTTNIMESLYVVKLLIQ
                     SLLFILINSFENYNDINSNNKFTQLLGASVTNFVFSKALAKIGGLRSLDIVDCNIFSL
                     LLTNVLYLNRIHEDSTIPFMVLSQCLLAFLTVILINYVIETRLISSYRPYVRSFVCLG
                     NILIVLPFLVKYSLIIDGHDPLEWLISFVLESNARQIIMTIWLASVVVLIPSVMTIKD
                     KMSLNTSRKVWHFLIILLIVYPFKIEELLVKIALSGSIVLFMVVEYIRYMKFEPIGNY
                     LDIQLRSFADYRDENGSLIISYLYLIIGVSTPLLISGSPAGLVGLGVGDALASIVGGR
                     WGRLKWSSTNKTIEGTLAFITSTTLVCVFLKQYLEYYQEISVTNLFNMCVLAGILEGN
                     SVLNDNILIPSFMLILEELFINI"
     gene            complement(<537087..>538664)
                     /gene="TPHA0I02420"
                     /locus_tag="TPHA_0I02420"
                     /db_xref="GeneID:11532812"
     mRNA            complement(<537087..>538664)
                     /gene="TPHA0I02420"
                     /locus_tag="TPHA_0I02420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687131.1"
                     /db_xref="GeneID:11532812"
     CDS             complement(537087..538664)
                     /gene="TPHA0I02420"
                     /locus_tag="TPHA_0I02420"
                     /inference="similar to DNA sequence:INSDC:YMR015C"
                     /note="similar to Saccharomyces cerevisiae ERG5 (YMR015C);
                     ancestral locus Anc_2.562"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687179.1"
                     /db_xref="GeneID:11532812"
                     /db_xref="GOA:G8BXW7"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:G8BXW7"
                     /translation="MAEVIVNRVAQNATDAIIQNQSVLSSIQEMSYWKIFFTFISVVL
                     VWDQVSYQIKKGSIAGPRFKFYPIIGPFLESLDPKFEEYKAKWDSGELSCVSIFHKFV
                     VIASTRDLSRKILQAPKYVKPCVVDVAIKILRPSNWVFLDGKAHTDYRRSLNGLFTKA
                     ALAKYLPSQEKIMDKYIEKFVEFSKETDYEPRVFFHEMREILCALSLGSFCGDWITED
                     QVRGIADDYYLVTAALELVNFPIILPFTKTWYGKRTADAAMKIFENCAQMSKDYIAKG
                     GEPKCVMDAWCKLMHDAKYKNDEDSRLFHREFSNKEISEAIFTFLFASQDASSSLACW
                     LFQIVADRPDVLQKIREEQLAVRNNDMNTELTIDLIEKMEYTSMVVKETLRYRPPVLM
                     VPYVVKNNFPVTPSYTAPKGAMLISTLYPSLHDPEVYDDPEEFIPERWVEGSKANDNK
                     KNWLVFGCGPHVCLGQTYVLITFAALLGKFALHTEFEHKVTPLSEKIKVFATIFPKDD
                     LFMSFKKRDPITGEVTE"
     gene            complement(<541153..>542085)
                     /gene="TPHA0I02430"
                     /locus_tag="TPHA_0I02430"
                     /db_xref="GeneID:11534319"
     mRNA            complement(<541153..>542085)
                     /gene="TPHA0I02430"
                     /locus_tag="TPHA_0I02430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687132.1"
                     /db_xref="GeneID:11534319"
     CDS             complement(541153..542085)
                     /gene="TPHA0I02430"
                     /locus_tag="TPHA_0I02430"
                     /inference="similar to DNA sequence:INSDC:YKL043W,YMR016C"
                     /note="similar to Saccharomyces cerevisiae PHD1 (YKL043W)
                     and SOK2 (YMR016C); ancestral locus Anc_2.564"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687180.1"
                     /db_xref="GeneID:11534319"
                     /db_xref="GOA:G8BXW8"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:G8BXW8"
                     /translation="MIMSYSEPAQANNAFVINNLNGTKIATSNNNNNEMNNFNKPNII
                     LPTSVTPEIGRNHTIPRLTTILWKDEITVCYQVIANGVVVLRRADNHMVNGTKLLNVT
                     GMTRGRRDRMLRSEKERHVVKVGLMHSKGVWIPLERARYLAEKTNISDFLYPLLSDDL
                     PEIVKMHELTQRKMINTTPSYTTPYASDNSHKDNIIQRIHTTEYARGPQYEYTHPYTY
                     PQPPQLDPGAAHLQHINPQLQQQLQQQQQQQHVLQQYPPQLHQFYPQLDYQQSPQPTV
                     IFHHLSPNTMNHDHINGTPAHGPGHMNYPNDHNR"
     gene            complement(<545006..>546547)
                     /gene="TPHA0I02440"
                     /locus_tag="TPHA_0I02440"
                     /db_xref="GeneID:11534320"
     mRNA            complement(<545006..>546547)
                     /gene="TPHA0I02440"
                     /locus_tag="TPHA_0I02440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687133.1"
                     /db_xref="GeneID:11534320"
     CDS             complement(545006..546547)
                     /gene="TPHA0I02440"
                     /locus_tag="TPHA_0I02440"
                     /inference="similar to DNA sequence:INSDC:YKL045W"
                     /note="similar to Saccharomyces cerevisiae PRI2 (YKL045W);
                     ancestral locus Anc_2.566"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687181.1"
                     /db_xref="GeneID:11534320"
                     /db_xref="GOA:G8BXW9"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="UniProtKB/TrEMBL:G8BXW9"
                     /translation="MFRQSKKKLASRRNFDFNSSSGDVSNQVILSSTASTTEEEKKLY
                     DEIYEGKVSFYELPPQGEITLHQFETWAIDRLKILLEIESCISRNKSLKEIESIIKPQ
                     FQKLLPFNTDNFEDRKKDYYSHYILRLCFCRSKELRDKFVRSEVLLFKIRYEMLTTVD
                     KSKFVKSLNLPLLRYISDEEKAKFSKELYNTIAPSLQFQLNITDDQQKRQYLQQEKFI
                     KLPFENVIDLVGSRQVFLKDGYAYLPQFQQLNLLTSEFSKNLMEDLIRTYQYLPRLNE
                     DDRLVPILQHLSSGYTISDFKGDDYTSTENQNNDINNRSVNTDDIQRHFPLCAKNLMY
                     GLKEHHHLRYNGRQQLSFFLKGIGLSCDEAMQFWTEAFAGRVSIDKFNKEYRYNFRHN
                     YGLEGNRINYKPWDCRTILSKPRPARGEYHGCPYRDWNPDRLTSELKKMDLSQQQIVS
                     VLDFCAKNEYTIACTKVFEASHSSNDSVSDSVDDMTHISHPNLYFERSRKWHEKREGK
                     SEVIK"
     gene            complement(<547185..>548711)
                     /gene="TPHA0I02450"
                     /locus_tag="TPHA_0I02450"
                     /db_xref="GeneID:11534690"
     mRNA            complement(<547185..>548711)
                     /gene="TPHA0I02450"
                     /locus_tag="TPHA_0I02450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687134.1"
                     /db_xref="GeneID:11534690"
     CDS             complement(547185..548711)
                     /gene="TPHA0I02450"
                     /locus_tag="TPHA_0I02450"
                     /inference="similar to DNA sequence:INSDC:YMR021C"
                     /note="similar to Saccharomyces cerevisiae MAC1 (YMR021C);
                     ancestral locus Anc_2.568"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687182.1"
                     /db_xref="GeneID:11534690"
                     /db_xref="GOA:G8BXX0"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:G8BXX0"
                     /translation="MIIYQNDKYACVSCIRGHRSSTCKHTGRMLVKVRTRGRPTSCKT
                     RKVIMVDKDSEVKVAKERNPENLLESSTSPDGSVDTQVGSAGNGVSSEVTLANDTDVD
                     QGNSTGYDGKRSCVGMDANPILFLNVKKKQNAVFINGKLNIIVDDSSENDADANANVN
                     LNVRPKLSDKENGFVRASSSLQDDKAFKYMLENEYIKRYVKDEKEDGKLNSTPNNPIK
                     LCGCEGKGTAMKAYHDSKNKIDDKYLATHSKNLPVENSTPGAIEPVGVDETNTSNVDH
                     YGIVSNSESTKYSNLCIGNYENPSKPDTDLLKYIDYDSNNPDSTIMMNDIVNNSNLMV
                     ELLTHKGLYLSSTCSCPDDNCPCSNCLLHRNETELNAYIQQSGIPLSEVGEAQILNTL
                     VDDCSLADCKCTPETCQCTSCTIHLEELVSFDKIIFSGILHFPFRRKTKILFKNKIIP
                     SRYWWDYIKIQLPRQSQTESGVTDIIKWFDSLISLYHFNLQDYDPTNQSSNLSNMHYL
                     "
     gene            <549215..>549718
                     /gene="TPHA0I02460"
                     /locus_tag="TPHA_0I02460"
                     /db_xref="GeneID:11534691"
     mRNA            <549215..>549718
                     /gene="TPHA0I02460"
                     /locus_tag="TPHA_0I02460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687135.1"
                     /db_xref="GeneID:11534691"
     CDS             549215..549718
                     /gene="TPHA0I02460"
                     /locus_tag="TPHA_0I02460"
                     /inference="similar to DNA sequence:INSDC:YMR022W"
                     /note="similar to Saccharomyces cerevisiae UBC7 (YMR022W);
                     ancestral locus Anc_2.569"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687183.1"
                     /db_xref="GeneID:11534691"
                     /db_xref="GOA:G8BXX1"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8BXX1"
                     /translation="MIMSKTAQKRLLKEYQQLIRESPPGIVAGPSDENNMFEWDCLIS
                     GPPETPYENGVFNATLLFPKDYPLSPPKLTFTPSLLHPNIYPNGEVCISILHSPGDDP
                     NMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDASILYRDNRPEFERQVKLS
                     ILKSLGF"
     gene            <550108..>551466
                     /gene="TPHA0I02470"
                     /locus_tag="TPHA_0I02470"
                     /db_xref="GeneID:11534678"
     mRNA            <550108..>551466
                     /gene="TPHA0I02470"
                     /locus_tag="TPHA_0I02470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687136.1"
                     /db_xref="GeneID:11534678"
     CDS             550108..551466
                     /gene="TPHA0I02470"
                     /locus_tag="TPHA_0I02470"
                     /inference="similar to DNA sequence:INSDC:YKL046C"
                     /note="similar to Saccharomyces cerevisiae DCW1 (YKL046C);
                     ancestral locus Anc_2.570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687184.1"
                     /db_xref="GeneID:11534678"
                     /db_xref="GOA:G8BXX2"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:G8BXX2"
                     /translation="MRFNTNKLLFVNCILSLYSSLTSAVYLDLDNYESLQNATALVAY
                     GLMDYYTGLQYGKTIGMFSDPYYWWEAGGAWGCMLDYWFFMENDTYNDIIKQALLYQV
                     GTANDYVPLNQSTTEGNDDQAFWGIAAMMAAERNFTNPAEDEPQWLYLAQAVFNTMAL
                     RWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGALFHIAARLARYTGNDSYAEWAEKVYD
                     WMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWTYNQGLILSGCAYLYNYTGSELWH
                     TRTKNFLSSSSVFFNDTILYEAACQNQETCNTDQRSFKAYFSRFLGVTAQLVPETRDN
                     IMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGKYGLGEQMAALEILVNTRALDR
                     PAPYTSSNGGSSTGDGAAGTETSATNLSPLNITAGSRAGAGIITAVIGISIVACACWL
                     VI"
     gene            complement(<551687..>553276)
                     /gene="TPHA0I02480"
                     /locus_tag="TPHA_0I02480"
                     /db_xref="GeneID:11534679"
     mRNA            complement(<551687..>553276)
                     /gene="TPHA0I02480"
                     /locus_tag="TPHA_0I02480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687137.1"
                     /db_xref="GeneID:11534679"
     CDS             complement(551687..553276)
                     /gene="TPHA0I02480"
                     /locus_tag="TPHA_0I02480"
                     /inference="similar to DNA sequence:INSDC:YKL047W"
                     /note="similar to Saccharomyces cerevisiae YKL047W;
                     ancestral locus Anc_2.571"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687185.1"
                     /db_xref="GeneID:11534679"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="InterPro:IPR028115"
                     /db_xref="UniProtKB/TrEMBL:G8BXX3"
                     /translation="MSNFTDRKERMDYNDLVKKIKFLSESKPSGRTPLSCIFLSQFDM
                     KQGNIIVWSMQSKNSTINLSGIEFKSLPSGIHEVACDVVNFIIPKADDQLISDKSFCY
                     GVAYYKQNGQDIAKNTEHIDRSKVKMYSLGIIIDPEEFNKGTSIHPKSEQNKDILNNL
                     QADRYIRCNDYLDSLQILLAEWFKVGNFDDFSIFENFFNECSGQEIDEGVSNKKKQNV
                     KRKHMIEHFPFWVKKLGPLIFPLWKSSILNERILIIKPIDCNFEKCNALAYSLSLISQ
                     LFADNSLGQKNNIIPLFTIGVNDIDYLQKLRKDTRGLLNYVACTSDEIMSYKTELYDK
                     MLVLPVNFMSETCELLPKFITNKGVEVKATPHEYEIYDNLLNGIFDEKLTNDQKASFS
                     KLTEPVTWYQYIVDGLYLWVTAGFIKASYRQNVLTDFSIYSSYSYVNLKDDKFAIVLN
                     VLKYFHLKTVTLRNNISTLIESANGSSNTDSVVLAPADLLKMDLDCFSEQDLKFVHEL
                     ILRWYQKDMEVNNGEYLKAIC"
     gene            <553753..>554100
                     /gene="TPHA0I02490"
                     /locus_tag="TPHA_0I02490"
                     /db_xref="GeneID:11534680"
     mRNA            <553753..>554100
                     /gene="TPHA0I02490"
                     /locus_tag="TPHA_0I02490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687138.1"
                     /db_xref="GeneID:11534680"
     CDS             553753..554100
                     /gene="TPHA0I02490"
                     /locus_tag="TPHA_0I02490"
                     /inference="similar to DNA sequence:INSDC:YKL061W"
                     /note="similar to Saccharomyces cerevisiae YKL061W;
                     ancestral locus Anc_2.572"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687186.1"
                     /db_xref="GeneID:11534680"
                     /db_xref="InterPro:IPR020491"
                     /db_xref="UniProtKB/TrEMBL:G8BXX4"
                     /translation="MKGEDRVVYQSIEGLVDKTQEFIDTELAKAISFFSSKSEDNKKW
                     LNEISSTYKLENEGTMKDFEELKKAHIKKVDELEQKVVYFEDLYKEINELVEELAVKT
                     KIQKKRQSRLAES"
     gene            complement(<554264..>555934)
                     /gene="TPHA0I02500"
                     /locus_tag="TPHA_0I02500"
                     /db_xref="GeneID:11534480"
     mRNA            complement(<554264..>555934)
                     /gene="TPHA0I02500"
                     /locus_tag="TPHA_0I02500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687139.1"
                     /db_xref="GeneID:11534480"
     CDS             complement(554264..555934)
                     /gene="TPHA0I02500"
                     /locus_tag="TPHA_0I02500"
                     /inference="similar to DNA sequence:INSDC:YMR023C"
                     /note="similar to Saccharomyces cerevisiae MSS1 (YMR023C);
                     ancestral locus Anc_2.573"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687187.1"
                     /db_xref="GeneID:11534480"
                     /db_xref="GOA:G8BXX5"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXX5"
                     /translation="MTFSNTKLTNLFSLKIVDFYATQAVLLLYNVKSCPMMNTNGLGY
                     IRTNSVALRCQLSLLPCIRYYSNKLTTNTSYLPTVYALSTSPNTKSAIAVIRITGNHC
                     KHIYHKLTLRNDMIKPREALLRNLYKSNPHKNSRTLLDSSLILFFQSPRSFTGEDLLE
                     LHVHGGKVVIQEILKTIQSMHDKSKGIEIRSALAGEFSQRAFQNGKYDLTKIEGIRDI
                     IDAETETQRKGALVGFTGENKILFMNWRSVVLDNIAQLSAIIDFGDDIELDNLNLITS
                     KIQSNIKLLKAEINKFIQKVEKSSILQDGIKVSLLGSTNTGKSSLLNKIAYDDISIVS
                     NIAGTTRDVVTTPVNINGYKIIISDTAGIRNRSQTSDQIERLGMQKAISKVENGDICL
                     IMIDPTNKPLLSPDLLEIIKSPKLENRIVRIIINKSDLIESDECLNCIKSQLRDEYNL
                     AYPLNVISCLTDNGMKSLVNDLTKDFLHLSSVSEDENSIIVSQRVKDILQNDIIFGIE
                     NFENSSDDIVLMSENLRDTVEGIGKLTGENIGVEEVLGKIFSSFCIGK"
     gene            complement(556012..556084)
                     /gene="TPHA0Itrna2A"
                     /locus_tag="TPHA_0Itrna2A"
                     /db_xref="GeneID:11534481"
     tRNA            complement(556012..556084)
                     /gene="TPHA0Itrna2A"
                     /locus_tag="TPHA_0Itrna2A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11534481"
     gap             556227..556566
                     /estimated_length=340
     gene            <556711..>561240
                     /gene="TPHA0I02520"
                     /locus_tag="TPHA_0I02520"
                     /db_xref="GeneID:11534670"
     mRNA            <556711..>561240
                     /gene="TPHA0I02520"
                     /locus_tag="TPHA_0I02520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687140.1"
                     /db_xref="GeneID:11534670"
     CDS             556711..561240
                     /gene="TPHA0I02520"
                     /locus_tag="TPHA_0I02520"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687188.1"
                     /db_xref="GeneID:11534670"
                     /db_xref="GOA:G8BXX6"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8BXX6"
                     /translation="MDNDHSSSQVVKETLQSNIEIPNENTDVFIRTFKNRLSTLEGLY
                     EKTMMKHDEFLNSIEAGDYLSKITKLEEEEKGLELNIEKLRTKIIDREGLLNNRTTAH
                     TRTSINNTVTNGSNKEEGNQQTNLMNNGSLMFKTLKGKEVVINKNYLPLNIEFKLINI
                     EDLPLWIKEFVKFLNYYNLDNLNELPESTIIDPVEDQFIKGQLKENIKCEDIYDFIFM
                     ENSSIEILNEVKRIFLRKLNFAKRQKLWKQVSITEKSNNLALQLNLLNKLVGIEEFID
                     TNKMEIFNLIINRINNQVLQRINAVPIDLSKITPTQYLGIIKKRAEDAFEFHEQIKQF
                     YSSEREEAKSNSKNPETLRPIVKKVQRNPVQTKISTKKNQLKSAVDTVIDSGSGINFT
                     NKKGLIFNYRKLTTIPEYSGVGSSSNLQIIGQGSLRVRMDNNGKYQYIPVYYCPDEDA
                     TVLSAFGLRKTLGFIITEDYKNLKNDSISIKIHNVANTTWIKSDDLLLSSKDNRTSEK
                     LTKASSIRWIKPSTSFNNKTVTIHEAHERSNHLPVDVIVHNIENNAFSDVNKINLKKS
                     ELINFYCEQCAQAKMKQHDHIKDSMNKHYEQMQPGQSWSLDIRGPLGKNLAKVDNYLL
                     LMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRIVKELIVDRGSEFTNDSL
                     KTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHYSDLPWALWKYAALAAA
                     RIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTNNKLTNQGIPAITL
                     CKDPNSFGYLFYLPQTRKVISTMSYILANSEVNGDFIDPNKVLSEIVPDNDDTNEVTS
                     EDALEIEAEPSNADDITIIEGIENDTQYKIPPNIQEDTVYGLDTININDNQKVSDHTR
                     SSTADEEVKEPTLEQDTSNTSDNHSVHEAHMSTLPKDTATATSHIDILPDSVAESEPV
                     KNVSDQELLLINRFDNKNSDKFPSTEAMKQRRTKLFLKEFASITRRPLKSRKRELTTL
                     DLEGFEAAEEQKKKIKLRSVQAVNKIRTLYFKTAITNNTDVRGRKLFSEAFEKELQNL
                     LKMQVFDTSISIPRNQVPANRIIPLQTIFTVKRDGTHKARIVCRGDKQTEATYSNYHT
                     DLLQIDTLKLFLMIANNRKMWIQTLDINHAFLYADLREEIYVPLPHDRRFVTPLKKAL
                     YGLKQSPKEWNEHLKKFLNSIDLDDSRHTPGIFRNHDYSIMIAVYVDDCVIAAKSQEL
                     LDEFVSTLRNRFELKIIGKMNQGILRTDVLGMDLDYNIDEGKISLSLQSYIESIENDW
                     LDKISHIKTTSTPHVSSYEHNIKNIDSMDTKTRSKKINELQKINGVINYIRSRCRYDV
                     EFAANKLARSVNFPADNVFYMADKLMNYIFQTKSEKLVFTRETTDNPAITLLSDASLG
                     TEHDMKSRMGIMLWYGENLYKVISRASSAVRNSSTEAELDAIYEGSKEAYYLKKILEE
                     MNLQKDPTVISITDS"
     gene            complement(<564177..>564671)
                     /gene="TPHA0I02540"
                     /locus_tag="TPHA_0I02540"
                     /db_xref="GeneID:11532905"
     mRNA            complement(<564177..>564671)
                     /gene="TPHA0I02540"
                     /locus_tag="TPHA_0I02540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687141.1"
                     /db_xref="GeneID:11532905"
     CDS             complement(564177..564671)
                     /gene="TPHA0I02540"
                     /locus_tag="TPHA_0I02540"
                     /inference="similar to DNA sequence:INSDC:YLR154C"
                     /note="similar to Saccharomyces cerevisiae RNH203
                     (YLR154C); ancestral locus Anc_1.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687189.1"
                     /db_xref="GeneID:11532905"
                     /db_xref="InterPro:IPR013924"
                     /db_xref="UniProtKB/TrEMBL:G8BXX7"
                     /translation="MFWIILNTGMIIEGERYITMKIQFNSNINIENRGYTAHNVPCKI
                     RYSGPSDEFEDNFIFDEDNTNDMYVNYLRGCKIVGQEINSVFDKEVNCYLMDVTGDMD
                     ISESHNDKNGDSDNKKLESISLVPVAKILKVINYERDGNESRLVEEMGKFEESLELNE
                     LIHG"
     gene            <564902..>565138
                     /gene="TPHA0I02550"
                     /locus_tag="TPHA_0I02550"
                     /db_xref="GeneID:11532906"
     mRNA            join(<564902..564933,565009..>565138)
                     /gene="TPHA0I02550"
                     /locus_tag="TPHA_0I02550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687142.1"
                     /db_xref="GeneID:11532906"
     CDS             join(564902..564933,565009..565138)
                     /gene="TPHA0I02550"
                     /locus_tag="TPHA_0I02550"
                     /inference="similar to DNA sequence:INSDC:YJL205C"
                     /note="similar to Saccharomyces cerevisiae NCE101
                     (YJL205C); ancestral locus Anc_1.129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687190.1"
                     /db_xref="GeneID:11532906"
                     /db_xref="GOA:G8BXX8"
                     /db_xref="InterPro:IPR024242"
                     /db_xref="UniProtKB/TrEMBL:G8BXX8"
                     /translation="MVQKAPYLFGKFLDPFCALIVGSLSYAVYEKQNGREEGHSLSQL
                     LMKRYGQPK"
     gene            complement(565366..565455)
                     /gene="TPHA0Itrna1Y"
                     /locus_tag="TPHA_0Itrna1Y"
                     /db_xref="GeneID:11534321"
     tRNA            complement(join(565366..565402,565416..565455))
                     /gene="TPHA0Itrna1Y"
                     /locus_tag="TPHA_0Itrna1Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11534321"
     gene            complement(<567289..>567714)
                     /gene="TPHA0I02560"
                     /locus_tag="TPHA_0I02560"
                     /db_xref="GeneID:11534541"
     mRNA            complement(<567289..>567714)
                     /gene="TPHA0I02560"
                     /locus_tag="TPHA_0I02560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687143.1"
                     /db_xref="GeneID:11534541"
     CDS             complement(567289..567714)
                     /gene="TPHA0I02560"
                     /locus_tag="TPHA_0I02560"
                     /inference="similar to DNA sequence:INSDC:YBR258C"
                     /note="similar to Saccharomyces cerevisiae SHG1 (YBR258C);
                     ancestral locus Anc_1.345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687191.1"
                     /db_xref="GeneID:11534541"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:G8BXX9"
                     /translation="MFLMVEKYGIIANMSGDTDKAQELADLFKKHGYFDKLKQDILNK
                     RIENGEQSAQLQELVKLKVAQIVNEMVNSNEDLIFKNRGSTTALIEGQIVKDGYAKLN
                     TGENGINLTEVIEESMSSEDMKNDIFKVLENLDKDLMKS"
     gene            complement(<567953..>570076)
                     /gene="TPHA0I02570"
                     /locus_tag="TPHA_0I02570"
                     /db_xref="GeneID:11534335"
     mRNA            complement(<567953..>570076)
                     /gene="TPHA0I02570"
                     /locus_tag="TPHA_0I02570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687144.1"
                     /db_xref="GeneID:11534335"
     CDS             complement(567953..570076)
                     /gene="TPHA0I02570"
                     /locus_tag="TPHA_0I02570"
                     /inference="similar to DNA sequence:INSDC:YBR260C"
                     /note="similar to Saccharomyces cerevisiae RGD1 (YBR260C);
                     ancestral locus Anc_1.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687192.1"
                     /db_xref="GeneID:11534335"
                     /db_xref="GOA:G8BXY0"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8BXY0"
                     /translation="MMDQTSLSSKVSNSNVGDANGEPHNGGEQGTLLDREEIKRIMDS
                     DVAINALLAILKQSLLTCEEFTKYVKKKYMFEQENVEELSKQYKHFFTSTSNTSPSLR
                     RCMRQILQFDGKLANVKQSYVTALIKMYEELSSLLLTMTKMRKSIKEKSRRLEKEVSD
                     AIHVSEKAQMRYNSLCQDWDKLRMTDPTKTKLTLRGSKTTKEQEEDLTRKIDAADIEY
                     KQRVDHSTSLRTVFLNKERPQIVSELRDLILEIDTAMTIQLQKYCIWTENLALNVGVT
                     VLPLDPKHSMKSIVLNVTNEKDLYNYLNKYNQNGKESLLSNKSLVPVPYKKHPSMVKD
                     KLVSPHGNSTFSVNNQRNLNPINTNSKDTGGFSSPNTTVVASGNSASKTSLSSSTYIP
                     TSSVYSPNDNNNKYLSQGTSDSATDSPHVSGLGIQVASYAGAATAAVVGLSGSNNTNN
                     NLNTLPSKKYYGNDGNEGAMRTSSFATGSSAYTDDSGRPISHIQHENVIPAGIQNNFK
                     TFGIPLEKLLEYEQDSVPTIVKQCVYVIDTYGLQVEGIYRKSANVLDVGKLKDEIDKD
                     PSNISMILPPKDYTDSDLFVVSSLLKAFFSALPETLIPSSCVPELKVCLSIEDLETRK
                     NYMHGLIYKFPDAQYWTLRTLIFHLKRVMANEAHNRMNLKGLSIIWGPTIVPQNDEDI
                     NDINFQIGTMEIIFAVADQAFESEE"
     gene            complement(<570602..>570916)
                     /gene="TPHA0I02580"
                     /locus_tag="TPHA_0I02580"
                     /db_xref="GeneID:11534336"
     mRNA            complement(<570602..>570916)
                     /gene="TPHA0I02580"
                     /locus_tag="TPHA_0I02580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687145.1"
                     /db_xref="GeneID:11534336"
     CDS             complement(570602..570916)
                     /gene="TPHA0I02580"
                     /locus_tag="TPHA_0I02580"
                     /inference="similar to DNA sequence:INSDC:YBR262C"
                     /note="similar to Saccharomyces cerevisiae YBR262C;
                     ancestral locus Anc_1.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687193.1"
                     /db_xref="GeneID:11534336"
                     /db_xref="UniProtKB/TrEMBL:G8BXY1"
                     /translation="MIIPILQKTARVTSFVTVAGVTATSYYYYFVHDNGYYYKTSSWK
                     KLDDKVQNLIDGKESIRYVGIGELVDRPVDIHVRSNSETFKDIWNAEVRRAVEWLYSV
                     GK"
     gene            complement(<571327..>572004)
                     /gene="TPHA0I02590"
                     /locus_tag="TPHA_0I02590"
                     /db_xref="GeneID:11532862"
     mRNA            complement(<571327..>572004)
                     /gene="TPHA0I02590"
                     /locus_tag="TPHA_0I02590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687146.1"
                     /db_xref="GeneID:11532862"
     CDS             complement(571327..572004)
                     /gene="TPHA0I02590"
                     /locus_tag="TPHA_0I02590"
                     /inference="similar to DNA sequence:INSDC:YBR264C"
                     /note="similar to Saccharomyces cerevisiae YPT10
                     (YBR264C); ancestral locus Anc_1.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687194.1"
                     /db_xref="GeneID:11532862"
                     /db_xref="GOA:G8BXY2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BXY2"
                     /translation="MVSGNEEIEESSCDLKLVLLGESSVGKSSVVSRYVTGKFNKTNA
                     TIGAAFITKEIKFVSEEGEHRVVNLEIWDTAGQERYRSLAPMYYRNTDVAVIVFDLTV
                     PDSAAKALAWVDELLSYVEKERREEIVITVVGNKNDLIEGDDKIDSAMEQDIATLAKR
                     PIWRVSAKTGEGIEELFQDIVRSIPKEKFRTKAQQQEATARNKHVTLNPDSSAWHRIT
                     ERTTCEC"
     gene            <572400..>573818
                     /gene="TPHA0I02600"
                     /locus_tag="TPHA_0I02600"
                     /db_xref="GeneID:11532863"
     mRNA            <572400..>573818
                     /gene="TPHA0I02600"
                     /locus_tag="TPHA_0I02600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687147.1"
                     /db_xref="GeneID:11532863"
     CDS             572400..573818
                     /gene="TPHA0I02600"
                     /locus_tag="TPHA_0I02600"
                     /inference="similar to DNA sequence:INSDC:YBR273C,YJL048C"
                     /note="similar to Saccharomyces cerevisiae UBX7 (YBR273C)
                     and UBX6 (YJL048C); ancestral locus Anc_1.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687195.1"
                     /db_xref="GeneID:11532863"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8BXY3"
                     /translation="MDLQEGFGFLTDAHVAITRAIQTNTVLVVYATDEDNHGKWLQSW
                     AHPRLMTNENMEKKTTFLIIVKGTPEFQQLQELFPNIHTQSLYFIKNQKIELIITGDS
                     GSDKFSHWNRIIDYLEGIECTPVTDSTVSTNRNQTSTVPIPVTNPTPVNNVESIADTN
                     PEADVAPNKTPINNKKTFKEEVNDLTRKKYHEQMLKQKQLERSERQRILRLVESDRQE
                     RLARKLQEEMNKKSQKDKDKLNELEEIVIKIENPDINDNIKNLGKLEKLTECTLQIRL
                     TNGQSIVNKFDADSALTEVRSWVNENRSDGKCSYLFHRNVPRATFSIDEEEKSLRELE
                     LIPRSALILEQIDNNCEDVQPGLLGRITNRLAFWRASPQSDLQTNTESCTSTEENDTN
                     NTANTKEESSDSKNSSSSYKSPSFRYVTQLNTVESDLNLAERSVSPNVRVFANDTDEH
                     KSDEDRPSYNGNNINLENKKDD"
     gene            complement(<573932..>575278)
                     /gene="TPHA0I02610"
                     /locus_tag="TPHA_0I02610"
                     /db_xref="GeneID:11534372"
     mRNA            complement(<573932..>575278)
                     /gene="TPHA0I02610"
                     /locus_tag="TPHA_0I02610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687148.1"
                     /db_xref="GeneID:11534372"
     CDS             complement(573932..575278)
                     /gene="TPHA0I02610"
                     /locus_tag="TPHA_0I02610"
                     /inference="similar to DNA sequence:INSDC:YJL049W"
                     /note="similar to Saccharomyces cerevisiae YJL049W;
                     ancestral locus Anc_1.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687196.1"
                     /db_xref="GeneID:11534372"
                     /db_xref="GOA:G8BXY4"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:G8BXY4"
                     /translation="MGLPQSRLESLYKDFRPLQELNYDGYQANIATWKKYLLSEYSPN
                     VERLTMKIGDDFLRSLNQEVYGIPKSIDVVIDSMVSDGTLVTIEDFTNGLLGNGEGSN
                     VVGWFKSKLGFSRKFVSRKDESSTGYMKEMELIHKQNLIKISEKIHDNIKRNIIRKIT
                     SFTGCILCKEEFCQKAGISEVVTDKEDVEILIKYLDYYKNILVYDKEVIKLLGIPESW
                     IIDEGSKNRITENDVKISEVKDALFKIKLKIGYLENKNDKQMAKILDKNIGRETRKEY
                     LIGKKIIDKHLSNLLRYKNNLLEMKNQIDASATNNLLVKTLTASHDILKSLNDYTGSV
                     ENVEVLLNKIEDQKHISEDINEALASTNLSYDENIIDDTELESDLKKLEDTLEKENKT
                     KEKKAKEYRTEGNKETESSNELLGKLSQLSIKDDELNFEANKLPNTTERIPEQEHI"
     gene            complement(<575648..>576685)
                     /gene="TPHA0I02620"
                     /locus_tag="TPHA_0I02620"
                     /db_xref="GeneID:11534373"
     mRNA            complement(<575648..>576685)
                     /gene="TPHA0I02620"
                     /locus_tag="TPHA_0I02620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687149.1"
                     /db_xref="GeneID:11534373"
     CDS             complement(575648..576685)
                     /gene="TPHA0I02620"
                     /locus_tag="TPHA_0I02620"
                     /inference="similar to DNA sequence:INSDC:YJL053W"
                     /note="similar to Saccharomyces cerevisiae PEP8 (YJL053W);
                     ancestral locus Anc_1.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687197.1"
                     /db_xref="GeneID:11534373"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:G8BXY5"
                     /translation="MNLFFKPPVDIEILFDKEDSRKHVEVLPASGSHSKVLGDSLPVY
                     EDGESISGNVTVRVREGKIVEHLGIKVTLIGSIDLVKAAGNSTSNSYKSIDVRKRSIE
                     QFICMTYDLSPAGELNHSQSFPFKFKDMSMQFESYRGKNVDVSYYIKVTVMKKGTDIS
                     KIKPFWVYLYKDLEEVKKIVEQTKKMSEQKKANGIKKNDKDDKNSDSIEKKPIKLDIG
                     IENCLHIEFEYTKSIFSLKDVIVGRIYFLLTRLKIKHMELSLITRESSGLQQSNTLVD
                     STAIRYEIMDGSPVKGETIPIRLFMSGYDLTPSISCNYFDIKNYLSLVIIDEDGRRYF
                     KQSEIKIYRSK"
     gene            complement(<577199..>578548)
                     /gene="TPHA0I02630"
                     /locus_tag="TPHA_0I02630"
                     /db_xref="GeneID:11534623"
     mRNA            complement(<577199..>578548)
                     /gene="TPHA0I02630"
                     /locus_tag="TPHA_0I02630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687150.1"
                     /db_xref="GeneID:11534623"
     CDS             complement(577199..578548)
                     /gene="TPHA0I02630"
                     /locus_tag="TPHA_0I02630"
                     /inference="similar to DNA sequence:INSDC:YJL054W"
                     /note="similar to Saccharomyces cerevisiae TIM54
                     (YJL054W); ancestral locus Anc_1.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687198.1"
                     /db_xref="GeneID:11534623"
                     /db_xref="InterPro:IPR021056"
                     /db_xref="UniProtKB/TrEMBL:G8BXY6"
                     /translation="MSKPPNPALKAMGLSWIKLPSRNWIIFGTVFGGLVSGVLYDKDI
                     QKKIRLKYINEVKSNSNTKISTVEVPRKITVFIAPPPSDYLDVSMKIWRRYVKPILYY
                     SGYEYELIEENRQGLIRTEVANRIRAVRRELKQQLEDKNTKSELRIETAKNGNGESED
                     DNGKEFKRNFDYRDIMGIFYKSEKPKEIISEDSQTLLPELAGGVICIGRGSYKEYING
                     IHEGMLGPLEALSEPTIAEINNEPASEPQGNTSIDNDSTNVDINIATSSTELNPTLNK
                     VSDTDKDSENEDDEDDDEKRETRKLKPYLTSDQYSTVDIPLEISQALLKGNDIIRDPQ
                     NKIPIMLHQPVLVIPVPNLIGFLAIPERIYRFYTKRKYVEEVCSEVASLVNQKNIRPY
                     ESSADLSLAAQEESDWPSKWVKQGLERKSEWTQELKDDPRVTKYMHICASPPQEQDK"
     gene            complement(<578998..>579708)
                     /gene="TPHA0I02640"
                     /locus_tag="TPHA_0I02640"
                     /db_xref="GeneID:11534624"
     mRNA            complement(<578998..>579708)
                     /gene="TPHA0I02640"
                     /locus_tag="TPHA_0I02640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687151.1"
                     /db_xref="GeneID:11534624"
     CDS             complement(578998..579708)
                     /gene="TPHA0I02640"
                     /locus_tag="TPHA_0I02640"
                     /inference="similar to DNA sequence:INSDC:YJL055W"
                     /note="similar to Saccharomyces cerevisiae YJL055W;
                     ancestral locus Anc_1.327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687199.1"
                     /db_xref="GeneID:11534624"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:G8BXY7"
                     /translation="MFEKSVCVYCGSASGADKVYEEHASKLGRLLNANKWRLVYGGGT
                     TGLMGTIARTTMKGDGTSKGSVLGIIPNALVDKERSNTVDLNEIDDYNNKIKESVENH
                     SGLSPISKEYGETFIVPDMHTRKKMMANESDAFVAMPGGFGTLEEIMECITWSQLGIH
                     NKPIVLFNVGGFYDPLLEFVKKSIESGFISKNNGNIIAVAKTAQEVIDKINNYKIPDG
                     RFTLNWSDDLTDNLNCDH"
     gene            complement(<580125..>581390)
                     /gene="TPHA0I02650"
                     /locus_tag="TPHA_0I02650"
                     /db_xref="GeneID:11534625"
     mRNA            complement(<580125..>581390)
                     /gene="TPHA0I02650"
                     /locus_tag="TPHA_0I02650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687152.1"
                     /db_xref="GeneID:11534625"
     CDS             complement(580125..581390)
                     /gene="TPHA0I02650"
                     /locus_tag="TPHA_0I02650"
                     /inference="similar to DNA sequence:INSDC:YBR271W"
                     /note="similar to Saccharomyces cerevisiae YBR271W;
                     ancestral locus Anc_1.325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687200.1"
                     /db_xref="GeneID:11534625"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8BXY8"
                     /translation="MFDPLDLFTPEEERVNEVIVQSRYSSKESQVEIENDGDGLGDSI
                     DDSDAKIVSILDLPLIPYANTKVLLCTLILLRPNAQINFNSDESVDSDIAKDVPTDLL
                     DELLKWYTETFPNSNLNTLSKIIEKIPVIKSTSDKESLLNYYTSALKNLEKRLAIGAE
                     NDIEHIDLAMKEVVQRISENCGRTAQPSMTREFKLENLHHIVKLYEPSLTADNLGWKT
                     WGSSLVLSQYLINNFNKYINVNNCHVRKVRVLELGAGTGLVGISWGCKWKEEVTSAGN
                     ENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTDPTSFTNTHTEEPFQYI
                     LIADPIYSPEHPKWVVDMIVKFLKKPKDGNVSRCFMQIPIREKYQVERETLWRLIEEN
                     NLKFTDEQVDYGQDDWGQVQYLYKEIQWK"
     gene            <582108..>584219
                     /gene="TPHA0I02660"
                     /locus_tag="TPHA_0I02660"
                     /db_xref="GeneID:11532829"
     mRNA            <582108..>584219
                     /gene="TPHA0I02660"
                     /locus_tag="TPHA_0I02660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687153.1"
                     /db_xref="GeneID:11532829"
     CDS             582108..584219
                     /gene="TPHA0I02660"
                     /locus_tag="TPHA_0I02660"
                     /inference="similar to DNA sequence:INSDC:YJL057C"
                     /note="similar to Saccharomyces cerevisiae IKS1 (YJL057C);
                     ancestral locus Anc_1.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687201.1"
                     /db_xref="GeneID:11532829"
                     /db_xref="GOA:G8BXY9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8BXY9"
                     /translation="MSLVPYREDSLILDDPHSNSIMILNPSVGSVRFYQQLYSSHLHT
                     NNTSEDNFDIEKVNYFPRQKASRDTFQFNPISTFRCPQCGTEIDPIVRFENVGNNNKP
                     NQKSSNDDFHVDSNTHSKSKATSSHSAYFNLSKQYFNLLESSHKRLRLQEISYKDDEL
                     ISDISEISSKSPFFIPDDLFIPGYFRKFFNTIDLLGRGARGSVFKVVHKIGSIELGLF
                     ALKKIPIGNDSLWFEKCIREVKALNSITHETVNLITYNHVWLEMERSNGLVRTVAGDS
                     ISQGEEMIPCLFILQQYCPGGNLEEVIQNKVFQKSNEFTTNAERKKIFKLERARKNSN
                     VTRQLGLSTIQITDIIRNIANGLKELHDLGLIHRDLKPSNCLLVHEYEQNLPDIDPKD
                     SNNEWHFPPIVIGDLGESQVFGESRSATGATGTLEFTAPEVIIPGEVNTNPNFGSIDS
                     YNEYSYSSDIYSLGMILYFIIFGELPFGIDLELPQLKSSIINLKTFDKDSLIKKHVEM
                     NLKPINYNIFNLMLLLISKDPNNRPKASEIDELLDIILQGNKGNHHVSVSHNGDLKDE
                     EGDVSITTESRSKQQRSATSTIQAMPVNNERQMITVNYRIKPAANNISYSTSKSLFKM
                     FKDVSLTSSIILIESSIVYFVTSYSSPNSISQLISCILWGLSIKRSLKIQSLILLLQL
                     AMLLNVFYSDYTQFLLTILHK"
     gene            <584606..>586180
                     /gene="TPHA0I02670"
                     /locus_tag="TPHA_0I02670"
                     /db_xref="GeneID:11532830"
     mRNA            <584606..>586180
                     /gene="TPHA0I02670"
                     /locus_tag="TPHA_0I02670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687154.1"
                     /db_xref="GeneID:11532830"
     CDS             584606..586180
                     /gene="TPHA0I02670"
                     /locus_tag="TPHA_0I02670"
                     /inference="similar to DNA sequence:INSDC:YBR270C,YJL058C"
                     /note="similar to Saccharomyces cerevisiae YBR270C and
                     BIT61 (YJL058C); ancestral locus Anc_1.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687202.1"
                     /db_xref="GeneID:11532830"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ0"
                     /translation="MSHHLNRQRSATTLLPNTNSNELNANTNRARFHSVSSDIVPQKL
                     YIPEDDSPMLKSVRSPTNNVPNISNVGFQSIFEGGGQRRSKQSLLSFDENDNHLKHTA
                     SLRSNPSSLSFDNDDIMKFGDATSMKSVFTSSSSLKNRRASNIFSRSKDMSTSNDATK
                     KLNNISRKQSDASVAQSYKSTKSGTLSKVARKIFHRKQNRHDGEVAVEQVVPSSLSKF
                     LHPSYLIHRNQSQFIHNSNTLADSGRSVYSFNPTLTTNHLENMALMNNEVNNSSTNST
                     MMLHDLLKNLPSLEANYKNFNIQELTILTGNVWGVFCNVIIELFKRKRLWQLPAKIED
                     FNKVLSFYAFLKTDSKVASPQVTFLNELEEFISSSLYVLENQIIFNYTNENTMNTLLK
                     RLGVIWQVFYQQVYYDVMSVLLPLEESFRTHPDYWGYSTYSDSYEMISVDHILLKCFR
                     DCIVLPYYQNFGNRDNGVSKSFQIYIYSEEEENGVTDQDKLILLQCFGILSTIQGNDE
                     SQKILEELLEGIRMSI"
     gene            complement(<586316..>587575)
                     /gene="TPHA0I02680"
                     /locus_tag="TPHA_0I02680"
                     /db_xref="GeneID:11534374"
     mRNA            complement(<586316..>587575)
                     /gene="TPHA0I02680"
                     /locus_tag="TPHA_0I02680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687155.1"
                     /db_xref="GeneID:11534374"
     CDS             complement(586316..587575)
                     /gene="TPHA0I02680"
                     /locus_tag="TPHA_0I02680"
                     /inference="similar to DNA sequence:INSDC:YJL059W"
                     /note="similar to Saccharomyces cerevisiae YHC3 (YJL059W);
                     ancestral locus Anc_1.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687203.1"
                     /db_xref="GeneID:11534374"
                     /db_xref="GOA:G8BXZ1"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018460"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ1"
                     /translation="MNIDHNYKKIYIYFWSFGLINNVLYVVILVAAIDIVKIRLPKSI
                     VLLADILPSFIIKIASPFFIDRIKYSNRIWCLILLSCIGMYLVSQKSVLVSLLGICLT
                     SLSSGFGETTFLQLTHYYRHTSLNGWSSGTGAAGLVGSSVYMLLTSILKFSPRQTLLL
                     FSIMPFAFLLYFKLDDRNYTLADSTNDNINIESTNEILLLDEEENERCDTGHPSLLLD
                     PPDLQFRLDCLKLEFLRTVEKLKPLFVPYMLPLSIVYLFEYLINQAVSPTLLFPINET
                     ENLHFYHSYRDLYVLYGTLYQCGVFISRSTASYFRFKKLFLLSYLQGFNFLLAIIQSW
                     YFIIKTPWILMILILYEGLIGGSSYVNTFMNILEDVEPQKIEFSLGATSIADSSGIFF
                     AALIGLMLEPELCRHQVNDGRPWCQLE"
     gene            <587981..>588418
                     /gene="TPHA0I02690"
                     /locus_tag="TPHA_0I02690"
                     /db_xref="GeneID:11534375"
     mRNA            <587981..>588418
                     /gene="TPHA0I02690"
                     /locus_tag="TPHA_0I02690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687156.1"
                     /db_xref="GeneID:11534375"
     CDS             587981..588418
                     /gene="TPHA0I02690"
                     /locus_tag="TPHA_0I02690"
                     /inference="similar to DNA sequence:INSDC:YBR269C"
                     /note="similar to Saccharomyces cerevisiae YBR269C;
                     ancestral locus Anc_1.320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687204.1"
                     /db_xref="GeneID:11534375"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ2"
                     /translation="MRYSTLSSSIRCALQLSAKNDIYSRRGIQYFRTLINQRKFNTKQ
                     VPSPPKLPKTEQDEFEKLQKIAQTQVIIDGYNEEIKNNPTKESLQNAILTKNDIGGFS
                     PEFRKTIPEFEGDVNPKTGEVGGPKQDPLRHGDYSFNGRVTDF"
     gene            complement(<588523..>591135)
                     /gene="TPHA0I02700"
                     /locus_tag="TPHA_0I02700"
                     /db_xref="GeneID:11534376"
     mRNA            complement(<588523..>591135)
                     /gene="TPHA0I02700"
                     /locus_tag="TPHA_0I02700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687157.1"
                     /db_xref="GeneID:11534376"
     CDS             complement(588523..591135)
                     /gene="TPHA0I02700"
                     /locus_tag="TPHA_0I02700"
                     /inference="similar to DNA sequence:INSDC:YBR276C"
                     /note="similar to Saccharomyces cerevisiae PPS1 (YBR276C);
                     ancestral locus Anc_1.312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687205.1"
                     /db_xref="GeneID:11534376"
                     /db_xref="GOA:G8BXZ3"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ3"
                     /translation="MKHHHNSVEASNNLRLSKNYDNNGSIGMKRRKSTDYLTFNGSNV
                     EYIDPLDALKLFKEENNSSELPSHNVMFPWLYSIANNSVQKPDGTLDSLLFMRSKNSC
                     CPKNETIGNSGILKSSIDPKDIFISIDDNDFVNDCKNNIHLINLESKYKFVREVLFKT
                     LDVNESGFLKNDSLTNIDNLIATCIKFNIFPFLKTDCNILEKLKTKETYVANSVSNNI
                     QRDTVRSSTKWKQSNIFRRFDLQCSKSFELSKTVILYCFHNDHSDTNIITPHSYCDNC
                     YGLLILLKIAINFINISYQKGSNNKMNNNNLVDINIMVMKYNTLSDIPKELIAIEPMN
                     IKTLKKKPNQLLSEFDIATFNCWETNISYHEKLEITKLTSISKIDESSKIWAGNLTDF
                     HIYQLLSKLKVNNDESEPDVNKIIRKRTDFNCIDLKTICTIRDVVYNHQHIHLNDSGI
                     FNIPKLTKPICLFINCFEHAPLPTMKDVCSAFDKLNNAHDKQVHYMFPSSGSIGLGNL
                     NISSINIILNTCYMIYYLSEFHDVQTLFYCANGYTETSFLLVAYLIFYWNLPLEKTML
                     KLHLKYDRSFFLFHSDLQVLGHLQLLLQEFSPNKEVNFMKYKQSFNANKSMEPLEITP
                     EMFSKIFFIQVPPESDFSKIKGPFPSKILPHLYLGSLEHTQSNYLLKQLGINYIISVG
                     ETITWLEDDSTDIYSRKRGISNPIPNPILQATNVRANGLRRATISKQINSYNKSDNSS
                     WSEIIEKDGFKILKINNLLDNGQDTISDQLDEALEFIDECYQKKGKVLVHCMVGVSRS
                     ASVCIAECIKRLNCNLLQAYLYVRARRLNIIIQPTLMFMYDLLKWRQAKHHEDKDDWH
                     ILCRSIHELNSKYI"
     gene            <592806..>594107
                     /gene="TPHA0I02710"
                     /locus_tag="TPHA_0I02710"
                     /db_xref="GeneID:11534473"
     mRNA            <592806..>594107
                     /gene="TPHA0I02710"
                     /locus_tag="TPHA_0I02710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687158.1"
                     /db_xref="GeneID:11534473"
     CDS             592806..594107
                     /gene="TPHA0I02710"
                     /locus_tag="TPHA_0I02710"
                     /inference="similar to DNA sequence:INSDC:YBR279W"
                     /note="similar to Saccharomyces cerevisiae PAF1 (YBR279W);
                     ancestral locus Anc_1.309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687206.1"
                     /db_xref="GeneID:11534473"
                     /db_xref="InterPro:IPR007133"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ4"
                     /translation="MSKKQEYIANINYQNNLPEPTIPPTLIKYKNNDDEDVGSAHLIT
                     SLYSKVNVNNLIKINEDLGMELDLLKIPGVLNNSDLTFLNGFDNIKLDEKDKILLRDP
                     GVDRLAKSDLSKVSFLRRTEYVSTSIVSHNDSSMLANKKRGRLDNNIDDADKVLNTSE
                     IVERIESSFDKNNSDLEKLRHPIKKKLTAVKSWNFLPDTASMDQNYFILRLVGSAKLD
                     AQERSKLALDTAVFRPVELEEDDWISMYTTDSKDSKLLANDLERTLEDTGTVASDNKT
                     YPFKRLRDFDMQQMQSMEDATATNKNEIKDVALVFNDEKNTVYYKPIRSRIELKRRRV
                     NDVIKQLVNEHKLDQINVKLRNPTTNESSLRDKIRTRFDPIDFPYVEEEIEVSQIESQ
                     PSNSVEQTTDSSINESNSSTSLNEDTKDKSEEAALEKEDAL"
     gene            <594478..>595374
                     /gene="TPHA0I02720"
                     /locus_tag="TPHA_0I02720"
                     /db_xref="GeneID:11534474"
     mRNA            <594478..>595374
                     /gene="TPHA0I02720"
                     /locus_tag="TPHA_0I02720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687159.1"
                     /db_xref="GeneID:11534474"
     CDS             594478..595374
                     /gene="TPHA0I02720"
                     /locus_tag="TPHA_0I02720"
                     /inference="similar to DNA sequence:INSDC:YJL068C"
                     /note="similar to Saccharomyces cerevisiae YJL068C;
                     ancestral locus Anc_1.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687207.1"
                     /db_xref="GeneID:11534474"
                     /db_xref="GOA:G8BXZ5"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="InterPro:IPR014186"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ5"
                     /translation="MSITINKELASCGGRLIKLSHESISTHTKMDVNIYLPKQFYDDT
                     HSAPIPTLYYLSGLTCSPENASEKAFWQPQADKYGFAVVFPDTSPRGEGVATDPENSW
                     DFGIGAGFYVNATESPYVKHYHMYDYVHKELPVVLNDHFNKASKRVDFTENISITGHS
                     MGGYGALAGFLRNISDNKYKSCSAFAPIVNPSAVLWGEKAFSGYLGSDKSTWLEYDPC
                     ELIKKTENIKNSILLIHVGTNDPFLKNQLKPENILEASKGTSWENKIDVKLAVGFDHS
                     YYFISTFVPEHAEFHAKALGLI"
     gene            <595791..>597593
                     /gene="TPHA0I02730"
                     /locus_tag="TPHA_0I02730"
                     /db_xref="GeneID:11534494"
     mRNA            <595791..>597593
                     /gene="TPHA0I02730"
                     /locus_tag="TPHA_0I02730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687160.1"
                     /db_xref="GeneID:11534494"
     CDS             595791..597593
                     /gene="TPHA0I02730"
                     /locus_tag="TPHA_0I02730"
                     /inference="similar to DNA sequence:INSDC:YJL069C"
                     /note="similar to Saccharomyces cerevisiae UTP18
                     (YJL069C); ancestral locus Anc_1.305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687208.1"
                     /db_xref="GeneID:11534494"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ6"
                     /translation="MSTKGDKVQINMDYIIPPPDKEEELLSKLVFGDNTDFQSNLANF
                     DLDFLSNDHVDVDVQSDAGSEDDSEAELINNVNDDQLFFVDDGNDRVDNGDEDKMDVD
                     SDVNASLEDISSEDGNSDAWEDSDDERIRIDITASNKSKKLRTSYAQSQINGSDYVHR
                     LRAQFERIYPKPKWVDDVSEESNSDNSDAGNSDDEYEKVINGDINALSKILESSYQYK
                     DISNSILLPKGKLDIIRLKDANAAHPSKSAVQSLSFHPNKPLLLTGGFDRTLRIYHID
                     GKNNHLVSSLYLKDTPVQTCTFYVAPNSGNSKKVTQQNIFTGGRRRYMHSWDLSTQLV
                     HNQTANTSTSRIEKISRLYGHQDTQRSFEKFKLGHFYNFTSNETHGIILLQGNNGWIN
                     IIHATTGVWLTACKIEGVLTDFCIDYKPLAGSKFQTILIAANTSGEIWEFNLSKNNEV
                     QRRWKDAGGMGITIIQVGGGTNTANFFPVSSGKIKTNTWLAIGSESGYVNIYDRRNKF
                     ENIQPVASLDQLTTTISSLVFSSDGQILCMASRAVKDALRLVHLPSCTVFSNWPTSGT
                     PFGRVTSVAFSSRSEMLAVGNEQGKVRLWRLNHY"
     gene            complement(597777..597848)
                     /gene="TPHA0Itrna1C"
                     /locus_tag="TPHA_0Itrna1C"
                     /db_xref="GeneID:11534495"
     tRNA            complement(597777..597848)
                     /gene="TPHA0Itrna1C"
                     /locus_tag="TPHA_0Itrna1C"
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /db_xref="GeneID:11534495"
     gene            complement(<602303..>605521)
                     /gene="TPHA0I02740"
                     /locus_tag="TPHA_0I02740"
                     /db_xref="GeneID:11532820"
     mRNA            complement(<602303..>605521)
                     /gene="TPHA0I02740"
                     /locus_tag="TPHA_0I02740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687161.1"
                     /db_xref="GeneID:11532820"
     CDS             complement(602303..605521)
                     /gene="TPHA0I02740"
                     /locus_tag="TPHA_0I02740"
                     /inference="similar to DNA sequence:INSDC:YJL076W,YKR010C"
                     /note="similar to Saccharomyces cerevisiae NET1 (YJL076W)
                     and TOF2 (YKR010C); ancestral locus Anc_1.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687209.1"
                     /db_xref="GeneID:11532820"
                     /db_xref="InterPro:IPR018844"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ7"
                     /translation="MMYKIQVILIPPNSIDNSYYRVTSSNAFINNLNINNENATLNKA
                     PFNGSGFTGYGNDQNINKPNSNDSMIGSSYNSMIFNPYNSMPNTNLLLLFPNYKKFLL
                     FTKPDNTLLTVSNEIVTKCLKLYPGGENEIDILSLQDINNCDLDPDFIVKDVFVTDNI
                     IKVILKNDINITSPSSLFSSNKKQKINNGTSINTQIPPYQPLQAAPVNTQNGYSNANG
                     GITVIKKRQGSGNNIIRNGLTSNTMRISTPLVHQIYSRTNKHLNNSDDENENVDDGND
                     NNDMEAMDRSFLPPPHQPQSPPIRISSDFDSTKKIKSLVEDDTVSKSETVDPVKAKQQ
                     RIFLGTPIRNASMPNGVCLTGQKVMSEQRYSSLDAKSSIFANTRSISTVCKGNDKIAL
                     NDSRITSGMLSIPEPKLSEVEKQLHEGPSSPSTILPPKPDRIPMKKPYIPDNSDSDSD
                     SDYMSDSSSSINSESSPSIEVKQNIIVQDMQRPTENGSPAPSHIKNNNRAKISDQVSD
                     SSTFKLAELPQTGNVKGLNNKEEESKQKGNVKGSDDKEEESKQNGNSSQTLKPDTKGN
                     INLEKSLVNSNKFINKLENVTLNNITSEAKEKPNNFSKHEILSMVDGNELDLNRPFKN
                     LKGTSNKKPYTTVLHKDIDNSKPDPRNILPTRLPRNAARRAAEKLSTRYETISKFNAD
                     NDSTSESDSESSSGNESDRIASDVEADGDKDRLQSATGKVPHQNHNIVVRENNEIKKL
                     NIHDLNTRVITSDPNTSTANTDKNIIPKQIISEKNESLSSSTKPTPKDIPGSQPPANT
                     SRGVASLPNREVELNIQAPILSKKNNNIPVFEESNTSTVPQILRKPSFLESEIDSEVN
                     DVFDKTTNESMNPISINKIPAVHSMNKPPAVHSKNQPPTIRSTNSKPSAAMPSIIKPS
                     ATMPSIIKPSATIPSSSKSSTTMPSNSIPPIAYTSNKKANNDTKTNSKLPTNTTNNIP
                     PAFSSANNISAAFTPTNRRESVSNATKDTIEMQPSGKVKNLLSSQSVQKLNIQLSKES
                     DSSSSSDGSTDSTSSDSDSSREDEEDSRFKNIREVNAALQKR"
     gene            complement(<606058..>607074)
                     /gene="TPHA0I02750"
                     /locus_tag="TPHA_0I02750"
                     /db_xref="GeneID:11534633"
     mRNA            complement(<606058..>607074)
                     /gene="TPHA0I02750"
                     /locus_tag="TPHA_0I02750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687162.1"
                     /db_xref="GeneID:11534633"
     CDS             complement(606058..607074)
                     /gene="TPHA0I02750"
                     /locus_tag="TPHA_0I02750"
                     /inference="similar to DNA sequence:INSDC:YKR011C"
                     /note="similar to Saccharomyces cerevisiae YKR011C;
                     ancestral locus Anc_1.293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687210.1"
                     /db_xref="GeneID:11534633"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ8"
                     /translation="MAVNELLYLYAGENKPRIKLTCTHTFRSVESLAAYMQEVQDNYY
                     LELQTCMTITDNLKIYSNTRSADDLFYILEFNEVNRSLYLWKSEGSWDVNDAIASFYS
                     RNVVEDKEANVERNSVDRFLSDRRCGKYLDREEWRNFIRGIDFNWAEKGAMDSFWGFF
                     LELMNLEEKKSVCTGNDVDSEGKLLVYRSLIILSILKTRVLQNKIKLKATFLEYYNRM
                     AGLGSRSPSIDSSYSSAASILEENIEELKTCEGDTSQDENELDINYLYEKPVPQYSMH
                     DKNKINRIHKKLTTKNIDNSTIVDNFNKHFKYIIDDYETYHLKFNQIKKRKYTKRNSL
                     PSTD"
     gene            <608496..>609356
                     /gene="TPHA0I02760"
                     /locus_tag="TPHA_0I02760"
                     /db_xref="GeneID:11534634"
     mRNA            <608496..>609356
                     /gene="TPHA0I02760"
                     /locus_tag="TPHA_0I02760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687163.1"
                     /db_xref="GeneID:11534634"
     CDS             608496..609356
                     /gene="TPHA0I02760"
                     /locus_tag="TPHA_0I02760"
                     /inference="similar to DNA sequence:INSDC:YJL079C,YKR013W"
                     /note="similar to Saccharomyces cerevisiae PRY1 (YJL079C)
                     and PRY2 (YKR013W); ancestral locus Anc_1.291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687211.1"
                     /db_xref="GeneID:11534634"
                     /db_xref="GOA:G8BXZ9"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:G8BXZ9"
                     /translation="MKLSNLTIAAVASAAAVAAAPAVVVEHVHASPTITVQGYVYFEN
                     GVAQTSYTTIDDSTKTQAAAVAAAVVPTLVANANVADSTSSTSTSTSTTTLTQQSTTS
                     SSTTTTEVAAPSTSSTSTQAAAPSTSSTAQAAATTAVATTDSSLSDFANEMLNAHNAK
                     RALHQDTNSLEWSSDLASYAQNYADNYDCSGTLTHSGGSYGENLAAGYDGADAVEAWY
                     SEISSYDFSNPAYSSSTGHFTQLVWKSSTQVGCGFKQCNNDWGTYIICSYNPAGNYIG
                     QFAENVGNLL"
     gene            <610421..>614296
                     /gene="TPHA0I02770"
                     /locus_tag="TPHA_0I02770"
                     /db_xref="GeneID:11534635"
     mRNA            <610421..>614296
                     /gene="TPHA0I02770"
                     /locus_tag="TPHA_0I02770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687164.1"
                     /db_xref="GeneID:11534635"
     CDS             610421..614296
                     /gene="TPHA0I02770"
                     /locus_tag="TPHA_0I02770"
                     /inference="similar to DNA sequence:INSDC:YJL080C"
                     /note="similar to Saccharomyces cerevisiae SCP160
                     (YJL080C); ancestral locus Anc_1.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687212.1"
                     /db_xref="GeneID:11534635"
                     /db_xref="GOA:G8BY00"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8BY00"
                     /translation="MAGYPKLNANTASEFIGEASPALSLNSGTPTRASISIDTTEVSA
                     TSSIFNPENEDDIEDFSEEEIIEEVIPVEEIPVEEAPVEDAPVEDAPVEEAPVEEAPV
                     EEAPEEQVSPSEIIVDQKDAVIQAPKKVSIKDLPTLASNVDIPVFSTGWGSNVKPKQI
                     DTKAMKSLSGSFPSAAAVEAKPMRSKHIQESFKINGDTSSKSNKVNYTEIASSVKKQF
                     KVSIESTTSATGRLIIVSGNSDDVINAKRILLKRLEKPVNVELQVPTSCKPAIIGLGG
                     RNIRELISKYQIRIHIEDKPIQDSFDENLNDTLTNIELYGDSASVDLVKKNINTTVKE
                     ETKNATFRVPVENKSLIAYINIKDVNDAKTHSSIKVQFNEKNEEFTISGSREEAKEVM
                     NEVKSYLSNLSASIEEENIKIPYKFQVLIDAYEIRKTFNVTVEFPKTQEEETVRFVGP
                     KDKVSEAINFARTTSKDYLIEVLDISRSHSNNLEHAKRLVLLFEKYNSLKKIAAEYEG
                     VKFYLPSFQKFENSKSVEIIITSLKDSSKLLKFARKEIINLVDGISPADLLIIDDIEY
                     ELFHRETSTILEANTDIVKFIQLGDVATGNNEIVLAAYNESNDFKPAADEIKSILEKS
                     NKSLDKIRESQHSLASETLMMESNLQDELLNSNSKPYLLIDEEIEKHNGSIQIKLHTP
                     DSDSVLIRGHEKSIKLAKKSLSMIIENPERKHNEVIDVPADVLSRFIGVKGANIQAIR
                     SKYDITTQFADADTKPQSKEPMKVTLIGIQYNVKRAVEFINTEIKRWSDIITKEFIAP
                     LQYHAALIGRRGANLNHLQNKYSVNINFPRENTVVTIRGPSRLVNQAYDELHDLLEFE
                     MKNSNKVVVKVPVAQISRVIGKSGQMINDLRAAYGVEMDFIEETNDLASLKTDQVQLE
                     IVGTKEAIKEASEKVTSILFNSTNFTTENIEVDQKYYKNIIGQNGATLRDIIFKSGGD
                     HLSMTRPINIPRTGAKETHITVQGPKEFVKRAITHIKEIVANAENSITKELDIESGSQ
                     GALIGPAGTVRRQLESEFKITLQIPNRGDTKSKVKLIGLPENIEKAEKKIFTEIIKKN
                     FDLEVNVPASIHEFVSERGAFAQSLRINQFVSVRYGSYTKLANTLNNRALSIPIDDVS
                     GNDDEKLKLTITSAPISADSQRTEIIPWRIRYEPVELEGLLSDDSEFSSDEEKKNHML
                     NLAKQLIEKRISLAPTANTVGYIWAKDTSKFNSVVGPAGTRIIKLRDITGCIINIPRN
                     SEKIKNVIYVRGTESDVKACTQTIMDLLK"
     gene            complement(<614605..>615231)
                     /gene="TPHA0I02780"
                     /locus_tag="TPHA_0I02780"
                     /db_xref="GeneID:11532866"
     mRNA            complement(<614605..>615231)
                     /gene="TPHA0I02780"
                     /locus_tag="TPHA_0I02780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687165.1"
                     /db_xref="GeneID:11532866"
     CDS             complement(614605..615231)
                     /gene="TPHA0I02780"
                     /locus_tag="TPHA_0I02780"
                     /inference="similar to DNA sequence:INSDC:YKR014C"
                     /note="similar to Saccharomyces cerevisiae YPT52
                     (YKR014C); ancestral locus Anc_1.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687213.1"
                     /db_xref="GeneID:11532866"
                     /db_xref="GOA:G8BY01"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY01"
                     /translation="MLQFKLVLLGDSSVGKSSIVYRFVKDSFDEFRESTIGAAFLSQT
                     ITLEENNQVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTAPDSLMKAKSWIEE
                     LKKKVGNEELVICLVGNKVDICEEDDTKRKIEFEEAKDWANDENLLFYEVSAKTGYNV
                     KEVFQKIGEQLYEYKKAEQANKGTQDNSNITSNIRLQEPQASNPTSCC"
     gene            complement(<615778..>617829)
                     /gene="TPHA0I02790"
                     /locus_tag="TPHA_0I02790"
                     /db_xref="GeneID:11532867"
     mRNA            complement(<615778..>617829)
                     /gene="TPHA0I02790"
                     /locus_tag="TPHA_0I02790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687166.1"
                     /db_xref="GeneID:11532867"
     CDS             complement(615778..617829)
                     /gene="TPHA0I02790"
                     /locus_tag="TPHA_0I02790"
                     /inference="similar to DNA sequence:INSDC:YJL083W,YKR019C"
                     /note="similar to Saccharomyces cerevisiae TAX4 (YJL083W)
                     and IRS4 (YKR019C); ancestral locus Anc_1.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687214.1"
                     /db_xref="GeneID:11532867"
                     /db_xref="GOA:G8BY02"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8BY02"
                     /translation="MIDNIFQLGKNNHKHALLQLNDKEQSDSLQAAQLTFRKFSDPGA
                     ASPQTRAGEQQALKQGQRRGRYLSSRSLRNDNSLSTQFHKFNFNSKSGLNYPKSNQKL
                     KAKHDISEIVSHTQTSGNVSPINEGNPANPRKEISPIDIAVVAANLANSYVDDQTPTS
                     TEFNTVHRVSKGDISTRKDSSPEYVGVKDDSKYELIDAPSTINSHYQGTGHQVPGKNI
                     NSIAREDIFERRNSDTALARMHKSSLKKKNEGIIAKNKLAVNNHINTTGLDNHSNEFQ
                     SPLSHSRVELYSSDSPDNDQYTTTSPNDYSDVENILNLAKNVDSNSLNVSKFAPSSLF
                     EKQKQNYSTSSIGHPNVPPKKVTYQGTLPDLIPNYTRNSTLGKIKAKLLRSAASKTIV
                     PIKSTVTEDENGKTFIKTQNNTKFKSTMRQHDNSSGKEYYDTANSDKDLDEYDSYSDE
                     DDFDSDDEDGIYTDSKNDNSSKSKISSQEDNVKNRVRTLRQSEIGHNFYSPTSETGYR
                     NKFDEDRPWRSHQDLFIITTEERKRYEGMWVSNRYRYLSLVPWYQKMMDGEEVEFQSL
                     PDEGLIMNQVVKDIWLRSNLPIDLLIKIYNFVDKRRDATLDRDSFIVGMWLVDQCLYG
                     RKLPKQIPNSVWNSTNKYNMNKITRATAKNLKKQKEKLRKKEMKLIKKENKLANTNLE
                     I"
     gene            <618372..>618848
                     /gene="TPHA0I02800"
                     /locus_tag="TPHA_0I02800"
                     /db_xref="GeneID:11534337"
     mRNA            <618372..>618848
                     /gene="TPHA0I02800"
                     /locus_tag="TPHA_0I02800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687167.1"
                     /db_xref="GeneID:11534337"
     CDS             618372..618848
                     /gene="TPHA0I02800"
                     /locus_tag="TPHA_0I02800"
                     /inference="similar to DNA sequence:INSDC:YKR020W"
                     /note="similar to Saccharomyces cerevisiae VPS51
                     (YKR020W); ancestral locus Anc_1.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687215.1"
                     /db_xref="GeneID:11534337"
                     /db_xref="UniProtKB/TrEMBL:G8BY03"
                     /translation="MPEQIAHKKSSSVKISNKDKRLLLKEVYKLDDEANGTLSGNDQD
                     GNKNQTSNNNDAVPMNDAKPTAQLTSNDMDSDNDDTLEVENLEGKPLNELEFKDLLHI
                     HNRLLRKETDTNNSIKNVIYDNYYDLIKVNDLLKEMTDDNHTKLEQLRVTLEYITK"
     gene            complement(<618926..>619897)
                     /gene="TPHA0I02810"
                     /locus_tag="TPHA_0I02810"
                     /db_xref="GeneID:11534338"
     mRNA            complement(<618926..>619897)
                     /gene="TPHA0I02810"
                     /locus_tag="TPHA_0I02810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687168.1"
                     /db_xref="GeneID:11534338"
     CDS             complement(618926..619897)
                     /gene="TPHA0I02810"
                     /locus_tag="TPHA_0I02810"
                     /inference="similar to DNA sequence:INSDC:YJL088W"
                     /note="similar to Saccharomyces cerevisiae ARG3 (YJL088W);
                     ancestral locus Anc_1.279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687216.1"
                     /db_xref="GeneID:11534338"
                     /db_xref="GOA:G8BY04"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="UniProtKB/TrEMBL:G8BY04"
                     /translation="MSQIRHLISIKDLSDQEFSILVNRAEYYKNVFKSNDLAEFQKNH
                     LKLIGRTIALLFSKRSTRTRISTEGAAAFFGAQSMFLGKDDIQLGTNESFYDTTKVVS
                     SMVSCIFARVNSHDDIQNLCKDSSVPIINSLCDKFHPLQAICDLLTIKEHLDYTNNKL
                     KLAWIGDANNVINDLSIACLKLGIDVIVATPDGIELDKDIFEEAKKIAKKNNCQFEIT
                     HDSEKGSAGANVLVTDTFISMGEEYAKKIKLKQFKGFQINSQLAALAAPNYKFMHCLP
                     RHHEEVTDEVFYSENSIVFQEAENRLYAAMAVIDVFVINKGNFNAAA"
     gene            complement(<620925..>624059)
                     /gene="TPHA0I02820"
                     /locus_tag="TPHA_0I02820"
                     /db_xref="GeneID:11534694"
     mRNA            complement(<620925..>624059)
                     /gene="TPHA0I02820"
                     /locus_tag="TPHA_0I02820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687169.1"
                     /db_xref="GeneID:11534694"
     CDS             complement(620925..624059)
                     /gene="TPHA0I02820"
                     /locus_tag="TPHA_0I02820"
                     /inference="similar to DNA sequence:INSDC:YJL089W"
                     /note="similar to Saccharomyces cerevisiae SIP4 (YJL089W);
                     ancestral locus Anc_1.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687217.1"
                     /db_xref="GeneID:11534694"
                     /db_xref="GOA:G8BY05"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8BY05"
                     /translation="MPRLASTRETTKLQVEVKNRKKRKYGNRNNSVAPRALVPVPDQH
                     SLKEKPVGNQHDDFHGMKDSLKLGNEHYDNDINIRLSQACDRCRLKKIKCDGLKPSCT
                     HCSKIKFACKTSDRLTRRGFPKGYTEMLERQVIELQHKLKLLETQSPSIEGNTSSVQN
                     KKLIENCCSDNSTAQSSTLETEKNLIDRSEFWDVIIKDSLYSAETLLNEKFTKNFIDK
                     EWLVDFQLSILISNLQLNPQYNYLPNFLINKANTNLAQLKELIDLSINNFTVIQNSIL
                     PLLYSNDDLVEVSNLTNNTINKNPINIMIICYIIQLNWSCFDKFKLFEVTKTVIINNY
                     YHFKDVNKQNQNIKILNLLNLSIYYYMSVIDSNNLSIINDLFNITTVFINDALKTSNF
                     INKDQIKNKPMKKSLDNDIYANYSIANRNELIKNRSISITCYKFLLKWWNLLHKKDIR
                     LIANLNTEYDSDLLLGIYDEKLNLFKILNEFVSIVSTNIMLPNEQLSIHFQDYENVLI
                     KKNLYFNNNENFLEKTLTTDECKSLQMTLYYLILQAVLINPATNNSLYTASKNNYKTK
                     YPKKNQNITINDNSTLIQDQSKVENSFQILLKYHSFLTNGNFSLKDQPQQFYVKYFLP
                     CQNTEIIRFSLLHLNSWSVTNTKKFDGDLTLPENWNLLRYKTFLTRFCTLWFFDDMKN
                     VLLVELQNNFKFDLSLKLKLSNTNLNKYNKLGYLQSVSNFNDTNKIGNGYNFSFFFGG
                     RTNLLKCNSDAIMDQFDMFTDNNIVDPTNTNPDLEYVATEGNIGRNQNIANAEHAPSM
                     RDHLENCKPNIVDNTGFYQPLFESFSLKSLTQLDGNNNLVDVGKYSSEFLLNQEETDD
                     GYAEDDDEDDFTNDNLQPLEIPFVHKRHKSLFQSRYDRSPATLIKTKEYMNKNKVAKN
                     NQSSMTSNVSAIILPGNAQTLQDNQVKLDHMILNNSLKPVSHEPLSPSAVNCRPEATE
                     DSKPDERDNTTAKYKTDGASSLNGHKAQNLLQSPNKTPSFNNFNFIETTRSFSDMLFL
                     KSNSQLNLLKKIQD"
     gene            complement(<625081..>626052)
                     /gene="TPHA0I02830"
                     /locus_tag="TPHA_0I02830"
                     /db_xref="GeneID:11534695"
     mRNA            complement(<625081..>626052)
                     /gene="TPHA0I02830"
                     /locus_tag="TPHA_0I02830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687170.1"
                     /db_xref="GeneID:11534695"
     CDS             complement(625081..626052)
                     /gene="TPHA0I02830"
                     /locus_tag="TPHA_0I02830"
                     /inference="similar to DNA sequence:INSDC:YJR100C"
                     /note="similar to Saccharomyces cerevisiae YJR100C;
                     ancestral locus Anc_7.472"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687218.1"
                     /db_xref="GeneID:11534695"
                     /db_xref="InterPro:IPR005552"
                     /db_xref="InterPro:IPR025659"
                     /db_xref="UniProtKB/TrEMBL:G8BY06"
                     /translation="MKTSRVEMFICNRIPLLVRRSLSTTHLVKQAVGNPSFRRRPSHD
                     HKNRISYTNYSDVSTEKASILSSTPVATSILNEPTIIIERQIEVMNIVVGFEQANKYK
                     IMDVRGNALGRIEERDYSIGKAALRQLSKLHRPFTVDVFDNYNNVILTIKRPFSWVNS
                     HIQAILPNEETGQFDEGSQVVGESVQKWHAWRRKYELFANTRDEEQTSSDPYFKQFGV
                     IDAPFLSFEFAVRDKNNKIIGGVDRNWVGIGRELFTDTGIYIVRFDSTRSFENIYPPE
                     TLSTNVMTLDERAVLLANAISIDFDYFSRHSRSTGGGLLTFGGDGYE"
     gene            complement(<626804..>627271)
                     /gene="TPHA0I02840"
                     /locus_tag="TPHA_0I02840"
                     /db_xref="GeneID:11534696"
     mRNA            complement(<626804..>627271)
                     /gene="TPHA0I02840"
                     /locus_tag="TPHA_0I02840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687171.1"
                     /db_xref="GeneID:11534696"
     CDS             complement(626804..627271)
                     /gene="TPHA0I02840"
                     /locus_tag="TPHA_0I02840"
                     /inference="similar to DNA sequence:INSDC:YJR104C"
                     /note="similar to Saccharomyces cerevisiae SOD1 (YJR104C);
                     ancestral locus Anc_7.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687219.1"
                     /db_xref="GeneID:11534696"
                     /db_xref="GOA:G8BY07"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /db_xref="UniProtKB/TrEMBL:G8BY07"
                     /translation="MVKAVAILKGDTEVSGIVYFEQKSEDEPTTVTYEITGNTPNSER
                     GFHVHEFGDVTNGCTSAGAHFNPFNKTHGHPNSEDRHVGDMGNIKADAKGVAKGAFTD
                     KLVKLIGPTSVIGRSVVVHSGTDDYGLGGHADSLTTGNAGGRNACGVIGVTNA"
     gene            <629162..>630997
                     /gene="TPHA0I02850"
                     /locus_tag="TPHA_0I02850"
                     /db_xref="GeneID:11534357"
     mRNA            <629162..>630997
                     /gene="TPHA0I02850"
                     /locus_tag="TPHA_0I02850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687172.1"
                     /db_xref="GeneID:11534357"
     CDS             629162..630997
                     /gene="TPHA0I02850"
                     /locus_tag="TPHA_0I02850"
                     /inference="similar to DNA sequence:INSDC:YBL042C"
                     /note="similar to Saccharomyces cerevisiae FUI1 (YBL042C);
                     ancestral locus Anc_7.481"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687220.1"
                     /db_xref="GeneID:11534357"
                     /db_xref="GOA:G8BY08"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G8BY08"
                     /translation="MHQFSSDSQSVSSMSKDKATGYSLNKDDDIILTSKSIGDDFITE
                     TVSEQESIDKVYDNDASGWFHKAIEYLSVKGPNGEQGIVETYLYNDDLRPVEAERRVW
                     TWRQYIYFWISGSFNVNTWQISATGLQLGLNWWQTWICIWVGYFFVAIFLVAGSRVGN
                     MYHISFPIASRISYGPYFAIWVVLNRVVMACVWFSTLAWLGGECVQLMLRTIFGNDLP
                     QRLGDHIQDPNLNNYQFMCFMLFWIVGLPFLWFPPHKLRHVFAVKAVLAPIAAFAFLI
                     WTLIKADGKLAFGNLTGGSALSKSATAWAVIRSIMSALDNFSTLILNAADFSRFAKSP
                     KSSTYSQFIALPLCYAIISLIGILTTSAAYNMYGINYWSPLDVLDRYLDNFNKGNRAG
                     VFLISFVFAFDQLSSNLAGNAIPAGTDMTALFPKFINIRRGSYICAALALCICPWDLM
                     ASSSKFTTALSAYAVFLSAIAGVQFADYFIVRKGYINVYHCYTNRMDSFYMYNKYGTN
                     WRAVVAYIAGIVPNFTGFIGSLEISVPEGAMKVYYLNYFIGYFVSALVYIILVYYFPI
                     KGVPNNAKITDRVWYESWIEVENFTETRASYEKFGDENVEVRQSV"
     gene            complement(<631549..>632058)
                     /gene="TPHA0I02860"
                     /locus_tag="TPHA_0I02860"
                     /db_xref="GeneID:11534358"
     mRNA            complement(<631549..>632058)
                     /gene="TPHA0I02860"
                     /locus_tag="TPHA_0I02860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687173.1"
                     /db_xref="GeneID:11534358"
     CDS             complement(631549..632058)
                     /gene="TPHA0I02860"
                     /locus_tag="TPHA_0I02860"
                     /inference="similar to DNA sequence:INSDC:YBL043W,YJR115W"
                     /note="similar to Saccharomyces cerevisiae ECM13 (YBL043W)
                     and YJR115W; ancestral locus Anc_7.483"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687221.1"
                     /db_xref="GeneID:11534358"
                     /db_xref="UniProtKB/TrEMBL:G8BY09"
                     /translation="MDSDLDIRQCYAMASLARTKLFNAGRQMYNLKTSRRRDIQLRVV
                     IGHANLLDSVMDKICLYNSSPMPIHYQSATAIDNDDDNVNAPPSVSDTSDDYDDSDES
                     EDSDLDYDELDIFSDEEDNEYVLDSANKIELQLSRSNSESNDLADMRMPSFVMSQNLQ
                     LPVFKTIGV"
     gene            <632499..>632972
                     /gene="TPHA0I02870"
                     /locus_tag="TPHA_0I02870"
                     /db_xref="GeneID:11534322"
     mRNA            <632499..>632972
                     /gene="TPHA0I02870"
                     /locus_tag="TPHA_0I02870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687174.1"
                     /db_xref="GeneID:11534322"
     CDS             632499..632972
                     /gene="TPHA0I02870"
                     /locus_tag="TPHA_0I02870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687222.1"
                     /db_xref="GeneID:11534322"
                     /db_xref="UniProtKB/TrEMBL:G8BY10"
                     /translation="MGLPQIGEGLINVSGHLTMVTNQKETKIVLKVIESVYELGKSVV
                     GNAKFRVTDTLEWVNMVGVAVGGCCRTSLQEPIRQKNAIQGEAACVLCVASETELTEK
                     LNAENTPTVACRDRVCEMNADSSQLPRTVGGGKKCHVLTRYPNNTTIVITCRQAD"
     gene            <633548..>634918
                     /gene="TPHA0I02880"
                     /locus_tag="TPHA_0I02880"
                     /db_xref="GeneID:11534323"
     mRNA            <633548..>634918
                     /gene="TPHA0I02880"
                     /locus_tag="TPHA_0I02880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687175.1"
                     /db_xref="GeneID:11534323"
     CDS             633548..634918
                     /gene="TPHA0I02880"
                     /locus_tag="TPHA_0I02880"
                     /inference="similar to DNA sequence:INSDC:YBL045C"
                     /note="similar to Saccharomyces cerevisiae COR1 (YBL045C);
                     ancestral locus Anc_7.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687223.1"
                     /db_xref="GeneID:11534323"
                     /db_xref="GOA:G8BY11"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8BY11"
                     /translation="MLRNSNNLVKNGILRRFLSTRPEVTELSNGVSVVTRYNPNVAHN
                     TTGLVFGSGSSAENPYNNGVSHVCSSLFSRHNKKVNADAVKQGFKLDSLVDREYQSFL
                     VTSAGSANLAKALDCLNTSFAETTQNVNQSDFDQSKTLITEELYKLENKNKFQQERVM
                     EHLHSTAFQNTPLSLPKRGTMESVQSLVTDDLKEFASVNYNNTNVIVVNEGNIQHNDF
                     IELLESKNFKLSNEHKPTLPKSTFLGSEVRLRDDTLPKAYFAIAVEGESIRSPDYLTS
                     QVAAEIFGSYNALEPKSRLQGVKLIDQFQEYNIAEMYDHFSLSYKDSGLWGFRAVTSE
                     FNSIDEVVHFTLKQWNRLTISITETELARGKQLLKLKLASNLESNPNVTQIVSELGYQ
                     ALNGNIRPTLAEQFALIDKITVKDIKNWASKRLWDQDVAIAGSGQIEGLLDYMRIRND
                     MSMMRW"
     gene            complement(<635136..>636410)
                     /gene="TPHA0I02890"
                     /locus_tag="TPHA_0I02890"
                     /db_xref="GeneID:11534377"
     mRNA            complement(<635136..>636410)
                     /gene="TPHA0I02890"
                     /locus_tag="TPHA_0I02890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687176.1"
                     /db_xref="GeneID:11534377"
     CDS             complement(635136..636410)
                     /gene="TPHA0I02890"
                     /locus_tag="TPHA_0I02890"
                     /inference="similar to DNA sequence:INSDC:YBL046W"
                     /note="similar to Saccharomyces cerevisiae PSY4 (YBL046W);
                     ancestral locus Anc_7.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687224.1"
                     /db_xref="GeneID:11534377"
                     /db_xref="InterPro:IPR015267"
                     /db_xref="UniProtKB/TrEMBL:G8BY12"
                     /translation="MSVKSDGLLDDVGVNMMGIKSANLYKLLNTIVDKKDVTILTVTD
                     PKDLFPDLIYHLTTVIPNELFRSPPTAFVDKAMKQLEDIGEYLKKKFMEKSEYPFTIV
                     RICELCYDPFKYYKVFELEKFTRAITRCCYVTSYWNTRGSSRVNEIVLHDESNKKEIT
                     DDVALTKIPWITKSMEEKLIPFAKCIDEIMSINLGFDDDEEDDDIDIETDKNNYSDPR
                     QNMNMNSDDIMIEEYYEEEDGKYDDLGDDRKDVDEDEDEDEDDFDYVEKPEDEEEYDD
                     DNVDEEEEREYNDANDSNEADENEIENRDDNNEFQDMKVSSYKRRTTEVDDFDYKNES
                     DGSLEEQSITPKKLRQYNMIMSTSPMMSVNARGTNIPNVNIEEKNILVSPDSLQLSDK
                     DELTISKKKEYIDNYDNSNKNDSPLTSKVRKA"
     gene            <636781..>637560
                     /gene="TPHA0I02900"
                     /locus_tag="TPHA_0I02900"
                     /db_xref="GeneID:11534378"
     mRNA            <636781..>637560
                     /gene="TPHA0I02900"
                     /locus_tag="TPHA_0I02900"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="XM_003687177.1"
                     /db_xref="GeneID:11534378"
     CDS             636781..637560
                     /gene="TPHA0I02900"
                     /locus_tag="TPHA_0I02900"
                     /inference="similar to DNA sequence:INSDC:YJR113C"
                     /note="similar to Saccharomyces cerevisiae RSM7 (YJR113C);
                     ancestral locus Anc_7.486"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="XP_003687225.1"
                     /db_xref="GeneID:11534378"
                     /db_xref="GOA:G8BY13"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:G8BY13"
                     /translation="MLRLKVSSAPLKCLNGRLLNVSKIGTQICLSKRFESGKVEAKVK
                     PPINMSDEDVDGWLKTLSTLKEEFSQTEYLPEHSLSPPGQSKIDIAQEAANMNKDFIP
                     TEEQLLELDLVKSQPFMKMKDPVLTHITNMIMKDGKKQRAERTISKALYIVFCKTRED
                     PVEILKKCLDDLAPLMLVKTFNTGVAKSAVIPVPLNKRQRDRLAWKWIIEGANKRASN
                     DFSVRLGEEILSVHDGNSSGFEKRDQLHKTAIVHRSYIKLK"
     gene            complement(<637778..>638263)
                     /gene="TPHA0I02910"
                     /locus_tag="TPHA_0I02910"
                     /db_xref="GeneID:11534379"
     mRNA            complement(<637778..>638263)
                     /gene="TPHA0I02910"
                     /locus_tag="TPHA_0I02910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687178.1"
                     /db_xref="GeneID:11534379"
     CDS             complement(637778..638263)
                     /gene="TPHA0I02910"
                     /locus_tag="TPHA_0I02910"
                     /inference="similar to DNA sequence:INSDC:YJR112W-A"
                     /note="similar to Saccharomyces cerevisiae YJR112W-A;
                     ancestral locus Anc_7.487"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687226.1"
                     /db_xref="GeneID:11534379"
                     /db_xref="UniProtKB/TrEMBL:G8BY14"
                     /translation="MTSSSDALVTFEPNGIPVRKKYLISLFSQFCLLFYILGIAVNSK
                     LTFITSDHDKVAHFTVFLLESYLFVKCFEMKIIATLKWKKFTSRAKDQESLRDITYST
                     IMINKYQVGFVFCSIGVSVGSEFMQFILSRGRRSFDPMDMGFNFMGSLLGLSIAFLQE
                     R"
     gene            <639184..>642786
                     /gene="TPHA0I02920"
                     /locus_tag="TPHA_0I02920"
                     /db_xref="GeneID:11534647"
     mRNA            <639184..>642786
                     /gene="TPHA0I02920"
                     /locus_tag="TPHA_0I02920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687179.1"
                     /db_xref="GeneID:11534647"
     CDS             639184..642786
                     /gene="TPHA0I02920"
                     /locus_tag="TPHA_0I02920"
                     /inference="similar to DNA sequence:INSDC:YBL047C"
                     /note="similar to Saccharomyces cerevisiae EDE1 (YBL047C);
                     ancestral locus Anc_7.488"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687227.1"
                     /db_xref="GeneID:11534647"
                     /db_xref="GOA:G8BY15"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8BY15"
                     /translation="MSSIVLSTPLTAEEQQFYGRKFSELDPEQLGIVTGEAIRPLLAS
                     SGLPSTVLSQVWATVDVNQQGFLNFNEFSATLRILGHLEKNQNIPISKELYSVPPSPL
                     ASFGSGMTRNVSAMSSGGPVPIPPISQHDVNNLSALFDRTANGAATLSGAAAREIFVK
                     APLDNQILGRVWALCDRSDIGSITKVEFLMAMHLINLSISKSPSVTPFPQSIPQAAWD
                     SMQRLLNSSVSAVPTTNSFAVHSTGDSLPSATSPTSTQNQLPRGGLQRQSTISRLSSG
                     AFTSAPTDWQLTAEKKQQFDTLFDSLDKAKTGRLSSQILVPFFVSSKLNQDVLATIWD
                     LADIHNSTEFTKIEFAIAMFLIQKKNAGIELPDVIPDQLLRSPALGLVQAQQPIQQQQ
                     PVQQQPVQQYVPEQQRAQAPLTQPQQHMQPSAPLQETQNTGSLNDLLALNESFNSPVR
                     AQSQPQVQQNFVSQEPVIQPFKKFTPTSNFGQSIIKEEDENELSAQQPTQQQYVQQPV
                     QQPVQQPVQQPVQQPVQQPVQQPVQPVQKLSVQQPVQQPVPVPIPVQTQAQTPQSTVN
                     PGFTEFQNKSVSARNTSNSLQRAPSVSLKTVPNFGSFGGAVGAAVGGAVGGAAIGAAN
                     LMRSSDLFADSKSSLELSNATTELANLSNQVNSLSKQAAITNEKKNKASQELRTLNET
                     KLKVENRINALRAAHEQNSMQTQKLEASLAQIMAENEQLETTLQEVTSTHTQLQTDAQ
                     LLDENLTKTQTQNSELKEQLANSNIMSKSLQEQLRSKQIEIRDVKASADATVKDLALD
                     TFTAASVGHELASITEKLAVYQSKQKELDDYERTIESQHETIEKKFKELEEKKNDIEA
                     RKSQLQERLIQVQEQDGLYQQHVASLDIMSNDLKKRQATFDEANDNLRQQYLDYVQRV
                     NDVKEKGLNPSHMLDQNSHDEEVSKFVDDSVANSSLGKQDLNNESHIIKTPVEKEISD
                     HKTTSTIVEPLPGDWEIPDAPSPVENSVQPVVATTGAVSSDDDDDDDDDDDDIFQDTR
                     EDFINSYELGENEAFALEKDTFNDDFLGLEQTNIENDVNNVLEDTHSAESFEDIDADN
                     LSQELENNDFTTFSDFGPTSVATPVDTNVAAQPGNNEWDDLFTGFGNAKQTSNANTAN
                     QQPVQETQRTMDNSQPTIDRALATTPKSLAMEELCGMGFSQEEAKAALEKTVGT"
     gene            <643330..>644178
                     /gene="TPHA0I02930"
                     /locus_tag="TPHA_0I02930"
                     /db_xref="GeneID:11534648"
     mRNA            <643330..>644178
                     /gene="TPHA0I02930"
                     /locus_tag="TPHA_0I02930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687180.1"
                     /db_xref="GeneID:11534648"
     CDS             643330..644178
                     /gene="TPHA0I02930"
                     /locus_tag="TPHA_0I02930"
                     /inference="similar to DNA sequence:INSDC:YJR111C"
                     /note="similar to Saccharomyces cerevisiae YJR111C;
                     ancestral locus Anc_7.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687228.1"
                     /db_xref="GeneID:11534648"
                     /db_xref="GOA:G8BY16"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:G8BY16"
                     /translation="MANILNPQRLVQLSRFSPKLSNTWYLIAAVTFSVCNAPQEIPIL
                     YHYVMLLQNKQHGMQAMNQFAQRAVQLCLDNKLNRKEEIDEMYRNPSNFDKRLAERFR
                     ETLLKTGPLAGLPKAINSLHHLSNSTPASLRPHVENLDPKDQCTSKRETYKNTVLRVK
                     DEDENMDRLRERGLAHWNEIYDKVSPRVMNDLNSCYPDLWYYTFNNVYSPLFSFDEIL
                     TKTETSLIIIASLVPQDVNPQLKGHLRGALNVGCDKETVEAARSLSIMIAQFCGVKWK
                     SEIVKL"
     gene            complement(<644288..>646450)
                     /gene="TPHA0I02940"
                     /locus_tag="TPHA_0I02940"
                     /db_xref="GeneID:11534380"
     mRNA            complement(<644288..>646450)
                     /gene="TPHA0I02940"
                     /locus_tag="TPHA_0I02940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687181.1"
                     /db_xref="GeneID:11534380"
     CDS             complement(644288..646450)
                     /gene="TPHA0I02940"
                     /locus_tag="TPHA_0I02940"
                     /inference="similar to DNA sequence:INSDC:YJR110W"
                     /note="similar to Saccharomyces cerevisiae YMR1 (YJR110W);
                     ancestral locus Anc_7.491"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687229.1"
                     /db_xref="GeneID:11534380"
                     /db_xref="GOA:G8BY17"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8BY17"
                     /translation="MDYIKVTKVDDVILHRRGNSFKGTLHLTTHHLIFASESLSREFW
                     VSYPIITSVFKNKGSALFSKEKVYKETNLVNNDIVTNELNNFTNLNTLNITTNENVNK
                     WYEGRDLWSFTNIKIIGKDYTVFSIDFLFEEDAKNVYDTLLKLTVLDDISQLYAFIYK
                     PNKTELQYNSWDIYDEVSEFSRQGLDLESESCPWRISSINCDYDFSKTYPDKIIVPRN
                     VSDSTLKYASKYRSKERIPVLSYFYKKNKCSIIRAAQPLPGLTKQRSIQDETLVLSSF
                     NCSHLNTSDQKNDPINAANKYTHSDRNIIVDARPVANAFGQTALGGGTENMDNYNYKN
                     TCQRMFLGIDNIHVMSSTLNYVVENYMVDGDLNLPIDSQLLNSNKGSNWIKYVRLILS
                     STDTLLKSMVFNNSNLLIHCSDGWDRTTQVCSLIQLCLDPYFRTFEGFMVLVEKDWIS
                     FGHKFLERSGHLSSESIFHDNTVGYKDIFTMSPNNDSPFNDDDDDDEDILFEKEEGIF
                     PSIDGLKNFSSSGILSLDLVTKFSGHFKKKKEKRSLKFTSPVFQQFLDCVYQLIIQNP
                     NKFEFNERFIRRLVYHLYSCQYGSFLSNNQHDMKANDIFSKTRSVWDYFRCREAEFIN
                     KNYIRPESDLNGPKKVSSIDNTFTSDQHDNDLVFPDLTNIQWWWQLYGRKDNEMNTIH
                     RNSEETQNINNHTTDNMMEKNNNISKYLPFGLEIFGKK"
     gene            complement(<647294..>647806)
                     /gene="TPHA0I02950"
                     /locus_tag="TPHA_0I02950"
                     /db_xref="GeneID:11534381"
     mRNA            complement(<647294..>647806)
                     /gene="TPHA0I02950"
                     /locus_tag="TPHA_0I02950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687182.1"
                     /db_xref="GeneID:11534381"
     CDS             complement(647294..647806)
                     /gene="TPHA0I02950"
                     /locus_tag="TPHA_0I02950"
                     /inference="similar to DNA sequence:INSDC:YBL049W"
                     /note="similar to Saccharomyces cerevisiae MOH1 (YBL049W);
                     ancestral locus Anc_7.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687230.1"
                     /db_xref="GeneID:11534381"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:G8BY18"
                     /translation="MGLRYSSYIDPVVPTEGKHLAEDISFQILDYRLANENGSRSWFT
                     PRTISSRLRRVSSSSASSTSHYKVSKNFVTYGCRTCRTHLSSYSQIMSKDYRGKTGDA
                     YLMHNVVNVVEGEPEVRSMITGDYIVCDILCHWCKNVVGWKYLESEKKEQRYKEGTYV
                     LELQTICKCD"
     gene            complement(<649001..>649975)
                     /gene="TPHA0I02960"
                     /locus_tag="TPHA_0I02960"
                     /db_xref="GeneID:11534382"
     mRNA            complement(<649001..>649975)
                     /gene="TPHA0I02960"
                     /locus_tag="TPHA_0I02960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687183.1"
                     /db_xref="GeneID:11534382"
     CDS             complement(649001..649975)
                     /gene="TPHA0I02960"
                     /locus_tag="TPHA_0I02960"
                     /inference="similar to DNA sequence:INSDC:YBL050W"
                     /note="similar to Saccharomyces cerevisiae SEC17
                     (YBL050W); ancestral locus Anc_7.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687231.1"
                     /db_xref="GeneID:11534382"
                     /db_xref="GOA:G8BY19"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8BY19"
                     /translation="MSDPNQLLAKAEKVGKPSSGFMKIFGSSDQSKYEEAADLCVQAA
                     TLFRLSKKLSNAGDCFVKAANYQINAGNDDEAANTFIDAYKCFKSSSSNGITSAMTSR
                     NNTPGLDENDTFITSDSSAQTDIQKAAVSLNRAVEIFTVKGQFRRGANFKFELGELYE
                     NDLQDYHSAMDCYELAGDWYSQDQAQALTNKCYVKLANLKALDADYIGAAKVYHQLVT
                     NSMGNRLSQWSLKEYYLKMALCQLAAKDNVAATRTLKEAKQNDSNFNNSRESVLLETL
                     IDCLNEGDSEKLSQAVFEFDKFNKLDKWYTTILLKIKESITEAEDNLL"
     gap             650894..650944
                     /estimated_length=51
     gene            <651061..>654399
                     /gene="TPHA0I02970"
                     /locus_tag="TPHA_0I02970"
                     /db_xref="GeneID:11534532"
     mRNA            <651061..>654399
                     /gene="TPHA0I02970"
                     /locus_tag="TPHA_0I02970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687184.1"
                     /db_xref="GeneID:11534532"
     CDS             651061..654399
                     /gene="TPHA0I02970"
                     /locus_tag="TPHA_0I02970"
                     /inference="similar to DNA sequence:INSDC:YJR109C"
                     /note="similar to Saccharomyces cerevisiae CPA2 (YJR109C);
                     ancestral locus Anc_7.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687232.1"
                     /db_xref="GeneID:11534532"
                     /db_xref="GOA:G8BY20"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:G8BY20"
                     /translation="MSIYKNTQPTVSIYNSECYNPQLLHDIKSVLIIGSGGLSIGQAG
                     EFDYSGSQAIKAIKDSNSNINIILINPNIATNQTSHSLADRVYYLPVTPEYITYIIEK
                     ERPDSILLTFGGQTGLNCGISLKENGILDKYNVKVLGTPIKTLVTSEDRDLFAKALNE
                     INIPIAESIACDNIDDVIASANKIGYPVIIRSAYALGGLGSGFANNDTELKNLASQSL
                     ALAPQVLVEKSMKGWKEIEYEVVRDHVGNCITVCNMENFDPLGVHTGDSIVFAPSQTL
                     SDEEFHMLRTAAIKIINHLGVIGECNVQYALQPDGLEYKVIEVNARLSRSSALASKAT
                     GYPLAYTAAKIALGYTLPELPNPITTTTVANFEPALDYIVAKIPKWDLSKFQYVNRDI
                     GSAMKSVGEVMAIGRCYEEAFQKAIRQVDPSLLGFQGSDEFEDLDEALKTPTDRRLLA
                     IGQALIVENYTVERVHELTKIDKWFLHKCSNIVDIYKYLAQVKDITQLSYKLLLKAKK
                     LGFSDKQIAKSINIEEQLIDELQIRELRKSKGIIPFVKRIDTLAAEFPADTNYLYITY
                     NATKSDIEFNDNGVLVLGSGVYRIGSSVEFDWCAVNAAKSLREQGKKTVMINYNPETV
                     STDFDEVDRLYFEELSLERVMDIYDLEHSEGCIISVGGQLPQNIALKLFENGYKTLGT
                     SPVDIDNAENRHKFSSILDSIQVGQPEWSENSTLESAEEFCNKVGYPVLIRPSYVLSG
                     AAMSVVNSEEELDKKLTLASDISPDHPVVISKFIEGAQEIDVDAVAHNGSVLVHAISE
                     HIENAGVHSGDASLVLPPQQISSAIKTELLSIAKKVAKAWNITGPFNMQIINDGIGPL
                     KVIECNIRASRSFPFVSKVLGVNFIDIAVKAFLSKHVPEPVDLMSKEYNYVATKVPQF
                     SFTRLAGADPFLGVEMASTGEVASFGANLIESYWTAIQSTSNFKVPLPPSGILVGGDL
                     TKNYIKNVVKTIDTLGFKIYVPNQSTYDYLTSEKEIQSEIIIAEIPADKSKLRKYFQQ
                     LDIQTVFNLASKKAEDTLDENYIMRRSAIDFAIPLFNEHETSLLFAKCLQKKVDEKIK
                     ILNSNDVVIPPEVHSWDEVLGFKA"
     gene            <654672..>654968
                     /gene="TPHA0I02980"
                     /locus_tag="TPHA_0I02980"
                     /db_xref="GeneID:11534533"
     mRNA            <654672..>654968
                     /gene="TPHA0I02980"
                     /locus_tag="TPHA_0I02980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687185.1"
                     /db_xref="GeneID:11534533"
     CDS             654672..654968
                     /gene="TPHA0I02980"
                     /locus_tag="TPHA_0I02980"
                     /inference="similar to DNA
                     sequence:INSDC:Scer_YGOB_Anc_7.495"
                     /note="similar to Saccharomyces cerevisiae Anc_7.495
                     (Scer_YGOB_Anc_7.495); ancestral locus Anc_7.495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687233.1"
                     /db_xref="GeneID:11534533"
                     /db_xref="UniProtKB/TrEMBL:G8BY21"
                     /translation="MNDAEDPYDWYYHNQKENKPENELKKTINDLNSASAQETYQRSL
                     PKEVYPELKPIPNNTASANGVRRQIEAYDVEKEDKTSKKRNAIRTRLQVINPPR"
     gene            <657332..>658669
                     /gene="TPHA0I02990"
                     /locus_tag="TPHA_0I02990"
                     /db_xref="GeneID:11534340"
     mRNA            <657332..>658669
                     /gene="TPHA0I02990"
                     /locus_tag="TPHA_0I02990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687186.1"
                     /db_xref="GeneID:11534340"
     CDS             657332..658669
                     /gene="TPHA0I02990"
                     /locus_tag="TPHA_0I02990"
                     /inference="similar to DNA sequence:INSDC:YER020W"
                     /note="similar to Saccharomyces cerevisiae GPA2 (YER020W);
                     ancestral locus Anc_7.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687234.1"
                     /db_xref="GeneID:11534340"
                     /db_xref="GOA:G8BY22"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY22"
                     /translation="MGVCGSKESADAHKGSNNNEAANVAKSKPTDSNSPNVTIRTKNK
                     NNNNSQDVPSHPSANSNVNKSSNAVDSKNSSTEDISDGLNTDMENADLSLTNSKTDAT
                     LSNEKHIPKVLLLGTGESGKSTVFTQLRIITNNKFDESERLSYRNSIHENILEIGEDL
                     ISGRRHFNITITEDEEKEYLISEKDLDFFVKESYELRCHNKMAELEQFPEHLVNILTK
                     LSQLPSTKDLLDDYEKISQIYLMDSIRYFIENLPRIAKANYSPSDQDIIRSRSKTSGI
                     HDAYINIGNNSKIHVFDVGGQRSERKKWIHCFNNVTVVIFCVSLSEYDQFLIEDKSQS
                     RFHESLVLFENIVNSRWFSRTSVVLFLNKIDLFVEKLKKVPLEKYFPDYTGGQDINKA
                     AKYILWRFFQLNRANLNIYPHITQATDTSNIKVLFSAVKETILQNNLKDSGVL"
     gene            complement(<658915..>660966)
                     /gene="TPHA0I03000"
                     /locus_tag="TPHA_0I03000"
                     /db_xref="GeneID:11534341"
     mRNA            complement(<658915..>660966)
                     /gene="TPHA0I03000"
                     /locus_tag="TPHA_0I03000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687187.1"
                     /db_xref="GeneID:11534341"
     CDS             complement(658915..660966)
                     /gene="TPHA0I03000"
                     /locus_tag="TPHA_0I03000"
                     /inference="similar to DNA sequence:INSDC:YJR106W"
                     /note="similar to Saccharomyces cerevisiae ECM27
                     (YJR106W); ancestral locus Anc_7.498"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687235.1"
                     /db_xref="GeneID:11534341"
                     /db_xref="GOA:G8BY23"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G8BY23"
                     /translation="MIWAFKLAHPKLLYEGATSLSFTFILSSSIQVIIYFILLGICAS
                     DYLCPSVASLSGSEESASSGVLAAVLLSWCNSSPDLFSNFMSWTSRSLDNDSNNKNFA
                     ALSVGEVLGACGIILCVVEGSIFMLMSFLDLNIMETQRKTILKDLGFTSVAILAMWYV
                     CVMNKVTVFNCIVMIMIYVIYLTSKFIYKGQKKADNVEDEEEPYNLELSSQTSDEGID
                     AFTGHIRPNILTAMDFNNLLSVLESSNKSVDQEQLTTLEAAYDDNLNMDDMLDIPRRA
                     STVPITEARYTDVPNFPNSAPETFQSYRDDPGHELMDDQYLHTFNMTVRSSKTKIMSK
                     YKKNFFRMFLPHLMHFSQKSKIDAILSVITSPFVIILRLSCPQPLKIIDYDIDTKKYV
                     YSKIDMAILFLQTLLSPLFSFFILSCIMSSNFSLFIWTIPILLSSLFIFLAVVYYRTI
                     IAYNKFSIFTSPSFGDAVISDSSAERRIIEKLTGLLRILLLVICITNTILWISLIANA
                     LIEILEIYQNITGISEAILGLTIFAWGNSVSDLISNIAMCNLYKKQPDSNGQNLTDIA
                     TKFFMISCSSCVGSVMLNSMGGIGVSGLFSMIFIHKESHRFWLLRNIVLNESEDGFEV
                     KFIVSCVALLIQVILLFLTFGGIKSSRDWIQSNKFGLGLTMCCLWALSTLINILLEIF
                     I"
     gene            complement(<661410..>662429)
                     /gene="TPHA0I03010"
                     /locus_tag="TPHA_0I03010"
                     /db_xref="GeneID:11534667"
     mRNA            complement(<661410..>662429)
                     /gene="TPHA0I03010"
                     /locus_tag="TPHA_0I03010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687188.1"
                     /db_xref="GeneID:11534667"
     CDS             complement(661410..662429)
                     /gene="TPHA0I03010"
                     /locus_tag="TPHA_0I03010"
                     /inference="similar to DNA sequence:INSDC:YJR105W"
                     /note="similar to Saccharomyces cerevisiae ADO1 (YJR105W);
                     ancestral locus Anc_7.499"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687236.1"
                     /db_xref="GeneID:11534667"
                     /db_xref="GOA:G8BY24"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8BY24"
                     /translation="MFQEKLVVLCNPLLDIQATVDAEYLKKYDLKANDAILVDAKSGD
                     KKMAIYDELASYPDVKYIAGGAGQNSARGAAYILGKGKVAYFGSVGKDKYAEKLAAEN
                     AAAGVTSLYQVQEDAGTGKCAALITNFDRSLVTDLSAANLFTPDHLDKNWSVVENAEI
                     FYIGGFHLTVSPESIIKLGKHAKETGKQFILNLSAPFIPQFFKDALKEVLPYTTMVIA
                     NEAEAEAYAEAFELKCSKTDLEAIAKEIVGDSKKTVIFTHGLEPTVVVTSEGSQTFPV
                     KALESSKIVDTNGAGDAFAAGFLAALVEKKPLETAIDMGQWLAALSIQEIGASYPKVP
                     LAYSA"
     gene            <663059..>663904
                     /gene="TPHA0I03020"
                     /locus_tag="TPHA_0I03020"
                     /db_xref="GeneID:11534668"
     mRNA            <663059..>663904
                     /gene="TPHA0I03020"
                     /locus_tag="TPHA_0I03020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687189.1"
                     /db_xref="GeneID:11534668"
     CDS             663059..663904
                     /gene="TPHA0I03020"
                     /locus_tag="TPHA_0I03020"
                     /inference="similar to DNA sequence:INSDC:YJR116W"
                     /note="similar to Saccharomyces cerevisiae YJR116W;
                     ancestral locus Anc_7.500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687237.1"
                     /db_xref="GeneID:11534668"
                     /db_xref="GOA:G8BY25"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:G8BY25"
                     /translation="MQDPLLAYSFFPDSSSIFLRHVHEVLLSLAFYTVCYQYVAPAVN
                     KMVFGEKYTNIKDDGLKIDFDVHTVSMFQCVVTYISIYPTIFLNLPSDSVYNLGNFAD
                     ERCSMVTAIAMGYFIWDLYLCVRHYDIYGFQFTLHASATMYVLCLTMRPFAQTWISKF
                     LSFELSTPFVNINWYFMQILKNEKIGKSGVNAQGSKSATMSLLNTFNIVNGICLMVVF
                     FFVRIIGGPIMLLGVLFDVLEGINELPVIHYTMLLSLMIAMETLSVFWFMKMIKVIRK
                     LTNKK"
     gene            <664487..>666604
                     /gene="TPHA0I03030"
                     /locus_tag="TPHA_0I03030"
                     /db_xref="GeneID:11534669"
     mRNA            <664487..>666604
                     /gene="TPHA0I03030"
                     /locus_tag="TPHA_0I03030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687190.1"
                     /db_xref="GeneID:11534669"
     CDS             664487..666604
                     /gene="TPHA0I03030"
                     /locus_tag="TPHA_0I03030"
                     /inference="similar to DNA sequence:INSDC:YER022W"
                     /note="similar to Saccharomyces cerevisiae SRB4 (YER022W);
                     ancestral locus Anc_7.503"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687238.1"
                     /db_xref="GeneID:11534669"
                     /db_xref="GOA:G8BY26"
                     /db_xref="InterPro:IPR019313"
                     /db_xref="UniProtKB/TrEMBL:G8BY26"
                     /translation="MSEDNFQDIKKNGINLALDPNLINLPLYTSSFSPTGKSETFTGT
                     ANSEEADVELKVPLDKKLNDANTKSINLINNPYEVFGKLPLAQLIPLISQQKGPGFTF
                     GNLSEDELLREIQQEEELEKNNNVDELIDRFPDSNKMDMDILPLEDDTAKLSDLSTTQ
                     GADESSMDFNSQNHELLGDGIIAINNDTKEFIPQANFEQIRKQMIDDINLAINESSLS
                     LEFVSLLLSGAREQSALSSMSPFLKKTVSPGSLNSEKIPHETKSKKDEQMLAILDKGW
                     KLKSLDDSRQMLKENYAALTKTLQREHEYWRKLATNISNKDVIFKLRDYSTNQRVLGI
                     KYGYGDSGSTYRYDKGIALLRNNVETNKLELVPTSKGSIEHGNELQNYERFIRIRIYT
                     RLESEDDSVLSGESSISNEFLNNNFDSSEKNSDSIRSQISRLKAFIFEKELMHHLKKE
                     CSELISFGVVVENENKIVLELSNEKIEIDFVSLQDPSVVNHEQDSPRVNDKRANLILV
                     TLRMLLVVMFKKEIRQTMISSKRNITKSADEILLVKPILGKIRHHSYKVILRRILKDY
                     VLGIIPEASIKEEAVSASEDVNSSEDGRKKVALDKHIETLTNEIEAFEYLLELPVSKF
                     DITLPMMDNKAATINLLLKNPNYCNAVIDIKYLDKNGVTIFNTTFTEFKEVEEFLSFI
                     VSEYSKDKSSLIKNDDIKMEDVN"
     gene            <666935..>667792
                     /gene="TPHA0I03040"
                     /locus_tag="TPHA_0I03040"
                     /db_xref="GeneID:11534312"
     mRNA            <666935..>667792
                     /gene="TPHA0I03040"
                     /locus_tag="TPHA_0I03040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687191.1"
                     /db_xref="GeneID:11534312"
     CDS             666935..667792
                     /gene="TPHA0I03040"
                     /locus_tag="TPHA_0I03040"
                     /inference="similar to DNA sequence:INSDC:YER023W"
                     /note="similar to Saccharomyces cerevisiae PRO3 (YER023W);
                     ancestral locus Anc_7.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687239.1"
                     /db_xref="GeneID:11534312"
                     /db_xref="GOA:G8BY27"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:G8BY27"
                     /translation="MGYTLTFLGCGVMGQAVLSAIYNAPKVTDAAIAKLYPSKIIACN
                     HNDETAMGVTKLIESLPPSPNGIIVESTFGENDRAVKEADIVFLGTKPFIVEETMRKV
                     KEHMGEKLLISICAGWTIEQLTAYSRNVSRVMTNTPAKYGYGCAIVAHSPTVNENQRA
                     IVSQLISQVGKYIELPEKNMDAATALVGSGPAFVLLMLESLMESGIQMGIPLKESKEC
                     ALKVMEGTVKMVEMSGEHPGVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAAN
                     VAAKLGKKK"
     gene            <669074..>670591
                     /gene="TPHA0I03050"
                     /locus_tag="TPHA_0I03050"
                     /db_xref="GeneID:11534313"
     mRNA            <669074..>670591
                     /gene="TPHA0I03050"
                     /locus_tag="TPHA_0I03050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687192.1"
                     /db_xref="GeneID:11534313"
     CDS             669074..670591
                     /gene="TPHA0I03050"
                     /locus_tag="TPHA_0I03050"
                     /inference="similar to DNA sequence:INSDC:YJR121W"
                     /note="similar to Saccharomyces cerevisiae ATP2 (YJR121W);
                     ancestral locus Anc_7.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687240.1"
                     /db_xref="GeneID:11534313"
                     /db_xref="GOA:G8BY28"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY28"
                     /translation="MVLPRLYGVSTKGALKNAMRLSSHTSVRGLATAAPLVGKVKGVI
                     GAIVDVQFGQGNLPAILNALEIQTPNGKLVLEVAQHLGENAVRTIAMDGTEGLVRGEK
                     VIDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKLRKPIHADPPSFVEQSTAAEV
                     LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERT
                     REGNDLYREMRETKVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQ
                     DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSV
                     QAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRLLDAAVVGQ
                     EHYDTATRVQETLQAYKSLQDIIAILGMDELSEADKITVERARKIQRFLSQPFAVAEV
                     FTGIPGKLVRLKDTISSFKAVLEGKYDHLPESAFYMVGGIEDVVAKAEKLASEAN"
     gene            <671909..>672586
                     /gene="TPHA0I03060"
                     /locus_tag="TPHA_0I03060"
                     /db_xref="GeneID:11532844"
     mRNA            <671909..>672586
                     /gene="TPHA0I03060"
                     /locus_tag="TPHA_0I03060"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_003687193.1"
                     /db_xref="GeneID:11532844"
     CDS             671909..672586
                     /gene="TPHA0I03060"
                     /locus_tag="TPHA_0I03060"
                     /inference="similar to DNA sequence:INSDC:YJR123W"
                     /note="similar to Saccharomyces cerevisiae RPS5 (YJR123W);
                     ancestral locus Anc_7.509"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_003687241.1"
                     /db_xref="GeneID:11532844"
                     /db_xref="GOA:G8BY29"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:G8BY29"
                     /translation="MSDTEVPVDAVEEFEVVEEFTPVELATAIPEDVQRAQSEIKLFN
                     KWSFDDIEVKDASLVDYIQVRNPVYVGHTAGRYANKRFRKAQCPIIERLTNSLMMNGR
                     NNGKKLKAVRIVKHTLEIINVLSEQNPLQVVVDAIANSGPREDTTRVGGGGAARRQAV
                     DVSPLRRVNQAISLLTIGAREASFRNIKTIAETLSEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            <673542..>676358
                     /gene="TPHA0I03070"
                     /locus_tag="TPHA_0I03070"
                     /db_xref="GeneID:11532845"
     mRNA            <673542..>676358
                     /gene="TPHA0I03070"
                     /locus_tag="TPHA_0I03070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687194.1"
                     /db_xref="GeneID:11532845"
     CDS             673542..676358
                     /gene="TPHA0I03070"
                     /locus_tag="TPHA_0I03070"
                     /inference="similar to DNA sequence:INSDC:YER024W"
                     /note="similar to Saccharomyces cerevisiae YAT2 (YER024W);
                     ancestral locus Anc_7.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687242.1"
                     /db_xref="GeneID:11532845"
                     /db_xref="GOA:G8BY30"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G8BY30"
                     /translation="MTDISNTFEYENGLPKFPIPTIDNTLNQLLKSLEPLYYADGYYK
                     HPLDLEQIQELNKIFQDFKTSTISNLLQKRLIDFNIENDCYLDKLHLDINNHHSNTIM
                     DMTNDDILPRNPFLILANDAIKDISQQDRAAVLIHSSLKFISALRKNILQPDYTYANI
                     SSDSNDNIAFQKKYLSMKPYLKLFGTTRCPVFEEGEIEHFDLNKKYSYSDTNSMDWSE
                     DDEEEEETDKDRNLEQKENKNSRPVTRDGSITLEDESLFTSHGITYKNCPDSKHILII
                     SRGQYYTLDVLDTNDCVVYTDDELSLIFEYIINDSNLDSKKLPSVGNKNNMTGATALG
                     SLTSYSYKNWKYARKRLEKRYPNELNLIDAALFVLVLDDTGLSGNSSIEVKDNLDGTS
                     VAEDGDNSSDDCKRLFYGTSTIDENGNQVGSCISRWYDKLQIVVTTDAKAAIIWDSFT
                     SDGSVVLRFISEAHAESVLRLARNVNEDKSKFSLWPTVHDPCYNPRSNKPNSLKDDLP
                     RVVKKIDWSFSHILNTHIHLSETKLADLISKHDITKVSVPFGKKTAQKLGVKPDSMIQ
                     VALQVAHYALYGRFVYGYEPVSTRSFKNARSVFINLQSQDILELCQEFISNSLEDLVK
                     LDKFINSCHIHGQKVKEAKEGNGFERHFNALKYVYKFHEHFGITASKQELQIAKNLFE
                     NPLLTPFSSPELIFANCGNTATTTFGITPAIPQGYGIGYIIKDEQCDLTVTSQFRQGK
                     RLMFMLNWVLHEIRTYFRKSRNLGRGGIRVNPLVDKLYAMDNAKYASKLNAMTQGSGH
                     SSNNTNGFFDLKGHMESRTVSGMNSHSNSSLALNQSNKTYSSMINSKEFNEAVMSLNI
                     ESKNQNGPTEEEKLGTGSQIPSLQPNDEESDSDENTRNVVTKFGESGFIFQIEEQKTS
                     NVIDSKFDIDFDRGRVGRKIVSFE"
     gene            <677072..>678640
                     /gene="TPHA0I03080"
                     /locus_tag="TPHA_0I03080"
                     /db_xref="GeneID:11534369"
     mRNA            <677072..>678640
                     /gene="TPHA0I03080"
                     /locus_tag="TPHA_0I03080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687195.1"
                     /db_xref="GeneID:11534369"
     CDS             677072..678640
                     /gene="TPHA0I03080"
                     /locus_tag="TPHA_0I03080"
                     /inference="similar to DNA sequence:INSDC:YER025W"
                     /note="similar to Saccharomyces cerevisiae GCD11
                     (YER025W); ancestral locus Anc_7.513"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687243.1"
                     /db_xref="GeneID:11534369"
                     /db_xref="GOA:G8BY31"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY31"
                     /translation="MTDFQDREPSIIINGDMDNEEIIYGEEEIAEVEEAVVEEEKPRK
                     KVAFSGLDEESDEEKRKREFEEGGGLPEQPTDPDFSKLNPLSTEIINRQATINIGTIG
                     HVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQDPTCPEPDCYRSFK
                     SDKEIHPKCQRPGCEGRYELVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNES
                     CPQPQTSEHLAAIEIMKLKHVIILQNKVDLMKEENALEHEKSILKFIRGTIADGAPII
                     PISAQLKYNIDAVNEFIVKTIPVPPRDFMVSPRLIVIRSFDVNKPGTEIEDLNGGVAG
                     GSILNGVFKLGDEIEIRPGIVTKDDKGKIQCKPIFSNIVSLFAEQNDLKFAVPGGLIG
                     VGTKVDPTLCRADRLVGQVVGAKGHLPNIYTDIEINYFLLRRLLGVKTDGQKQAKVRK
                     LESNEVLMVNIGSTATGARVVAVKADMARLQLTSPVCTEVNEKIALSRRIDKHWRLIG
                     WATIKKGTTLEPIA"
     gene            complement(<678920..>680965)
                     /gene="TPHA0I03090"
                     /locus_tag="TPHA_0I03090"
                     /db_xref="GeneID:11534370"
     mRNA            complement(<678920..>680965)
                     /gene="TPHA0I03090"
                     /locus_tag="TPHA_0I03090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687196.1"
                     /db_xref="GeneID:11534370"
     CDS             complement(678920..680965)
                     /gene="TPHA0I03090"
                     /locus_tag="TPHA_0I03090"
                     /inference="similar to DNA sequence:INSDC:YLR452C"
                     /note="similar to Saccharomyces cerevisiae SST2 (YLR452C);
                     ancestral locus Anc_7.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687244.1"
                     /db_xref="GeneID:11534370"
                     /db_xref="GOA:G8BY32"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:G8BY32"
                     /translation="MKVADNNTLHERSSKGFNRTPSGLIYTNNIKNVYSIFLISLQLK
                     SKESRSGTFLNSFSKQSCYFSFSVADAIKTMKNMELKVEMNKTSISISYAIKNELAHH
                     LLKIFMEAKLLHAPVDRTRNEPKEKTPLQPTPKGVAILYQYTRSIGLKEIPPIIFSEL
                     NSNQLFCFERNSVTDSIIRSDYLIYLLFMRIMGSRPNIWSPSKPSDRLPSLFKLLEYS
                     TDSFSFESIDYDPISGFQSTQNSQTSIINQSIQLQDIDLTNEDRESPLAHRFFTNPDS
                     DSHIQYYVSDVGVRLFKDKVFDKDIEPIDYTFTTKALWQWLMDCTDILYPKEASYIVV
                     LFAKKGLIEPIIKPDQKLSSKKVMINKTTYFKLTPLGWSVVKWNLSNTKTRSHSIPYS
                     DNNNVNFSKNMESGSYSFNTDTESLSHSISSSIKTHGSSELKNIEFNDIIADPGMRFL
                     FRQFLQEDICVENLDAYLEILKFLKKMRNLNKMLKSKASTSANRKLSNIQNNITDAMD
                     TALSKHASECLEMSYQIYSTFIIECAPYQLNIDHNLRESISKVILHTDNTDELTTKTT
                     NGTTNDNSDLQIKNFQINLPEEKLTSSPDILTNSSKTNIEENISNIESDNSDGQSYND
                     TLSPAVNLLLIILPLFIKLKDNLRLLMKNDSLPKFKNSKLFSEFLQTSNIRERCLST"
     gene            complement(<681645..>683666)
                     /gene="TPHA0I03100"
                     /locus_tag="TPHA_0I03100"
                     /db_xref="GeneID:11534371"
     mRNA            complement(<681645..>683666)
                     /gene="TPHA0I03100"
                     /locus_tag="TPHA_0I03100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687197.1"
                     /db_xref="GeneID:11534371"
     CDS             complement(681645..683666)
                     /gene="TPHA0I03100"
                     /locus_tag="TPHA_0I03100"
                     /inference="similar to DNA sequence:INSDC:YPR161C"
                     /note="similar to Saccharomyces cerevisiae SGV1 (YPR161C);
                     ancestral locus Anc_7.515"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687245.1"
                     /db_xref="GeneID:11534371"
                     /db_xref="GOA:G8BY33"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8BY33"
                     /translation="MSAATNSPLKKTEFKYKIGKIKQMPTVQMDLNTNLSYIELNARK
                     NETIYGCTMFKNHYKEEKKLGQGTFGAVYKGIHLETQRQVAMKRIIMPQESDLFPITA
                     QREITILRKLNNKHIVKLIEMVYDTAPEPSNSNANYSNNAKDPSLLNKSFYMILPYMI
                     ADLSGLLHNPRITLPVNEVKNMMLQLLEGINYLHCEKYMHRDIKTANILIDHTGTLKL
                     ADFGLARMYYGTPPNLKYPGGAGIGAKYTGVVVTRWYRAPELVLGDKQYTTAVDLWGI
                     GCVFAEFFEKKPILQGNSDIDQGHVIFKLLGTPTKESWDMAAYLPGAELLRTSYPETL
                     SERFGKFLTATGLDFLRSLLSLNPYKRLTAMSALQHPFFKEEPLPSKHLTCLTEESHE
                     SDIKRYKEEMHQSLSQRVPTAPKGHINEKGMEKGKQISQSSDINAPERYYAENTFNNN
                     NNNFSNSRSTYPNQSNPNYRSQTYKGNQNRYNNNGPNNMNKNNKHYNQYNTDSRQYSN
                     NNKMSNLPNSRSRYQKSDPHANDRNPATYNRHTQKASSGNYSNAISGRINQYNNTYRR
                     DHEESNIESRTNKISSTISRDDSKHENRQSHTRINQNSKPYNKGPTASNESRFSRGID
                     SETYQNSSVREHLRESDKQTQSDTSNKNESKISKNTDNNTRDKNFADFY"
     gene            complement(<684255..>685442)
                     /gene="TPHA0I03110"
                     /locus_tag="TPHA_0I03110"
                     /db_xref="GeneID:11534681"
     mRNA            complement(<684255..>685442)
                     /gene="TPHA0I03110"
                     /locus_tag="TPHA_0I03110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687198.1"
                     /db_xref="GeneID:11534681"
     CDS             complement(684255..685442)
                     /gene="TPHA0I03110"
                     /locus_tag="TPHA_0I03110"
                     /inference="similar to DNA sequence:INSDC:YPR163C"
                     /note="similar to Saccharomyces cerevisiae TIF3 (YPR163C);
                     ancestral locus Anc_7.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687246.1"
                     /db_xref="GeneID:11534681"
                     /db_xref="GOA:G8BY34"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8BY34"
                     /translation="MAPAKKNVKMDLNSFLNDETFGSSWADEDVDLNKINIPIESAQA
                     NTIPLEELAAANMAKMGAGGRGSRLDPALGAGARRDFQRTEYPVPDVPPYKAIINNIP
                     WDITPEGVTAWVEDGLEKEGAVVDLALPTDMRDPSRLKGIAFVEFAQRDDLVKALTFN
                     ATRLNDRTVYVSVAGPRREFSRGGEDFDWGAARGSNFQGGRPDREEANLDWGAARGSN
                     YQERKPRREEPNLDWGVARGSNYQERRPEREEVNLDWGAARGSNYQERKPRREEPNLD
                     WGSARGSNFGEQGNFNRAPRERKPRKDEPELDWGSARGAKYQQKTQRYERTVTEKTEE
                     KPKIQQSAFAVLSNDVDNEEDEEEVKTPAKKEEEITQLEREAAKLSVNDGDDSEWEVA
                     GKK"
     gene            <687085..>694902
                     /gene="TPHA0I03120"
                     /locus_tag="TPHA_0I03120"
                     /db_xref="GeneID:11534682"
     mRNA            <687085..>694902
                     /gene="TPHA0I03120"
                     /locus_tag="TPHA_0I03120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687199.1"
                     /db_xref="GeneID:11534682"
     CDS             687085..694902
                     /gene="TPHA0I03120"
                     /locus_tag="TPHA_0I03120"
                     /inference="similar to DNA sequence:INSDC:YLR454W"
                     /note="similar to Saccharomyces cerevisiae YLR454W;
                     ancestral locus Anc_7.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687247.1"
                     /db_xref="GeneID:11534682"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019439"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:G8BY35"
                     /translation="MWFDLIIKLPLLVIATWLLIRQVIKTLFGISAAYINPFTFRIIG
                     FEYKDILKIELLEFNPFRKRIRISKLTFNNKQIENKNQTNASNHKKTSHGHNLKAVLP
                     KWLFKYLPHLLSFLNEVHIVADHVFLTDYDLYISTIGSVFNYKEITSSLSLELFMRQV
                     KNKNSTILTDTLQQLEINFEKIEVDHSIVFNDIKIDSKFGVLRLPYAYLKQQSASTKI
                     IEPDNIESKHSDILCDLAIQDTIKAFRKKLERIQGYLKPICEINLYMDKILLDDLELT
                     NLPELNEISQYFTYNIEASNVTLNLIRFSKDYPGYNLNFGEDDTPYKINSNFSRVNIG
                     VKINKINEKEIYLAKIIEVPSINLYGHTNIFSQQFQFSEGRFENALSTLNFQISSLIV
                     DLDITTLSFIKSFSRNIKVFKGAFGYSKEIDAIDQLKEFEDLRSLKWRKVLKTYLTSL
                     FPLLNLKFTLDDSKIILNDETDTIIFYLSALLGTYKSNRSLSFSQNDKLDSIINYDTA
                     FDLELSDLHCQHLITDGSNYNHKILEIESVSLKQKVKWSPEIQFSFDGEVDNVNIDLS
                     ELRSMIALNKIVKKTDCQLLQVETIYFKELYDKFAKQLYNAEFNCSRLKEMQSIKKVS
                     PESFVFNTLPDYFDYIKVDLRRIQMTLGIRSVFMPPDIFSLLEAQSPKDLVEGKLRKF
                     TNKVDKVQLALFSNKTQWHNKIEMGQVYMSKSGLDSLNRNDSNDLEDIGTSQSTQIDR
                     LWNFNILVNNVTSSVIYETCKFSTEFSSRTVSSLKVVSIKVFPETESYTVPSENKVVI
                     VIDNKKASSMVDLINVFMGISGFHTLNQIFRKNTYCSVKETCAKKILVSLNKAKKKSF
                     WYFIDWVKFKQLIQIRLSSELSRQVLILPNALKIKFESSNMFISIDKLNDICINGELA
                     RMCVESPTQKDTWIRMMLINKFKMNINLSEMLRQIKNNETGNSEVLPGVTLAYESSHF
                     SIPNKFAMYRIFDNISTIVKSLKQMIYSMKTSQSDIVIFPVTVNPVRLPNVNLSSKRS
                     IITIEDDPLESELNMIFQIGLEEQRIRLEKVKQFKNSLERKYQDTNSSANQSEKNNDK
                     FSSDDTYTKLVFLSSARGCKKSKNILKKLLSAKKSDRETSEKEDELLEDKNPILINEH
                     ESYIRLQENISTSWIRRIKDYKKVEKEKYEENFEYLWGLTNLHNISKDFNTNVRDFIY
                     SPPLTTIIVEGIDINISQPSCGLECIAEFIHDVGKGVPLDTQYSIMFPMYLDVNIREF
                     RWHLRDYPLPFINIPPPTENQKISNNFKISGDLCLTEAMIQSSNEIRTIFVPLVPSVE
                     LVNKDHYYSLFVPRTLTSVKVYSKLEIGIHTERSTQVVWGSSYSPAIQQVMQCFEDLS
                     KPPTDLSPKLGVWDKIRYMFHSRIKINWAKKNRFEISLLGAKSPYKIGREDAGFIIGF
                     NGNTVLDCNPNNSPKQLLACSADQIYFSIPNYFAKPLLVWSMPSHKNIFVPNQDNTNL
                     QTYASYYYLLQQDYNNERKEAVKLMQKHYIEKNGIKLSGGMTLKLGFVFEGLGKGGIR
                     SSDFAPHYETFLCNPIYVKDLSKYDAYKNFKSHFIHMSFALLSNSSNAYNAMQLDSSG
                     MDTFLKWWKSFSNNPPVRRGTLYDAKNLSPKFGGALRTISYYANVSPLFITHIQRNID
                     INNTQSSSFYENIEYVGIKAKVSRFVMDLHQRKEVISEFREKLNEHKRVSRMKFLEGD
                     FSSGTIDIRTIHAKFHKVTFIEDKQNYEFDLYEDDDNWVDISDFKEPFSISIDDYTPH
                     VTIRPLLLAPQFVYQKRAKYGDKYQLDPVTSEPIQAFKNDISHCCCVNGQIDLPTTYQ
                     EKRISTLLTKEKELNEKLKIANTSEEKSYLLKHINMTKQIIQQLEYFIEDTKMVVNSK
                     GNVKPEDLHFQVIDKETEASKKLYENRYLIFGMFLRWDEGARDVITTYLMYLNLNSYF
                     SKIDRYKSIRTFEDIVNQKSGTVGSPSNYNSEQNFKTSILESSTQSAKNHGTKQEKEE
                     DILKYFEIGLRKLITSINYTTSEDHFVQFLAPQIQLSSKFEPNSCIVIAAPLIKLRVL
                     SFASANNNDVFIQDTFLKRYGILISKANVFLFHKDKFKDSMDIFFQCLAYGQTKEVPW
                     SPWLGAESCFDPSALSDSTIIKNLNTTIYLDSIYEFSSVYEFVRHQLQDCMNIYIPKV
                     QVTCDSRSYLTLFKISTNLFMSMKLTDPVLKKKIDKVSISFDFTELRKIYDTTVLLSN
                     VIHKSQLAENESIFRQKLLDDAGLVDLFNIHNERITNLSKLYILLHVLCSRRKERHEF
                     TKSMEWNIDVESIELLMLQKDSTPFLTVVSKDIKFNRVASSSGYNSNTITVKAADIFN
                     LEDTAAYKNLLGPYVTQKKLLRKSITEENKPMFHINWVMDKPIGGIKVVKSVETFVQG
                     LSVSIEEETVLKLVHWLLPHEVASALHTNDESDEESDVESLNSEFYFNGEDNSELNEM
                     IQRSTDFVIMENIVINGFKLCISFKGKGSKRLINVTDFVFNFPKLSFVNQTMRSIDII
                     IILKKVLIKALLKQSGKFLLSKLKRRPALESSSLLLPHSVPLSKTLSANSKVSEGEQL
                     KQSEIQIPI"
     gene            <696033..>696662
                     /gene="TPHA0I03130"
                     /locus_tag="TPHA_0I03130"
                     /db_xref="GeneID:11534342"
     mRNA            <696033..>696662
                     /gene="TPHA0I03130"
                     /locus_tag="TPHA_0I03130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687200.1"
                     /db_xref="GeneID:11534342"
     CDS             696033..696662
                     /gene="TPHA0I03130"
                     /locus_tag="TPHA_0I03130"
                     /inference="similar to DNA sequence:INSDC:YPR165W"
                     /note="similar to Saccharomyces cerevisiae RHO1 (YPR165W);
                     ancestral locus Anc_7.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687248.1"
                     /db_xref="GeneID:11534342"
                     /db_xref="GOA:G8BY36"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY36"
                     /translation="MSQQVGSNIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVF
                     ENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQE
                     KWIAEVLHFCQGVPIILVGCKVDLRNDPQAIEYLREAGQQPVSTAEGQAVADQIGATG
                     YFECSAKTGYGVREVFEAATRASLMGKSKNNGKQKKKTSEKKKRKCVVL"
     gene            <697331..>697990
                     /gene="TPHA0I03140"
                     /locus_tag="TPHA_0I03140"
                     /db_xref="GeneID:11534343"
     mRNA            <697331..>697990
                     /gene="TPHA0I03140"
                     /locus_tag="TPHA_0I03140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687201.1"
                     /db_xref="GeneID:11534343"
     CDS             697331..697990
                     /gene="TPHA0I03140"
                     /locus_tag="TPHA_0I03140"
                     /note="ancestral locus Anc_7.521"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687249.1"
                     /db_xref="GeneID:11534343"
                     /db_xref="GOA:G8BY37"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY37"
                     /translation="MEEIKLTDTSFSSNTSTHNDFRYNKKLVIVGDAYTGKTALLVAC
                     RSNQFSPVYVPTVFDCGSKLFNFEDKKVDMRFWDTSGKDDYIRLRPLSYPNSHVVLLC
                     YSIDSRESLNNVIEKWSSEVFHYCKKNASILLVGCKVDLRNDPDTIAKLKLQNTVSIS
                     KEEGIRAAEEIGAIQHIETSALTGYGIKELFEEAVKVTMTDSNVVRKRKKLRICRCTI
                     M"
     gene            complement(<698231..>698578)
                     /gene="TPHA0I03150"
                     /locus_tag="TPHA_0I03150"
                     /db_xref="GeneID:11534327"
     mRNA            complement(<698231..>698578)
                     /gene="TPHA0I03150"
                     /locus_tag="TPHA_0I03150"
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /transcript_id="XM_003687202.1"
                     /db_xref="GeneID:11534327"
     CDS             complement(698231..698578)
                     /gene="TPHA0I03150"
                     /locus_tag="TPHA_0I03150"
                     /inference="similar to DNA sequence:INSDC:YPR166C"
                     /note="similar to Saccharomyces cerevisiae MRP2 (YPR166C);
                     ancestral locus Anc_7.522"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /protein_id="XP_003687250.1"
                     /db_xref="GeneID:11534327"
                     /db_xref="GOA:G8BY38"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:G8BY38"
                     /translation="MGNFRFPFKTKLPPGFVNARILKDNFKRQQVAENEITIKALKYI
                     SRNTALPPRARLEAQLQLSVMPNYTRSTQVHNRCVETGHSRAVLSDFRLCRTQFREKA
                     LAGDLPGVKKGIW"
     gene            <699246..>700805
                     /gene="TPHA0I03160"
                     /locus_tag="TPHA_0I03160"
                     /db_xref="GeneID:11534328"
     mRNA            <699246..>700805
                     /gene="TPHA0I03160"
                     /locus_tag="TPHA_0I03160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687203.1"
                     /db_xref="GeneID:11534328"
     CDS             699246..700805
                     /gene="TPHA0I03160"
                     /locus_tag="TPHA_0I03160"
                     /inference="similar to DNA sequence:INSDC:YPR169W"
                     /note="similar to Saccharomyces cerevisiae JIP5 (YPR169W);
                     ancestral locus Anc_7.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687251.1"
                     /db_xref="GeneID:11534328"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8BY39"
                     /translation="MAKKKNSTKTNLESLVSSALPIVEFKHKDPLFQVACHPEKPIVV
                     SGTATGYIFCHQYDATVLQEAVDRRRKSATDDSTKKDKNEKFWAVVEVPSEDTEDIAG
                     IKLLWKTKRHKESVRGIALDSDGKYMYSVSSDNVLKKSETETGKVLKKITLSEQPKDA
                     KFTKIVKSSTHPFLVLGDEVGNVLVLDSETLQEKNKLIDIHDGKDAINDIFHFSRRSA
                     YKFISLGQTTLGYWDARESNQSDKKILPDDTDSKRMVLLSDDQEDEILCGTFVDPEVG
                     DTIVCGMGEGLLTVWKPEKNGLEDQLTRIKIAADESIDCIIPTLQDDNCIWCGCSNGK
                     IYKANAKSGKVIEIRKHSNLDEVAFLDLDCEYRVISGGMDSVKIWELNDVNVEVKDNS
                     NKDESDFSMSDSDISISDSDEENEDNSVNEDEEVEVPATEEWAGFESETSDTESVEND
                     DEKGLIGLSKEQLMKELDKDILGLSDSDNETNSKRKTRGSKFQKKQKKQKIQKEVAHN
                     DNHGITKFEGL"
     gene            complement(700945..701018)
                     /gene="TPHA0Itrna1I"
                     /locus_tag="TPHA_0Itrna1I"
                     /db_xref="GeneID:11534329"
     tRNA            complement(700945..701018)
                     /gene="TPHA0Itrna1I"
                     /locus_tag="TPHA_0Itrna1I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11534329"
     gene            <701928..>702416
                     /gene="TPHA0I03170"
                     /locus_tag="TPHA_0I03170"
                     /db_xref="GeneID:11534538"
     mRNA            join(<701928..701945,702060..702190,702308..>702416)
                     /gene="TPHA0I03170"
                     /locus_tag="TPHA_0I03170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687204.1"
                     /db_xref="GeneID:11534538"
     CDS             join(701928..701945,702060..702190,702308..702416)
                     /gene="TPHA0I03170"
                     /locus_tag="TPHA_0I03170"
                     /inference="similar to DNA sequence:INSDC:YPR170W-B"
                     /note="similar to Saccharomyces cerevisiae YPR170W-B;
                     ancestral locus Anc_7.526"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687252.1"
                     /db_xref="GeneID:11534538"
                     /db_xref="UniProtKB/TrEMBL:G8BY40"
                     /translation="MQPIVSGGSAWFCTVLSAFGVVILSVIAHLFKTNHESFVGSIND
                     PEDGPAVAHTVYLAALVYLGFFVFCGFQIYLIKRKPSIELR"
     gene            <702761..>705184
                     /gene="TPHA0I03180"
                     /locus_tag="TPHA_0I03180"
                     /db_xref="GeneID:11534640"
     mRNA            <702761..>705184
                     /gene="TPHA0I03180"
                     /locus_tag="TPHA_0I03180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687205.1"
                     /db_xref="GeneID:11534640"
     CDS             702761..705184
                     /gene="TPHA0I03180"
                     /locus_tag="TPHA_0I03180"
                     /inference="similar to DNA sequence:INSDC:YPR171W"
                     /note="similar to Saccharomyces cerevisiae BSP1 (YPR171W);
                     ancestral locus Anc_7.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687253.1"
                     /db_xref="GeneID:11534640"
                     /db_xref="UniProtKB/TrEMBL:G8BY41"
                     /translation="MFSLTLNIIIYYINYYYKKEVGYLVIYLPKKQLAYSRVSDSKYT
                     MVREDKDLDSFLKNVEDIDQRRQNGQGRKTTTAKKPPIVGKKPFHLSTSDKEESLRVA
                     KGILDGSYKETDSYKAIIDGPDDQDSTLEVDYISEYSVNLSPSNPSSPKKPNNQKDET
                     ITNQNKKFLISEEEYALLQQLKDQKNNESTNKKEKVKEDFTIPSRGKPRHLRDDPNEI
                     KESHRDRRGYEHPHRSKEHTHRNHDHSHRSHDYSRRIHDYTHRTHKSNESSHRYRSMR
                     NELEADDNVEVEAPPSLPRRRYKLSQDGSKVEDEERPPPLPIKPQRKIINNRSDIKNV
                     SGEVESNQIRDHAQKRDDVEERRRDRIENINSQDSYIPVIDRSSKPKYDAKPVVNRET
                     KPFSSSKNTSKESVEKVEFDKTEKTKAIANKPKPPPPSSRSMAQPKSYMESLETNKLT
                     KASSSTSDKSLISTSKASSLDYLDSAQNRGPPVPEKKKISASYKVPSDKEKSNGFIGS
                     ALKSNKTPTDEIKRLKPEVPPKCNGIISTKSDKSSNPENDLNNNAETKDKPDLPPKKK
                     ALDTSLDGLKKLQQQKPDVPNKSPDIAFPKVKLKAISKQAPDVPKKKQPFADLKLKPV
                     QKPKPVIPPKKLDIELPELKATKQEKIQIEENVEINKVSLKKTSVNIVKTNNDNNNQI
                     PEALLKHKSLAKAKTAPLVPQRKISMPEALAKSKTIREASSKDKIVGGEIGKKRPPLT
                     PPVRKELTPAEKLEAILQTPNPYVKNPVSRSSTNSDISTNSFTLLDKRKQTAYYLTNP
                     KVVIAAQHH"
     gene            <706068..>706664
                     /gene="TPHA0I03190"
                     /locus_tag="TPHA_0I03190"
                     /db_xref="GeneID:11534641"
     mRNA            <706068..>706664
                     /gene="TPHA0I03190"
                     /locus_tag="TPHA_0I03190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687206.1"
                     /db_xref="GeneID:11534641"
     CDS             706068..706664
                     /gene="TPHA0I03190"
                     /locus_tag="TPHA_0I03190"
                     /inference="similar to DNA sequence:INSDC:YLR456W,YPR172W"
                     /note="similar to Saccharomyces cerevisiae YLR456W and
                     YPR172W; ancestral locus Anc_7.529"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687254.1"
                     /db_xref="GeneID:11534641"
                     /db_xref="GOA:G8BY42"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:G8BY42"
                     /translation="MSCTANFPDHLLNLIKKSKYLHLATSSTECVPSISLMNYIYVPQ
                     DKLFRPADIYDYIIFATPQNTEKYHNMEANPVVALLFHDWVTANNLSIKKKSLSQTNT
                     PEPGASGIVESAPPSKLLNLLQELNQAELNEMSATIIGHAYIVSQDSEEESHYKKLLL
                     KVNPDASAFILGEETVVVKVKIESCKVTDTSNNTKIYT"
     gene            complement(<706938..>708236)
                     /gene="TPHA0I03200"
                     /locus_tag="TPHA_0I03200"
                     /db_xref="GeneID:11534645"
     mRNA            complement(<706938..>708236)
                     /gene="TPHA0I03200"
                     /locus_tag="TPHA_0I03200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687207.1"
                     /db_xref="GeneID:11534645"
     CDS             complement(706938..708236)
                     /gene="TPHA0I03200"
                     /locus_tag="TPHA_0I03200"
                     /inference="similar to DNA sequence:INSDC:YPR173C"
                     /note="similar to Saccharomyces cerevisiae VPS4 (YPR173C);
                     ancestral locus Anc_7.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687255.1"
                     /db_xref="GeneID:11534645"
                     /db_xref="GOA:G8BY43"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY43"
                     /translation="MSTGDFLSKGIDLIQTAVNYDTATQYAEAYTAYYNGLDYLMLAL
                     KYEKNPKSKELIRAKFTEYLNRAEQLKEHLEKEEENKKNGTSNSTSGAQKSANNKDSN
                     DEDAEDKKLKGALSGAILTEKPNVKWEDIAGLEGAKEALKEAVILPVKFPHLFTGNRK
                     PTSGILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFNMAR
                     ENKPSIIFIDEVDALTGQRGDGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPW
                     QLDSAIRRRFEKRIYIPLPDLAARTKMFEINVADTPCVLSKEDYRSLGQMTEGYSGSD
                     IAVAVKDALMEPIRKIQSATHFKDVSEDDQKKLWTPCSPGAPNATEMSWVDIEAKELK
                     EPVLTITDFLKAIKTNRPTVNEEDLKRQEEFTSDFGQEGN"
     gene            complement(<708918..>710111)
                     /gene="TPHA0I03210"
                     /locus_tag="TPHA_0I03210"
                     /db_xref="GeneID:11534646"
     mRNA            complement(<708918..>710111)
                     /gene="TPHA0I03210"
                     /locus_tag="TPHA_0I03210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687208.1"
                     /db_xref="GeneID:11534646"
     CDS             complement(708918..710111)
                     /gene="TPHA0I03210"
                     /locus_tag="TPHA_0I03210"
                     /inference="similar to DNA sequence:INSDC:YLR457C,YPR174C"
                     /note="similar to Saccharomyces cerevisiae NBP1 (YLR457C)
                     and YPR174C; ancestral locus Anc_7.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687256.1"
                     /db_xref="GeneID:11534646"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:G8BY44"
                     /translation="MLESVQGMARGFFGQDSEDRTPVDGRKHEYGDLEYMKAQRRKRM
                     ADRSSSARAHLMREVNGNESGEVLLNTVRNRNRGGVKKSVNGERRKGRMYQEKVEREM
                     LAGRIARNQRNPGTLTKILSAIKTIFSPEAENMGRMKRVSESLDQLLPESNRISDSAR
                     CSQMEERRRMRERIGRSEAFKRKLLEKRNDEALLDQLKRGRPSYRQNDDIDRENETID
                     AEFSSDAKNDISRRDYNRKVKSRNLNIVDDQVFLLQKKVDSLESKLNIVEKELYLSKK
                     KLKFAKEKNSLLESLLDDANIDSEYVKSRRDIKNLQKENLIPEADLPPSPRRTVNPLF
                     TSSPMRKVSGSTKKNEEEVGKPTTSEFYNKYPKIPETEKLKQDIRERSLSPINIDYSK
                     YSSPR"
     gene            <710752..>713037
                     /gene="TPHA0I03220"
                     /locus_tag="TPHA_0I03220"
                     /db_xref="GeneID:11532855"
     mRNA            <710752..>713037
                     /gene="TPHA0I03220"
                     /locus_tag="TPHA_0I03220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687209.1"
                     /db_xref="GeneID:11532855"
     CDS             710752..713037
                     /gene="TPHA0I03220"
                     /locus_tag="TPHA_0I03220"
                     /inference="similar to DNA sequence:INSDC:YPR175W"
                     /note="similar to Saccharomyces cerevisiae DPB2 (YPR175W);
                     ancestral locus Anc_7.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687257.1"
                     /db_xref="GeneID:11532855"
                     /db_xref="GOA:G8BY45"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="UniProtKB/TrEMBL:G8BY45"
                     /translation="MFSSGNVLPVKIQPPLLRPLAYRVLSKKFGLNIKSDGLAELAEF
                     IGNAFGMEWKKSSETVLFLEQFATVWKQQERGLFIDSTGTKSVISEIKERSKSRIKVR
                     DEPDLGPAQEPKKAKTLDNFLLKNVLQQKNVEVTKQETDSEDIPMDDGIEIISEHTSL
                     SNNGTGIEMSDGIETSDGIVIKEEEVQDITDVDPISNYSIPQIEPIEQIEAEEVTEDE
                     MEQLNWRDYFKIINVDEQQNFSYNPRKLQFIFKPSFKKPHSNHNSEIINNSNLKLQLP
                     DIQSKLAIFSTRYYLLRDRIMRNEAFQNNDSFNPLSSMVNMKNALQNNDKSELISNMS
                     LTPIKTLLGRNGQNFLILGMLRVNAKGNWCLEDPSGDIEVDLSQTLPTAGLYYVPGAI
                     VLTEGIYYSATNTFHVTSMTHPPCERRDVTLEAIGNIDLLGIHGISTPNYIAKLDDDL
                     KIRLHYLEKDFTDHRFAIMGGDMFLNELQTLSALRKVFSKLNEDPPIMIILQGSFSST
                     PVHASTNSKSMSISTQYKNNFDSLASLLSEFEDLINYSTFLFIPGVNDPWSSMVTLGS
                     TGLWPQKPIPNHFTTRINRICRHVIWGSNPTRIAYLSQEIVIMRDNICGRFKRNSVQF
                     RTVEEKEGINKQLKKDNEKSQLLDDDDIPMKSLSIDPNKLPARVHESRKIVKTILDQG
                     HLSPFTPDIRPIAWGLDHSLTLYPIPSTLILCDQTAPQFELTYNGCKAFNPGKFISNN
                     RARFLAYTPSLKKVQEEELYF"
     gene            complement(<713161..>714135)
                     /gene="TPHA0I03230"
                     /locus_tag="TPHA_0I03230"
                     /db_xref="GeneID:11532856"
     mRNA            complement(<713161..>714135)
                     /gene="TPHA0I03230"
                     /locus_tag="TPHA_0I03230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687210.1"
                     /db_xref="GeneID:11532856"
     CDS             complement(713161..714135)
                     /gene="TPHA0I03230"
                     /locus_tag="TPHA_0I03230"
                     /inference="similar to DNA sequence:INSDC:YPR176C"
                     /note="similar to Saccharomyces cerevisiae BET2 (YPR176C);
                     ancestral locus Anc_7.533"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687258.1"
                     /db_xref="GeneID:11532856"
                     /db_xref="GOA:G8BY46"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:G8BY46"
                     /translation="MPSELKLHKEKHIQYIDSLDKKQSDFEYWLSEHLRLNGVYWGLT
                     ALSLLNAKDTFKREDVIKFVLSCFDDQYGGFAPFPKHDGHLLSTLSGLQILATYNSLD
                     ALTVIRREKCIKFIKGNQLPDGSFQGDRFGEVDTRFSYNALSSLSILGELSSDVVDPA
                     VDFILKCYNFDGGFGSCPGAESHSAQVFTCLGALAIVNKLDRLSDHQIEEIGWWLCER
                     QLPEGGLNGRPSKLPDVCYSWWVLSSLAVIKKLDWINYEKLRNFILQSQDEVKGGISD
                     RPDNEVDVFHTVFGLAGLSLMGFDDLVPIDPAYCMPCSVTKEFKVYPY"
     gene            <714446..>715879
                     /gene="TPHA0I03240"
                     /locus_tag="TPHA_0I03240"
                     /db_xref="GeneID:11532857"
     mRNA            <714446..>715879
                     /gene="TPHA0I03240"
                     /locus_tag="TPHA_0I03240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687211.1"
                     /db_xref="GeneID:11532857"
     CDS             714446..715879
                     /gene="TPHA0I03240"
                     /locus_tag="TPHA_0I03240"
                     /inference="similar to DNA sequence:INSDC:YPR178W"
                     /note="similar to Saccharomyces cerevisiae PRP4 (YPR178W);
                     ancestral locus Anc_7.534"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687259.1"
                     /db_xref="GeneID:11532857"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:G8BY47"
                     /translation="MEEKKGILLEDLEIDLDHIPISNQDKTSINDKLSKIKIQRHGRI
                     FDIPTDDIQIMEILKRLGVEGTLPNENARLRRERLIGIISDDLTLFKKFEGHMKELDT
                     TNANNTLSDDDGDEEEEEEFYTVADDDLIKARKLILQYSITNSMKRIKLEKELANNFN
                     WKNVLASKRNLKTGLKRYELTGSQVIAERPVSVVKLAPQSKLLASGSWDGAISIVDNM
                     NLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDCLVKVFGYEKNDLTSIDTLKGHQG
                     RVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTAT
                     AGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKE
                     SNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESVATLEGHTEKILT
                     LDTSPISNLIVSSGWDRTVKIWDNDNI"
     gene            complement(<715976..>717922)
                     /gene="TPHA0I03250"
                     /locus_tag="TPHA_0I03250"
                     /db_xref="GeneID:11532879"
     mRNA            complement(<715976..>717922)
                     /gene="TPHA0I03250"
                     /locus_tag="TPHA_0I03250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687212.1"
                     /db_xref="GeneID:11532879"
     CDS             complement(715976..717922)
                     /gene="TPHA0I03250"
                     /locus_tag="TPHA_0I03250"
                     /inference="similar to DNA sequence:INSDC:YPR179C"
                     /note="similar to Saccharomyces cerevisiae HDA3 (YPR179C);
                     ancestral locus Anc_7.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687260.1"
                     /db_xref="GeneID:11532879"
                     /db_xref="GOA:G8BY48"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8BY48"
                     /translation="MDLLKILDTKPVPEIVNKNFLSISGNTSGDYWLPTPMTLYQKEL
                     TDQIVSLHYSDILRYFETDDFEEDVVMKSLETMCFNSQLVATHPFLLIDHNMPKSLIT
                     KEVSAHLAETSGKFNVLKDLVNILHEYETDIALICRSGRTMNLIEALLLGNKVNIKRY
                     DGNSLKTKQKSRNFSRTFHLFPSTDLNFKKYPILIKEQFNMVIALDSSVDTNSSGIDY
                     IIRHGRNSTSIPEKAPVIRLISVNTFDHCNLYFSQIMKKGSREFLTYVTAAVVVLRDR
                     VGVLPPDLRPVYSHKLKYLIDWLEDSSLPWPLPDIYPIKKYTPMDVERSLLLEVHYNQ
                     YDDSLESAFTNNKKRGFSSVDRDSQKDFDIKTFYNKKRVQNDYSTNPLKQDMSQLTGI
                     TTSNNVHGIDYHLSSGILTYKLIQYINEYYVDITLLNAELKDFEETKPIQEKHKEYLD
                     KDSNDVGAKLRELNEKNSSDLEKAAKFENENKKLYEDIERLENSIESSLEIISSKSET
                     LRSMKDSFIKYHKLQEDLIDAKRMQDSKEAENKYMHNEISRAEVSIKENEEEITKIIS
                     DSDVLRNNLKNNMEKFKEKKVAVDERIADLKVSLKKSEDLKEELQAKLIRSVEKLNNL
                     PTPRVRATNSSSTSAGRKYKSRKK"
     gene            complement(<718664..>721162)
                     /gene="TPHA0I03260"
                     /locus_tag="TPHA_0I03260"
                     /db_xref="GeneID:11532880"
     mRNA            complement(<718664..>721162)
                     /gene="TPHA0I03260"
                     /locus_tag="TPHA_0I03260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687213.1"
                     /db_xref="GeneID:11532880"
     CDS             complement(718664..721162)
                     /gene="TPHA0I03260"
                     /locus_tag="TPHA_0I03260"
                     /inference="similar to DNA sequence:INSDC:YPR181C"
                     /note="similar to Saccharomyces cerevisiae SEC23
                     (YPR181C); ancestral locus Anc_7.537"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687261.1"
                     /db_xref="GeneID:11532880"
                     /db_xref="GOA:G8BY49"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:G8BY49"
                     /translation="MSVCNWICLAMNGVVVLGWQRHLHTHCVRRSETAAHTSMDFETN
                     EDINGIRFSWNVFPNDKIDSAKNVVPLGCMYTPLKEFDNDNEDAVVIDADGTVMNKKI
                     LNYNPVYCTQPQCKAILNPYCIIDPRNNSWICPICSSRNHLPSQYSNMSQENMPIELQ
                     YTSVEYITNKPIQIPPIFFLVVDITTEDENLDALKEYLISSLSLMPPNALIGLITYGT
                     VIRLHDLSCTTIDRCNVFKGDREYKLENLIEMLTGQKPTNLNTANNSSNVNSQNQANP
                     VQISPFSLNRFFLPLEQIEFKLTQFFENLTHDQWAVPTGHRPLRATGQALNIASLVLQ
                     GCYRHSAARIILFSSGPCTLGPGLIVSSELKDPLRSHHDIDSDRASHYKKATNFYNQI
                     ADRVADNDHTVDIFAGSYDQIGMSEMKKLTDKTGGILLLTDAFMTSIFKQSYLRMFAK
                     DDEGYLRMAFNGKLTVKTSKDLKIQGLIGHASTAKKNESANISDSKIGLSGTNTWKMS
                     TLSPKHSYAIYFEIAQSNKKKSGDATANQMNQMNQQQPTLAYTQFITTYQHSSGTNRI
                     RVTTVANQLLPLGSPGIIASFDQEAAAVLIARMAVDKAENDSKTDIIRWIDNSLIKLA
                     QRYANYNKDDPMSFRLSPNFSLYPQFMYYLRRSQFLSVFNNSPDETAFYRHIFIREDT
                     TNSLIMIQPTLTSFSMEEEPRPVLLDSVSVKPNTILLLDTFFYILVYHGEQIAQWRKA
                     GYQDDPQYADFKGLLEEPKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSY
                     QDVTHGGATVVLTDDVSLQNFMSHLQSVAVTSKK"
     gene            <721681..>722072
                     /gene="TPHA0I03270"
                     /locus_tag="TPHA_0I03270"
                     /db_xref="GeneID:11532827"
     mRNA            join(<721681..721689,721824..>722072)
                     /gene="TPHA0I03270"
                     /locus_tag="TPHA_0I03270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687214.1"
                     /db_xref="GeneID:11532827"
     CDS             join(721681..721689,721824..722072)
                     /gene="TPHA0I03270"
                     /locus_tag="TPHA_0I03270"
                     /inference="similar to DNA sequence:INSDC:YPR182W"
                     /note="similar to Saccharomyces cerevisiae SMX3 (YPR182W);
                     ancestral locus Anc_7.539"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687262.1"
                     /db_xref="GeneID:11532827"
                     /db_xref="GOA:G8BY50"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016487"
                     /db_xref="UniProtKB/TrEMBL:G8BY50"
                     /translation="MSELVNASLQPVNPKPFLRDLIGKKIVVKLKFNKTEYIGTLKSL
                     DNYFNLQLDAAEEVIDGVSKGTIGDIFIRCNNVLYVGEHLE"
     gene            <722577..>723383
                     /gene="TPHA0I03280"
                     /locus_tag="TPHA_0I03280"
                     /db_xref="GeneID:11532828"
     mRNA            <722577..>723383
                     /gene="TPHA0I03280"
                     /locus_tag="TPHA_0I03280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687215.1"
                     /db_xref="GeneID:11532828"
     CDS             722577..723383
                     /gene="TPHA0I03280"
                     /locus_tag="TPHA_0I03280"
                     /inference="similar to DNA sequence:INSDC:YPR183W"
                     /note="similar to Saccharomyces cerevisiae DPM1 (YPR183W);
                     ancestral locus Anc_7.540"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687263.1"
                     /db_xref="GeneID:11532828"
                     /db_xref="GOA:G8BY51"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8BY51"
                     /translation="MSISQSVIVPAYHEKLNIKPLTTRLFAALGNEGSKTTELIFVDD
                     NSNDGSVEEVEKLNNNGYPNVRIIVRTDERGLSSAVLKGFMEAKGEYLICMDADLQHP
                     PESVPQLFQSLKSHAFVLGTRYAPGVGIDKDWPLYRRVISSTARAMAKPLTVASDPMS
                     GFFGLQKKYLTMAKMDDINKQGFKIALELLAKLPLPEDPRLAIGEVPFQFGVRTEGES
                     KLSGKVIIQYLEQLKELYIFKFGANNLIIFIAVWTILCLYVLKKFSSLVL"
     gene            <724313..>729004
                     /gene="TPHA0I03290"
                     /locus_tag="TPHA_0I03290"
                     /db_xref="GeneID:11532837"
     mRNA            <724313..>729004
                     /gene="TPHA0I03290"
                     /locus_tag="TPHA_0I03290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687216.1"
                     /db_xref="GeneID:11532837"
     CDS             724313..729004
                     /gene="TPHA0I03290"
                     /locus_tag="TPHA_0I03290"
                     /inference="similar to DNA sequence:INSDC:YPR184W"
                     /note="similar to Saccharomyces cerevisiae GDB1 (YPR184W);
                     ancestral locus Anc_7.541"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687264.1"
                     /db_xref="GeneID:11532837"
                     /db_xref="GOA:G8BY52"
                     /db_xref="InterPro:IPR006421"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR010401"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029436"
                     /db_xref="UniProtKB/TrEMBL:G8BY52"
                     /translation="MKGRSQLENTLLLRLDSDGVPIANNTLYGSGVLTLPSLPYKLEY
                     INDDNPIVTLKIMIAAGSTISRDGLIWTNVPESSNVEFNRDHFRKIIIKSSIHSDCYI
                     DLKLFRPGSFCFYVSYRNKKNLLKTTKKHYFILGPSLFINDTYLPLNSINCQTIISKW
                     LPKSTSPEDNWQKIFKLIANKKYNMIHFTPLQQRGESNSPYSIYDQLMFDPDFFKENQ
                     KSVKLLIDDLEKTHNMLSLTDIVFNHTANNSFWLRKHPESGYNQFTAPHLNAAIELDK
                     ALLDFSSRLKSLNYPVDLKNDNDLLEILDGIKVHVLGQLKLWEYYVINIKETVNEVEA
                     KFDEISITNGDEEDESLNDEILNNLENLAAYVRENYNVGNFDNLAERYSHKLNIEKLI
                     ILLKKSKKFEKFDEETNTFIINLLDEINLPLYRIYDDDVNEILEQLFNRIKYLRISDD
                     GPKLGVITNKSPLTEPYFTRFVGENDGIEYALANNGWIWNGNPLIDFASKNSKAYLRR
                     EVIVWGDCVKLRYGKEPADSPYLWKRMSDYITMNAKIFHGFRIDNCHSTPLHVGEYFL
                     DLARSHNPNLYVVAELFSGSETTDCLFVERLGISSLIREAMQASSEDELSNLIHRYGG
                     RPIGSYKFVPMDTFAFSPDLELDEDYCTYSIKDKSIHCVSEIMIPRVLTCQPPHALFM
                     DCTHDNKMPYEKRTIEDTLPNAALVAFCSSAIGSVYGYDEIYPELLDLVNEKRKYDLS
                     GSINKNLNDEVGICKIKRKLNAIRKEIAISSIDIEDSEMHVHHEGQYITFHRTNSKTG
                     KGYYLIVRTKFSDFNEDQMFPSVTLRATKCKFNCAYSLEKVDTSFSPDNDLLTGVKSK
                     IVELKDFTIHVDADSNSVIELPENFPPGSIAIFETGYVGIDDTLDHLIRSGALKATSN
                     LNFESLNAVLFRSESEELDVSGNTFGAYNIPNHGKLVYCGLQGWVSVLRDIMINNDLA
                     HPLSVNLREGHWALDYILERLNLYNDKPGIRDVQAWLAERFDKIKQLPNFLVPSFFAL
                     TIGILYGCCRFKAMLLFPKYIGNANVFVQSLALTSIQMVSEVKSTSIFPNINVPCMCA
                     GLPHFSTNYMRCWGRDVFISFRGLLLVTGRYETAKQHILGFAKTTKHGLIPNLLDAGR
                     NPRYNARDAAWFFLQAIQDYITIVPEGHSILSEKVSRRFPLNDKYITYEDPEAFSYSS
                     SIEEIIYEILSRHAKGIKFREANAGPNLDRVMKDEGFNIEIAVDWSTGLIHGGNQFNC
                     GTWMDKNGESEKAKSKGVPGTPRDGAAVEINGLLKSTLRFVLKLISEGKFKKTDVTRQ
                     DGSKISFADWNDLLQENFEKNYYIPLDPKDDNEYNTDSNIVNRRGIYKDLCGSGKPFE
                     DYQLRPNQFIAMAVAPELFSPEHAMSAIKVADENIRGKLGMRTLDPSDYNYRPYYNNS
                     EDSDDFATSKGRNYHQGPEWVWCYGYFMRSFHTFNFLANPLSRNETENRPSSYLMQQI
                     YLRLDDHRKAIIESPWAGLPELTNKDGEFCQDSSPTQAWSSGCILDVLYDVWVAFDSK
                     WYAKQIKQNNP"
     gene            <729773..>732031
                     /gene="TPHA0I03300"
                     /locus_tag="TPHA_0I03300"
                     /db_xref="GeneID:11532838"
     mRNA            <729773..>732031
                     /gene="TPHA0I03300"
                     /locus_tag="TPHA_0I03300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687217.1"
                     /db_xref="GeneID:11532838"
     CDS             729773..732031
                     /gene="TPHA0I03300"
                     /locus_tag="TPHA_0I03300"
                     /inference="similar to DNA sequence:INSDC:YPR185W"
                     /note="similar to Saccharomyces cerevisiae ATG13
                     (YPR185W); ancestral locus Anc_7.542"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687265.1"
                     /db_xref="GeneID:11532838"
                     /db_xref="GOA:G8BY53"
                     /db_xref="InterPro:IPR018731"
                     /db_xref="UniProtKB/TrEMBL:G8BY53"
                     /translation="MSTMNIPNSRRKELIELIQAFFLESTFLICESNNLSEYEILNEI
                     KHFEENLQASSTVEIPESIEKWFEKKKTDILTSNSADNFLTLVIETVLDLSQLPPTDF
                     LTLKDREGNSWNVCKGGKKSGIVLERWLIELDNKSSTFENYKIQHEEEYGDLNNKENE
                     RKYINETKKQIILLARYLYTLIQLLPTSNLIEYISKGDIKSKLSLQIKVMDGSQTILS
                     KGRIGLSKPIINTYANVLNETNIPAHLEQRKLTPIWTELGLLRISSSLRIDTKFEINK
                     IVPVKSKSTDNGYKNIEYGAKINSQDYATDVSEHNALQDTASRNMDTLVSQPALQSSR
                     SQGNNAFISVSPHTNMLTGVYSYPYSTQNHSLGSRKSSLSKSLNPFKQAVVLNSGNSP
                     QMLLNNTSNASVAAVTKNQRSRNSSMSAANTHSHDIPTDSFSVGSGSKYSSSFSRLHR
                     HSSIKSTEINENQLKVIPKRTTSSDDLLDFMKLLEDKQDLNVGKAASKLNTSMIISNS
                     LLHYQKLKPSNTILSDDLSLSVIGEPGSTRNRRVSVSNSSIPSVSSPIQYTSIYSRLS
                     KANVNGSDIHKGGVQGKESSYEKEKALDGNSERNLGTFGIRPRSLSNDSLTSVQRILP
                     IQKLYSGDNFSFDEDEEMLVSVRGSPNNKLKKSVSPHSIDSINSYISKNRLPFQQPSY
                     YSNPTTAAVPAYAKLHKPNILSTEMLEEESKKKGEANNSDNTIDENHSRHIKEDEDEL
                     LFFMSDMNISKD"
     gene            <733120..>733494
                     /gene="TPHA0I03310"
                     /locus_tag="TPHA_0I03310"
                     /db_xref="GeneID:11534630"
     mRNA            <733120..>733494
                     /gene="TPHA0I03310"
                     /locus_tag="TPHA_0I03310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687218.1"
                     /db_xref="GeneID:11534630"
     CDS             733120..733494
                     /gene="TPHA0I03310"
                     /locus_tag="TPHA_0I03310"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687266.1"
                     /db_xref="GeneID:11534630"
                     /db_xref="UniProtKB/TrEMBL:G8BY54"
                     /translation="MALANTAHSSTNIMNKLKNLNYIGSEPAFIFISMIRELINPIRP
                     EEYFHLEPIIINYILNSLNGDYASIRDHFSQPPQYTIEDIFASIRSKYEYMKMNKSIN
                     TTSTSQTDTYHTCSRPLHKRII"
     gene            <735235..>735657
                     /gene="TPHA0I03315"
                     /locus_tag="TPHA_0I03315"
                     /db_xref="GeneID:11534631"
     mRNA            <735235..>735657
                     /gene="TPHA0I03315"
                     /locus_tag="TPHA_0I03315"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687219.1"
                     /db_xref="GeneID:11534631"
     CDS             735235..735657
                     /gene="TPHA0I03315"
                     /locus_tag="TPHA_0I03315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687267.1"
                     /db_xref="GeneID:11534631"
                     /db_xref="UniProtKB/TrEMBL:G8BY55"
                     /translation="MQQTITLASYIGYKFWFDILYCVNCLARHTLYPSKQVIRFFKEL
                     LQFLWQTRSKRLVWNKRDKTDDDANYITGIVDASFAKQEEYKSQYRAFIQLNSNMIGA
                     VSSKLKLTCASSIKTELYGISESTHRFANLCLRNGAIH"
     gene            <737136..>738824
                     /gene="TPHA0I03320"
                     /locus_tag="TPHA_0I03320"
                     /db_xref="GeneID:11534632"
     mRNA            <737136..>738824
                     /gene="TPHA0I03320"
                     /locus_tag="TPHA_0I03320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687220.1"
                     /db_xref="GeneID:11534632"
     CDS             737136..738824
                     /gene="TPHA0I03320"
                     /locus_tag="TPHA_0I03320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003687268.1"
                     /db_xref="GeneID:11534632"
                     /db_xref="GOA:G8BY56"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8BY56"
                     /translation="MYVESFKNTFAVDILEYFNLAKIEEAIPDISSIKPMLNSSDNSI
                     ETEKENDVQESFQVSSDFDSLDNKEKAVNDIEACPIEEKPKNQKKVEERDPYMLEWDD
                     PNDPDFPVNWSKKKRAVILLQIMLLTSVTYMGSSIYTPGQLQIQSEFGVGHVVATLNL
                     SLYVLGYGLGPLIFSPQSEFSLLGRQHLYTVTLFIFAMLQIGCATVHNFGGLAVLRFF
                     SGVFCSPSLSTGGASIADILAPEVVPVFLGLWAVAAFSSPVLAPLLGAVMVVAEDWRW
                     IFWLQLWLSTFTLIVLLLFMPETHHGNILYRRARRLRKQTGDDRWSTASAEKEKKLEL
                     GAFLLTAVYKPIKIIMREPIIAAIDMYTALLYGIFYLFFEAFPLVFGGIYNFTLVESG
                     LAFLGFQVGCAIIYPIYIVFLVKYILPRMQNQTFVPEDFLVINMIVAIFLPAALFVFG
                     WTAGVHWILPIFAEVLFVISAFTIFQSNFAYIAISFSDHVASVFAGNGLARAGFACAF
                     PLFGQAMYNNLGSEKYPVAWGSSLLGFISIGMSTIPFLLYKYGAVLRSKSKFTA"
CONTIG      join(HE612864.1:1..740259)
//
DBGET integrated database retrieval system