GenomeNet

Database: RefSeq
Entry: NC_016532
LinkDB: NC_016532
Original site: NC_016532 
LOCUS       NC_016532             452480 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 13, complete genome.
ACCESSION   NC_016532
VERSION     NC_016532.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 452480)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 452480)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612868.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..452480
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="13"
     gene            complement(<1..>6651)
                     /gene="TPHA0M00095"
                     /locus_tag="TPHA_0M00095"
                     /db_xref="GeneID:11532017"
     mRNA            complement(<1..>6651)
                     /gene="TPHA0M00095"
                     /locus_tag="TPHA_0M00095"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687974.1"
                     /db_xref="GeneID:11532017"
     CDS             complement(<1..6651)
                     /gene="TPHA0M00095"
                     /locus_tag="TPHA_0M00095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688022.1"
                     /db_xref="GeneID:11532017"
                     /db_xref="GOA:G8C0S7"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="UniProtKB/TrEMBL:G8C0S7"
                     /translation="MKLFSFKLLQILFLFLALYATHIYGDVTSNFSVTSYGTIVQPPI
                     SSISSTLNGIIFINLAFTTYITTTFYVLQTLYSTTSYSYIYTEANAIPYTKSTQIVYS
                     FGGTPGFYSFTTYIYYVATPYFTGTVVKYPSTRTATSTSYWTSTGVTTSFVQFGLVTD
                     TQNGSGILINSYIVSSPYSGTFTTTVYTYSHLNFVLTQTTTSKSASSYLYYVYIVNSP
                     YPSTVLYSYSINTAQQTPLTYSYSTTLGIGTDSQTTYTTIFYVSTNLPQISTSTTIAS
                     YLGTTPAVTSISISTTTISGSPTLVSVFYIYTNIPNTFTSVTTRVTNTSSNKYTISTS
                     IQIGIGADGSSTATTIYYIGIPDNFFKSTTSDYWTGNQLTTSLGYTTTAGADGKSTVG
                     TIYYVLNTRNPGVTITSPWSGSYTTFYSTSVSYSTLYLLIFFPIASYTTTFYYINIPI
                     FRTTMLTSTYANVANTTTYSTNVFTFTGFDKNVTTETIYYIYTPPVRSSTSILTRTNI
                     GGTKSTTFRTIAVTTTGADGKETTDVTYYIGLPDALFQTTTTAPWTGDYTLTYDINYT
                     TVSGADDSSTVITIYHVETPTPFGLWDTTYWTGTYTTYNYQGIVWRFGFFLIIFFGIW
                     PYDYYILSTPKRDTTFTSFTRPWLSHSSKTSILTTTVVNDGSATTETIYFIYTPATTL
                     TSTSFTQGEFTGSVASTTRTLTTYVSDSPDTQYYEVLYYVVLPINEALSTVYTQWTGL
                     YATTATTVTSTITGSDGNLSIVTIYTVETPHIEPSTSYTYWTGSSTQVLSTSVYTSIG
                     YLDNFFATWTLTLVIVETPIREVLTSIYSYWGSSGTSTYSTFISTTTDYMGNATTEIV
                     YYILTPERYAYSTQYFEVSGSSIGTTTFSTIATTITGADGLETTETVYYVGIPTVAGQ
                     TTILTSWTGSYISLYSSTVLDGITTFYIETPVFSPMISYVPYPGDLTSTIATLVMTSF
                     GYIGSFLLPWTLTTYIVETPSRGLTSTSFTPWLNQNTNTFSTILTTVSGADGIFTTET
                     VFFVYTPYRVTTTTTTTGWQSPITGTFTTSMSVATGTDGQETTEIIYVVGTPKSDLTT
                     TVFTAGLKSSTLTYSTLVKTITESDYTYTETIYYVSTPKRDLTTTEYSADNALTTVTY
                     SSTIVTVTDSLGDETTETTYFVQTPKRVSTSTSLTGWYASDTFTYSTITTTISENGLA
                     TSVTIYFVYTPIEETTTTVFSTGSVGTTATYSTLITTFIGSDGKATTETIYYVQTPLR
                     VGTSTSYVGWTTRSTTTYSTGIITVTNVVGEEVTYTVFFVHTPDFHTTNYETVTDSLS
                     YTTTEATVLTYFTDTDGIVTTTTIYLVVIPIPSAVETHYTYWTGSFSSLFSTLTTQFV
                     GANSSTTLQTIFFIETPVRNSSSTSYLLWTGISQSTFSTTLNKFIGSDGLETTGTLYF
                     VYTPSHVEILTTFSGVLDSTTSTYSTVISTLTDAKGSETTETIYYVHTPIRMSSSTIT
                     TLGTYSSTYTYSSLTTIVTDEDGNEVTETVYYVYTPSIVTQTTVFFPNTESVTTTFET
                     FTTTFTDVFGVETTATVYYVYTPERATTMTSFSKGYNPVTTTFETIVNTVTNNNGEAI
                     TETTFLVQLPILETTSTVYEEHDITEISTYSSDIFTFTNSEGDEVTETVYYVYMPMEK
                     TSSNESEPLSSESTELSEETSEDLSTLLETTDSETEKSIDSETETDTSETESEHHSIN
                     ISSDVSSETSSDVSSETSSDVSSETTSDVSSETSSDVSSETTSDVSSETSSDVSSETT
                     SDVSSETSSDVSSETSSEGSSAASLTTSTYTSTDSEGDITTGTTTFPVETSSETSSEV
                     SSEASLTTSTYTSTDSEGNVTTGTTTFPVETSSETSSEVSSEASLTTSTYTSTDSEGN
                     VTTGTTTFPVETSSETSSEVSSEASLTTSTYTSTDSEGNVTTGTTTFPVETSSETSSE
                     VSSEASLTTSTYTSTDSEGNVTTGTTAFPIGLSSYPQLTRSLEETNVISIWTSTDSYG
                     NIISGSSILNISHSKDCTSMLHSTVISGELINAISKSRQPTSSLNDVSMNESSTPVPA
                     PITTTVVSGSSTETDVISFYTTTDSEGEVVTTSTTYSAVSSESSASVPAPITTTVVSG
                     SSTETDVISFYTTTDSEGEVVTTSTTYTGVTSESSASVPAPITTTVVSGSSTETDVIS
                     FYTTTDSEGEVVTTSTTYSAVSSESSA"
     misc_feature    17638..18088
                     /note="Z region at HMRa1"
     misc_feature    join(17638..17685,17741..17902,18001..18030)
                     /note="incomplete silenced copy of a1 at HMRa-1 locus"
     misc_feature    18085..18296
                     /note="X region at HMRa1"
     gene            complement(<18364..>18828)
                     /gene="TPHA0M00110"
                     /locus_tag="TPHA_0M00110"
                     /db_xref="GeneID:11531821"
     mRNA            complement(<18364..>18828)
                     /gene="TPHA0M00110"
                     /locus_tag="TPHA_0M00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687975.1"
                     /db_xref="GeneID:11531821"
     CDS             complement(18364..18828)
                     /gene="TPHA0M00110"
                     /locus_tag="TPHA_0M00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688023.1"
                     /db_xref="GeneID:11531821"
                     /db_xref="UniProtKB/TrEMBL:G8C0S8"
                     /translation="MLNTSSDINFQFGLRRLSISVIRIRNHHKCDMYSFVIQVCGLFG
                     QTLNQIRQDINIFNNFYTQHILRFIVEGVRYRKEEIMLLYKLANKCALSVKEIRTIVL
                     IRIPYTLLNHHLRRNLLLYTFFSLDVVSISISISISVPGRPRASAKKIQRAA"
     gene            complement(19355..19437)
                     /gene="TPHA0Mtrna1L"
                     /locus_tag="TPHA_0Mtrna1L"
                     /db_xref="GeneID:11531973"
     tRNA            complement(19355..19437)
                     /gene="TPHA0Mtrna1L"
                     /locus_tag="TPHA_0Mtrna1L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11531973"
     gene            <23458..>25317
                     /gene="TPHA0M00120"
                     /locus_tag="TPHA_0M00120"
                     /db_xref="GeneID:11531946"
     mRNA            <23458..>25317
                     /gene="TPHA0M00120"
                     /locus_tag="TPHA_0M00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687976.1"
                     /db_xref="GeneID:11531946"
     CDS             23458..25317
                     /gene="TPHA0M00120"
                     /locus_tag="TPHA_0M00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688024.1"
                     /db_xref="GeneID:11531946"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:G8C0S9"
                     /translation="MSFSEQDRKSGADMQLDLDRKSDAEMQKDLDIEPKLTAVSSSSD
                     DAESHVDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAYAYGLDGQVRYTYQSYATSSY
                     AQHSLLSTVNCITTVIAAAGQICYARASDIFGRMTILVIGVIFYSMGTIIESQATNVS
                     RFAAGSCFYQLGYTGIVLTLEVIAADFSNLNWRLLASFVPALPFIINTWISGNVTSAV
                     NGNWKWGIGMWAFILPLSAIPLGCCLLHMRYLAKKNAGDRLLKEASLIGTLGWKKFIV
                     EILFWRLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLL
                     WEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSVHESVKSAT
                     RITSLYSFVSVITGTILGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRGDNNSHSGI
                     IGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNIGSSVGAAVSGAIW
                     TNILPKEISKRLNNETLAALAYSSPYSFIIDYTWGTPERDAVVLAYRYTQRILCIVGL
                     CFCTTLLISALFLRNHKLVSSVSIDKEQTKVEEVSDITSKEKAPKKWYERLFE"
     gene            complement(<25769..>27604)
                     /gene="TPHA0M00130"
                     /locus_tag="TPHA_0M00130"
                     /db_xref="GeneID:11531974"
     mRNA            complement(<25769..>27604)
                     /gene="TPHA0M00130"
                     /locus_tag="TPHA_0M00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687977.1"
                     /db_xref="GeneID:11531974"
     CDS             complement(25769..27604)
                     /gene="TPHA0M00130"
                     /locus_tag="TPHA_0M00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688025.1"
                     /db_xref="GeneID:11531974"
                     /db_xref="GOA:G8C0T0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8C0T0"
                     /translation="MTVRDVASHSSSVSSLNSICYEIGGTAKTNGIDDSYFKKDNGTV
                     AYDLEVNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKDLKARHISMIAIGGSLGT
                     GLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFTSYASRYCDP
                     ALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIAINTIG
                     VKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYSSSV
                     VNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILFF
                     YVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFV
                     FSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSG
                     SAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFA
                     LFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEAD
                     LNSYKAAVDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF"
     gene            complement(<28356..>29003)
                     /gene="TPHA0M00140"
                     /locus_tag="TPHA_0M00140"
                     /db_xref="GeneID:11532002"
     mRNA            complement(<28356..>29003)
                     /gene="TPHA0M00140"
                     /locus_tag="TPHA_0M00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687978.1"
                     /db_xref="GeneID:11532002"
     CDS             complement(28356..29003)
                     /gene="TPHA0M00140"
                     /locus_tag="TPHA_0M00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688026.1"
                     /db_xref="GeneID:11532002"
                     /db_xref="UniProtKB/TrEMBL:G8C0T1"
                     /translation="MKGTDKNVESVWETPEKFSSLKPCSASSEHHDHLRNGHFRVRAF
                     TNWTSNTSPGISSREGTFARNVPGKSYSGIATSSERLPVCGRQISSSLRRGVDDSGDE
                     RRTRELRIERIRVCKANINGDVDIGTSTLRACMRAFQSQEKGIACNGGSSHRRCVSTY
                     ICTVTAHGGHHRPADSVTRKGTINPHHLAPATPGTHWGLAPGAPPASPVNLRSYQ"
     gene            <29607..>31919
                     /gene="TPHA0M00150"
                     /locus_tag="TPHA_0M00150"
                     /db_xref="GeneID:11532003"
     mRNA            <29607..>31919
                     /gene="TPHA0M00150"
                     /locus_tag="TPHA_0M00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687979.1"
                     /db_xref="GeneID:11532003"
     CDS             29607..31919
                     /gene="TPHA0M00150"
                     /locus_tag="TPHA_0M00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688027.1"
                     /db_xref="GeneID:11532003"
                     /db_xref="GOA:G8C0T2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:G8C0T2"
                     /translation="MDTASPNGCTKIKKKNTPGYSRTGCLQCKKLHTKCDEKKPSCNR
                     CLKRNSECTYRMNFISTAYSSSKGMISFSVGDAAPSRPVANGSPPRTPGGAAATKNCS
                     NKHKFKIQMNTSQFNPEQNKPPYNNADDMGTDHVKIPNSKIEASVIDSMGPAVGDMPT
                     PDSKEMSYTLNSATPDTGNIDPKVEHLDYILSNKGSKNNLDAIEDNAAFDSFGFESIT
                     ASKPPFPLIEKPSKKENSDLDYFQKRQTDLEIEVMKNAVELHSDIFFPQTNIQIFNLL
                     NFDSKNEPVSFFDYSAMDDNSILPRDKTFEQKFSLLSKLDPINRHYSLHLAQNSGNAA
                     IDVSSIPIKDENFLLFIWTIYHKTYGLNEFALFPEERIDELIIILKSLDEDYPIIHTV
                     IRYAVALFMKNLYHRKGLTDLSAMWDTYVVIPSMKPCIDLLNARMNKPINYAECSALA
                     FGAAVLFSPNSTGANTTWKSHLTGVYILLKKAVSYFKPEILDTKKGKYAFALYGITNS
                     LFCRTEVCAYIASESGGVLTNKDELNSFYNVDPFSTYHLLNRQFDLAVGCIHTIYPSC
                     RKITSELIHWKQKNINLSGTHFIKFKFLNKDKAVREELKKFGTSVLNSITEIYKDLVE
                     NDSFKKSALKSIKDYKLIFSLENCNKLNMNSLKMYLMVFFLNEDEKSIDPIVEILEDS
                     LKQWYGIPYKDSVGIKCNWAIYYCALIAIVLNLDNLSEHFLKIINDIANEGLEIAFRS
                     CERLEHISRMIKLKQYDNLDDSKVSQFLAY"
     gene            complement(<32192..>32908)
                     /gene="TPHA0M00160"
                     /locus_tag="TPHA_0M00160"
                     /db_xref="GeneID:11531826"
     mRNA            complement(<32192..>32908)
                     /gene="TPHA0M00160"
                     /locus_tag="TPHA_0M00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687980.1"
                     /db_xref="GeneID:11531826"
     CDS             complement(32192..32908)
                     /gene="TPHA0M00160"
                     /locus_tag="TPHA_0M00160"
                     /inference="similar to DNA sequence:INSDC:YPL267W"
                     /note="similar to Saccharomyces cerevisiae ACM1 (YPL267W);
                     ancestral locus Anc_6.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688028.1"
                     /db_xref="GeneID:11531826"
                     /db_xref="UniProtKB/TrEMBL:G8C0T3"
                     /translation="MSHTTRSRTPLSSRSINHRINNVNKITISKNSIEKVSPLKRSDI
                     DISIALKKSPIRRSNDSALLRSRSNSRSPIKNKNSTPEPFTLFEETQDQRATVLMNHM
                     SLTRNLRTYRDENDWEFIKENMSPNKLKNRETAQELLNKTRQNSHRQILKDLSISEHK
                     GYIEDPRTRESSELNIHIKNGISIPSFVTPPRDKNIKDYFKVAGTFDKTVIQNTTSRS
                     TDDIPKDKVIRKLNFNICSY"
     gene            complement(<33610..>35478)
                     /gene="TPHA0M00170"
                     /locus_tag="TPHA_0M00170"
                     /db_xref="GeneID:11531827"
     mRNA            complement(<33610..>35478)
                     /gene="TPHA0M00170"
                     /locus_tag="TPHA_0M00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687981.1"
                     /db_xref="GeneID:11531827"
     CDS             complement(33610..35478)
                     /gene="TPHA0M00170"
                     /locus_tag="TPHA_0M00170"
                     /inference="similar to DNA sequence:INSDC:YPL269W"
                     /note="similar to Saccharomyces cerevisiae KAR9 (YPL269W);
                     ancestral locus Anc_6.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688029.1"
                     /db_xref="GeneID:11531827"
                     /db_xref="InterPro:IPR013889"
                     /db_xref="UniProtKB/TrEMBL:G8C0T4"
                     /translation="MEEQKDLEVIESLFPVSEFQDAIDCLKKLEELKIDDLSISLGKL
                     YKLLSNLKLVINEIFISKINGKNANTVVIIDSIIKNKSSIAVILGGIYEIEGVLNHIL
                     NLLEELISENSSNISDCNNIFNLIENCTKVEHDLKRQFNVIKPNLDISIEFYEIMNDH
                     MGTLDKLVEKKIQETVSIQEEKFSSPIRHAPNFTLNEIIEILDKNSYSNESKIPAFSP
                     LEESLVERYLQLKEEIKPIELSLTEVLIKRINDFKNRDQNNIEALHALLLKHFKLLMD
                     KYRFLVDEMRNLKLELIDRRWNIIFINLNNEISFLLESVESLQKKYTNNKASEILDKE
                     TNEKLICQLSLKSKIVTKTFNVIYKAFEISLVDAGISKKTNNLAKKWLELRPLNDALI
                     LFSETESKEMQDNKEIQKLTNHLNNLTLNGELKENEEMALQPNLDTIKTPKKKIGAAL
                     LRKMNIKPIIITDTPPPSIEKDNPFFKKNLDRMENSEGGNNEKGKDYNFKDQSITNDI
                     PSLKFAASSDSMDRQLNNDKSDADKENVAYNNTIRELEYQKMQYFSKQKSRIPSINSE
                     KSSKVVRSASLNLSHSKNSSPMMWTPFTKNTSAHLKLPTPKSQLLVKETGARSVTR"
     gene            <36974..>38485
                     /gene="TPHA0M00180"
                     /locus_tag="TPHA_0M00180"
                     /db_xref="GeneID:11532015"
     mRNA            <36974..>38485
                     /gene="TPHA0M00180"
                     /locus_tag="TPHA_0M00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687982.1"
                     /db_xref="GeneID:11532015"
     CDS             36974..38485
                     /gene="TPHA0M00180"
                     /locus_tag="TPHA_0M00180"
                     /inference="similar to DNA sequence:INSDC:YPL272C"
                     /note="similar to Saccharomyces cerevisiae YPL272C;
                     ancestral locus Anc_6.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688030.1"
                     /db_xref="GeneID:11532015"
                     /db_xref="UniProtKB/TrEMBL:G8C0T5"
                     /translation="MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDN
                     ATLYTGRSVNEVSLKSVLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTIS
                     YDKSKDKALMKDQISDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDI
                     FSTANFEKYLLKEMNDVLNSNQKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALT
                     SDLLNLQTQSFFKTIYQNTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGR
                     TVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRS
                     LIADSSDFGLFYKNIKVECPLELINDEKYYTNPEVLHSMQNNSLLEIQFERISRHVSD
                     VISQRMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFS
                     VNNLNFTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN"
     gene            complement(<38571..>39746)
                     /gene="TPHA0M00190"
                     /locus_tag="TPHA_0M00190"
                     /db_xref="GeneID:11532016"
     mRNA            complement(<38571..>39746)
                     /gene="TPHA0M00190"
                     /locus_tag="TPHA_0M00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687983.1"
                     /db_xref="GeneID:11532016"
     CDS             complement(38571..39746)
                     /gene="TPHA0M00190"
                     /locus_tag="TPHA_0M00190"
                     /inference="similar to DNA sequence:INSDC:YEL056W"
                     /note="similar to Saccharomyces cerevisiae HAT2 (YEL056W);
                     ancestral locus Anc_6.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688031.1"
                     /db_xref="GeneID:11532016"
                     /db_xref="GOA:G8C0T6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:G8C0T6"
                     /translation="MEKVEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQ
                     WLPGDKTSTRQHLILGTLTSGAETDYLKIAALDLPDEIIIGKKSDKVVKSNLKVVKKF
                     AHDGEINRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFN
                     PNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVS
                     EDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGK
                     ILHSMTGHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEV
                     MMIHAGSRSAINDISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVSISDLE"
     gene            complement(<40103..>42007)
                     /gene="TPHA0M00200"
                     /locus_tag="TPHA_0M00200"
                     /db_xref="GeneID:11531999"
     mRNA            complement(<40103..>42007)
                     /gene="TPHA0M00200"
                     /locus_tag="TPHA_0M00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687984.1"
                     /db_xref="GeneID:11531999"
     CDS             complement(40103..42007)
                     /gene="TPHA0M00200"
                     /locus_tag="TPHA_0M00200"
                     /inference="similar to DNA sequence:INSDC:YPL263C"
                     /note="similar to Saccharomyces cerevisiae KEL3 (YPL263C);
                     ancestral locus Anc_6.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688032.1"
                     /db_xref="GeneID:11531999"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:G8C0T7"
                     /translation="MAKKTKKDKDAKKARAEAKAKKNQSKAEIKDKKKAKKNLDGEDE
                     DDMDIEEVLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTS
                     QEQGVTHFYNDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPK
                     QNTFYHYSDTWLLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTS
                     YLNDSWLFDITSYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQ
                     KGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEE
                     TEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEIL
                     EKANLKDDDEDANELSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDT
                     LFIYGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEE
                     DEDDEDDDEEETVDQKLVAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVR
                     TGASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIE
                     KDTTKSTKRR"
     gene            complement(<42336..>43973)
                     /gene="TPHA0M00210"
                     /locus_tag="TPHA_0M00210"
                     /db_xref="GeneID:11532000"
     mRNA            complement(<42336..>43973)
                     /gene="TPHA0M00210"
                     /locus_tag="TPHA_0M00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687985.1"
                     /db_xref="GeneID:11532000"
     CDS             complement(42336..43973)
                     /gene="TPHA0M00210"
                     /locus_tag="TPHA_0M00210"
                     /inference="similar to DNA sequence:INSDC:YEL058W"
                     /note="similar to Saccharomyces cerevisiae PCM1 (YEL058W);
                     ancestral locus Anc_6.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688033.1"
                     /db_xref="GeneID:11532000"
                     /db_xref="GOA:G8C0T8"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:G8C0T8"
                     /translation="MHWNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGL
                     LACLRSIALDGKAVGVMITASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFC
                     HSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIID
                     YGLLTTPQLHFLTNAINTTKSRAPVTEDDYYSFFMDAWVSITALHGIKVLQSPRLYID
                     AANGIGGPKVSKLFEVWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPA
                     ADSDPATLYCSFDGDADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEK
                     ISMGVVQTAYANGNSTNYLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGT
                     IMFSNKFFETCESLLKENNESLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLT
                     PSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSF
                     VRASGTEDAVRVYAEASTPQDAAALNEEVSKAVLASV"
     gene            <44225..>44461
                     /gene="TPHA0M00220"
                     /locus_tag="TPHA_0M00220"
                     /db_xref="GeneID:11532001"
     mRNA            <44225..>44461
                     /gene="TPHA0M00220"
                     /locus_tag="TPHA_0M00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687986.1"
                     /db_xref="GeneID:11532001"
     CDS             44225..44461
                     /gene="TPHA0M00220"
                     /locus_tag="TPHA_0M00220"
                     /inference="similar to DNA sequence:INSDC:YEL059C-A"
                     /note="similar to Saccharomyces cerevisiae SOM1
                     (YEL059C-A); ancestral locus Anc_6.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688034.1"
                     /db_xref="GeneID:11532001"
                     /db_xref="GOA:G8C0T9"
                     /db_xref="InterPro:IPR024645"
                     /db_xref="UniProtKB/TrEMBL:G8C0T9"
                     /translation="MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLE
                     SNRYICRPFKRLFEVCAGTSYETTAQPTNSADRS"
     gene            <45121..>46878
                     /gene="TPHA0M00230"
                     /locus_tag="TPHA_0M00230"
                     /db_xref="GeneID:11532026"
     mRNA            <45121..>46878
                     /gene="TPHA0M00230"
                     /locus_tag="TPHA_0M00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687987.1"
                     /db_xref="GeneID:11532026"
     CDS             45121..46878
                     /gene="TPHA0M00230"
                     /locus_tag="TPHA_0M00230"
                     /inference="similar to DNA sequence:INSDC:YEL060C,YOR003W"
                     /note="similar to Saccharomyces cerevisiae PRB1 (YEL060C)
                     and YSP3 (YOR003W); ancestral locus Anc_6.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688035.1"
                     /db_xref="GeneID:11532026"
                     /db_xref="GOA:G8C0U0"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:G8C0U0"
                     /translation="MLGGSVHSSARVSLSWPRYNYTTTIHNYHTQLYNMKLQNTLVSA
                     VIAASVAEALVIPALDQGRGRGHALDHGPNNNNNVPAFMMRAAAAPASAMEMVKDVTD
                     QILAYYQHASPASRGLELAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALF
                     RRLSEEQRPAAAPGASALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVD
                     YVEKDSVVHSLDETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTG
                     ISVSHLEFGERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLR
                     SDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVN
                     AAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAP
                     GLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQM
                     KKKIIDYATKNALADLPADTPNKLIYNGGFNSTDFWASAAAPQSHKVKTNRYSLGSFL
                     DSIQDSNNHWFNFDNMNIF"
     gene            <47407..>50226
                     /gene="TPHA0M00240"
                     /locus_tag="TPHA_0M00240"
                     /db_xref="GeneID:11532027"
     mRNA            <47407..>50226
                     /gene="TPHA0M00240"
                     /locus_tag="TPHA_0M00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687988.1"
                     /db_xref="GeneID:11532027"
     CDS             47407..50226
                     /gene="TPHA0M00240"
                     /locus_tag="TPHA_0M00240"
                     /inference="similar to DNA sequence:INSDC:YEL061C"
                     /note="similar to Saccharomyces cerevisiae CIN8 (YEL061C);
                     ancestral locus Anc_6.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688036.1"
                     /db_xref="GeneID:11532027"
                     /db_xref="GOA:G8C0U1"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:G8C0U1"
                     /translation="MSADPQKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDV
                     MGSNEISINTSDDIVSGLTAQLNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGY
                     NCTVLVYGMTSTGKTYTMTGDEKLYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKC
                     SFIELYNEELKDLLIDSNNTKLKKLRIFDSNLSKSSNNNNISRQNSHFISGMDLRKNP
                     INPINNSNDNTAIQNGNASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVS
                     SRSHTIFTINLYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT
                     LGRVINSIADKNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEY
                     ATKAKSIKNKPQLGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTN
                     DLESYKTEIQECDRIVKSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTL
                     EIQHKKEQILVEELAHSREKSLKMKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLI
                     ENLNGIAKENLIVQTNVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLIL
                     EMFSSDVKKNQELNETYFANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNT
                     TKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWD
                     ISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDEIIKKHMNQIKSNVDSLNSTPKL
                     LNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLVFDEICKSIQFAFANYSKTNL
                     QESALLKGRLFADIDPLNDTNLNKQESLTFDKGDAKLTKENNEDMSSKDENKLNNQNV
                     TLIGLKRSHMDLNDSDSPLKSRRIE"
     gene            complement(<50326..>53226)
                     /gene="TPHA0M00260"
                     /locus_tag="TPHA_0M00260"
                     /db_xref="GeneID:11532028"
     mRNA            complement(<50326..>53226)
                     /gene="TPHA0M00260"
                     /locus_tag="TPHA_0M00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687989.1"
                     /db_xref="GeneID:11532028"
     CDS             complement(50326..53226)
                     /gene="TPHA0M00260"
                     /locus_tag="TPHA_0M00260"
                     /inference="similar to DNA sequence:INSDC:YOR005C"
                     /note="similar to Saccharomyces cerevisiae DNL4 (YOR005C);
                     ancestral locus Anc_6.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688037.1"
                     /db_xref="GeneID:11532028"
                     /db_xref="GOA:G8C0U2"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="InterPro:IPR029710"
                     /db_xref="UniProtKB/TrEMBL:G8C0U2"
                     /translation="MTSVPNMNIDTSEREPRNFSPSPDFKWLCNELFVKLDEVRLKPK
                     SVDTRPKNIQYDIVINNFIHLWRVTVGNDIYPALRLILPYRDRRNYYIREHTLIRIVC
                     DYLKLQKNSVTEQRLRRWKQKARRSINLSSFCIQEIKKRLSEPVSKEKITIDKLNSIL
                     DSLSMERSSSKITNGSSGKKLSQLESIKYCFENMSFIELEYFFDILIKARLIGGLEHK
                     FLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNSKDLTIALHNAFEPQLAKKVNLSY
                     EVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLYGKDKSTATISK
                     YLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLENDLCSPLFIVF
                     DVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSALQAAISVG
                     SEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKDSLMCGVAV
                     LENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANGISNEEF
                     KEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNEALRD
                     KFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHSHIKKKRSRT
                     SKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRLRIDELINIIKVNGG
                     QLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCIANDKLLDFEPS
                     HCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKTPKEQLYSNPLQFDQQIE
                     KIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVIIIGDEHSKSS
                     NEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDFPIIF"
     gene            complement(<53640..>54773)
                     /gene="TPHA0M00270"
                     /locus_tag="TPHA_0M00270"
                     /db_xref="GeneID:11531950"
     mRNA            complement(<53640..>54773)
                     /gene="TPHA0M00270"
                     /locus_tag="TPHA_0M00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687990.1"
                     /db_xref="GeneID:11531950"
     CDS             complement(53640..54773)
                     /gene="TPHA0M00270"
                     /locus_tag="TPHA_0M00270"
                     /inference="similar to DNA sequence:INSDC:YOR007C"
                     /note="similar to Saccharomyces cerevisiae SGT2 (YOR007C);
                     ancestral locus Anc_6.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688038.1"
                     /db_xref="GeneID:11531950"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8C0U3"
                     /translation="MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVF
                     DVDKDLISNILKTAYRSNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLS
                     RNKDDINVPVKVIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDA
                     IKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYE
                     IGDYEGSLAAFKRMIEIAQENNKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEG
                     SGNSVNDGPKRKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMN
                     DPRVRQMKENVNSDSMSNIPILKDLFYSLLNTTVYEENLNGKK"
     gene            complement(55173..55245)
                     /gene="TPHA0Mtrna1R"
                     /locus_tag="TPHA_0Mtrna1R"
                     /db_xref="GeneID:11531951"
     tRNA            complement(55173..55245)
                     /gene="TPHA0Mtrna1R"
                     /locus_tag="TPHA_0Mtrna1R"
                     /product="tRNA-Arg"
                     /note="codon recognized: CGU"
                     /db_xref="GeneID:11531951"
     gene            complement(<55778..>56689)
                     /gene="TPHA0M00280"
                     /locus_tag="TPHA_0M00280"
                     /db_xref="GeneID:11531948"
     mRNA            complement(<55778..>56689)
                     /gene="TPHA0M00280"
                     /locus_tag="TPHA_0M00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687991.1"
                     /db_xref="GeneID:11531948"
     CDS             complement(55778..56689)
                     /gene="TPHA0M00280"
                     /locus_tag="TPHA_0M00280"
                     /note="ancestral locus Anc_6.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688039.1"
                     /db_xref="GeneID:11531948"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:G8C0U4"
                     /translation="MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLD
                     HFNVIPPAGFPDHPHHGQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHS
                     EMPVLMENGEILDGLQLWVDLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKS
                     YGIESVKDLAYTPVDFYVYKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHS
                     SIFFNTDGDNVQGIVGSDDTEFAIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESY
                     TGGFERALNWRSSIRNGIDESQAANHK"
     gene            <57784..>58767
                     /gene="TPHA0M00290"
                     /locus_tag="TPHA_0M00290"
                     /db_xref="GeneID:11531952"
     mRNA            <57784..>58767
                     /gene="TPHA0M00290"
                     /locus_tag="TPHA_0M00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687992.1"
                     /db_xref="GeneID:11531952"
     CDS             57784..58767
                     /gene="TPHA0M00290"
                     /locus_tag="TPHA_0M00290"
                     /inference="similar to DNA sequence:INSDC:YOL002C"
                     /note="similar to Saccharomyces cerevisiae IZH2 (YOL002C);
                     ancestral locus Anc_6.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688040.1"
                     /db_xref="GeneID:11531952"
                     /db_xref="GOA:G8C0U5"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:G8C0U5"
                     /translation="MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIG
                     RFTRQLITITHWDDLPDWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMV
                     PGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVA
                     IYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFR
                     SREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLY
                     AMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLSAYEYAHEMLIK"
     gene            <59377..>61701
                     /gene="TPHA0M00300"
                     /locus_tag="TPHA_0M00300"
                     /db_xref="GeneID:11531872"
     mRNA            <59377..>61701
                     /gene="TPHA0M00300"
                     /locus_tag="TPHA_0M00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687993.1"
                     /db_xref="GeneID:11531872"
     CDS             59377..61701
                     /gene="TPHA0M00300"
                     /locus_tag="TPHA_0M00300"
                     /inference="similar to DNA sequence:INSDC:YDL028C"
                     /note="similar to Saccharomyces cerevisiae MPS1 (YDL028C);
                     ancestral locus Anc_3.162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688041.1"
                     /db_xref="GeneID:11531872"
                     /db_xref="GOA:G8C0U6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C0U6"
                     /translation="MVLNDNTRFSKSGGIRNDTIQTYNNDSDSDEKLTVLPKLSNFGS
                     ALISEKNENITRNSLTNSSISMSSNYNQINTLTKNNEIGTINSNFNNGQIASPKFKGI
                     KNLIDQEMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQEN
                     DHKTFESMNDMENDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTTPSSSFGSTLYSS
                     TTNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFE
                     KQKEENRKNIMKKRSVSKEGFMTSISSNSVSSKISRQSSFHTTTNNRHSSMVSKQDTN
                     AILMNTTSTRSDEKVMKPLNEYEPDRKVLASIDINKNINVNAIEKKRPVEHQYSYEKS
                     KIHISESRESQSSTVEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDI
                     EYERIELLGRGGSSKVYKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGEIELLKKLEN
                     EKRVVKLIQYQMDNGVLYLVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKV
                     VHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEAL
                     VALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVK
                     IVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLI
                     RNAVYYGSDQGQVSEDKITELADDVLNRLADFRL"
     gene            complement(<61976..>64921)
                     /gene="TPHA0M00330"
                     /locus_tag="TPHA_0M00330"
                     /db_xref="GeneID:11531873"
     mRNA            complement(<61976..>64921)
                     /gene="TPHA0M00330"
                     /locus_tag="TPHA_0M00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687994.1"
                     /db_xref="GeneID:11531873"
     CDS             complement(61976..64921)
                     /gene="TPHA0M00330"
                     /locus_tag="TPHA_0M00330"
                     /inference="similar to DNA sequence:INSDC:YDL031W"
                     /note="similar to Saccharomyces cerevisiae DBP10
                     (YDL031W); ancestral locus Anc_3.159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688042.1"
                     /db_xref="GeneID:11531873"
                     /db_xref="GOA:G8C0U7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0U7"
                     /translation="MSRSVNKRSMSADSDDSDFEDNGVDIAKSIAFNASGSDSSDDSD
                     EEDDFKVDDGVQDLIEYSDEETTEKEVKKTKKASNPFPLLEMSDDEDDKNSKNSAFND
                     DADDVNDYFSTNMQDKSKHKKGSFPSFGLSKLILSNINKKGFRQPTPIQRKTIPLILQ
                     RRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHKVFKDFS
                     RGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPGRFMHLKVEMGLDLKTVEYVVFDE
                     ADRLFEMGFQEQLNELLASLPMNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDAESK
                     ISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTEEEIKKLTASNKRSDEIDSDNER
                     EQADRKLNKKKKFEKFIKPKLPSANELPSEKATIVFVPTRHHVEYISNLLKDCGYLVS
                     YLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASSKIFVH
                     RVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQMYEATCSLAKNKWIAAG
                     NEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDLQMAKKTSLKAEKLY
                     FRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQNRNNKETVFEFG
                     RNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHALEDEILKGEDHESGY
                     TISKEALAAFEDADKLLQEQEKKKRKPKTYKDPQFFLSHYAPAKDIQDKQLNLTSGFT
                     NDAAQAAYDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQKIPASF
                     KSGRFDEWSKARHIKPLKAGVREDSIPTNLLADVTGPSDGSRTFGGRFKHKQNKAPRL
                     PDKHRDDYESQKKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNENKQKKN
                     ARPSKKRKY"
     gene            <65852..>66940
                     /gene="TPHA0M00340"
                     /locus_tag="TPHA_0M00340"
                     /db_xref="GeneID:11531874"
     mRNA            <65852..>66940
                     /gene="TPHA0M00340"
                     /locus_tag="TPHA_0M00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687995.1"
                     /db_xref="GeneID:11531874"
     CDS             65852..66940
                     /gene="TPHA0M00340"
                     /locus_tag="TPHA_0M00340"
                     /inference="similar to DNA sequence:INSDC:YOL064C"
                     /note="similar to Saccharomyces cerevisiae MET22
                     (YOL064C); ancestral locus Anc_3.157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688043.1"
                     /db_xref="GeneID:11531874"
                     /db_xref="GOA:G8C0U8"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:G8C0U8"
                     /translation="MAFEKELLVATQAVRKASLLTKRIQGRVIAHKDSSTLIKSDSSP
                     VTIGDYAAQTVIINAIKSNFPDDKILGEESAAGLKDEFLSEILKEIKENDTIFDESYS
                     TDFKFRSDEYPLKTIDDVRNVINLGDYKGGRQGRFWCLDPIDGTKGFLRGEQFAVCLG
                     LIVDGTTQVGVLGCPNLSLKEYGGEKDIEGYEKFGYIFRAVRGQGAFYQPNASDPTDN
                     SHWTTCHVRQLQDAQQMISLEGVEKAHSSHSEQSEIKREQGITKTLHLDSQAKYCLLA
                     LGLGDVYLRLPIKLSFQEKIYDHAAGNVIVHEAGGIHTDAMENVPLDFGNGLTLSTKG
                     VIASSGPQRLHDAVVSTSESVITSRASK"
     gene            <67519..>69792
                     /gene="TPHA0M00350"
                     /locus_tag="TPHA_0M00350"
                     /db_xref="GeneID:11531875"
     mRNA            <67519..>69792
                     /gene="TPHA0M00350"
                     /locus_tag="TPHA_0M00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687996.1"
                     /db_xref="GeneID:11531875"
     CDS             67519..69792
                     /gene="TPHA0M00350"
                     /locus_tag="TPHA_0M00350"
                     /inference="similar to DNA sequence:INSDC:YDL035C"
                     /note="similar to Saccharomyces cerevisiae GPR1 (YDL035C);
                     ancestral locus Anc_3.156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688044.1"
                     /db_xref="GeneID:11531875"
                     /db_xref="GOA:G8C0U9"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:G8C0U9"
                     /translation="MIPIKSQSSWTAEILNLVKRKNIKTRLKNTTTLNVALGLPGMFQ
                     AFTLQTQKKLHTVAITSSTFSVLCGCCSFYLLYNYDKRDKVFRHELITLLTVCDFIKT
                     LILMIYPTVLKCDRNQMGNQKLYNTLGFLTAFAIEGADLAILVFAIHFALLIFKPDMK
                     WENKKTKNIDGGLFKCRYYVWPIVIILPFVFASLAFIDYSMVNFKFEKTYTELIIDDN
                     DLNFEFQARTGGYKPLSTMCYFPPSPIWYKLALSWGLRYFLVLFILITYACIYISVSR
                     QTSLLNRTMKELGYSPKQEKDDPLKKSNIFKRILKSFFQLIAHVFLPIIERDESDSDE
                     SADNLLLFSMSNVHDNENSNNNNYTNSNNVTENGNVQAGLHFQESNKHMESSTTENNT
                     KSNTDMLHNIFSKRNRSGNLGILNHEKSEVDNLQQGLRRETYLAMYHRRNNTRSNLRS
                     IFIYPFSYICLWAFPIAIDITQYRYEIDHGPIIWLAYIGAFVYPLSSFVDLLVISYRE
                     KPWKHSWRQVEKKSLMDTYRYESQIGEDEIIKLCNSPLGKLGWYYYSLPSEEVGLFSS
                     IFSMRKSENGKRMKETPSTDSGISTPGSFSSGSKYSHHSFNHSSNTMKYNNLSSSLPE
                     ISLYWRLIHTLPMLQGVNLYEFNEELKSINGISDIIRTKTENDTCTTVKIISNVTKNN
                     STVAHNNLHTLTENNELKKASSERHEVAYNIDFSNITLNNTNFSDVVNTTSTKNYPTT
                     TQQKNDGKVTLIEFLRG"
     gene            <70094..>71974
                     /gene="TPHA0M00360"
                     /locus_tag="TPHA_0M00360"
                     /db_xref="GeneID:11531961"
     mRNA            <70094..>71974
                     /gene="TPHA0M00360"
                     /locus_tag="TPHA_0M00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687997.1"
                     /db_xref="GeneID:11531961"
     CDS             70094..71974
                     /gene="TPHA0M00360"
                     /locus_tag="TPHA_0M00360"
                     /inference="similar to DNA sequence:INSDC:YDL036C,YOL066C"
                     /note="similar to Saccharomyces cerevisiae PUS9 (YDL036C)
                     and RIB2 (YOL066C); ancestral locus Anc_3.154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688045.1"
                     /db_xref="GeneID:11531961"
                     /db_xref="GOA:G8C0V0"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8C0V0"
                     /translation="MLTRFQRQLVTIKHYNLMTIKREMSSSNNEIDEGNSNTDSQSTS
                     ELSEFETYLLHDKARARQEKLFKQINQNKRAKRDNSKITQTELRDKAGFKLKVANTNS
                     NRNKQEDPEFEVRIEGPLRKITPYLFTYKTFCKLRWRDRKLIDVFVNEFRDREESYYI
                     KTIAAGKVFLNNEPANLDSVIRNGDYITHQIHRHEPPITSRPIKTVFENDDILAIDKP
                     SGIAVHPTGRFRFNTITKILRKKLGYSVHPCNRLDRLTSGLMFLAKTPKGADEMGDQL
                     KAREVTKEYIARVVGEFPIEETVVELPLRSIDPRVSLNAVCKGNDENAKHAKTIFSRI
                     SYDGKTSVVKCKPLTGRTHQIRVHLQYLGHPIANDPIYSNPSIWGPLLGKGGVEDYKE
                     IADKLDEIGKTKVAESWFFSDAEGEKLLPDQKCEVCETTLYSDPGPNDLDLWLHAYRY
                     ESTELNEYGEKKWSYRTDFPDWAVEPNVKYMKMALEEARKCGPTRTAFNVGAVLVNGT
                     TILSTGYSRELPGNTHAEQCALEKYFEKNNTKVVPEGTSIFTTVEPCSLRLSGNEACL
                     ERIINQNGNIRTVFVGTMEPNIFVKNNKSLTNLTKNNIEYVKIPGFEEDCLQVATIGH
                     EN"
     gene            <72373..>74889
                     /gene="TPHA0M00370"
                     /locus_tag="TPHA_0M00370"
                     /db_xref="GeneID:11531962"
     mRNA            <72373..>74889
                     /gene="TPHA0M00370"
                     /locus_tag="TPHA_0M00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687998.1"
                     /db_xref="GeneID:11531962"
     CDS             72373..74889
                     /gene="TPHA0M00370"
                     /locus_tag="TPHA_0M00370"
                     /inference="similar to DNA sequence:INSDC:YDL040C"
                     /note="similar to Saccharomyces cerevisiae NAT1 (YDL040C);
                     ancestral locus Anc_3.153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688046.1"
                     /db_xref="GeneID:11531962"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:G8C0V1"
                     /translation="MSKRRGAAKPKPKSAASKPKDNSGLLEALKLYESKNYKKSLKLL
                     EAILKKDSSYVDALALKGLDLYSTGETEEAKSYINNAISKIKSFKASPICCHILGIYM
                     RSTKNYTDSIRWFQASLDNGSTNHQIYRDLSILQSQIGDFKAVLASRKKYWEAYMGYR
                     ANWTSLAVAQYINGERQQAINTLSQFEKLAAGKLSEPELYENSECIMYKNDIMYTAAE
                     SNVEKLNKVLKHLCDNEKDIFDKYAVLERKASILMKTGEFKEASKVYRALIKRNPDNL
                     KYYKLLEVTLGISNDKGLKLKLYKKLATFYPKAEPPKYIPLSFIEDENYLRESLNEYV
                     TAQLKRGVPATFSNIKPLYRQRSDIIPRLCEDIVTEFLGTLEASSDPSAVIWTNYYLS
                     QHYLFVRNYPKAQEYIDKAIEHTPTMVELYILKGRILKHMGMLSEAAEALEEGRKLDL
                     QDRFINCKTAKYYLRANDIEKAVEVVSLFTKNDDAVNGVKDLHLVEASWFIIEQAEAY
                     NRLHVDSKKKLEELRTSSAEVTEEDENADSQKIKELEWDTMKFQGLSLKRYTAISKFY
                     QQFEDDQLDFHSYCLRKGTSRAYLEMLDWGKSIYTKPIYVRAMKGASRLYFELNDTLK
                     ERNDSEIVPKKKSNTKNKKDSSLNKRKDQERKIVMAYPADKDNDEFGEKLSNSKKPLD
                     DFLNVFFTKYNNQVTDVDKDYVLAFLTEYKLGKLALSAGAITKYSKIVGPNASIIGAM
                     AIILALATRDDQPFEDIAKQVARKVLESDFSSIPINEVNSPDFNFIKYFKDNYKLDNV
                     NALLLLDYFQLNKDDIKPLILKSIETLEPYKKIYILEYEL"
     gene            <75380..>75943
                     /gene="TPHA0M00380"
                     /locus_tag="TPHA_0M00380"
                     /db_xref="GeneID:11531963"
     mRNA            <75380..>75943
                     /gene="TPHA0M00380"
                     /locus_tag="TPHA_0M00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003687999.1"
                     /db_xref="GeneID:11531963"
     CDS             75380..75943
                     /gene="TPHA0M00380"
                     /locus_tag="TPHA_0M00380"
                     /inference="similar to DNA sequence:INSDC:YOL067C"
                     /note="similar to Saccharomyces cerevisiae RTG1 (YOL067C);
                     ancestral locus Anc_3.152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688047.1"
                     /db_xref="GeneID:11531963"
                     /db_xref="GOA:G8C0V2"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8C0V2"
                     /translation="MTSVPDSVESFSETANSSQPANVTIERLRRDNMNEKIQEILNLI
                     PTEFFEEHLRAKSASANTLEANSLNDQIKASGTKDGKPNKGQILTQAVEYIIHLQNEI
                     DANNREEVDMLAQLQELSKQKGVIVNDVNLENTIAEEMLAKIGVGPLSAQNEENKTDL
                     NARKETSNNQQTQKLEYGGYSEYGNGL"
     gene            <76584..>78269
                     /gene="TPHA0M00390"
                     /locus_tag="TPHA_0M00390"
                     /db_xref="GeneID:11531964"
     mRNA            <76584..>78269
                     /gene="TPHA0M00390"
                     /locus_tag="TPHA_0M00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688000.1"
                     /db_xref="GeneID:11531964"
     CDS             76584..78269
                     /gene="TPHA0M00390"
                     /locus_tag="TPHA_0M00390"
                     /inference="similar to DNA sequence:INSDC:YDL042C,YOL068C"
                     /note="similar to Saccharomyces cerevisiae SIR2 (YDL042C)
                     and HST1 (YOL068C); ancestral locus Anc_3.151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688048.1"
                     /db_xref="GeneID:11531964"
                     /db_xref="GOA:G8C0V3"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8C0V3"
                     /translation="MTEGEQLIMNGKRSASTDIDNFPLSSLQRSSQSQAQTQSHSESE
                     SQQPIKKLKTEDIEETQVSVNHGNDETIDTCKRFRDVLKPIMPILPIKIYQDQLTKKY
                     ILPKFERGDMLNARLFLKFYGLRKFLDSYLPEQLNTLYLYHIIKLLGFEINDSFLLTS
                     IYKVIETDNSKIEQFFEENKGKLDENYERLLRNIADNESGDPLGKKHAVRLVKDLQKA
                     VNKILCTRIRLSNFSSPMDFVNRLKEAKNILVLTGAGVSTSLGIPDFRSSEGFYSKIK
                     YLGLDDPQDVFNFDIFMQDPSVFYNIAHLVLPPDNICSPLHSFIKMLQDKGKLLRSYT
                     QNIDNLESYAGIKPEKLVQCHGSFATASCVTCHWQLPGEKIFNSIRKMELPLCPYCYP
                     KRKEYFPTEVVTETDSSEKIFSIPSQFDSDMGRFSTFSYVQKSCGVLKPDITFFGEAL
                     PSKFHKTIRKDILECDLLICIGTSLKVAPVSEIVNMLPAHVPQVLINKDPVKHAEFDI
                     SFLGLCDDVVAYITELCGWDIPHKSWPTLKNTKFNCIENDKGVYAIAPEETPK"
     gene            <78578..>79474
                     /gene="TPHA0M00400"
                     /locus_tag="TPHA_0M00400"
                     /db_xref="GeneID:11531856"
     mRNA            <78578..>79474
                     /gene="TPHA0M00400"
                     /locus_tag="TPHA_0M00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688001.1"
                     /db_xref="GeneID:11531856"
     CDS             78578..79474
                     /gene="TPHA0M00400"
                     /locus_tag="TPHA_0M00400"
                     /inference="similar to DNA sequence:INSDC:YDL043C"
                     /note="similar to Saccharomyces cerevisiae PRP11
                     (YDL043C); ancestral locus Anc_3.150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688049.1"
                     /db_xref="GeneID:11531856"
                     /db_xref="GOA:G8C0V4"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8C0V4"
                     /translation="MDYQNRAGSKKGAGGIASESHSNLQRRKKVEELLREGEQVPYTF
                     QDEGISNNNVASNSLARKDPYIYKNHSGKLVCKLCNTMHMSWTSVERHLKGKKHGLSV
                     LRRENMVDKHKSNMNKSNRNGEDLMLQQFQKAVEKRRQAIISNGIEPLCKISKIKDEE
                     SGLPGISIQVDYNTRGETNGSDLKVGKDLEYLKPFIKIVNGIELAKDSGTENNDKNNK
                     KNDNGINNNATTVTKDEDINDEYLVIAYEPFENIGITLPPKEIILDASSGDELKSLEE
                     LNQRCTYWDSDSKYFYVQFFFK"
     gene            complement(<79537..>80919)
                     /gene="TPHA0M00410"
                     /locus_tag="TPHA_0M00410"
                     /db_xref="GeneID:11531857"
     mRNA            complement(<79537..>80919)
                     /gene="TPHA0M00410"
                     /locus_tag="TPHA_0M00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688002.1"
                     /db_xref="GeneID:11531857"
     CDS             complement(79537..80919)
                     /gene="TPHA0M00410"
                     /locus_tag="TPHA_0M00410"
                     /inference="similar to DNA sequence:INSDC:YOL069W"
                     /note="similar to Saccharomyces cerevisiae NUF2 (YOL069W);
                     ancestral locus Anc_3.149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688050.1"
                     /db_xref="GeneID:11531857"
                     /db_xref="GOA:G8C0V5"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="UniProtKB/TrEMBL:G8C0V5"
                     /translation="MSRYTFPILDIPEIVLTLHKCDFAMANEVNIRRPTSEYIITLYK
                     QIIESYMGLSADHLLTLGVNANKESVTNDNNDEHNVLNVLVLNKICFKFFLNIGVTDF
                     NIMDLYKPDHLRVQRLLSAVVNFARFRVEKMEDCTDIIEKSGVLLDELTSTFHKFNYL
                     QNIKNQYVIKSHPSNELDNVSPFVDSINNEEELKRLDSENAALEIELKKLTAVQEQLK
                     NNYDNYKRTKNDLFTGLESVNFKYIELESEKKKLEKFTNANIVDINRKIDDVKSQIKI
                     YDEKLISLQEKQNNVKVAVTSLQHIIEELYDIIRLLSTDLEQKNRDEQDLLNFQKQLK
                     LRNEKLEVLLKSNISYKLKLLNNQLEAQNEKLLDLKKQHDRETLENDSTITNLKRKYN
                     EETLKEFKEGEKNIQENLINIELKNIELEIEEMQNNYKIEINEIENQYSLLVTHINNY
                     MEKMLNKMQI"
     gene            <81825..>83087
                     /gene="TPHA0M00420"
                     /locus_tag="TPHA_0M00420"
                     /db_xref="GeneID:11531858"
     mRNA            <81825..>83087
                     /gene="TPHA0M00420"
                     /locus_tag="TPHA_0M00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688003.1"
                     /db_xref="GeneID:11531858"
     CDS             81825..83087
                     /gene="TPHA0M00420"
                     /locus_tag="TPHA_0M00420"
                     /inference="similar to DNA sequence:INSDC:YOL070C"
                     /note="similar to Saccharomyces cerevisiae YOL070C;
                     ancestral locus Anc_3.148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688051.1"
                     /db_xref="GeneID:11531858"
                     /db_xref="UniProtKB/TrEMBL:G8C0V6"
                     /translation="MSLEGSNNANDKSVNTKRLSLMLDSLQANVSDSSDERAETVKPS
                     TVEQGPISNMLPPNNGMYSVANRSSFISSYSGVVEEGIAVSFMNNTNSGSERDSNSTF
                     GNSSETVQKIPLLPTLPLQENVNSFIPKEKKSGSQQVKRFDSLPSTPSPTQLEAITVQ
                     RYSSLRSSKSNKASNNLKTILVEPSTPTASKNQIPIILQSPQEDTATQMQKEEDKDES
                     DDSIPEIRITSRVSDTDMESVSSSVLEPLLTTVERANSGKDPIRSETNEYNPSIPPRN
                     SRRPCSKIHVPEVLVENVESETYGHADAPNSDEILSQEHSKHPPPSSIQAEDAPVQRN
                     LGTIEPFSQVDPDALSRMISFTNGTLVSSEFSKLDMQMEEKKVLEQLVDALTRLAADM
                     ISDPERFDEGIRRMDKATKDLEGFSEHI"
     gene            <83619..>84998
                     /gene="TPHA0M00430"
                     /locus_tag="TPHA_0M00430"
                     /db_xref="GeneID:11531859"
     mRNA            <83619..>84998
                     /gene="TPHA0M00430"
                     /locus_tag="TPHA_0M00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688004.1"
                     /db_xref="GeneID:11531859"
     CDS             83619..84998
                     /gene="TPHA0M00430"
                     /locus_tag="TPHA_0M00430"
                     /inference="similar to DNA sequence:INSDC:YDL044C"
                     /note="similar to Saccharomyces cerevisiae MTF2 (YDL044C);
                     ancestral locus Anc_3.147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688052.1"
                     /db_xref="GeneID:11531859"
                     /db_xref="UniProtKB/TrEMBL:G8C0V7"
                     /translation="MLRLRALNVSRCAVNRGIHSSNALLGEMKQSSSGKIGRDTSLDE
                     SKTFKSEEELSNIQERTLFENVFERIMEKERERELSRKDVMSQVNKLSKGHSSDEDYS
                     EGLNPGSSNEKLQIVFGQDKKQLSENDKRMLAFFRKSSEEHNKIHDSSHYSDLATLTT
                     DDIRKYPVSLVSTILDIDDNQAKELKMDRSILGKFAKLASNNVKKSYLPDAETTDDAL
                     NRKEAMLEYLKKKQMFKSDMDKAMKPYIDYIITQVKTDHELLEYFMELIQQYKTNADK
                     IIPTSTSFEELPNEIKTQCEAHPTVLPTPLDITVPYIIQTFLKDEKIYLPSERRYSLS
                     AFIHNECKQLDQLSLYLSVCSIEFYNILLQLTWENFSEIYPLRQLIGEMTINGVMGNL
                     ETINILEKIVEDLQYLNDDIAHEQPSDVNNEVVENNRKIFSNIWCRDNTIGLAKIEKY
                     LANLKSSLA"
     gene            <85489..>86445
                     /gene="TPHA0M00440"
                     /locus_tag="TPHA_0M00440"
                     /db_xref="GeneID:11531822"
     mRNA            <85489..>86445
                     /gene="TPHA0M00440"
                     /locus_tag="TPHA_0M00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688005.1"
                     /db_xref="GeneID:11531822"
     CDS             85489..86445
                     /gene="TPHA0M00440"
                     /locus_tag="TPHA_0M00440"
                     /inference="similar to DNA sequence:INSDC:YDL045C"
                     /note="similar to Saccharomyces cerevisiae FAD1 (YDL045C);
                     ancestral locus Anc_3.146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688053.1"
                     /db_xref="GeneID:11531822"
                     /db_xref="GOA:G8C0V8"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8C0V8"
                     /translation="MASLEETSQHCNDIVESYLRLSPNESEFIKCTQDAINETKRCIL
                     DEIFCKWCPFSGEISLSYNGGKDCQVLLIVYLSCLWEYYKKGSQASFPLAELPAAFIS
                     LEECFPKLQDFIEFTAMKYHLNLYKSPLHPDKKIKMADAFDIYLNEFPRIKGILIGIR
                     RTDPFGEKLVPIEKTDSGWPEFMRLQPILHWSLASVWSFLIYSNEPICELYSMGFTSL
                     GKVTETDPNPYLMIENDKDHNRSNRFNWEEEHAFQNQKELNKENIESDYELVNVTETS
                     IHTAGNQIHRDTKYYPGWYLTDDKLERCGRIKPAECYPQAPT"
     gene            complement(<86623..>86910)
                     /gene="TPHA0M00450"
                     /locus_tag="TPHA_0M00450"
                     /db_xref="GeneID:11531823"
     mRNA            complement(<86623..>86910)
                     /gene="TPHA0M00450"
                     /locus_tag="TPHA_0M00450"
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /transcript_id="XM_003688006.1"
                     /db_xref="GeneID:11531823"
     CDS             complement(86623..86910)
                     /gene="TPHA0M00450"
                     /locus_tag="TPHA_0M00450"
                     /inference="similar to DNA sequence:INSDC:YDL045W-A"
                     /note="similar to Saccharomyces cerevisiae MRP10
                     (YDL045W-A); ancestral locus Anc_3.145"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /protein_id="XP_003688054.1"
                     /db_xref="GeneID:11531823"
                     /db_xref="InterPro:IPR017264"
                     /db_xref="UniProtKB/TrEMBL:G8C0V9"
                     /translation="MSGKAPVVRLPPLPRLKVKKPIIKQETNKCLVLMSNLLQCWSSN
                     GHMSSSCEGIAKELKGCTAVNAMGGKHNDQKSNINYHAARLYDRVGGKHHD"
     gene            complement(<87266..>87730)
                     /gene="TPHA0M00460"
                     /locus_tag="TPHA_0M00460"
                     /db_xref="GeneID:11531824"
     mRNA            complement(<87266..>87730)
                     /gene="TPHA0M00460"
                     /locus_tag="TPHA_0M00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688007.1"
                     /db_xref="GeneID:11531824"
     CDS             complement(87266..87730)
                     /gene="TPHA0M00460"
                     /locus_tag="TPHA_0M00460"
                     /inference="similar to DNA sequence:INSDC:YOL071W"
                     /note="similar to Saccharomyces cerevisiae EMI5 (YOL071W);
                     ancestral locus Anc_3.144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688055.1"
                     /db_xref="GeneID:11531824"
                     /db_xref="GOA:G8C0W0"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:G8C0W0"
                     /translation="MLSRLMCSPTNVASVTSATSRLVTRTSLVRRFSQNDDDVLARVK
                     VAPIKRVNEPIETKKARLIYQSRKRGILETDLLLSRFAAKYLKTMTPQQLDEYDSLLN
                     ELDWDIYYWATKNYKTTPLPDRWKHSEVLAMLQEFSKNKDKEILRMPELDKY"
     gene            complement(<88015..>88548)
                     /gene="TPHA0M00470"
                     /locus_tag="TPHA_0M00470"
                     /db_xref="GeneID:11531825"
     mRNA            complement(<88015..>88548)
                     /gene="TPHA0M00470"
                     /locus_tag="TPHA_0M00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688008.1"
                     /db_xref="GeneID:11531825"
     CDS             complement(88015..88548)
                     /gene="TPHA0M00470"
                     /locus_tag="TPHA_0M00470"
                     /inference="similar to DNA sequence:INSDC:YDL046W"
                     /note="similar to Saccharomyces cerevisiae NPC2 (YDL046W);
                     ancestral locus Anc_3.143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688056.1"
                     /db_xref="GeneID:11531825"
                     /db_xref="InterPro:IPR003172"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8C0W1"
                     /translation="MLKLWVWALLFQLSTVWSFQINAPFFAKGQPPVTDKEPIPGDSS
                     LQHCDLAISQVVDITQVNLSPNPPARGKDLTISASGTVASVVGEGSYVDVEVRLGYVK
                     LLTQKFDLCQMLSDNDIAGLGECPIQKGAYSLTKAVRIPDEVPPGKYTVLARAYNEHG
                     ELLTCITGDIVFPVDML"
     gene            complement(<88920..>89870)
                     /gene="TPHA0M00480"
                     /locus_tag="TPHA_0M00480"
                     /db_xref="GeneID:11531916"
     mRNA            complement(<88920..>89870)
                     /gene="TPHA0M00480"
                     /locus_tag="TPHA_0M00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688009.1"
                     /db_xref="GeneID:11531916"
     CDS             complement(88920..89870)
                     /gene="TPHA0M00480"
                     /locus_tag="TPHA_0M00480"
                     /inference="similar to DNA sequence:INSDC:YDL047W"
                     /note="similar to Saccharomyces cerevisiae SIT4 (YDL047W);
                     ancestral locus Anc_3.142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688057.1"
                     /db_xref="GeneID:11531916"
                     /db_xref="GOA:G8C0W2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8C0W2"
                     /translation="MGNRGPDEWLETVKKCQALTENEMKQLCEMVKELLMEESNIQPV
                     QSPVTVCGDIHGQFHDLLELFRTTGGFPDEINYVFLGDYVDRGYYSLETFTLLMCLKV
                     KYPSRITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKI
                     LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFG
                     SKVAREFNHVNGLSLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
                     DEDLDPVFKIFSAVPEDYIQAAAAGGPSGSTATQRGGYFL"
     gene            complement(<90239..>91672)
                     /gene="TPHA0M00490"
                     /locus_tag="TPHA_0M00490"
                     /db_xref="GeneID:11531917"
     mRNA            complement(<90239..>91672)
                     /gene="TPHA0M00490"
                     /locus_tag="TPHA_0M00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688010.1"
                     /db_xref="GeneID:11531917"
     CDS             complement(90239..91672)
                     /gene="TPHA0M00490"
                     /locus_tag="TPHA_0M00490"
                     /inference="similar to DNA sequence:INSDC:YOL072W"
                     /note="similar to Saccharomyces cerevisiae THP1 (YOL072W);
                     ancestral locus Anc_3.141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688058.1"
                     /db_xref="GeneID:11531917"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:G8C0W3"
                     /translation="MQYSLAIFFQELSDGSFECLSLDLESNGERISMLQEELCRRFKK
                     DKALEKLVETQAFAFHGKSEWTRFNIMVVSFLKYCRDVNPWSLLESYDLIFNFYTDLV
                     NCLLNDSYPIDKLVPITKEMTDYVVPVACKLDNNYELLNTRRFQFLSYVSSVVSKLFN
                     STKPLRNLDDHEGFVEKPHFQQLPGKQKILLYLVNKLNNIYFRIHSPQLCSNIFKNFK
                     PKCMIYRFGEYPVQERIEFHYLLGRYYLLNNNVLNAYRQLDRSFELLSHVASTLNLSL
                     ESMQPLRSNLQRILKYLVPAGLIIGKLPRFWVVGEVDQQLAHQYAAVARAVRAGNLKG
                     VNEWLQEHESALRRSHLLLTLLEKLPVLAYRYLVRAVVQGYTMELSSSRVPYAVVRRA
                     VELSTGPGPGAEARLTIYNAVHSAANVEAMLVDLINLNLFRGNCFPMLETCVVRKTTD
                     VSQVFPSVPEKVVAMFPLNGDDAWLDE"
     gene            <92065..>93234
                     /gene="TPHA0M00500"
                     /locus_tag="TPHA_0M00500"
                     /db_xref="GeneID:11531918"
     mRNA            <92065..>93234
                     /gene="TPHA0M00500"
                     /locus_tag="TPHA_0M00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688011.1"
                     /db_xref="GeneID:11531918"
     CDS             92065..93234
                     /gene="TPHA0M00500"
                     /locus_tag="TPHA_0M00500"
                     /inference="similar to DNA sequence:INSDC:YGR072W"
                     /note="similar to Saccharomyces cerevisiae UPF3 (YGR072W);
                     ancestral locus Anc_3.140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688059.1"
                     /db_xref="GeneID:11531918"
                     /db_xref="GOA:G8C0B0"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8C0B0"
                     /translation="MAETTAKMELPTGEAAGKNQGDWNAKGKHKKGRRPENNASNATQ
                     GKSRSQRSRHRRKAKDKEVSGFKLVLQSLPPALTETEFWDAVKSVVNDTNEYQINLNS
                     FYFVQGKLSDKPFHDPVYSRSYIMFKDMENLRKFALKIQDVTFTDANNDSSVASIKIS
                     PYNRSYNSALEKKKPAANKKVLEGTIKDDPLFKAFVQSMKIMAESDQYMYSEINLFKP
                     LKKELDKQKQVNEAILKQTEKALVELAGAVESEKKSKKKKKKKKKSEKKKEEETASKD
                     SSSVAKTKSKPKGKPKLKSKSKLESKSKTNAKSKKVKEHDSLKKEKNNNVVILEAAGK
                     KELQRRKRTLAKKENDLKNVQKNSFTKLPSLMPNTPNPTPSSNPKMKILKRPNTE"
     gene            complement(<93362..>94057)
                     /gene="TPHA0M00510"
                     /locus_tag="TPHA_0M00510"
                     /db_xref="GeneID:11531919"
     mRNA            complement(<93362..>94057)
                     /gene="TPHA0M00510"
                     /locus_tag="TPHA_0M00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688012.1"
                     /db_xref="GeneID:11531919"
     CDS             complement(93362..94057)
                     /gene="TPHA0M00510"
                     /locus_tag="TPHA_0M00510"
                     /inference="similar to DNA sequence:INSDC:YGR075C"
                     /note="similar to Saccharomyces cerevisiae PRP38
                     (YGR075C); ancestral locus Anc_3.138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688060.1"
                     /db_xref="GeneID:11531919"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:G8C0B1"
                     /translation="MSHEFAVEAYLSSKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLT
                     DNSLRGNTVLQLSKVIVRDLGTLLNGSSQQLNVIGGVEFKCILMKLVEMRPTWEQLLS
                     LLNIDNDFNSVGTVGEFDNKYITALVLTYIRIQYHFINSDHQLFNKCKKLFKLYMNDY
                     RKLKSIAFGTNCWSMSQAIDVGIGHIDELVEWLATKNDIWGLPLAMCSWCNLDEASES
                     ESESTADSDSESN"
     gene            complement(<94384..>94857)
                     /gene="TPHA0M00520"
                     /locus_tag="TPHA_0M00520"
                     /db_xref="GeneID:11531928"
     mRNA            complement(<94384..>94857)
                     /gene="TPHA0M00520"
                     /locus_tag="TPHA_0M00520"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_003688013.1"
                     /db_xref="GeneID:11531928"
     CDS             complement(94384..94857)
                     /gene="TPHA0M00520"
                     /locus_tag="TPHA_0M00520"
                     /inference="similar to DNA sequence:INSDC:YGR076C"
                     /note="similar to Saccharomyces cerevisiae MRPL25
                     (YGR076C); ancestral locus Anc_3.137"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_003688061.1"
                     /db_xref="GeneID:11531928"
                     /db_xref="UniProtKB/TrEMBL:G8C0B2"
                     /translation="MSVNSNVKLFELLPKQLKNFFKKYPPSVKYADRPVSTHSLEANP
                     FYANKHPVTGRYHDPKFSLRRMSVLYKTAYLYGVHTFLPPMKKKFFEDKYENKKFMRG
                     VLNPKGHKHELLREGKLAKMEEAIKNADNYIIEAKGSKYAKKLEKRRAEKQKSWF"
     gene            complement(<95225..>96955)
                     /gene="TPHA0M00530"
                     /locus_tag="TPHA_0M00530"
                     /db_xref="GeneID:11531929"
     mRNA            complement(<95225..>96955)
                     /gene="TPHA0M00530"
                     /locus_tag="TPHA_0M00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688014.1"
                     /db_xref="GeneID:11531929"
     CDS             complement(95225..96955)
                     /gene="TPHA0M00530"
                     /locus_tag="TPHA_0M00530"
                     /inference="similar to DNA sequence:INSDC:YGR077C"
                     /note="similar to Saccharomyces cerevisiae PEX8 (YGR077C);
                     ancestral locus Anc_3.136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688062.1"
                     /db_xref="GeneID:11531929"
                     /db_xref="UniProtKB/TrEMBL:G8C0B3"
                     /translation="MGDIAYLVSALKSSTSAGHLSDSDPEFRSKLINNIVYHVPRVQC
                     VQDLYCLANAILNSRIWGNGDAALKLYDMSRSFMHWKLQMSEPTISISTFYETWDTCI
                     KRCPSWNINKLGILSGILSTKNEFLQLNQNYFIDDRGIVSNYYKHWRKTYFIYGWNAS
                     LVRYYSDPEGEMKLILLYVPINVSNDNIPWPVVMRSLMNLMTMYTRQEKHVLFNENDF
                     LNRNINNVAKTLQLATLHCEDGLLAKILNTFCGNLYDLSVNEQNRNTNREVFKDVYYT
                     NILITAVMFFKSILDAKQDNIPNGWRHQIIICLFYTHFIAREFTTEGFRSYEFVYNVA
                     ITGLTDASCQEPQLYLDLVGMMTSSIWNVSGNTVQDAKLLFLLEFIEYTIPQYPNMTD
                     TLMLDVMKQLIYRNIHNRDTELKEATNTMAMAAISNGSPQVLQWKQSFIPKYLRLTSQ
                     EYLQEGLSIRQFLIINKRIAETIESMDIHGIIQSKVSSDTLNYLLTTSSDKSLSPEQR
                     CTMAQCLIIHAIHASKTEQLHWLTKCYSLVTVQTRGTLLPVLWETVLHLNSDAALHWW
                     YQTVVTSSKF"
     gene            <97251..>98114
                     /gene="TPHA0M00540"
                     /locus_tag="TPHA_0M00540"
                     /db_xref="GeneID:11531930"
     mRNA            <97251..>98114
                     /gene="TPHA0M00540"
                     /locus_tag="TPHA_0M00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688015.1"
                     /db_xref="GeneID:11531930"
     CDS             97251..98114
                     /gene="TPHA0M00540"
                     /locus_tag="TPHA_0M00540"
                     /inference="similar to DNA sequence:INSDC:YOL073C"
                     /note="similar to Saccharomyces cerevisiae YOL073C;
                     ancestral locus Anc_3.135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688063.1"
                     /db_xref="GeneID:11531930"
                     /db_xref="UniProtKB/TrEMBL:G8C0B4"
                     /translation="MSTEVPAGFNKYPATQLCFVATIVVPLLANALSYKYLFMVRNDP
                     FIIEYNQYWRFVTFQFGALNESDVVLLALIWYNFRQIERLMGSYKYLSVISLCWMYTT
                     LILSGSAVILNVVFPWSVWQNFPSGSLPLVLTLFHFYKQYTPQIYEFEFVFPLPWQLQ
                     PPTDSDITGSQYQSLSGKKTFKWKLTDQFYIEFLIVLLVLSQGFAGIVCGFISWIIGV
                     LLDGGLLPGMKVWRLPLFLFSSDNIQTHNVNDIRNQLQNSTEGTADANENLDDVPPRS
                     LGRQFIDTFRG"
     gene            complement(<98253..>98846)
                     /gene="TPHA0M00550"
                     /locus_tag="TPHA_0M00550"
                     /db_xref="GeneID:11531931"
     mRNA            complement(<98253..>98846)
                     /gene="TPHA0M00550"
                     /locus_tag="TPHA_0M00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688016.1"
                     /db_xref="GeneID:11531931"
     CDS             complement(98253..98846)
                     /gene="TPHA0M00550"
                     /locus_tag="TPHA_0M00550"
                     /inference="similar to DNA sequence:INSDC:YGR078C"
                     /note="similar to Saccharomyces cerevisiae PAC10
                     (YGR078C); ancestral locus Anc_3.134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688064.1"
                     /db_xref="GeneID:11531931"
                     /db_xref="GOA:G8C0B5"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="UniProtKB/TrEMBL:G8C0B5"
                     /translation="MDTIFNSTKTNPRGIPEAPFVEKVEDFIKDVSDFELVFNKFQER
                     LSKYKYMQESKLSTIKMLSTRIPDIESTLKICKTLKAKSESAEDDGGAEIETHYQLND
                     TLYAKAVINTKEATNVGLWLGAEVMLEYPVEEAIDLLEKKLKDSKESLEVSREDSDFL
                     RENITTMEVNCARLYNWDVQKRQEMKNISEDTNNLKI"
     gene            <99542..>100303
                     /gene="TPHA0M00560"
                     /locus_tag="TPHA_0M00560"
                     /db_xref="GeneID:11531868"
     mRNA            <99542..>100303
                     /gene="TPHA0M00560"
                     /locus_tag="TPHA_0M00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688017.1"
                     /db_xref="GeneID:11531868"
     CDS             99542..100303
                     /gene="TPHA0M00560"
                     /locus_tag="TPHA_0M00560"
                     /inference="similar to DNA sequence:INSDC:YBR035C"
                     /note="similar to Saccharomyces cerevisiae PDX3 (YBR035C);
                     ancestral locus Anc_3.236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688065.1"
                     /db_xref="GeneID:11531868"
                     /db_xref="GOA:G8C0B6"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:G8C0B6"
                     /translation="MVACLLDNHTDIHLVSQVYELLKKMSSNPETKNPIIFAPKTYQY
                     NKFSLDESELLKNPIELFTNWFSDAKKDPTESIPECVTFSTANLPSGKVSSRVLLFKE
                     LDDRGFTIYSNWGTSGKAEDIKTNPNAAINFFWKNLQRQVRVDGFTEHVNRETSERYF
                     KTRPRGSKIGAWSSPQSHVLKDREELEEYIKASEKRFEGVADADIPCPDYWGGLRIVP
                     LEIEFWQGRESRLHDRFLYKRNSENEPWEVVRLAP"
     gene            complement(<100472..>101560)
                     /gene="TPHA0M00570"
                     /locus_tag="TPHA_0M00570"
                     /db_xref="GeneID:11531869"
     mRNA            complement(<100472..>101560)
                     /gene="TPHA0M00570"
                     /locus_tag="TPHA_0M00570"
                     /product="60S ribosomal protein L4"
                     /transcript_id="XM_003688018.1"
                     /db_xref="GeneID:11531869"
     CDS             complement(100472..101560)
                     /gene="TPHA0M00570"
                     /locus_tag="TPHA_0M00570"
                     /inference="similar to DNA sequence:INSDC:YBR031W,YDR012W"
                     /note="similar to Saccharomyces cerevisiae RPL4A (YBR031W)
                     and RPL4B (YDR012W); ancestral locus Anc_3.232"
                     /codon_start=1
                     /product="60S ribosomal protein L4"
                     /protein_id="XP_003688066.1"
                     /db_xref="GeneID:11531869"
                     /db_xref="GOA:G8C0B7"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="UniProtKB/TrEMBL:G8C0B7"
                     /translation="MSRPQVTVQSLTGEATSSALPMPAVFSAPIRPDLVQTVFTSVNK
                     NKRQSYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFAP
                     TKTWRKWNVKVNHNEKRYATASAIAASAVASLVLARGHRVEKIPEIPLVVSKDLESVK
                     KTKDAIAALKAVGAHADLIKVLKSKKIRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKA
                     FRNVPGVETANVTALNLLQLAPGAHLGRFVIWTEGAFAKLDQVWGSETVASSKAGYTL
                     PKNIISTTDITRVINSSEIQAAVRPAGQATQKRSHVQKKNPLKNKQILLRLNPYAKVF
                     AAEKIGSKKAAKSASKPAAVFKETLKHD"
     gene            complement(<102003..>103685)
                     /gene="TPHA0M00580"
                     /locus_tag="TPHA_0M00580"
                     /db_xref="GeneID:11531870"
     mRNA            complement(<102003..>103685)
                     /gene="TPHA0M00580"
                     /locus_tag="TPHA_0M00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688019.1"
                     /db_xref="GeneID:11531870"
     CDS             complement(102003..103685)
                     /gene="TPHA0M00580"
                     /locus_tag="TPHA_0M00580"
                     /inference="similar to DNA sequence:INSDC:YBR030W"
                     /note="similar to Saccharomyces cerevisiae YBR030W;
                     ancestral locus Anc_3.231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688067.1"
                     /db_xref="GeneID:11531870"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:G8C0B8"
                     /translation="MAATLIDDVNDIIGLVKDNETNSVFRTDMCEVKKSEFGGLGVYA
                     KEDIEEGTSLLKVHKSILFSANNCSIGNLLHEEGIGGMLGLNIAFIYEITVFKEKSFW
                     YNYLKSIRFLDEDGVLLLPPSHWEESDKKLLRGSSVDLLYGALDPEVEIQEGFEIAID
                     LSIKWNQELNLNIPEGFLDVNITDIDDIREKLKKFVSVAFALSSRVFEVDAYHENALV
                     PIADLFNHNSEKTDVRFVSVFDVCAECGEFGPCKHDEIDEVAEEGADNDEEVQEVEGS
                     GNFNALVKQLEEEVEDRCTEREDSTMSDETYVEIVLAKAVKEGDEIFNSYGDLNNSLL
                     LSRYGFAYLDNKNDMVDLSLQLHDVVNSDKKYQIRLKWWSDVGYTLYESWYKLNREEA
                     EKSEGEEEDDDGEDEDDEDDEEHEEDTHEHEHEHVHGEGCSRDHGSNVLNELYVDFDC
                     TPSRNLNALINILSLDDNKYDKLTSSLEQDTETPPQFVTTIFDTFDQFNTSNKAISNT
                     NQNIKLLKQLLQLKKPHPLPTNKTAISEHQLQQVKTLLQNENTLIRNMSTKL"
     gene            <104477..>105646
                     /gene="TPHA0M00590"
                     /locus_tag="TPHA_0M00590"
                     /db_xref="GeneID:11531871"
     mRNA            <104477..>105646
                     /gene="TPHA0M00590"
                     /locus_tag="TPHA_0M00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688020.1"
                     /db_xref="GeneID:11531871"
     CDS             104477..105646
                     /gene="TPHA0M00590"
                     /locus_tag="TPHA_0M00590"
                     /inference="similar to DNA sequence:INSDC:YBR026C"
                     /note="similar to Saccharomyces cerevisiae ETR1 (YBR026C);
                     ancestral locus Anc_3.228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688068.1"
                     /db_xref="GeneID:11531871"
                     /db_xref="GOA:G8C0B9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C0B9"
                     /translation="MLQKYLFCSQRLVSTKRAMSTIPKTFKSIIYSRHDVEDCTGVLK
                     LHNYEPKQSIEDNIVLRTLAFPVNPSDINQLQGVYPSIPDKTLEYGTEEPSAIAGNEG
                     VFEVVHVPQDGNAQEFAVGDLVIPLRSNQGTWTNYKIIEDPKEIIKVNGLDLLTGATV
                     SVNGCTAMQLVNDYVDWSSSPSENQWIVQNAGTSGVSKLVTQIAKAKGIKTLSVIRDR
                     DDFEEVAEDLTNKYGATRVISETENNDKAFNKTELPKLLGNDYAIRLALNSVGGKSST
                     AIARKLAKDSLMLTYGGMSKQPVTLPTSLFIFKNLDSKGFWITENYKKDPFKKQKDVA
                     AFIKLYNDNKIVKPDETKDFQITNWDTQNDDDITLLNKIKNAIKAKGKKQMIVVN"
     gene            <106066..>107247
                     /gene="TPHA0M00600"
                     /locus_tag="TPHA_0M00600"
                     /db_xref="GeneID:11531840"
     mRNA            <106066..>107247
                     /gene="TPHA0M00600"
                     /locus_tag="TPHA_0M00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688021.1"
                     /db_xref="GeneID:11531840"
     CDS             106066..107247
                     /gene="TPHA0M00600"
                     /locus_tag="TPHA_0M00600"
                     /inference="similar to DNA sequence:INSDC:YBR025C"
                     /note="similar to Saccharomyces cerevisiae OLA1 (YBR025C);
                     ancestral locus Anc_3.226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688069.1"
                     /db_xref="GeneID:11531840"
                     /db_xref="GOA:G8C0C0"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0C0"
                     /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCP
                     LGNPANYPFATIDPEEARVIVPSPRFDELCKIYKPASEVPAHLTVYDIAGLTKGASAG
                     EGLGNAFLSHIRSVDSIYQVVRCFDDAEIIHIEGDVNPTRDLEIISNELRLKDIEFCE
                     KALEAAEKIAKRGGQSLEVKQKKEEMALIERIIQLLKDGQRVANQSWTPKEVEIINSM
                     FLLTAKPCIYLINLSERDYIRKKNKHLLLIKEWIDKNSPGDLVIPFSVCLEERLSHMS
                     DEEAAEELKTIGAVSALPKIVTTMRKKLELISFFTCGPDEVREWTIRKGTKAPQAAGV
                     IHNDLMNTFILAQVMKYEDVVEYKDDAAIKSAGKLQQKGKDYVVEDGDVIYFRAGAGK
                     N"
     gene            <107857..>110727
                     /gene="TPHA0M00610"
                     /locus_tag="TPHA_0M00610"
                     /db_xref="GeneID:11531841"
     mRNA            <107857..>110727
                     /gene="TPHA0M00610"
                     /locus_tag="TPHA_0M00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688022.1"
                     /db_xref="GeneID:11531841"
     CDS             107857..110727
                     /gene="TPHA0M00610"
                     /locus_tag="TPHA_0M00610"
                     /inference="similar to DNA sequence:INSDC:YBR038W"
                     /note="similar to Saccharomyces cerevisiae CHS2 (YBR038W);
                     ancestral locus Anc_3.224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688070.1"
                     /db_xref="GeneID:11531841"
                     /db_xref="GOA:G8C0C1"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C0C1"
                     /translation="MTRNPFMVDPNNGSPIRSPNKPNLTRFSTHSSEETSNWQANSGE
                     DPFADGSEYNQTNQFQGLPPSPSRAAMRYSPDRRHRTQFYRDSANNTPVASRFQANMQ
                     QSPSRPGDTIIQFNEPAHHSYDIADMTSSYYPDSTNPREQNNNLFGNSNRNYSQYSGS
                     MASTAASSFETDEKFRKSFESESYTVYSGDTFEETRYEVNHPIRKDYVRRANSESRSR
                     PVIAAPSSKAILRLDNPIPRGLLDTLPKRNSPEYTEMRYTACTVEADDFVNEGYSLRS
                     SEMNRECQVAICITMYNEDKYALARTLHSVMRNIAHLCKREKSTVWGPNGWKKVTVIL
                     VTDGRSKVNAGSLDYLAAIGVYQEDMAKASVNGDPVKAHIFELTTQVSLNEDLDYVSE
                     DIVPVQFVFCLKEENKKKINSHRWLFNAFSPVLQPNVVMLVDVGTKLNDTAVYHLWKA
                     FDMDSNVAGAAGQITTMKGKYGKKLLNPLVASQNFEYKISNILDKPLESMFGYISVLP
                     GALSAYRYRALQNHEDGTGPLRSYFLGETQEGRDHDVFTANMYLAEDRILCWELVAKR
                     NASWVLKYVKEAEGETDVPEEIPEFISQRRRWLNGATFAAMYAQLHFYQIWKTNHSFT
                     RKVMLHIEFFYQFVQMLFSWFSISNFVLTFYYLAGSLNDVIKHGDVLFIFFKYLIFCD
                     LASLFIISMGNRPQGGKWLFMTSLIILTICAIYSLICGFTFAFMTLNENTETYGTFLS
                     IVVSLLSTYGLYTFASIMYLDPWHMITSSIQYFFTLPAFTCTLQIFAFCNTHDVSWGT
                     KGSGVESKPLSKAIVVKGPDGKQIVETDWPQEVDKKFLEIKSRLKEIEVEETTVDESL
                     QRNDYYRDIRTRIVMVWMLSNLILIMAIIEVYSPTETNNKYLKFILWSVAALALFRVT
                     GSMAFLFMKYLRAIVSFANKRESIGGSINMKMPSIKVFNTSN"
     gene            <111191..>114331
                     /gene="TPHA0M00620"
                     /locus_tag="TPHA_0M00620"
                     /db_xref="GeneID:11531842"
     mRNA            <111191..>114331
                     /gene="TPHA0M00620"
                     /locus_tag="TPHA_0M00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688023.1"
                     /db_xref="GeneID:11531842"
     CDS             111191..114331
                     /gene="TPHA0M00620"
                     /locus_tag="TPHA_0M00620"
                     /inference="similar to DNA sequence:INSDC:YBR023C"
                     /note="similar to Saccharomyces cerevisiae CHS3 (YBR023C);
                     ancestral locus Anc_3.223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688071.1"
                     /db_xref="GeneID:11531842"
                     /db_xref="GOA:G8C0C2"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C0C2"
                     /translation="MNVGNSDATNNAESETLDNNSAYDSNSAENGVSEHRLRWYQKFG
                     RFANTGDARARFNYWLFYCYLLTFWIPAALLAKCGMREHGRRVAWREKIGLLSIILFL
                     GLFVSFLTFGFNRTICSPVENTRDHKDNFSDTLLMHGKAFNLQLFNHIVVPGISQTTN
                     FMGEPYNYGGYDASFLFQNVNGNCKGLITPKDNCTIPHNDIGDLAWYYPCKILNDVGE
                     LIEYSNEMELESHFDGWNCHTSNISREEFYKMNSSVTVTYKWEDLKKQSNKLVVVNGQ
                     VLDLSRLDYLDRYNLNYPIHFDEIKTLKLEGYDLSLLYTSEGQKRMLRCLTEITKVGI
                     IDSKTVGCLIADVVLYLSLVIILSIVISKFFFACYFKWVIAKGQGVSKVDNKTFLKEL
                     RDIEKWSNNTLEQDQENLNNNIQRSSNNNDDQGNNDFEIETPIKFNEKVEKHFPYLSR
                     IKHVNNKPSTDDNIDISVKGYTTISLQDHFHKVSSSSQCLLKTNSFLNGLNSSISLVP
                     SDKGSTSQLQFEKSLIHKKALVQPDIYFTPFNFPLVYTVCFVTCYSEEAEGIKATLDS
                     LTATDYPGSHKLLMVVCDGLVKGSNNDKTTPEICISMMEDFVIDPTDVEASSYIAVAT
                     GRRRHNMAKIYCGYYRYKGNDIKNKDKRLPMVTIVKCGLPEESQDVKPGNRGKRDSQV
                     LMMSFFQKLLFNERMTELEYHLLKGIWQITGTNATFYELILMVDADTKVYPNSISHMV
                     AEMIKDPLIMGLCGETKIVNKAQSWVTMIQVFEYYISHHQTKAFESVFGSVTCLPGCF
                     SMYRLKAPKGTEGFWVPILINPDIVEKYSDNVTNTLHKKNLLLLGEDRYLSSLLLKTH
                     SGRKMVFVPKAACKTMVPDTFKVLLSQRRRWVNSTIHNLFELVLVRDLCGTFCFSMQF
                     FILIELIGTLVLPLAICFTMYIIFFSITSSPTPVITLVLLALILGLPGILVVVTATRI
                     SYIMWLGVYILALPIWNFVIPVYAYWKFDDFSWGDTRAVDGETKDNHGDDEGIFDYSN
                     IKLMKLEDHIKLDSNI"
     gene            complement(<114589..>116499)
                     /gene="TPHA0M00630"
                     /locus_tag="TPHA_0M00630"
                     /db_xref="GeneID:11531843"
     mRNA            complement(<114589..>116499)
                     /gene="TPHA0M00630"
                     /locus_tag="TPHA_0M00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688024.1"
                     /db_xref="GeneID:11531843"
     CDS             complement(114589..116499)
                     /gene="TPHA0M00630"
                     /locus_tag="TPHA_0M00630"
                     /inference="similar to DNA sequence:INSDC:YBR021W"
                     /note="similar to Saccharomyces cerevisiae FUR4 (YBR021W);
                     ancestral locus Anc_3.221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688072.1"
                     /db_xref="GeneID:11531843"
                     /db_xref="GOA:G8C0C3"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:G8C0C3"
                     /translation="MNNISSGHSFHQSSSTDNKFEYESSSKMKQRNELDSSTADTIGT
                     FTKTLDDINSFEEESDTEYAYTTILEQSSKWERFYYEYIVADKSTIGIPFLHSFMYNH
                     DLRPVEKARRVWSWYNYLWFWLAECFNINTWEVADTGLQLGLNWWQCWITVWLGYSFV
                     AIFVSLSSRIGAAYHLSFPVSARASFGVYFSLWPIINRVVLAIIWYSVQAWICVTPIS
                     LMLQSIFGTDLPTRIPDNINQKNTTTYEFMCFFIFWVVSFPFLLVPPHKIRHLFTVKA
                     CLVPFACFGFLIWAVRKADGKIALDHLTDYKPTGSDFSWAFIRSMMTCMNNFSTLTVN
                     APDFSRFSKTKISSLYSQMFAIPFLFSITSLIGILVTAAGYELYGENYWSPVDVLQKF
                     LDDSFSKGTRAGVFLISFVFVIAQLGTNISANSLSCGTDMSALVPKFINIRRGSMFCA
                     FMALCICPWNLLASSSKFTAALSAYAIFLSSIAGVLAADYFVVRRGYIKLSHLYSNQP
                     GSYYMFGNRYGFNWRACVAYFCGVAPNLPGFIGDVGAPQITVSEGATKLYYLSYWIGW
                     FVSFLVYITLCYFFPVEGSPVENILKDKGWFQRWADVEDFEKAWIRNSRKVDLYDDVS
                     TIYDHEEEEKFF"
     gene            complement(<117604..>122076)
                     /gene="TPHA0M00640"
                     /locus_tag="TPHA_0M00640"
                     /db_xref="GeneID:11531848"
     mRNA            complement(<117604..>122076)
                     /gene="TPHA0M00640"
                     /locus_tag="TPHA_0M00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688025.1"
                     /db_xref="GeneID:11531848"
     CDS             complement(117604..122076)
                     /gene="TPHA0M00640"
                     /locus_tag="TPHA_0M00640"
                     /inference="similar to DNA sequence:INSDC:YDR011W"
                     /note="similar to Saccharomyces cerevisiae SNQ2 (YDR011W);
                     ancestral locus Anc_3.220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688073.1"
                     /db_xref="GeneID:11531848"
                     /db_xref="GOA:G8C0C4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:G8C0C4"
                     /translation="MSSFVSSVHSNSASVADAEESFKGNNSDDVLAARTSGSFIRRTL
                     SHRSSVVMSDDAMSQVQDLARTLSHRTTRDGPIEDVLHEIESMANDAEEFDARKIFSD
                     MVRGANEQGIHIRKAGVIMEKVSAEGVDASTVEGTTFGDILCLPLTIYKGIRAAKQRK
                     MRSILNNVNLLAEPGEMVLVLGRPGAGCSSFLKTAAGEIDQFAGGVVGDISYDGIPQE
                     EMMKKFKSDVIYNGELDVHFPYLTVKQTLDFAIACKIPAKRVDNVPKEDYIAAVRDLY
                     ATIFGLRHTYQTFVGNDFVRGVSGGERKRVSIAEALAARGTVYCWDNATRGLDASTAL
                     EYAQAIRIMTNLLGSTALVTIYQASENIYQTFDKVTVLYLGRQIYFGKIEDAKVYFKK
                     MGYECPPRQATAEFLTALTDPNGFHIITPGYENKVPRTPEEFETYWENSDEFRQLQKD
                     IADYKSKIDIEKTKALYHESMDQEKSKYASKKSYFTISYPQQVQLCVKRGFQRIYGDK
                     TSTVINTVAAIVQAFVTGSLFYKTPSATNGAFSRGGVLYFALLYYSLIGLANINLDSR
                     PILQKHKAYSLYHLSAEAFASTIAPMPFRLIGLTCFIIILYFLAGLHTSAGAFFTVYL
                     FLFLCSETINGLFEMITSVCDNLAQANSIAGILMMAISMYSTYMIQLPAMHPWFKWIS
                     YVLPIRYAFESMLNAEFHGRRLDCGGTLVPSGAGYENIASENQVCAFTGSVEGQSYVL
                     GDDYLKAYFQYEYKHTWRNFGILWCFIIGYFSIKAFLTEFKRPTVGGGDALVFKKGYK
                     HPNSNTANDEETHDKLNLSESKEKYMTGSSSSEDDGTFEGLESTGTFVWNKVCFTIPY
                     DGGMRMLLDNVSGFCRPGTMTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPID
                     ASFERRTGYVQQQDVHIAELTVRESLQFSARMRQPQHLPDSEKMDYVERIIRVLDMDE
                     YAEALVGGIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWSIIQLLKK
                     LAASGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGENSKDLLTYFEDHGAR
                     KCERKENPAEYILEAIGAGATASVKDDWHEIWKNSSTYKNSEIEINNMIKGLSANANS
                     DGEGKAAQKYATSYFYQFRYVYFRTATILWRDLNYIMSKLMLHIVGGLFIGFTFYNVG
                     TTYAGLQHALFAAFMAIVISAPSMNQIQARAIASRELFEVRESKSNMFHWSLVLITQY
                     MSEIPYHLVFSTIFFVSLYFPLRIFFEASRSAVFYLNYCILFQLFYVGLGLMVLYMSP
                     NLPSAAILMGLTLSFLISFCGVTQPERLMPGFWTFMWKASPYTYFVQNLVGIMLHEKP
                     VICSKKELSYFNPPSGQTCGQYLERFLETNTGYVSNPNDTANCGYCIYSVGDEYLTYI
                     GSSYSYLWRNFGFYWAYIGFNICAMVGVYYIVHVRGVSFISPEKISKFLKRFKK"
     gene            complement(<122971..>124623)
                     /gene="TPHA0M00650"
                     /locus_tag="TPHA_0M00650"
                     /db_xref="GeneID:11531849"
     mRNA            complement(<122971..>124623)
                     /gene="TPHA0M00650"
                     /locus_tag="TPHA_0M00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688026.1"
                     /db_xref="GeneID:11531849"
     CDS             complement(122971..124623)
                     /gene="TPHA0M00650"
                     /locus_tag="TPHA_0M00650"
                     /inference="similar to DNA sequence:INSDC:YBR020W,YDR009W"
                     /note="similar to Saccharomyces cerevisiae GAL1 (YBR020W)
                     and GAL3 (YDR009W); ancestral locus Anc_3.219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688074.1"
                     /db_xref="GeneID:11531849"
                     /db_xref="GOA:G8C0C5"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:G8C0C5"
                     /translation="MQSLPVFRIDNDNKNVSDITKKCIDITLKFQDKFKYYPNFIVSS
                     PGRVNIIGEHIDYEEFPVLPMAINKNILCAVRILENSHSISIYNDNYEKFAEKKFDLP
                     LNGELISIDPSISDWSNYFKCGLLVAHKFLKKKYPDRFNNAMLKGLYIYIKGDIPTES
                     GISSSAAMCVTVAALIIRSNLGPEYSISKKELIAITEGAEHYIGVSTGSMDPAVIICN
                     ESNKLSFINFKPQLSTSNVELPVFNSENNIRFLIANTLVSSNKYETGPINYNLRVVED
                     TIAANILAAKYGFQLNRRMTESFTYDEDDYDMTFNSTRKQQTFSKGNLRDFMDAYFAR
                     HLNDESELFINPNDHNSIKRTEQMLNTMINLLDNCFPNDNNQHSTGYSIPELAGLLNC
                     SRDEFTREYLLVNPVRFQTLKVYQRSKHVFTEALRVIKCIELINFHGDLSMDRFLKEL
                     GRLMHESQRSCDELYECSCPEIDEVCEIAIANGSYGSRLTGAGWGGCTVHLVSSDEQI
                     ENIKRSLRENYYLKHNPSITEEELKNAMIVSTPSMGSCIFEL"
     gene            <125829..>127901
                     /gene="TPHA0M00660"
                     /locus_tag="TPHA_0M00660"
                     /db_xref="GeneID:11531850"
     mRNA            <125829..>127901
                     /gene="TPHA0M00660"
                     /locus_tag="TPHA_0M00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688027.1"
                     /db_xref="GeneID:11531850"
     CDS             125829..127901
                     /gene="TPHA0M00660"
                     /locus_tag="TPHA_0M00660"
                     /inference="similar to DNA sequence:INSDC:YBR019C"
                     /note="similar to Saccharomyces cerevisiae GAL10
                     (YBR019C); ancestral locus Anc_3.218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688075.1"
                     /db_xref="GeneID:11531850"
                     /db_xref="GOA:G8C0C6"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="InterPro:IPR025308"
                     /db_xref="UniProtKB/TrEMBL:G8C0C6"
                     /translation="MSERKVVLVTGGAGYIGSHTVAELIENGYDCIVVDNLDNSSYES
                     VARLKILVKRDIKFYHTDLCDRENLETIFKDNKIDSVIHFAGLKAVGESTKIPLKYHH
                     NNILGTLNLLELMEVYGVKSLVFSSSATVYGDATRFPDMIPIPEECPLGPTNPYGNTK
                     YAVEKILNDLYNSNNNFWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVG
                     RRDKLNVFGNDYETRDGTPIRDYIHVVDLAKGHIAALKYLEKKNEEGICREWNLGSGT
                     GSTVLEVLKAFCAACGDDIPYEIVGRRAGDVINLTAKPDRATRELEWKTELDVADACK
                     DLWKWTTENPFGYQLKGIVDAFAAEEDNYDSRFITLGDGTKFQATIANIGATLVDLKV
                     DGQSVVLGYDNEEGYLAEDSAYIGATIGRYANRIKNGTFSLNGETYQLALNNGPNANH
                     SSVDTFHTKKFLGPLVKNPSKDVYTAEFLLVDPSENSEFPGDLSVIVMYTLRVAEKSL
                     SIEYKAQVSGGKSTPINMTNHTYFNLNKVNKETFVGTEIQVINNKSVDIDENMIPTGK
                     IIDREIAKLNEKATILGQSEPKYDYAFVVDENEKYDQIDSSSRELKTVVKAYHPESNI
                     RLEVLTTEPSFQIYTGDFLSAGYHARQGFAVEPGRYVDAINQEPWKKSVTLSEGETYG
                     SKIVYRFS"
     gene            complement(<128546..>129421)
                     /gene="TPHA0M00670"
                     /locus_tag="TPHA_0M00670"
                     /db_xref="GeneID:11531851"
     mRNA            complement(<128546..>129421)
                     /gene="TPHA0M00670"
                     /locus_tag="TPHA_0M00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688028.1"
                     /db_xref="GeneID:11531851"
     CDS             complement(128546..129421)
                     /gene="TPHA0M00670"
                     /locus_tag="TPHA_0M00670"
                     /inference="similar to DNA sequence:INSDC:YOL088C"
                     /note="similar to Saccharomyces cerevisiae MPD2 (YOL088C);
                     ancestral locus Anc_3.111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688076.1"
                     /db_xref="GeneID:11531851"
                     /db_xref="GOA:G8C0C7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:G8C0C7"
                     /translation="MKLIYFTSFIVSLISLASLAVANTKNHETVLSLDQFYDACNSNS
                     SYTVVKYFTTWCSHCKKLAPVFDELSEIYLNDETSPNIKFLDVDCDMFGSTICAKLPG
                     FPVVQVIKPASSVIQSNKSPNEYENRSIFKRILDFVTSRFENPKWTLDEKRVVEFRGR
                     RDLETMNKFVNQVILKHNQDTLILNLLKDSEFKCEGERVILCKEGKKYLNEKLVNLNN
                     LEELLKERKKLENVYRNNIESIEKKNEEEAKDIISVLEKISFKLSMIDLYEDTVIRED
                     TKDDGDFADIVHDEF"
     gene            <129702..>130646
                     /gene="TPHA0M00680"
                     /locus_tag="TPHA_0M00680"
                     /db_xref="GeneID:11532029"
     mRNA            <129702..>130646
                     /gene="TPHA0M00680"
                     /locus_tag="TPHA_0M00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688029.1"
                     /db_xref="GeneID:11532029"
     CDS             129702..130646
                     /gene="TPHA0M00680"
                     /locus_tag="TPHA_0M00680"
                     /inference="similar to DNA sequence:INSDC:YBR152W"
                     /note="similar to Saccharomyces cerevisiae SPP381
                     (YBR152W); ancestral locus Anc_3.112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688077.1"
                     /db_xref="GeneID:11532029"
                     /db_xref="UniProtKB/TrEMBL:G8C0C8"
                     /translation="MHIYDTIGHCERRIRYCLNMAIRHIKRRYSESSAESSSDNSSDE
                     SNKKPDQSSNIDVKKNEEQELSGLNTKAIREDINYEQNNINGDSNDNINNPNISDNSN
                     GSENYSSSSSSSESDTSSESDSELRLFRPTFIKKRSITTDDSKLRNKEVKSDSTYAKL
                     IKRVEHNVLVSKKNEDSVKLMNSNYSTDKDLLRKIVELDDDDSKNADLEREMWMKRQE
                     TRKQKSRELLVQKQKELEENELQKMLNADKNIEDTTLETEVPNSELDRKAPKRSGRTK
                     ENMYMAKRASNIHFGEMEKLQEKSMNTNEQDSEYSLPI"
     gene            complement(<130921..>131568)
                     /gene="TPHA0M00690"
                     /locus_tag="TPHA_0M00690"
                     /db_xref="GeneID:11532030"
     mRNA            complement(<130921..>131568)
                     /gene="TPHA0M00690"
                     /locus_tag="TPHA_0M00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688030.1"
                     /db_xref="GeneID:11532030"
     CDS             complement(130921..131568)
                     /gene="TPHA0M00690"
                     /locus_tag="TPHA_0M00690"
                     /inference="similar to DNA sequence:INSDC:YBR154C"
                     /note="similar to Saccharomyces cerevisiae RPB5 (YBR154C);
                     ancestral locus Anc_3.114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688078.1"
                     /db_xref="GeneID:11532030"
                     /db_xref="GOA:G8C0C9"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020608"
                     /db_xref="InterPro:IPR020609"
                     /db_xref="UniProtKB/TrEMBL:G8C0C9"
                     /translation="MDKDSERSVSSLWRTFRTVKEMVRDRGYFISQDEIELPLEDFRA
                     KYCDYMGKPQRKMMSFQANPTEESLEKFPETGSLWVEFCDEPSVGVKTMKNFVIHIQE
                     KNYQTGIFVYQTNVTPSAMKLVPSIPPATIETFHEASLVVNITHHELVPKHIRLSEEE
                     KKDLLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM"
     gene            complement(<132140..>135313)
                     /gene="TPHA0M00700"
                     /locus_tag="TPHA_0M00700"
                     /db_xref="GeneID:11532031"
     mRNA            complement(<132140..>135313)
                     /gene="TPHA0M00700"
                     /locus_tag="TPHA_0M00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688031.1"
                     /db_xref="GeneID:11532031"
     CDS             complement(132140..135313)
                     /gene="TPHA0M00700"
                     /locus_tag="TPHA_0M00700"
                     /inference="similar to DNA sequence:INSDC:YOL087C"
                     /note="similar to Saccharomyces cerevisiae YOL087C;
                     ancestral locus Anc_3.115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688079.1"
                     /db_xref="GeneID:11532031"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021772"
                     /db_xref="UniProtKB/TrEMBL:G8C0D0"
                     /translation="MADQFTVSYGLPLPQLRNQQHETHILPVTKILQCRNQDKYNTDS
                     ERCESFLTCGRDGSIIKYLYSSDFQLIETKKMQAHSDWVTDLIDVGNSIFISVSHDFS
                     IVLHSINGKLDTWETKIIGCHDDYIKCIVSLPKIFSDYDEDKITFATAGLDKKIKVWS
                     LNKRLLTYKLLHVFDNSQDNGTGSVYVISAVDNPSVPYDLIAGDNNGNIILYSCKEGV
                     EVARIEKAHDQNIKCLKCVDNYKNLISTSSDGTITAWAIAISKTFDDKNNEIIIPLTK
                     IRNLNWNGAPVWCIYGESLKELYVGDAKANIFKVNFEISQPSAVVIFNGTRYPSKADT
                     TESRNNFGILDLMRVHDTNNLFFSVSKDSNLMHLDVELDDLTLIQGGVALTRSSLLTN
                     RRHVITENTRGEIQTWDIISCRLLNTFDVTDGDFNDIVYKYTTKEILPHWCTVSIKVG
                     LLFVKLNARLLSTEVYGAALENYEIINDVIINPDQRFNLGKIVINSLFNEFLSYEIEK
                     DKLLRKRIASKKKDSFFNYQKDEHNNSSLSIENGEPGTSDKKNKDKKKKSHIMKFKLG
                     SPSTQPAFSTTPSTPSSMIGNYSDNDRNINISNNLQNGIKITLESPRPQNRTKQPSIE
                     KLVNGYPNSKTESGTISMSTGSYLNRKLKKLGSRPSSAVQGGEHYENVRTPDSSFDES
                     SVDYGDDNNGTLRPVTATPFASITQSPQQRASSTPALEFSSRNSPLPSASVGGNVSPD
                     NVNQSTGKTLSHSKRNFMCDLLSEFEEAYIQQFQLNSSSLKLLSKKQPESKISKATEL
                     PLLRIKFGTLLVIHKWEKDACGGIVVFSTFLPGTNQSLDNNEFNDTTVIMEGEEFDSQ
                     IYEDEKLEKFDFIDYEYGHGINRRMLFEQLERNVPYWFAKILFDDNNHHESQSQPKLN
                     FTIALWTDDGPNSNANNTNDINKQSDNIDKPPSSKSAYQRLKFSRNKSTDSLPTATSL
                     PRISEYNSKLSALGMVRIKKIKQFITERFDCKTPEMKAKVDPSDWLEILCKGQVLEND
                     MTLSSVKTLYWKSQNGMVLEYRRKIKD"
     gene            <135858..>136163
                     /gene="TPHA0M00710"
                     /locus_tag="TPHA_0M00710"
                     /db_xref="GeneID:11532032"
     mRNA            <135858..>136163
                     /gene="TPHA0M00710"
                     /locus_tag="TPHA_0M00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688032.1"
                     /db_xref="GeneID:11532032"
     CDS             135858..136163
                     /gene="TPHA0M00710"
                     /locus_tag="TPHA_0M00710"
                     /inference="similar to DNA sequence:INSDC:YOL086W-A"
                     /note="similar to Saccharomyces cerevisiae YOL086W-A;
                     ancestral locus Anc_3.116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688080.1"
                     /db_xref="GeneID:11532032"
                     /db_xref="GOA:G8C0D1"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR029003"
                     /db_xref="UniProtKB/TrEMBL:G8C0D1"
                     /translation="MENGASTDKDKERLISQLKGKLWYCIEKQVKEETPFDTTISPKY
                     INALVELCYIQLVEVGKDLELFAKHANREVITVDDLMLLLRKLPNLQESLILNKDNR"
     gene            complement(<136387..>137268)
                     /gene="TPHA0M00720"
                     /locus_tag="TPHA_0M00720"
                     /db_xref="GeneID:11531892"
     mRNA            complement(<136387..>137268)
                     /gene="TPHA0M00720"
                     /locus_tag="TPHA_0M00720"
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /transcript_id="XM_003688033.1"
                     /db_xref="GeneID:11531892"
     CDS             complement(136387..137268)
                     /gene="TPHA0M00720"
                     /locus_tag="TPHA_0M00720"
                     /inference="similar to DNA sequence:INSDC:YBR146W"
                     /note="similar to Saccharomyces cerevisiae MRPS9
                     (YBR146W); ancestral locus Anc_3.117"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /protein_id="XP_003688081.1"
                     /db_xref="GeneID:11531892"
                     /db_xref="GOA:G8C0D2"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:G8C0D2"
                     /translation="MLHSNFKPNRIPLASTLLRMGNLFASIPIRSFSGTKFALENVRY
                     QTVKQSRIVPKLATFYSANPHHENCMNRLEHLLNKYIKYPTQSSLVNGMDKPAWLSFE
                     DYSLIGGGTRLRPIQYRQLISILNRLHHIDQQLSNDEIRTELGHYFKKSGMLVNERKV
                     HVLDEFGRAVAVGKRKSSVAKVYLVRGDGQILVNNRQLNDYFVEIKDRSSILFPLATT
                     SLSGSYNVFATTSGGGPTGQAEAISHAIAKALLIFNPLLKPRLRKAGLITRDYRHVER
                     KKPGKKKARKMPTWVKR"
     gene            complement(<137798..>138850)
                     /gene="TPHA0M00730"
                     /locus_tag="TPHA_0M00730"
                     /db_xref="GeneID:11531893"
     mRNA            complement(<137798..>138850)
                     /gene="TPHA0M00730"
                     /locus_tag="TPHA_0M00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688034.1"
                     /db_xref="GeneID:11531893"
     CDS             complement(137798..138850)
                     /gene="TPHA0M00730"
                     /locus_tag="TPHA_0M00730"
                     /inference="similar to DNA sequence:INSDC:YBR145W,YOL086C"
                     /note="similar to Saccharomyces cerevisiae ADH5 (YBR145W)
                     and ADH1 (YOL086C); ancestral locus Anc_3.118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688082.1"
                     /db_xref="GeneID:11531893"
                     /db_xref="GOA:G8C0D3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C0D3"
                     /translation="MSTEIPKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSG
                     VCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMS
                     CEECELSNESNCPEADLSGYTHDGSFQQYATADAVQAAKIPAGADLKNIAPILCAGVT
                     VYKAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGFRILGIDGGAEKEELFKKLGG
                     EYFIDFTQCKDIIAEVKKATNGGAHGVINVSVSEAAIEASTNYVRSNGTVVLVGLPAG
                     AVCKSNVFNQVVKSTKIVGSYVGNRADTREAIDFFVRGLVKSPIKVVGLSQLASVFDD
                     MQAGKIVGRVVVDTSC"
     gap             138964..138983
                     /estimated_length=20
     gene            <140188..>141501
                     /gene="TPHA0M00740"
                     /locus_tag="TPHA_0M00740"
                     /db_xref="GeneID:11531894"
     mRNA            <140188..>141501
                     /gene="TPHA0M00740"
                     /locus_tag="TPHA_0M00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688035.1"
                     /db_xref="GeneID:11531894"
     CDS             140188..141501
                     /gene="TPHA0M00740"
                     /locus_tag="TPHA_0M00740"
                     /inference="similar to DNA sequence:INSDC:YBR143C"
                     /note="similar to Saccharomyces cerevisiae SUP45
                     (YBR143C); ancestral locus Anc_3.121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688083.1"
                     /db_xref="GeneID:11531894"
                     /db_xref="GOA:G8C0D4"
                     /db_xref="InterPro:IPR004403"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR024049"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8C0D4"
                     /translation="METDAERNIEIWKVKKLIQSLEKARGNGTSMISLIIPPKGQISM
                     IQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNKIPPNGLVLYCGDIITEEG
                     KEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLQADDKFGFIVMDGQGTLFGSLAG
                     NTRTVMHKFTVDLPKKHGRGGQSALRFARLREEKRHNYVRKVAEVAVQNFIVNDKVIV
                     KGLILAGSADFKTDLAKSELFDPRLAEKVIKIVDISYGGENGFNQAIELSAETLANVK
                     FVQEKKLLTEYFDEISQDTGKFCYGIDDTLKALDLGACDRLIVFENLDTVRYTYKDAE
                     DQEVIKFVKPGQEDKSYAIDKATGQEMEVVSESLLIEWLAEHYKDYGATLEFITDKSS
                     EGSQFVSGFGGIGALLRYKVNFEQLQEDSDDEYYNSDEGSDFDFI"
     gene            complement(<141794..>144082)
                     /gene="TPHA0M00750"
                     /locus_tag="TPHA_0M00750"
                     /db_xref="GeneID:11531895"
     mRNA            complement(<141794..>144082)
                     /gene="TPHA0M00750"
                     /locus_tag="TPHA_0M00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688036.1"
                     /db_xref="GeneID:11531895"
     CDS             complement(141794..144082)
                     /gene="TPHA0M00750"
                     /locus_tag="TPHA_0M00750"
                     /inference="similar to DNA sequence:INSDC:YBR142W"
                     /note="similar to Saccharomyces cerevisiae MAK5 (YBR142W);
                     ancestral locus Anc_3.122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688084.1"
                     /db_xref="GeneID:11531895"
                     /db_xref="GOA:G8C0D5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0D5"
                     /translation="MANRLLQKRLGKINGKKNPKKNPKKVQKNANVKSEGKVVKSTEL
                     KWKKVDIPDTLGDFGGLYGLEEIDGVDVKIINGQAQFITRTDTNIKKDDENQDDIQID
                     ENTGIDDLVEFKNMDDIKEGELSAATSESEEEEEEEEDSDNNNEEDSDDNKKDNINVG
                     DDALKTNVFTSDVNLDNEVSSIDLPEWTNVVGDLSFTTLNGLASLAFTKPTEIQMKAI
                     PHALKGEDIMGKASTGSGKTLAYGIPILENLLRTAKVDANKPIALIFTPTRELAQQVT
                     QHLQKISKLIIEKNPYSILSLTGGLSIQKQQRLLKYKGSGRVVVATPGRFLELLEKDN
                     TLIDRFAKIDTLVLDEADRLLQDGHFDEFENILKHLNNANKKMEGTAKWQTMIFSATF
                     SIDLFDKLASSNWKNKKLDENESEMNVVLKHLMNKIQFKSKPVIIDTNPEQKVSEQVK
                     EALIECAPLERDLYSYYFISMFPGKTLIFCNAIDSVKKLHSFLTFLKISTFQLHSSMT
                     QKNRLKNLEKYQFQSEKNEKLGKPTVLIASDVAARGLDIPDIQHVIHYHLPRTADVYI
                     HRSGRTARGGKQGVSVMICSPEEAIGPLRKLRKMLDNKSQHSSKPFFKKWQNTVPLLP
                     IDLDVLAQIRERSHCASELADNDIASTSLRKDDVWMKKAADELGIDFDSDDEIVDTFL
                     AKNKTKKMNKTMERNDMRMTKIQLNNLLSKPIRKDMRRKYLTGGLVNLADNLVKKRGH
                     KNIIGHDEVDALATVQNKKQKK"
     gene            <144363..>145352
                     /gene="TPHA0M00760"
                     /locus_tag="TPHA_0M00760"
                     /db_xref="GeneID:11531912"
     mRNA            <144363..>145352
                     /gene="TPHA0M00760"
                     /locus_tag="TPHA_0M00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688037.1"
                     /db_xref="GeneID:11531912"
     CDS             144363..145352
                     /gene="TPHA0M00760"
                     /locus_tag="TPHA_0M00760"
                     /inference="similar to DNA sequence:INSDC:YBR141C"
                     /note="similar to Saccharomyces cerevisiae YBR141C;
                     ancestral locus Anc_3.123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688085.1"
                     /db_xref="GeneID:11531912"
                     /db_xref="GOA:G8C0D6"
                     /db_xref="InterPro:IPR021867"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8C0D6"
                     /translation="MLSRKRQTITGKQVVERVKNIKPSKTRKIIRRFHLLISKRKAIV
                     GKLKIKNIGDNDEESNVISIRKQLNGRELKMYNEGFSNDKADEREKQLLKVKVTDDRY
                     ELIALLGYIMNEIVNKGGLSNYQSASRVGQDNKRGGDSSKLLVKWLLDDLQLTSIDRV
                     LEIGCLSSQNHISKFKIVNGIERIDLQNINNDKKILKQDFMERPLPKGPEEKFDLISC
                     SLVLNFVNTPLDRGRMLLRFNDFLLDRGYVFIVLPLPCLNNSRYMNSDTFCQLMKHLG
                     FEKLQYTETHKICYMLFQRTMGYSPNCNSVSTFSRKTKLSDKPGMNNFTILLP"
     gene            <146593..>155424
                     /gene="TPHA0M00770"
                     /locus_tag="TPHA_0M00770"
                     /db_xref="GeneID:11531913"
     mRNA            <146593..>155424
                     /gene="TPHA0M00770"
                     /locus_tag="TPHA_0M00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688038.1"
                     /db_xref="GeneID:11531913"
     CDS             146593..155424
                     /gene="TPHA0M00770"
                     /locus_tag="TPHA_0M00770"
                     /inference="similar to DNA sequence:INSDC:YBR140C,YOL081W"
                     /note="similar to Saccharomyces cerevisiae IRA1 (YBR140C)
                     and IRA2 (YOL081W); ancestral locus Anc_3.124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688086.1"
                     /db_xref="GeneID:11531913"
                     /db_xref="GOA:G8C0D7"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8C0D7"
                     /translation="MAHTSKEQKVPRVNMSDRLCYNVICDRIYQFLPVKSSFTYYTQV
                     EEFEVFLKCRDILLTVVAKDRLHHILIHIMNCIEKKILTNNMAITEVTFEQFQSIIVL
                     MRLLNDLIEYNWDMHDMKQLKASEQKKVHQLDNAIFRNRMVGFASSRTQSHSTRPSKL
                     PTDNNLIHRLLNFCNNLKFHTSTINTLLSSSDDLYGQHLHLRFMLLANYQEILKKNSL
                     LKTDAILLDVTIAHLQSFLAASNPDEYSLYLNEKLLQPYFAHIHSPNEYNHQSARKDE
                     FELIKYFDLFASLQITSRDLIHFLEIVEKLSTVLGKTIFNTVFISHVTKTLQIWITSK
                     PNDFLTFNKMHQNEKRLDRYEIIESLFDQLFSTYKVSSLLTSNFARDPIIPTSSAPIQ
                     INSTSVNYNISEQNTSLNPFSKSNSRSSTGTSTNNPHINPLQPVGLSRTSSMNILNQE
                     NQSLKSHAKNNTLLNSYERLFFDQNSSNSSIQTNNIKDEIKGDSSNELDNSHLFSYIN
                     RRKSNTVLTELIGYNNSYTSSNLAILNILGILAILQNDVMIEASNISLTDINDHLPSN
                     IDQSKGPCYSDSTNKQTDNDSLPTTLNKIKSLSSSIRSFKRNPPKKKTIKFLTLLVKN
                     LNGSSSSSEVALLDSSYVLLSMLFLASTVSTIDVKAPAVFFCCRFINTFGQNLQVGRN
                     WNDRVNKAFSNFEVKYPHIFKALQLKYFISLLQMDTNNFIAHLCLEDVLRERNLTVLC
                     LYTEGFSLYFHTNLTNKISKESNVKTHAFLIELFYMVIKMRHSTIIGENALKEIFRKH
                     NKHVENIFKCNLQEHKTVISKKRDFYFGYDSNLDISDNDQNDNELITLSSNPSSVQQQ
                     METISKYSYKSIRSKTPVSVQSSIISNEVDQNEVDLEIMVSTILTIFSRKIYYFFTPE
                     NVDSIDLTYIIETNLCVVKIIADGYFSTNDAINKSSRTFVKVFLEFLTNINKDSPVQL
                     IVSAYFMTTGIVFMISKLLTNLSLSYESREVLLQAALQFMNTKYYLTKLLQDNGRGYH
                     ISLIVESQLNDIAAVVGKALFLSLCCGKPKIQQIVTDLYKSYYKFVLLYGEIIGRSDE
                     ELDIQLDFIRSLSSANYILMGNIAFQHYLLDTIMKHLQVPNRILVESIFIIYDRWLYL
                     SQNKLALTQDQFDEFRIFAGVIAVSSGIILSQKTNTDNYYIKENINSLEEKFNYFIVQ
                     QCIWINDSSLLTRENARDILSHELHPLAYNILLTNIKKKFDEISKSTTNVILDDYWYS
                     FIEQVIIILRTILQKDDDATKKNLILVSVEIIDIIEFLCIHIKNIPASNSKFHKIVIQ
                     MLKLFKGIQSSENKMFIKCHFQLKNKWLKFILEIFNDSVNHDFDFNNITLSHKDMDLD
                     KRKIDSLFIDRLLESSITLKYLTKNLPIEVIPSSADNDLRKLKATEFGKYFSYLFKGL
                     EICHIDDNIPHFLSNKKTLISSNIIASLANLTNANSDVGIEYALPLGLSLSREMKMSF
                     LKVFINIIQSEKKYNQHEDEHNKIIIFTELTKYFQKFPFLISDFCKVCPSDIIDEFSV
                     GIFEAFGATTFFNILFKELLSNEISTILRPSEILRRNSCTTSILTLFASSRGHEYLVD
                     VLKPALSNIVCSNDLMDIEKLDPDDPETGHKVSIYLSYFDKIVESIIGSQDIFPESFF
                     DVCKSIYDVTTTRFRDHGEIAVSAFLFLRFICPSIITPETESIESIFDTNKKKVCLSM
                     AKLLQMIANGSDSLTRWPSLKNEINRLTIYREKIFSFIKSVSTKDKIIQNDTQVSTDL
                     VPNLAFLQKVLYFNELSIRKTLLKDVQCFGSVEEFINLIEIFDTFMGKFKQPNFNPNN
                     DLPQYVKEHMYDMPRLYNFMEKNVFKKKNSTIIYKNFITESISSDNIPTITVSFRHLQ
                     YYSISNDEMVYHFIQTYSKIWTTKNYLVFDCTDYCSDGLDSLVPFLTLLLTLIPEETL
                     KLCVSLYVINADSSAVDQALKGGSNVGLFLAAYGKQKWITSNEDGNIIKFLGTKGETL
                     EIVKGVRIFLKDVLLYDHDSKKSVAVALQIGTNHIQVLIQEPKKIKLTDTSTVTEIKV
                     NHVYHISRILSVDISSYSGNDSEFTIALDSGSVTLCCDKYLDVIRMINQSMSRIEEDA
                     SNQDNLMSRPESVVLEEKDKEINKRYIVSNLLIILLLGFSDDDMKIKEVSYNLMVALQ
                     NTYKMDFGFFLYTSPEIYVSQNGSQILTEVTKTLVAKSSELTPYIIPCLLNLLESDIL
                     DFDDIPTYLSYLSAWMHNVYQHIYIADLNEDGVALTTKIIHRVIRLTVKHEAYSSLYI
                     DNIWHPMLVELQFINIVVDETLVYASERLYENKDKNKVLNILGSLPTFPVAKIVIGKL
                     LDIINSFSHSLIYEASNKSWSDLLILSKLASDLFFQNTLVAQNFLPETLIIISLLIDL
                     GPLELRETLFGLLMNVCNSLAINNTLPSTSKKQLDSLCQIFVSHRLRFIYGFSQNKNR
                     ILPRMSAESFQVNFKTLEYFIDNILLLMENYDGFESAHWKASYKSHIINILFNKKTLL
                     SARAVMILGIVNKSKTPEYLTKRILYNMMLATAEPDLSEEQLFLSIAHVHTCSKLVEG
                     LDPSLEIMKSMFWLSTTYVISEHPLFFEAGLIFLTNNIKRLFMVELHKGKNGRPLIDI
                     LLETKGQLQPQYSEIEKLVNFRWDKHNFTYILLWTVSRGLSFPHIKEFALFCLVQLFR
                     NTYYEFAAFKKDTHYLSYYLFVFVTMTPSQLEDVINAVEYEEEEEFYQFDSTNKVTKH
                     LLDWLVSDNEDTMITLYQIALIYRNLLIDDAGKFRFGLIMKYLLEKNPVCVLPIYNII
                     QPELFNQLATDKNILNSDLAFEIIGLVSRMSEFNKASKYEEELLETLGKRDLRIINSL
                     TTRQNESKLFFDPTNLTLSSIVAEEKKYTIRLISKIIQNSDELNNNISSSPSTSRIS"
     gene            <155858..>156061
                     /gene="TPHA0M00780"
                     /locus_tag="TPHA_0M00780"
                     /db_xref="GeneID:11531914"
     mRNA            <155858..>156061
                     /gene="TPHA0M00780"
                     /locus_tag="TPHA_0M00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688039.1"
                     /db_xref="GeneID:11531914"
     CDS             155858..156061
                     /gene="TPHA0M00780"
                     /locus_tag="TPHA_0M00780"
                     /inference="similar to DNA sequence:INSDC:YOL077W-A"
                     /note="similar to Saccharomyces cerevisiae ATP19
                     (YOL077W-A); ancestral locus Anc_3.128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688087.1"
                     /db_xref="GeneID:11531914"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:G8C0D8"
                     /translation="MGGAYTIFGRSFPSHQLALATIGLMGLLIAPNPFAKKEESKIDF
                     KASSPEEEKFIKDYIKKHATEAK"
     gene            <156567..>158990
                     /gene="TPHA0M00790"
                     /locus_tag="TPHA_0M00790"
                     /db_xref="GeneID:11531915"
     mRNA            <156567..>158990
                     /gene="TPHA0M00790"
                     /locus_tag="TPHA_0M00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688040.1"
                     /db_xref="GeneID:11531915"
     CDS             156567..158990
                     /gene="TPHA0M00790"
                     /locus_tag="TPHA_0M00790"
                     /inference="similar to DNA sequence:INSDC:YOL076W"
                     /note="similar to Saccharomyces cerevisiae MDM20
                     (YOL076W); ancestral locus Anc_3.130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688088.1"
                     /db_xref="GeneID:11531915"
                     /db_xref="InterPro:IPR019183"
                     /db_xref="UniProtKB/TrEMBL:G8C0D9"
                     /translation="MSDRTEKEIFELIEKSNFKQCNVKIALLRKQFPNSSYYVILELF
                     AKFKQSPKKFNYETELNSKYGLQGKEYVNDRKALNLLHTLFIEYSKFEEALNVYEKAM
                     FKYPSFQLAMEWFDKSISDGHYKYMAKASLQLSKYAVVGKNSTLDKRNYSIWYAISVL
                     ALFRFKRDTLTATELKLFPMLAFKNLEEIKPFHNSEEYIIYCSVCEALFIDLCNENNE
                     NNEKARLIVNEILPTLSSEVNLNLKKFIIKYCAKIEDYELLYKSSKKILESIDDYSVL
                     KSFIKASKHIGKSNEETKKLIIDLLGPSRNARLAYLECDVTFTGKIDRDSVMFYLEKF
                     HHKQCCVVDLNAYKEYLEVESVLNYMSELEPKNDIHDVNTLHFSNLTSNESSEKAINL
                     YNSHKHTLNKKMKTDYSILSTSIIKLVEESLSSNGKNPSLNDVLFSLSLLENYQTKDP
                     HNFDTKTWIIALYMHLGCVSQAYSHFADLKIKNVQSDIMHHLIYTRMSSLFPHKSHPY
                     IQHFLTEKENLYEKSLPRLTNFIKISFEREAYSKIMGMLDFRNRLVSSSFKWLSDIEE
                     TQLARLTNNKRGTLIQKNLESWRKINMINGAFNFSDNRDWSRFGEFVKKDNLPYTFQY
                     LKFTDMSMKVNFIKELMIYYLSLGESNSTLDNLIQETIPSDKLVLLKEHLTPIEAWSF
                     NIFYDLYKNEGSSLNDTLEYIPSKEELSTWRLSNYYITKLATLKTLDNMQQISDKKLK
                     ESIKKQLQELRENCDDLYKSYSSEIISSSSVLSSTQKKILNSLDYKELKPELITDGIL
                     KIQKAVRDL"
     gene            <159632..>161062
                     /gene="TPHA0M00800"
                     /locus_tag="TPHA_0M00800"
                     /db_xref="GeneID:11531876"
     mRNA            <159632..>161062
                     /gene="TPHA0M00800"
                     /locus_tag="TPHA_0M00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688041.1"
                     /db_xref="GeneID:11531876"
     CDS             159632..161062
                     /gene="TPHA0M00800"
                     /locus_tag="TPHA_0M00800"
                     /inference="similar to DNA sequence:INSDC:YBR138C"
                     /note="similar to Saccharomyces cerevisiae YBR138C;
                     ancestral locus Anc_3.131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688089.1"
                     /db_xref="GeneID:11531876"
                     /db_xref="UniProtKB/TrEMBL:G8C0E0"
                     /translation="MDEKSSSRVLENMDSNSMSLLYSSPSINSHSNSTGEIAKNSFFK
                     ITHSPTFENDKNTPLKWQQEKQEFQFQSNSTPSKSNFKNPQQRLLQARKRRSTLMGAK
                     PRVPSRLNKATSKLDLIDDRTLTSLPIPHPQKNENNNLFQNRQLNNKRPRYNETKELR
                     VHNDQVNRNVSYNQSTLDDSLDSMGEDKENTSKNYDHPIVLLEDYISYDDSGSSSRKR
                     NKRRISLSDLKRKMHKGQTNNVLKLRKIKHPSHLSNLTFSLAPNHANASSIMTDISEQ
                     YNTFEPEPNENSNASSDEINGVLKELIHPVTGVTEDQYISRISKKSQLVSCVVCDKVL
                     YELSSILPENNKFKEIVCGNCAEKYEAAAKLFEDYEFDSSLDISNSSIMSGMNNNVQY
                     LENIGLIKHKNTDTFSNELITRLQSQLKQTNEKDEKQNNEEFLLDSKSVLWFIEARKK
                     IRWRWRISKLLPEFLSNHNSNTTQSS"
     gene            complement(<161244..>161870)
                     /gene="TPHA0M00810"
                     /locus_tag="TPHA_0M00810"
                     /db_xref="GeneID:11531877"
     mRNA            complement(<161244..>161870)
                     /gene="TPHA0M00810"
                     /locus_tag="TPHA_0M00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688042.1"
                     /db_xref="GeneID:11531877"
     CDS             complement(161244..161870)
                     /gene="TPHA0M00810"
                     /locus_tag="TPHA_0M00810"
                     /inference="similar to DNA sequence:INSDC:YDR013W"
                     /note="similar to Saccharomyces cerevisiae PSF1 (YDR013W);
                     ancestral locus Anc_3.234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688090.1"
                     /db_xref="GeneID:11531877"
                     /db_xref="GOA:G8C0E1"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:G8C0E1"
                     /translation="MYGDLANKLILEAKRSKQLNSRSKDASKLSMYHEELIRNILKEI
                     SQLKRNTNYLREQQEMGNMDSRVAKCQYFVTLLCMERNKRCLLAYQKFRNDVLDSLAW
                     ENNGMDLLHDNVGITQDNSDLSPQEQEYLKEYSQLITEMKGGILSDIDISGSLDPPSD
                     VFIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRQSDIERLIQQGYVQKI"
     gene            <162278..>164209
                     /gene="TPHA0M00820"
                     /locus_tag="TPHA_0M00820"
                     /db_xref="GeneID:11531878"
     mRNA            <162278..>164209
                     /gene="TPHA0M00820"
                     /locus_tag="TPHA_0M00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688043.1"
                     /db_xref="GeneID:11531878"
     CDS             162278..164209
                     /gene="TPHA0M00820"
                     /locus_tag="TPHA_0M00820"
                     /inference="similar to DNA sequence:INSDC:YDR014W"
                     /note="similar to Saccharomyces cerevisiae RAD61
                     (YDR014W); ancestral locus Anc_3.235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688091.1"
                     /db_xref="GeneID:11531878"
                     /db_xref="UniProtKB/TrEMBL:G8C0E2"
                     /translation="MRGYGKRSSSVILLLTNNEDRSDVEFSDSSDNDETRRLEMNGSK
                     TRLVDGSVDINEFSSNAIASSPLKDKRGSSESIRGPDSSNPTGSNKTRKQDSSIATRE
                     LDIFDFLETKTTHKKRRTNYRKSTTIDDTDDSVVNFTSDLSYSVDNSEINETIEGLDS
                     FLMSLQKVKKDEVLDQLNIMTKEDECAFNELTSTTNSSKKLYDRRRTLLKKQKSDTDS
                     ELDEEEDDNEKEKNERQLSNSLDRKDKKSKETSKILSSEFNSQEADLSSTQHFLELKH
                     IGGTLRFEDDLEFLTSGSPEKLTKDKFISKLLNFSLAIQTDKDLISYINKHCKNEVYE
                     WCFTKATVRDPIIILLLGVICHEIEIPINEHNIDSHLTMLSELSKQHDIPEDTTLTQK
                     LVKLNYKDFVNIICPNTGVTYTIKLLEKNTSVLMNQSSCQKITCTLLKNYNELQTQDQ
                     DLLMKHLQDILSNYKFELNFLQNVVNSLESIFMSANGNTEVLKSLILITNDQEMVKHI
                     KYQTKQNMYNTCSTHIVNHFFSRKGSIIELLLLYNGLLLNIISQTNNDLQLSRETLDN
                     FTKIYNKLNDETPNESNQFLHDMIYLNFAYLLRQFQDSNLINDTTTSELHSKLKQFNL
                     SVKEYNINLSRKIEQILNI"
     gene            complement(<164369..>165457)
                     /gene="TPHA0M00830"
                     /locus_tag="TPHA_0M00830"
                     /db_xref="GeneID:11531879"
     mRNA            complement(<164369..>165457)
                     /gene="TPHA0M00830"
                     /locus_tag="TPHA_0M00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688044.1"
                     /db_xref="GeneID:11531879"
     CDS             complement(164369..165457)
                     /gene="TPHA0M00830"
                     /locus_tag="TPHA_0M00830"
                     /inference="similar to DNA sequence:INSDC:YPL279C"
                     /note="similar to Saccharomyces cerevisiae YPL279C;
                     ancestral locus Anc_3.237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688092.1"
                     /db_xref="GeneID:11531879"
                     /db_xref="GOA:G8C0E3"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:G8C0E3"
                     /translation="MIKEWKDIPSQVKFLFMYTTMAILGNYTRSAIQSLSEYGPSYIS
                     PGSVLWPNCVACILMGMLQDMNAMKWFEEEPELFVALTTGYCGSVSSYSTLLLETFEH
                     STSLTGSNIKSHTKLPNRAYGIMEFLSVLITQLFVSMSSLLFGKNIATNVLALYTDPA
                     QKSSDTPETTENLDKKEEDNNDNRMKPHPFYRKSITILAYITFTLALPFLALIVVLSG
                     VYGNYSRGKWTLPALFGIIGAFERFYLSKYFNSVWKSLPLGTFLANQFAVVIICILTL
                     VQRGRKSDGSDIPIVSSINACHVVSGLVTGYCGSLSTISTFINEGFKLPFIEMINYFT
                     CSIAVSYIFCVIILGSYAWSKGLVVPIC"
     gene            <166358..>166915
                     /gene="TPHA0M00840"
                     /locus_tag="TPHA_0M00840"
                     /db_xref="GeneID:11531991"
     mRNA            <166358..>166915
                     /gene="TPHA0M00840"
                     /locus_tag="TPHA_0M00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688045.1"
                     /db_xref="GeneID:11531991"
     CDS             166358..166915
                     /gene="TPHA0M00840"
                     /locus_tag="TPHA_0M00840"
                     /inference="similar to DNA sequence:INSDC:YDR014W-A"
                     /note="similar to Saccharomyces cerevisiae HED1
                     (YDR014W-A); ancestral locus Anc_3.238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688093.1"
                     /db_xref="GeneID:11531991"
                     /db_xref="UniProtKB/TrEMBL:G8C0E4"
                     /translation="MLTTRSLTSVGYTNDYECEDTHVYYGRGFCRASTMMELYSIDIE
                     EETERVDVPDTEKCTDLKNSNEIEPEQEPNISPDAANIILKSERNPSFVDETTLNSQD
                     ESYCQDTLGESTFTEPENMKICKLGKTPPIEIIHRPLKDLINKTNKMIYDVDSNHVQY
                     KAGLSKRCRKIPSLHRTQGKDAVSR"
     gene            <167679..>168599
                     /gene="TPHA0M00850"
                     /locus_tag="TPHA_0M00850"
                     /db_xref="GeneID:11531992"
     mRNA            <167679..>168599
                     /gene="TPHA0M00850"
                     /locus_tag="TPHA_0M00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688046.1"
                     /db_xref="GeneID:11531992"
     CDS             167679..168599
                     /gene="TPHA0M00850"
                     /locus_tag="TPHA_0M00850"
                     /inference="similar to DNA sequence:INSDC:YBR039W"
                     /note="similar to Saccharomyces cerevisiae ATP3 (YBR039W);
                     ancestral locus Anc_3.241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688094.1"
                     /db_xref="GeneID:11531992"
                     /db_xref="GOA:G8C0E5"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:G8C0E5"
                     /translation="MFSRVPALSSNIARNGMMVARVNGINAARNYATLKEVEMRLKSI
                     KNIEKITKTMKIVASTRLGKAEKAKNTSKNLSETDEQFFKNAETKTIGVEGKEPKELV
                     IAITSDKGLCGSIHSQLAKAVRAHLKESPAADVVTIGDKIKLQMLRSNANNLKASFNG
                     VGKEAPTFYESSLITEKLINEFKLNDYQKISIYYNNPVTSLSFEPSSMPVFNIEAIEK
                     SPSFEKFEIDADGKVSTDLFEYNLSCKLLSAMAQGHAAEISARRNAMDNASKNAGDMI
                     SRYSILYNRTRQAVITNELVDIITGASSLD"
     gene            <169273..>171297
                     /gene="TPHA0M00860"
                     /locus_tag="TPHA_0M00860"
                     /db_xref="GeneID:11531993"
     mRNA            <169273..>171297
                     /gene="TPHA0M00860"
                     /locus_tag="TPHA_0M00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688047.1"
                     /db_xref="GeneID:11531993"
     CDS             169273..171297
                     /gene="TPHA0M00860"
                     /locus_tag="TPHA_0M00860"
                     /inference="similar to DNA sequence:INSDC:YBR041W"
                     /note="similar to Saccharomyces cerevisiae FAT1 (YBR041W);
                     ancestral locus Anc_3.243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688095.1"
                     /db_xref="GeneID:11531993"
                     /db_xref="GOA:G8C0E6"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:G8C0E6"
                     /translation="MGSDAMITAILAKLFAALFRLIKVLLFPFYFVFIWLFKKPLDAL
                     DKRYRFREDFYIIPFFLKQVFLYFIKVKRNRFQNWYLFEDQVKHSGHIPCITYPRPTS
                     VKGEFKIETFSYSETYDIVLRLSYILHYDYGVEVGQTIGLDCTNKPLFIFLWLACWNI
                     GAVPAFLNYNTKGNPLVHSIKIANIDSVFIDPDASGPISQSEEEIKNALPNVKLNYLD
                     ELDLMKQITNPINPIFLQQANVRSPAHLADFNPAMLIYTSGTTGLPKAAILSWRKANI
                     GCLLFGHVLHMDTSSVVFTAMPLFHSTAALLGVCAVLSKGGCIALSNKFSATTFWKQA
                     YLTHATHIQYVGEICRYLLHTPVSDYENMHCVKYAYGNGLRPDIWQQFRKRFNIETIG
                     EFYAATEAPFATTTLQRGEFGIGACRSYGAIINWFLAFQQTLIRMDPDDENQIYRNAK
                     GFCENPKVGEPGEMLMRIFFPRKPETSFQGYLGNKKETESKVLRDVFRKGDAWYRCGD
                     LLRADEYGQWYFLDRLGDTFRWKSENVSTTEVEDQIISSNEKLFAQSVVVGIRVPGYE
                     GRAGFALIRLIDCDESTLTNDQKLEILNTMLKHLEKSLPKYALPIFVKFVNEFNMTDT
                     NKIRKKLYRDQILPHGSNNMETLYWLKNYKEYTVLTTEDWRAIEVQSLQL"
     gene            complement(<171415..>172566)
                     /gene="TPHA0M00870"
                     /locus_tag="TPHA_0M00870"
                     /db_xref="GeneID:11531994"
     mRNA            complement(<171415..>172566)
                     /gene="TPHA0M00870"
                     /locus_tag="TPHA_0M00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688048.1"
                     /db_xref="GeneID:11531994"
     CDS             complement(171415..172566)
                     /gene="TPHA0M00870"
                     /locus_tag="TPHA_0M00870"
                     /inference="similar to DNA sequence:INSDC:YBR042C,YDR018C"
                     /note="similar to Saccharomyces cerevisiae CST26 (YBR042C)
                     and YDR018C; ancestral locus Anc_3.244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688096.1"
                     /db_xref="GeneID:11531994"
                     /db_xref="GOA:G8C0E7"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:G8C0E7"
                     /translation="MSSPTRILKQYFISFISIICFLQGCGCIVLFQIVILTVYSKHEN
                     KLKLSLRKSKEAFIILLMCVMSVIAPSSIRITTDDKSMSLENFRFNKQLKHVESNLNQ
                     RSIFIANHQLYTDWIYLWKIAYTSNFGGDVYIFAKKALKKIPIFGYAMTNYNFIFLDR
                     NWVKDKNIIIRKLISILNYSTISNKNENDASSRNLPYCFIIFPEGTTLCKKAEIRSME
                     YAKKLGRRNFKHIVTPHTKGLRLLLTSLDKNIEKIYDLTVGYSGLKYGTYGEDEYSLK
                     QMIYHGKSPKLVDIHIKSIEVKDIPYQDEKQFQAWLFDLWEEKDKLLKGYYQLGHFDV
                     DPNFSTTTIDPFKMTLKEVIIAAVFIIASGSIFFYLYSNINNLKISYIL"
     gene            complement(<172868..>174064)
                     /gene="TPHA0M00880"
                     /locus_tag="TPHA_0M00880"
                     /db_xref="GeneID:11531844"
     mRNA            complement(<172868..>174064)
                     /gene="TPHA0M00880"
                     /locus_tag="TPHA_0M00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688049.1"
                     /db_xref="GeneID:11531844"
     CDS             complement(172868..174064)
                     /gene="TPHA0M00880"
                     /locus_tag="TPHA_0M00880"
                     /inference="similar to DNA sequence:INSDC:YDR019C"
                     /note="similar to Saccharomyces cerevisiae GCV1 (YDR019C);
                     ancestral locus Anc_3.246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688097.1"
                     /db_xref="GeneID:11531844"
                     /db_xref="GOA:G8C0E8"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:G8C0E8"
                     /translation="MSSFICKRFSSTSSQGLKKTALFDLHIELGATMVPFAGYSMPLL
                     YKGQTHVESHKWTRTNAGVFDVSHMLQSSLQGEGSLKFLERITPTDFSLIKDHNASLS
                     VFLNENGGIVDDTMITKVGADDFYIVNNAGCADRVKSFIPEQLSKSGYECEWKMIPDR
                     SLLALQGPMSSKILQNILAPSQTLNSLSFGQRRLFKLFNGVEIQVARSGYTGEDGFEI
                     SMLDKDAVDFAKLILDNELTKPIGLAARDSLRLEAGLCLYGNELTESITPVEAALNWI
                     ISRSRRNLTDPNAIKFNGYEKIIDQLKNKSSKELRAAFKYTGRGPAARKGAKVYLPDK
                     QTLIGTVTSGSASPSLNNINIGQVYVKNGYHKAGTELVVEIRGKFYPITIEKSPLVPT
                     HYYRTS"
     gene            complement(<174651..>175346)
                     /gene="TPHA0M00890"
                     /locus_tag="TPHA_0M00890"
                     /db_xref="GeneID:11531845"
     mRNA            complement(<174651..>175346)
                     /gene="TPHA0M00890"
                     /locus_tag="TPHA_0M00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688050.1"
                     /db_xref="GeneID:11531845"
     CDS             complement(174651..175346)
                     /gene="TPHA0M00890"
                     /locus_tag="TPHA_0M00890"
                     /inference="similar to DNA sequence:INSDC:YDR020C"
                     /note="similar to Saccharomyces cerevisiae YDR020C;
                     ancestral locus Anc_3.248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688098.1"
                     /db_xref="GeneID:11531845"
                     /db_xref="GOA:G8C0E9"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0E9"
                     /translation="MLQNNRLENLIVSIGGGHGAGCYETSLHLKESILKMFPNSRIRV
                     LNLDDMKDASTLNYDFTDYDFKSLHRELLKQPTEGDTTGKMKEPICINILCGGYALYD
                     KEIRDASKLKVYLDSDADKRLINLIQTQNITQPKDLSVLLTEYLHHLREESLKYIEPT
                     RVYADLIIPCKNESLASAILLDGINKAVEEMKTPLSLGDQETHNPLTKKTSLLNFEAE
                     RIDVQKGRYYDLA"
     gene            <175733..>176935
                     /gene="TPHA0M00900"
                     /locus_tag="TPHA_0M00900"
                     /db_xref="GeneID:11531846"
     mRNA            <175733..>176935
                     /gene="TPHA0M00900"
                     /locus_tag="TPHA_0M00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688051.1"
                     /db_xref="GeneID:11531846"
     CDS             175733..176935
                     /gene="TPHA0M00900"
                     /locus_tag="TPHA_0M00900"
                     /inference="similar to DNA sequence:INSDC:YDR021W"
                     /note="similar to Saccharomyces cerevisiae FAL1 (YDR021W);
                     ancestral locus Anc_3.249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688099.1"
                     /db_xref="GeneID:11531846"
                     /db_xref="GOA:G8C0F0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0F0"
                     /translation="MSAFRREDDQKLKFKTSKKLKVTATFEAMDLKDDLLKGVYLYGF
                     EAPSAIQSRAITQIISGTDVIAQAQSGTGKTATFTIGMLQVIDLKRKDLQALILSPTR
                     ELATQINQVVTNLGDYMNVQSYAMTGGKTMKDDLKKMNKSGCQVVSGTPGRVLDMIKR
                     QLISTRNVQMLILDEADELLGEHLGFKQQIYEIFAKLPSACQVVVVSATMSKDIIEVT
                     KKFMSDPTKILVKRDEISLEGIKQFYVNVSKEDWKFDTLCDLYDSLTITQCVIFCNTK
                     KKVDWLSQKLTRSNFSVIAMHGDMKQEDRDKVMNDFRTGTSRVLISTDVWARGIDVQQ
                     VSLVINYDLPENMENYIHRIGRSGRFGRKGVSINFVTDEDSSKQKEIERHYKIKIKPV
                     PADLSTLA"
     gene            complement(<176984..>177481)
                     /gene="TPHA0M00910"
                     /locus_tag="TPHA_0M00910"
                     /db_xref="GeneID:11531847"
     mRNA            complement(<176984..>177481)
                     /gene="TPHA0M00910"
                     /locus_tag="TPHA_0M00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688052.1"
                     /db_xref="GeneID:11531847"
     CDS             complement(176984..177481)
                     /gene="TPHA0M00910"
                     /locus_tag="TPHA_0M00910"
                     /inference="similar to DNA sequence:INSDC:YDR022C"
                     /note="similar to Saccharomyces cerevisiae CIS1 (YDR022C);
                     ancestral locus Anc_3.250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688100.1"
                     /db_xref="GeneID:11531847"
                     /db_xref="InterPro:IPR018621"
                     /db_xref="UniProtKB/TrEMBL:G8C0F1"
                     /translation="MDFEVPVITVLDTNISHIIKNGGQHKAEETSLNLFKGHNHLNKA
                     LSFPTNIRYIFEDDDNELEINNLKGTIDELDIENIIVIDLDTDNSLQKVQLISDKYEL
                     LSYKEKSCNENSTNPKISEKEIELKVLSQFKEFEHIPEQYSLEDLIKLYAIQNEQIEE
                     LIDLN"
     gene            complement(177656..177729)
                     /gene="TPHA0Mtrna1V"
                     /locus_tag="TPHA_0Mtrna1V"
                     /db_xref="GeneID:11532004"
     tRNA            complement(177656..177729)
                     /gene="TPHA0Mtrna1V"
                     /locus_tag="TPHA_0Mtrna1V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUA"
                     /db_xref="GeneID:11532004"
     gene            complement(<178414..>179805)
                     /gene="TPHA0M00920"
                     /locus_tag="TPHA_0M00920"
                     /db_xref="GeneID:11532008"
     mRNA            complement(<178414..>179805)
                     /gene="TPHA0M00920"
                     /locus_tag="TPHA_0M00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688053.1"
                     /db_xref="GeneID:11532008"
     CDS             complement(178414..179805)
                     /gene="TPHA0M00920"
                     /locus_tag="TPHA_0M00920"
                     /inference="similar to DNA sequence:INSDC:YBR045C"
                     /note="similar to Saccharomyces cerevisiae GIP1 (YBR045C);
                     ancestral locus Anc_3.252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688101.1"
                     /db_xref="GeneID:11532008"
                     /db_xref="UniProtKB/TrEMBL:G8C0F2"
                     /translation="MQVQVGTTNLNHSTPTKSSKRNQLKKWFHSFYDKPLDDTPISQL
                     PTEFIDISLDIDNSSRNLASDKQSNDNSILPDQYNKTSIRKHLKKNFHKFKLSNNYSN
                     AVNDVNNNSTDIEDYIKNMKEPSTCFDKYHTNTNDLNELFDHSMGRVFSGNILNESSV
                     FQNYYSRLNAKHFHYQYFNDRKNEYSDIKEYKNLRFISIDETMLNATSGNPPIIMKDN
                     DSSLDNSDKLDNGKINSKSESDVNSQNNEDVDNPIYDSDKSTKELEPETGFNSIIKTP
                     NKYLTGTNDIENAKSDNKIEAKEKYVDDINSYMLDSIPSSKAQTHSGIQKIGKDLSDS
                     DELPKPDYYIFNSTESPDSGDSKEGYSDTETMQLRISNAAKRCSYDVSSDTLTIHVVK
                     NELIDEPAQRDAISLKDKESNEVEIIDSQFSGVSPWNPEFNDDLNYFQDKVIQDIENK
                     RNLHEKKFIISYY"
     gap             179952..179971
                     /estimated_length=20
     gene            complement(<180084..>181115)
                     /gene="TPHA0M00930"
                     /locus_tag="TPHA_0M00930"
                     /db_xref="GeneID:11532005"
     mRNA            complement(<180084..>181115)
                     /gene="TPHA0M00930"
                     /locus_tag="TPHA_0M00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688054.1"
                     /db_xref="GeneID:11532005"
     CDS             complement(180084..181115)
                     /gene="TPHA0M00930"
                     /locus_tag="TPHA_0M00930"
                     /inference="similar to DNA sequence:INSDC:YBR046C"
                     /note="similar to Saccharomyces cerevisiae ZTA1 (YBR046C);
                     ancestral locus Anc_3.253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688102.1"
                     /db_xref="GeneID:11532005"
                     /db_xref="GOA:G8C0F3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C0F3"
                     /translation="MSVELPKTQEVVLIDDISEGYDTIKYVTDYPVPDDIKDDEILVK
                     NKYSGVNFIEAYFRKGIYPCEHPYILGREAVGTVVYVGRRMAHDYKVGDSVAYIGNSS
                     MAQFTKVSAKSPIINMSKFYIEEELTDELFQKYCASLINVLTVMTFIRESYKVKKNDN
                     ILVYAAAGGVGLIFDQLITKIGATVIAVASSDDKLQLAKLHGAKHLINSSTDDIVEKV
                     NEYTNGKGVEAVFDSIGKDTFETSMKVLRLKGTFVSFGNASGPVAPFPLSRLSPKVLK
                     LVRPQLYGYLQEKESWDYYSKEFIRVMDSGELKINISKVYQLGDYKKAAMDLESRKTT
                     GKLILKVPQ"
     gene            <182248..>183266
                     /gene="TPHA0M00940"
                     /locus_tag="TPHA_0M00940"
                     /db_xref="GeneID:11532006"
     mRNA            join(<182248..182292,182844..>183266)
                     /gene="TPHA0M00940"
                     /locus_tag="TPHA_0M00940"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_003688055.1"
                     /db_xref="GeneID:11532006"
     CDS             join(182248..182292,182844..183266)
                     /gene="TPHA0M00940"
                     /locus_tag="TPHA_0M00940"
                     /inference="similar to DNA sequence:INSDC:YBR048W,YDR025W"
                     /note="similar to Saccharomyces cerevisiae RPS11B
                     (YBR048W) and RPS11A (YDR025W); ancestral locus Anc_3.255"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_003688103.1"
                     /db_xref="GeneID:11532006"
                     /db_xref="GOA:G8C0F4"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR028333"
                     /db_xref="UniProtKB/TrEMBL:G8C0F4"
                     /translation="MSTELTVQSERAFQKQPHIFTNPKFKTSRRTKRWYKNVGLGFKT
                     PKTAIEGTYIDKKCPFVGMVSIRGKILTGTVVSTKMHRTIVIRRDYLHYVPKYNRFEK
                     RHKNVSVHVSPAFRVEVGDIVTAGQCRPISKTVRFNVLKVASSSKSKKQFSKF"
     gene            complement(<183611..>185602)
                     /gene="TPHA0M00950"
                     /locus_tag="TPHA_0M00950"
                     /db_xref="GeneID:11532007"
     mRNA            complement(<183611..>185602)
                     /gene="TPHA0M00950"
                     /locus_tag="TPHA_0M00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688056.1"
                     /db_xref="GeneID:11532007"
     CDS             complement(183611..185602)
                     /gene="TPHA0M00950"
                     /locus_tag="TPHA_0M00950"
                     /inference="similar to DNA sequence:INSDC:YBR049C,YDR026C"
                     /note="similar to Saccharomyces cerevisiae REB1 (YBR049C)
                     and YDR026C; ancestral locus Anc_3.256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688104.1"
                     /db_xref="GeneID:11532007"
                     /db_xref="GOA:G8C0F5"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:G8C0F5"
                     /translation="MNQVDAVRKNDGDGIKNDTELKNDGSHSPSANDVQSQEDNVDAA
                     ANNLSDVDWFLKNEALKYGNGKEDIESGNKNDDSTKNNDNTNDNGSSSTTNNNGNNNN
                     NNNTIKDSIARAAVAIATAFGSDNDRKKDKHSDRDKKNLRNQRKSKKSSKRDLDHDSE
                     IAEGSSEDEDEKVRKKLKSIRNEELSNQLKDDQDSMVVDPELATLDEVDESNKDELKL
                     NEKDSAATNSDVELNSINANENLVRKAIIESDSISQNPDFQQYLNTDGGDHDNHKNKK
                     LDLEAAAVYAHAQIASLEAEHKDIKNNKSNKESKQEYREVLPKDGESADYDLMGDMSE
                     LINSAAAKASETIPASSQTSGKSFDSSEESALEQFVDEYQKIKGMTRRDVCERIWSNE
                     RRKDDFWINICKVLPYRTRSSIYKHVRRKYHIFEQRGKWNAEEEKELAKLCVEKEGQW
                     SEIGKALGRMPEDCRDRWRNYVKCGPNRSSHKWSAAEETQLKEVIEAILNDNNLQNEK
                     YIQEQSDQARDRGVSGDALENLIKSYRSQLESKPFKDIINWTIVSEKMGGTRSRIQCR
                     YKWNKLMRKEALEKVDSMSGSDKKWILQKLADLGFTEDSQVDWEELAALKPDLNLNGS
                     EVKLSYEKMRSKIKNIKDKTINDISKELLVNFEDHFANK"
     gene            complement(<186308..>189322)
                     /gene="TPHA0M00970"
                     /locus_tag="TPHA_0M00970"
                     /db_xref="GeneID:11532022"
     mRNA            complement(<186308..>189322)
                     /gene="TPHA0M00970"
                     /locus_tag="TPHA_0M00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688057.1"
                     /db_xref="GeneID:11532022"
     CDS             complement(186308..189322)
                     /gene="TPHA0M00970"
                     /locus_tag="TPHA_0M00970"
                     /inference="similar to DNA sequence:INSDC:YDR027C"
                     /note="similar to Saccharomyces cerevisiae VPS54
                     (YDR027C); ancestral locus Anc_3.257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688105.1"
                     /db_xref="GeneID:11532022"
                     /db_xref="InterPro:IPR019515"
                     /db_xref="UniProtKB/TrEMBL:G8C0F6"
                     /translation="MDPSNIKINKSSTIEPNSSGSYTMTDVNGEFIQPPKIIEPTSMD
                     STLGEDDETSLNDDILSISESTKNKHLSRMSLDSASVRKSFESSIAGRSSRTFGFGHG
                     IHSGSQDFSPLGNNSIYEIVMNTRRKNWLGFPTSYDIPPVTLSKNEIEKNWKADIKNY
                     IESVKQEYLIFESTNNLKNMNRLEQIKQLEDYNNNDETQTKGKNEFNDTINDQQQGNM
                     FAKDLGQVPEFYFDKDFQLDNPRIFHKVLDGLRFNLTNVKVSENTDREEEFNQINERL
                     NDYLDAVEGLLVTEISKSSHKFYHALSNVDQIQDKVKNSIQGLDKISDGLIDIDKNKI
                     QKEIEKLQNMIKQKNIEKLEQGLLQVKAILVESDNCKKLFQEEKFDECMTLINTVNKL
                     VKGDKSDDPIVQKITNNWPHDLVDLRAVPSLSETREYLTNMNIEIGGKFSLQLCDILM
                     KDLQNYCKTSDTNEVLDRLQNKTRSRRYLEISKELQDSITVLIDKLFKCEELTSSFSF
                     FQDKLITELKTIIKLYLPNEKKAVSNEEADTSISLENSPNPESLHNSKGTQENNAVPQ
                     PKQTSSGTKLSKLIKEQTSEEFQQTLLHIFTHASEALRRLYRYQKMLLDTSLNEIISA
                     NDPNINEYDMITQLDIRNGINEGIKIIQLRMGKIIIVRRDISSQLSYSEFLKLYAIVV
                     CFIQECEEVSGEFLTKYLSDVLESQIQAYINFQNVKNSRLLREITKKDAWLPYIVEPT
                     VQRDVNDILVSMDIDPLDWTNELQLVKAKSSNRNNEVGEKELESVNGDNNSGNGNNTA
                     ESNTASVENNDGVKVTKAHSNSDNNGVVIPKKPVGHRKSVVVGDKTFVASESLITIIG
                     KIKEIMILSIDLPSVYLPNFERNISNLLEAFNANILRIFSEDKANSIQAQNPNPDQLK
                     PSVNRNYSIIGESLDCLVEFIKVIQKFYRRLMSSSKDFNKKKNATGTTNKNFPNAFPS
                     QHNNSVDYIQLLQLYQSTIEKIYLANAPPPPA"
     gene            complement(<189859..>192741)
                     /gene="TPHA0M00980"
                     /locus_tag="TPHA_0M00980"
                     /db_xref="GeneID:11532023"
     mRNA            complement(<189859..>192741)
                     /gene="TPHA0M00980"
                     /locus_tag="TPHA_0M00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688058.1"
                     /db_xref="GeneID:11532023"
     CDS             complement(189859..192741)
                     /gene="TPHA0M00980"
                     /locus_tag="TPHA_0M00980"
                     /inference="similar to DNA sequence:INSDC:YDR028C,YBR050C"
                     /note="similar to Saccharomyces cerevisiae REG1 (YDR028C)
                     and REG2 (YBR050C); ancestral locus Anc_3.258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688106.1"
                     /db_xref="GeneID:11532023"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:G8C0F7"
                     /translation="MSKNLSGYFKNNEDANDDMGPSVSMAIEADDQEQFQKSTFNLKR
                     TRSIGLFSDYLDTNTPLHTTSKTIAKPEVTRDDSMDSDLEYDNGSSESYDSYDEDMSS
                     EDEDDDLQAGEQLQLHRTQDHAGTADWSATPSKTPGQSASVSPPPADNDTILIPQDDN
                     DLVMEPNTHVDYLSHNWNESEVLNSWKYIILKKKRKDDVIDSVSSARLENASWRTWAK
                     ARNHLETVSPEIVNWSKDSDVTWLYGPVVTDSKSNEEYDEYSKDAASLHNLTAEMGYG
                     SDDETSKRLATKMTKKQLKPILKKRSVTEIIEENTQWKLNEVRKHLNEMKNSIVLLDS
                     YNSSEAFNDYNYLANKLNAQYYSNNNKKVENNPNNNPNNNNNNNPDQNHSVLNSTASS
                     SSHSTLSVKENEDKSISVNKNDNNDYNYDNKIHDSGNNSYSTLKNNTGQLTDKGPKNF
                     KSNSTSTLTTFMINTNDSFDHNTLDYNTNTTTTTMDTNDLKKKNLLMPALASILTTSV
                     SKQNKPQAVRHIHFSDRVEQCISLGYSQRDVMSMYSSNDTSSDEDESGRLQDYNHRDY
                     LSQENNDMYNSDNSSNSEYLQSNSSGNEDDNEDGGLFINARFSRRLSTSVNSTVTDNS
                     SLISSSTSRNRLKPIIKLLPATTLNYGSDEESDNSDYDYNYGNAVSHNVNTYRGYDYM
                     YDYNSVYTGDTSNFLPIDHSEVVDIPEGIDLQTSIADDSSNYNQGMISPTIEAHPILN
                     LGFNGSAELSSSNRGGFMCGPSDSEFSNSDNEQQFIENSQNQSSEDDTYTDYHANDTG
                     IKRYASVGKGGSSTSLKDLSRNGSNVSLSGATHSFITGKVLTPHLEQSNISEKPIKLV
                     QSAPPFHRQASKNNFIFDSDSSDNEADVEDIQMVDVPSVEGNSTNWNDVQPSSAIPIP
                     STLKANFGIDSKSPSPAQVEPSTVAINGSFSLRNNSIKSVISETDL"
     gene            complement(<193577..>194938)
                     /gene="TPHA0M00990"
                     /locus_tag="TPHA_0M00990"
                     /db_xref="GeneID:11532024"
     mRNA            complement(<193577..>194938)
                     /gene="TPHA0M00990"
                     /locus_tag="TPHA_0M00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688059.1"
                     /db_xref="GeneID:11532024"
     CDS             complement(193577..194938)
                     /gene="TPHA0M00990"
                     /locus_tag="TPHA_0M00990"
                     /inference="similar to DNA sequence:INSDC:YDR030C"
                     /note="similar to Saccharomyces cerevisiae RAD28
                     (YDR030C); ancestral locus Anc_3.259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688107.1"
                     /db_xref="GeneID:11532024"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8C0F8"
                     /translation="MNYSILQYKYNPNVSALNTVNKIKRNDFERLLDNEAPRVYNNIS
                     SQSSNLSNVSLNNVSCLDIDNTGKFLLAGMNDGLISAWAFNDKPGEQGELIDRKLKQI
                     KRDTASDDEEDETHSTATAAQQRGVAHPVREVHSFNVNRNRYRMYRKSNSPMNLDVDS
                     EVKSEKSHRYRIHTIKWYAKDNGLFFTGSNDCKFKMWDTASGFEPIQSVALYDSKNDR
                     KVKINQIDCNHGSGSDVVALATEDHSPRIVDLRNMNYGITFSSRDRKNEEKSEILCCK
                     FNPSVQRQWYFATGEDNGSVNIWDSRQVSRPWREVTSADTDSRRAHTRSCNDLIWNSE
                     GTELVTLGTDGKIKKWQPFGSSATLPAPQLIGSVDSNRNRHKKRTSVRLQWHTDTYLL
                     VNTDHNEVHVYETHTGKLYSKLKNPLPSRRQIDATALQANIANGIGTRIILGTSNSIV
                     EYI"
     gene            <195181..>195552
                     /gene="TPHA0M01000"
                     /locus_tag="TPHA_0M01000"
                     /db_xref="GeneID:11532025"
     mRNA            <195181..>195552
                     /gene="TPHA0M01000"
                     /locus_tag="TPHA_0M01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688060.1"
                     /db_xref="GeneID:11532025"
     CDS             195181..195552
                     /gene="TPHA0M01000"
                     /locus_tag="TPHA_0M01000"
                     /inference="similar to DNA sequence:INSDC:YDR031W"
                     /note="similar to Saccharomyces cerevisiae MIC14
                     (YDR031W); ancestral locus Anc_3.260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688108.1"
                     /db_xref="GeneID:11532025"
                     /db_xref="UniProtKB/TrEMBL:G8C0F9"
                     /translation="MSSILDELVMEDVALHCPVDFIEYHKCISKKDEGEDCSILQTKL
                     ATCIKTKVPSMQKILNNCSDKMTSYQDCIMKNRESRTINENCLGILDELRECARKQVA
                     HDPLPINEMKLRKIDNELNPK"
     gene            complement(<195709..>196305)
                     /gene="TPHA0M01010"
                     /locus_tag="TPHA_0M01010"
                     /db_xref="GeneID:11531975"
     mRNA            complement(<195709..>196305)
                     /gene="TPHA0M01010"
                     /locus_tag="TPHA_0M01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688061.1"
                     /db_xref="GeneID:11531975"
     CDS             complement(195709..196305)
                     /gene="TPHA0M01010"
                     /locus_tag="TPHA_0M01010"
                     /inference="similar to DNA sequence:INSDC:YBR052C,YDR032C"
                     /note="similar to Saccharomyces cerevisiae RFS1 (YBR052C)
                     and PST2 (YDR032C); ancestral locus Anc_3.261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688109.1"
                     /db_xref="GeneID:11531975"
                     /db_xref="GOA:G8C0G0"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8C0G0"
                     /translation="MPKVAIIIYTLYGHVAATAEAEKKGIEAAGGQADIFQVPETLTP
                     EIVKALGGAEKPNYPIASNDTLVEYDAFLFGIPTRFGNFPAQWKSFWDATGGLWAKGS
                     LHGKPAGIFVSTGTGGGNESTAMNALSTLIHHGMVFVPLGYKNSFPELTNLEEVHGGS
                     PWGAGTIAGADGSRQASKLELTVHEIQGKTFYETIQKL"
     gene            complement(<196924..>197961)
                     /gene="TPHA0M01020"
                     /locus_tag="TPHA_0M01020"
                     /db_xref="GeneID:11531976"
     mRNA            complement(<196924..>197961)
                     /gene="TPHA0M01020"
                     /locus_tag="TPHA_0M01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688062.1"
                     /db_xref="GeneID:11531976"
     CDS             complement(196924..197961)
                     /gene="TPHA0M01020"
                     /locus_tag="TPHA_0M01020"
                     /inference="similar to DNA sequence:INSDC:YBR053C"
                     /note="similar to Saccharomyces cerevisiae YBR053C;
                     ancestral locus Anc_3.262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688110.1"
                     /db_xref="GeneID:11531976"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:G8C0G1"
                     /translation="MPEIVSYKNIKPFVRLQDPKLSEGISVFNNRLLWVDIFRSEIYL
                     LNKPLDEVPQDTLSEAEKHELRTFPINHTTYDGEYPFDHTKYSEVVGVVYPYDQQNQY
                     ILFGSKFGIGKLELKTGKWTYLVTFDRCDTLTKERFMRLRSNDGGISKDGNYLYIGLM
                     DTFNEDLTDEGCILEYEFKTDKLTMLFNRYKVKIPNSIHYDKTDSNILYITDSLNFKI
                     WKYNKQTDERTELINVQKVNSEFESPEPDGSLIDYEDNLFVTAVWSTNKVQIFDLITG
                     TLQRELLLPVPRISCCCRYKHDLFITTANMNIDNDKTHDNEDTVGGSIYRIPNVFKST
                     TTASTKIYPSL"
     gene            <200895..>201851
                     /gene="TPHA0M01030"
                     /locus_tag="TPHA_0M01030"
                     /db_xref="GeneID:11531977"
     mRNA            <200895..>201851
                     /gene="TPHA0M01030"
                     /locus_tag="TPHA_0M01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688063.1"
                     /db_xref="GeneID:11531977"
     CDS             200895..201851
                     /gene="TPHA0M01030"
                     /locus_tag="TPHA_0M01030"
                     /inference="similar to DNA sequence:INSDC:YBR054W,YDR033W"
                     /note="similar to Saccharomyces cerevisiae YRO2 (YBR054W)
                     and MRH1 (YDR033W); ancestral locus Anc_3.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688111.1"
                     /db_xref="GeneID:11531977"
                     /db_xref="GOA:G8C0G2"
                     /db_xref="InterPro:IPR001425"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:G8C0G2"
                     /translation="MSQFIDLVKRGGNEAIKLNPPTGADFHITDRGSDWLFTVFCVNI
                     LFSLIYTALMFRKPVGERKLYYTAIAPTFFMGIAYFTMASNLGWTPIKAEFNHVKTST
                     QETHPGYRQVFYARYVGWFLAFPWVMVQLSIIGNTPLQHIFFNVASTEVFVVAWLIGS
                     LIHSTYKWGYWVFGIAGSFTTCVSLMTTTRNIMKKENKDNGVHQVFTILVSVVMFLWF
                     VYPVSWGLCEGGNVLQPDSEMIFYGVLDLLMLCFVPFLFILFSNYLGDRIRPKKHDDI
                     EKVLSSPSLGSPNMNSPTPVPSPAAATPKAEKKKHKKKHSKK"
     gene            complement(<202491..>204803)
                     /gene="TPHA0M01040"
                     /locus_tag="TPHA_0M01040"
                     /db_xref="GeneID:11531978"
     mRNA            complement(<202491..>204803)
                     /gene="TPHA0M01040"
                     /locus_tag="TPHA_0M01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688064.1"
                     /db_xref="GeneID:11531978"
     CDS             complement(202491..204803)
                     /gene="TPHA0M01040"
                     /locus_tag="TPHA_0M01040"
                     /inference="similar to DNA sequence:INSDC:YDR034C"
                     /note="similar to Saccharomyces cerevisiae LYS14
                     (YDR034C); ancestral locus Anc_3.264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688112.1"
                     /db_xref="GeneID:11531978"
                     /db_xref="GOA:G8C0G3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:G8C0G3"
                     /translation="MISSEDKSNNTSPGSNTSSERRDTYNSNSVLGSSNSTTPLYTSN
                     ISSISSVEKIDPSILSKSANQNANKYLDLNSTALGSVPSSNTNSPNDLSALQSAQSDS
                     ITPDPLSIVSKLSSTSVSSTSKDSHGNPIKRKYSRNGCTECKRRRMKCDETKPTCWQC
                     SRLNRHCVYVFNPKNKKRNKDLLATALSSNDNEDKFKLKKTISGTTSISSIKSESKNS
                     TNSLNYYSDLSISNSKENISNSTDKTNTNKIDETLNYNANLLIQNLNDIVNMKLNDSI
                     TLNEGLKDLESFELDIPELLNGESPSSSIPISFQMKNVITFNTELTALKLDKIHEKYL
                     KMFYYDCMDSIAPFFQDQSNPLRDIILSFAKSESYLLSAVLSVGASIYHRKTNDIEDE
                     KNYCQYLSHCLRFLDEQFQTESNVIDKIEPIILTVILLAWDCIYTMNSQWRSHLKGII
                     DLFKKINAGNSSKIINVAKSWFKIMETFASISTNFGGSLTDESDIDLIFDPYDYQYTD
                     SLKYLNIMTPVNEFNLLRGHKEDFDIVIKEVIKALNKIRDLNSKKNDNKKIVTGQLNN
                     LPMSFQRTIISSTNEGSTEDEETVSYFTIQKILVEIDRQLDYEFISKTGVIAADSPSH
                     PNNSEIKDNAIDTVVLANGHVIAVSWYDISHQTQVLSFLLIVLLKILKIPKESSSVQE
                     ICRKIMSFFKFLESDEPPTNRRTCYSNFAVLLAGLNTFDENTRTLIRKYYNLNINSGF
                     SRLSEHSMNRLEKVWAGNDQHNSNHDIVTW"
     gene            complement(<205757..>208390)
                     /gene="TPHA0M01050"
                     /locus_tag="TPHA_0M01050"
                     /db_xref="GeneID:11531852"
     mRNA            complement(<205757..>208390)
                     /gene="TPHA0M01050"
                     /locus_tag="TPHA_0M01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688065.1"
                     /db_xref="GeneID:11531852"
     CDS             complement(205757..208390)
                     /gene="TPHA0M01050"
                     /locus_tag="TPHA_0M01050"
                     /inference="similar to DNA sequence:INSDC:YBR055C"
                     /note="similar to Saccharomyces cerevisiae PRP6 (YBR055C);
                     ancestral locus Anc_3.265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688113.1"
                     /db_xref="GeneID:11531852"
                     /db_xref="GOA:G8C0G4"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR027108"
                     /db_xref="UniProtKB/TrEMBL:G8C0G4"
                     /translation="MERPAFLDKKPPPGYVPGIGRGATGFSTRGSKKGNESNVIPKRF
                     NNNSIELDPADLEAENIFTNIDKKLANRNRKKASKKDIDEATNFIDLKTNLSKVSNTE
                     WLHLPEATDITRRNKRQRLEEQMNRKFFAAPDTLLSSAKGSNSHALDLSKLTEEREKL
                     LGTIIDTAVDIKKNDSVSETTDYLDALDDIHEKDLSDNYNNESSKEAKEKMRAILKSY
                     RKSDPRNPDSWIASARLEKNCRNIKLAQKLLNEGCRNCPKSEEIWLENIKLNENNNAL
                     CRTIVTRGIQYNLQSLNLWLKAIDLESDNNNKQILLRKAITKLPKKEELWELAADYET
                     DMNEKIKILLKAVEFVPYSINLWIKLINSQPYEGAKKSLISAKNMLPKEYKLCVISLS
                     LEEKFNDNCTLEELIKIADNCFEKLFLNGVKITFEKWLEEAHILEKQYKFLKSAEAII
                     MKSLSVCNSEEPLSNIIAKFRKLEDSYCKVIGFKYVLSIDPSQYNVLTLMKRTCETLN
                     KLEIFYSTFETILFSNPFDKESNIIRKHPILSLIYAKEIWRYNYDPEKALMILNKSIE
                     VVPENVDMWTAKLKILCELGNFNEVESVFEKSINILKSYKNNDIVKIYYKHINYLRFR
                     QLNMEALNLLEKEYIVLFPKDVKLKLQRSQIYRDLGQYEEACKQLKLDIESLPFEPKL
                     SIALSEINESYLNKVTLARSNLDLSIVKNPSSSELYLGKINLEKRSGNLKQVEYILSQ
                     SFSKFPNDVDLWVEKLLLVNDKKSITKKGLFQDALKNTKNNFKILLQIGISFFNDLQY
                     TTSLKWIERSIKSNPKYGDSWIWLSRCYIKLKKPLDTCLEQVNKNEPKYGKEWIKISK
                     GISTQYLTDVDKLKECLKQKN"
     gene            208847..208929
                     /gene="TPHA0Mtrna2L"
                     /locus_tag="TPHA_0Mtrna2L"
                     /db_xref="GeneID:11531853"
     tRNA            208847..208929
                     /gene="TPHA0Mtrna2L"
                     /locus_tag="TPHA_0Mtrna2L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:11531853"
     gene            <210066..>211481
                     /gene="TPHA0M01060"
                     /locus_tag="TPHA_0M01060"
                     /db_xref="GeneID:11532009"
     mRNA            <210066..>211481
                     /gene="TPHA0M01060"
                     /locus_tag="TPHA_0M01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688066.1"
                     /db_xref="GeneID:11532009"
     CDS             210066..211481
                     /gene="TPHA0M01060"
                     /locus_tag="TPHA_0M01060"
                     /inference="similar to DNA sequence:INSDC:YBR056W"
                     /note="similar to Saccharomyces cerevisiae YBR056W;
                     ancestral locus Anc_3.266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688114.1"
                     /db_xref="GeneID:11532009"
                     /db_xref="GOA:G8C0G5"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:G8C0G5"
                     /translation="MSNFNQPPNIDQIFKYRTNYGVNLGSLFVLESWIYGDLFDKGGA
                     SELDAIRTQVKSSSVAATAAKLAKHYNDYISSIAWDYLANKAGTTALRVPIGYWHVNN
                     GNFTKDTVFSEISAVYQAAKPWDILKRLIDKANSYQIGILIDLHGLPGGANSAAHSGS
                     INQPPTFFDNNKFKSLVIDNILPFIVKDVCINKQNVIGLQIVNEADFNEKAVNQKDYY
                     IRAVSKIRNLQPTLPVIISDGWWPDQFSNWVKDNNLVSNVVIDTHIYRCYSDSDKSKN
                     ANQIISELKDSINIPADGADFVVGEYSCVLDEQTWQKTSGDRGTIIKNFGLEQNRQFK
                     IKSSWGWFFWTLQFKYGDGGEWGYIPQCEKGNIFLRVSNQNTIPVDQNRIESIIKDHI
                     NYWKDKGGDKMEHWRYIDGIYKAAYDIQAFQSFKNSSIGRWVSWTKLRRDHYVALKGN
                     SAYMWEYDQGYARGLQEFNKR"
     gene            213203..213274
                     /gene="TPHA0Mtrna1Q"
                     /locus_tag="TPHA_0Mtrna1Q"
                     /db_xref="GeneID:11531854"
     tRNA            213203..213274
                     /gene="TPHA0Mtrna1Q"
                     /locus_tag="TPHA_0Mtrna1Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:11531854"
     gene            <213990..>214220
                     /gene="TPHA0M01065"
                     /locus_tag="TPHA_0M01065"
                     /db_xref="GeneID:11531947"
     mRNA            <213990..>214220
                     /gene="TPHA0M01065"
                     /locus_tag="TPHA_0M01065"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688067.1"
                     /db_xref="GeneID:11531947"
     CDS             213990..214220
                     /gene="TPHA0M01065"
                     /locus_tag="TPHA_0M01065"
                     /inference="similar to DNA
                     sequence:INSDC:YDR034W-B,YBR056W-A"
                     /note="similar to Saccharomyces cerevisiae YDR034W-B and
                     YBR056W-A; ancestral locus Anc_3.267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688115.1"
                     /db_xref="GeneID:11531947"
                     /db_xref="UniProtKB/TrEMBL:G8C0G6"
                     /translation="MGHHHHPPQPAYYQQQQPVYQLQQPQPIYIQQNPPSNNDNCCGA
                     CCGGCCGALWSCFTVISQVLCCCCILEACCVF"
     gene            <215321..>216439
                     /gene="TPHA0M01070"
                     /locus_tag="TPHA_0M01070"
                     /db_xref="GeneID:11531855"
     mRNA            <215321..>216439
                     /gene="TPHA0M01070"
                     /locus_tag="TPHA_0M01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688068.1"
                     /db_xref="GeneID:11531855"
     CDS             215321..216439
                     /gene="TPHA0M01070"
                     /locus_tag="TPHA_0M01070"
                     /inference="similar to DNA sequence:INSDC:YDR035W"
                     /note="similar to Saccharomyces cerevisiae ARO3 (YDR035W);
                     ancestral locus Anc_3.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688116.1"
                     /db_xref="GeneID:11531855"
                     /db_xref="GOA:G8C0G7"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8C0G7"
                     /translation="MFIKNDNAGDRKCLEDWRIKGYDPLTPPDLLQHEYPISEKGKNI
                     IVNGRESACDIINGKDDRLIIVIGPCSIHDPKAALEYCDRLAKLSDKLSGDLLIIMRA
                     YLEKPRTTVGWKGLINDPDIDNSFQINKGLRISREMFTKLVEKLPIASEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAIDAMCAAAHEHYFL
                     SVTKPGVTAIVGTEGNEDTFVILRGGKHGTNFDPENVNIAKGQLEKAKLVGENNEKRR
                     IMIDCSHGNSNKDYKNQPKVAQSIYDQLTAGENSLCGVMIESNLVGGRQDVPKEGGRD
                     KLIYGCSITDACISWETTEDVLELLAKGVRNRREALKK"
     gene            complement(<216605..>217441)
                     /gene="TPHA0M01080"
                     /locus_tag="TPHA_0M01080"
                     /db_xref="GeneID:11531940"
     mRNA            complement(<216605..>217441)
                     /gene="TPHA0M01080"
                     /locus_tag="TPHA_0M01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688069.1"
                     /db_xref="GeneID:11531940"
     CDS             complement(216605..217441)
                     /gene="TPHA0M01080"
                     /locus_tag="TPHA_0M01080"
                     /inference="similar to DNA sequence:INSDC:YBR057C"
                     /note="similar to Saccharomyces cerevisiae MUM2 (YBR057C);
                     ancestral locus Anc_3.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688117.1"
                     /db_xref="GeneID:11531940"
                     /db_xref="UniProtKB/TrEMBL:G8C0G8"
                     /translation="MEYNSNGKDFYPNEVKNSQICNNKQNNSINMGEIYMNNLGIFNQ
                     NTMLSGENIPSNFKPTSTNQVQGQVWSEYNNFNEQSYAYKGSNNIRTNGTNNQQINEN
                     NKLFNNNLNEQNARKILREKDKKIQELQDELNKYKTSITTGSGNKVRNKKKQKEDNQN
                     NTKQLKSKNYIEIFRALSSALNKKEIELSKSKGDLRNIMTALALDPQNNVAKYSNIDL
                     ESISQGIVTQIEQLVGENQTMSNLISYENSKKIDIELELIKKENKALQKQIDKLKTNQ
                     KY"
     gene            complement(<217833..>220175)
                     /gene="TPHA0M01090"
                     /locus_tag="TPHA_0M01090"
                     /db_xref="GeneID:11531941"
     mRNA            complement(<217833..>220175)
                     /gene="TPHA0M01090"
                     /locus_tag="TPHA_0M01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688070.1"
                     /db_xref="GeneID:11531941"
     CDS             complement(217833..220175)
                     /gene="TPHA0M01090"
                     /locus_tag="TPHA_0M01090"
                     /inference="similar to DNA sequence:INSDC:YBR058C"
                     /note="similar to Saccharomyces cerevisiae UBP14
                     (YBR058C); ancestral locus Anc_3.270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688118.1"
                     /db_xref="GeneID:11531941"
                     /db_xref="GOA:G8C0G9"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR016652"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8C0G9"
                     /translation="MTDKLLSTVTVPNIIGKSECIYCFESPFNKTESQSINSVEHSLN
                     TCISCFQAVCRRHLGLHMNVTNHLCDSPHLSYLEIAKVIKPDSEEEQTLKETGSNKKL
                     KLQVIDKSEDETYNTLWALKAYNSINDESANILSTDKDTQVSEESKNIIDKIINAKAQ
                     ELVDQTTSWELEVKSCSHSRALSDQINTQSNNDSNLNQCSSCDLTENLWLCLHCGNVG
                     CGREQVGIDGNSHALKHFETNEDHPIAIKLGSLSSSSNDVYCYSCNDEVTFDNKEDLS
                     KILLNYGVDLQNKQANEKTLVELQVEQNMNWDFKMMDSQGNDLVKLNSNKDLGCGLIN
                     LGNSCYMNSVIKVLLNGGIPGWSLDSIGSSFPMDVVYPSNNLLCQLIKLNIAMKIEPE
                     RYPDGIKPTSFKKCITRGNAEFSSGKQQDSMEFFTFLTNQLDKKIFKNINKENNPNNL
                     FKFSLEERMQCNNCKAVKYITQTEEHLQLPLKENQKAQTLTENIENYFNGEEVDFTCP
                     HCTTSTSVLKTPAFKSYPSTLIINPIRIKLENLGLIKIDNELNMPGLGNNDYLDLSPY
                     KSKGFNPDSEVLMKDEEESNKFVPNQTSVAQLNEMGFTLNAVTRALFATGNQDTESAM
                     NWLFQHMEDFDLNEPFTPPVKSKSNDCDPEALNNMIAMGLYPKLCKKALLLNNHDVNK
                     SVEWVFGNMDDDGELDFNEETTVPDEIIGFDQPASYQLTAVVCHKGNSVHSGHYVAFI
                     KKNIDNKSNWVLFNDEKIVLAQDTDELKKNGYIYVYTRCS"
     gene            complement(<220631..>222181)
                     /gene="TPHA0M01100"
                     /locus_tag="TPHA_0M01100"
                     /db_xref="GeneID:11531942"
     mRNA            complement(<220631..>222181)
                     /gene="TPHA0M01100"
                     /locus_tag="TPHA_0M01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688071.1"
                     /db_xref="GeneID:11531942"
     CDS             complement(220631..222181)
                     /gene="TPHA0M01100"
                     /locus_tag="TPHA_0M01100"
                     /inference="similar to DNA sequence:INSDC:YDR036C"
                     /note="similar to Saccharomyces cerevisiae EHD3 (YDR036C);
                     ancestral locus Anc_3.271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688119.1"
                     /db_xref="GeneID:11531942"
                     /db_xref="GOA:G8C0H0"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR018376"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:G8C0H0"
                     /translation="MLRSVKQKSSLLKNVSTANYRRMINNKPLANIENVMNVPVHFTV
                     KDTARIITLNRPNKLNALNTEMSDSIFNTLNEYAKSSATKLIIFNSSNQPRSFCAGGD
                     VATVAIDNLNQKIKDSIKFFESEYSLNFQIATYDKPIVAIMNGITMGGGVGLAIHAPF
                     RISTENTKWAMPEMDIGFFPDVGTTFALPRILNISNEKLQMAAYLSLTGEVINGEDAY
                     LMGLSSHYISHENLNSLETRLGELLLNEKTGTDSNKENIYKKVNIALEEFSSELPKDY
                     KFKYNNHQLDVIEKVFEIDSKTSIEKILKNLDDIKNPDEIDFAQEIKSKLLTKSIPSL
                     QVAIRLLQHNSKDNISSALKRDLFTAANFCYASKNPDSPIEFTQSVKHKLIEKNKNAY
                     NWKQTAPLDPLQVNSLISPRPSLLTALKRNTENITWNNYPYHSKFQLPSESIINSYIK
                     KVNETNRATDGDISRSITKKEVVNYFTNYSDDFKGKNAVDKIASLICEKNFNVDEFNG
                     LISKSKDL"
     gene            complement(<222861..>223127)
                     /gene="TPHA0M01110"
                     /locus_tag="TPHA_0M01110"
                     /db_xref="GeneID:11531943"
     mRNA            complement(<222861..>223127)
                     /gene="TPHA0M01110"
                     /locus_tag="TPHA_0M01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688072.1"
                     /db_xref="GeneID:11531943"
     CDS             complement(222861..223127)
                     /gene="TPHA0M01110"
                     /locus_tag="TPHA_0M01110"
                     /inference="similar to DNA sequence:INSDC:YBR058C-A"
                     /note="similar to Saccharomyces cerevisiae TSC3
                     (YBR058C-A); ancestral locus Anc_3.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688120.1"
                     /db_xref="GeneID:11531943"
                     /db_xref="UniProtKB/TrEMBL:G8C0H1"
                     /translation="MSQDTKNTSSMKDKTTPASSMNYVETIKERKVHEGIHETWQSRL
                     EEFSESLYWAYYIHLPYYLMTSFDSFCLHVFFLVDIELKSIWYL"
     gene            complement(<223548..>225914)
                     /gene="TPHA0M01120"
                     /locus_tag="TPHA_0M01120"
                     /db_xref="GeneID:11531860"
     mRNA            complement(<223548..>225914)
                     /gene="TPHA0M01120"
                     /locus_tag="TPHA_0M01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688073.1"
                     /db_xref="GeneID:11531860"
     CDS             complement(223548..225914)
                     /gene="TPHA0M01120"
                     /locus_tag="TPHA_0M01120"
                     /inference="similar to DNA sequence:INSDC:YBR059C"
                     /note="similar to Saccharomyces cerevisiae AKL1 (YBR059C);
                     ancestral locus Anc_3.273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688121.1"
                     /db_xref="GeneID:11531860"
                     /db_xref="GOA:G8C0H2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8C0H2"
                     /translation="MDSKNETVLPQAVVSSSTEEGSNYLNVKKEGDDSNQNLLITNTN
                     QSVIDKNAYKQYESVTIEETQQVQQQLEQRVPQQQQVPQQQQVPQQQPIFPIDTYVPG
                     HIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLKRVLVT
                     DDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKSLLD
                     YMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLCD
                     FGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIF
                     LYKLLFYITPFERTGQFAILHSKYEFPQHSYSMKLINLIIIMLAENPNLRPNIYQVLA
                     YICKIINIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQMYQVQIRSMQNRGILTLKD
                     EALMNSLFIQSFEVGPKIPTNVGAYGYNENPSMISNQTNGISNSANMSLTEKFIHEFP
                     EVPGIDSLNGNIVNNGVGSQISTTVDSNSIPGLNNSTGVNHNISIANMNENGKSPSMD
                     DASAFFEAVNGNNSTTVPDPKDMNIIDSVVDLSHKQHLSSNPFPALSSSPTLKTNPID
                     SLSQEKFRQQQQFHLHSQKHILSGGSNISFTSFNSTSVQYGADNRNSTVISIPSTTVN
                     NANLSEVIEPEVNFVSSPTDSLSMGNTIYYSNPSTKSSIAIGQAIKDELKNTNEVETP
                     IDEVAEQNTIEDNEPQPLKKDFSKLILTDEIEFGNDQSESKANTEAPQ"
     gene            complement(<226403..>228328)
                     /gene="TPHA0M01130"
                     /locus_tag="TPHA_0M01130"
                     /db_xref="GeneID:11531861"
     mRNA            complement(<226403..>228328)
                     /gene="TPHA0M01130"
                     /locus_tag="TPHA_0M01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688074.1"
                     /db_xref="GeneID:11531861"
     CDS             complement(226403..228328)
                     /gene="TPHA0M01130"
                     /locus_tag="TPHA_0M01130"
                     /inference="similar to DNA sequence:INSDC:YBR060C"
                     /note="similar to Saccharomyces cerevisiae ORC2 (YBR060C);
                     ancestral locus Anc_3.274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688122.1"
                     /db_xref="GeneID:11531861"
                     /db_xref="GOA:G8C0H3"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="UniProtKB/TrEMBL:G8C0H3"
                     /translation="MSSPDSKNDIVEHVDILSSPSKLTYNVNSRPFIVTKKSNNRRQA
                     TRKRMSIEQIISPQKKSTRIDLEPVNLKSNEHEISHDDKSSSIFENEIKINEMLQSNG
                     SKDTSDDNISTASGRRTRRKKVLSYNYDEGDDNIHNDKSSGDDESFQLNESEKVVEDE
                     KEESSYVDEINDLDSSTINIKDENEALGVDLKQEPELKQEIRNNKKYSYISSLKKEIL
                     KNIGDDKKKMKGDLKPLQLTKNFKNTPLPDSNQYKPPMEKIIGSFFDTFEGYFDQRRS
                     VRSRDKSKNTMANSKTVTREEFVAITSAFNNSLLKSSRNYLFKKQRNLYPQYWFEVSQ
                     GFSLLFYGIGSKHSYLEDFVFNYLSPELAYAAIANNPHKKITTGIPCIIINGYNPICN
                     YRDVSKDITEALYPDELNRNESKYWDNHVLLKLQKMVEYYKTQPQDIKLIILVHNLDG
                     PSTRKDTFQVMLSTLARIRQVALVASTDNINAPILWDNMKAQDFNFIYHDVTNFEPRQ
                     IESSFQDVMKLGSSDTKNTLEGAKYVLQSLTKNSKKMYKLLLETQLTNVELNNFSKSA
                     KQGLAAIGVEFRTFLSECSNQFIAYNEVSLRSMLTEFIEHKMATITKDTRGAEKIWIP
                     YSYVEIKKLLKEVLTDI"
     gene            complement(<228715..>229656)
                     /gene="TPHA0M01140"
                     /locus_tag="TPHA_0M01140"
                     /db_xref="GeneID:11531862"
     mRNA            complement(<228715..>229656)
                     /gene="TPHA0M01140"
                     /locus_tag="TPHA_0M01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688075.1"
                     /db_xref="GeneID:11531862"
     CDS             complement(228715..229656)
                     /gene="TPHA0M01140"
                     /locus_tag="TPHA_0M01140"
                     /inference="similar to DNA sequence:INSDC:YBR061C"
                     /note="similar to Saccharomyces cerevisiae TRM7 (YBR061C);
                     ancestral locus Anc_3.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688123.1"
                     /db_xref="GeneID:11531862"
                     /db_xref="GOA:G8C0H4"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8C0H4"
                     /translation="MGKRSKDKRDLYYRKAKEQGYRARSAFKLLQLNEQYHFLDDPNL
                     KRVVDLCAAPGSWSQVLSRKLFVDNKSEDDSGKKIIAVDLQPMSPIDNVTCLQADITH
                     PKTFNKILELFGNEKAQFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTTCILEKGGV
                     FIAKIFRGRDIDLLYSQLGFLFKKIICAKPRSSRGTSLEAFIVCLDYCPPKDWVPKLD
                     LNKSVTEFFEGCNIKEIHNNSIITKWYEEDRDIVDFMTCGSLDAYDSDATYHIDVKDE
                     LSNDLLNVSLNPVQMPTNPPYKRALELKRKGKLTRSI"
     gene            <230135..>230863
                     /gene="TPHA0M01150"
                     /locus_tag="TPHA_0M01150"
                     /db_xref="GeneID:11531863"
     mRNA            <230135..>230863
                     /gene="TPHA0M01150"
                     /locus_tag="TPHA_0M01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688076.1"
                     /db_xref="GeneID:11531863"
     CDS             230135..230863
                     /gene="TPHA0M01150"
                     /locus_tag="TPHA_0M01150"
                     /inference="similar to DNA sequence:INSDC:YDR041W"
                     /note="similar to Saccharomyces cerevisiae RSM10
                     (YDR041W); ancestral locus Anc_3.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688124.1"
                     /db_xref="GeneID:11531863"
                     /db_xref="GOA:G8C0H5"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:G8C0H5"
                     /translation="MENYMKQMFLRRANVLALRNVRFQSSIPELTAKDLPASTVIDSV
                     TKSSSIAPEVNSEKTYTKYSNSVTENAKQHILPVNVEAVYHLPLRNEVKYGDLIADIQ
                     LRSYDNENLDFFSDFILRVGYYLGMPMTGPKPLPTRRERWTVIRSPFAQAKSKENFER
                     HTHKRLIRVWDTETEVLNIWLSYINKHAITGVGIKCNVFKRAGLDLEKDEKVESSIFS
                     SLEKQPGKKYKVWMKLLVTRFWNY"
     gene            complement(231178..231249)
                     /gene="TPHA0Mtrna1E"
                     /locus_tag="TPHA_0Mtrna1E"
                     /db_xref="GeneID:11531864"
     tRNA            complement(231178..231249)
                     /gene="TPHA0Mtrna1E"
                     /locus_tag="TPHA_0Mtrna1E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:11531864"
     gene            complement(<233141..>234151)
                     /gene="TPHA0M01160"
                     /locus_tag="TPHA_0M01160"
                     /db_xref="GeneID:11531945"
     mRNA            complement(<233141..>234151)
                     /gene="TPHA0M01160"
                     /locus_tag="TPHA_0M01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688077.1"
                     /db_xref="GeneID:11531945"
     CDS             complement(233141..234151)
                     /gene="TPHA0M01160"
                     /locus_tag="TPHA_0M01160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688125.1"
                     /db_xref="GeneID:11531945"
                     /db_xref="GOA:G8C0H6"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C0H6"
                     /translation="MAVLVTGASGFIALHVINLLLSQNYKVIGTVRSQAKADKVIRQF
                     NNPNLSFEIISDITKLDAFDETLKKHGKEIDNVIHMASPLPEEGNTDFENHYLLPAVN
                     GTKSILSAIKKFAPRSVKHVVMTSSIAAIINVNDFSVVTTEKDWNPITWEQAKTSSFM
                     CYLGSKTYSEKAAWDFLKENKDEVDFKFTAVNPAMVFGRQMFDEDVKDTLNVSCEFVN
                     KILCLPPTEKLSQDYAMSYVHVDDVALAHVKAIQEDKFDGKRLLLSAGTYSDQLIANS
                     INKQFPQIKGTIPPAVEDCKQLDIRYDSAVTQKLLGIEWKSFDASVYDIVHQALKRRG
                     KL"
     gene            complement(<235264..>236361)
                     /gene="TPHA0M01170"
                     /locus_tag="TPHA_0M01170"
                     /db_xref="GeneID:11531865"
     mRNA            complement(<235264..>236361)
                     /gene="TPHA0M01170"
                     /locus_tag="TPHA_0M01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688078.1"
                     /db_xref="GeneID:11531865"
     CDS             complement(235264..236361)
                     /gene="TPHA0M01170"
                     /locus_tag="TPHA_0M01170"
                     /inference="similar to DNA sequence:INSDC:YBR065C"
                     /note="similar to Saccharomyces cerevisiae ECM2 (YBR065C);
                     ancestral locus Anc_3.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688126.1"
                     /db_xref="GeneID:11531865"
                     /db_xref="UniProtKB/TrEMBL:G8C0H7"
                     /translation="MSSDEREFNICDSCFGRSSNIRMTKIPNGAECKICTFPFDVFQF
                     KSTNRSANVKKSIICFKCSNQRNVCQCCMLDLKWHIPIKVRDKIVSIINNDKSMQTEE
                     AKNDMMKRFLALKDVKLGAAKITDDDVKLEKLMSQLGEYIRKEKALQNQRADDADLKL
                     DNHGRSNAKEFENINIEHVLKKLPLQASFQLKEDVNETERSYFLYNIDQSLPEWKITN
                     KISEILKISDWQEKNSNSVIIKHKSRCGGVRLKNAILASNFVKSIIKDDLILKTKEGL
                     FRGILKIDGHHVFVIPWSMGFSNGSFGNSLKENIKLNIILDKLIRLENNRNDLSTEST
                     TSSGKARIQNKGKIEKKDKNKKSKRITNIQL"
     gene            complement(<237368..>238420)
                     /gene="TPHA0M01180"
                     /locus_tag="TPHA_0M01180"
                     /db_xref="GeneID:11531866"
     mRNA            complement(<237368..>238420)
                     /gene="TPHA0M01180"
                     /locus_tag="TPHA_0M01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688079.1"
                     /db_xref="GeneID:11531866"
     CDS             complement(237368..238420)
                     /gene="TPHA0M01180"
                     /locus_tag="TPHA_0M01180"
                     /inference="similar to DNA sequence:INSDC:YBR066C,YDR043C"
                     /note="similar to Saccharomyces cerevisiae NRG2 (YBR066C)
                     and NRG1 (YDR043C); ancestral locus Anc_3.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688127.1"
                     /db_xref="GeneID:11531866"
                     /db_xref="GOA:G8C0H8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8C0H8"
                     /translation="MNIKMYAQTQYFSPPVSSNLNSSDQIRKYNTLLPQFHNTQSIEH
                     NLKLKLNKGSYDNAVPSSPRSNVGSITYQSSLPSINELNPNATQNYQLLSSNNNNNQI
                     PHLTHPPYIPISQQQYTNQPIHTTYTNDITNTNNSIMYSKQSFVTGNPYIKTDYTSNT
                     ALTPPLHSMRNTNSYRSYTYNNMIARPITPPMTMSASPSVNTSVTQILQVPNIQTQAI
                     FSSTANSSIPFESNNQPSFYGVEIQEILKKNIKEMTKEERLLTIERRRKHQCKICMKK
                     FTTAGHLTRHHKIHTGEKNHKCPHRGCNLWFSRNDNSLQHYQTHLKRKTKKRRSERKP
                     TKTTKKVISNKNEKIK"
     gene            complement(<243586..>243918)
                     /gene="TPHA0M01190"
                     /locus_tag="TPHA_0M01190"
                     /db_xref="GeneID:11531867"
     mRNA            complement(<243586..>243918)
                     /gene="TPHA0M01190"
                     /locus_tag="TPHA_0M01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688080.1"
                     /db_xref="GeneID:11531867"
     CDS             complement(243586..243918)
                     /gene="TPHA0M01190"
                     /locus_tag="TPHA_0M01190"
                     /inference="similar to DNA sequence:INSDC:YDR045C"
                     /note="similar to Saccharomyces cerevisiae RPC11
                     (YDR045C); ancestral locus Anc_3.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688128.1"
                     /db_xref="GeneID:11531867"
                     /db_xref="GOA:G8C0H9"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:G8C0H9"
                     /translation="MLSFCPLCNNMLLISNADSSVHKLTCHSCPYEFPIENIEVYDRK
                     KLERKEIDDVLGGGWDNVDQTKVQCPNYDKCGGESAYFFQLQIRSADEPMTTFYKCVN
                     CGKRWKEN"
     gene            complement(<244556..>246379)
                     /gene="TPHA0M01200"
                     /locus_tag="TPHA_0M01200"
                     /db_xref="GeneID:11531900"
     mRNA            complement(<244556..>246379)
                     /gene="TPHA0M01200"
                     /locus_tag="TPHA_0M01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688081.1"
                     /db_xref="GeneID:11531900"
     CDS             complement(244556..246379)
                     /gene="TPHA0M01200"
                     /locus_tag="TPHA_0M01200"
                     /inference="similar to DNA sequence:INSDC:YBR068C,YDR046C"
                     /note="similar to Saccharomyces cerevisiae BAP2 (YBR068C)
                     and BAP3 (YDR046C); ancestral locus Anc_3.284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688129.1"
                     /db_xref="GeneID:11531900"
                     /db_xref="GOA:G8C0I0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:G8C0I0"
                     /translation="MSDFVGKHEKSPDFSVINNSSLDYANNLASTNDDDISIASSQNR
                     SLSHRKNTSYYRNFIDSFKRAEHGNLNEKSADLEDGTASIQSKSYMKKSLKARHVIMM
                     SLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNF
                     NTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWTDLNGDIFVVIFYVFL
                     LLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSF
                     AEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIY
                     LLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVILISVVSV
                     ANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQ
                     VFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIF
                     GVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKEWTILTDLS
                     KIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYNFWC"
     gene            <248914..>249660
                     /gene="TPHA0M01210"
                     /locus_tag="TPHA_0M01210"
                     /db_xref="GeneID:11531901"
     mRNA            <248914..>249660
                     /gene="TPHA0M01210"
                     /locus_tag="TPHA_0M01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688082.1"
                     /db_xref="GeneID:11531901"
     CDS             248914..249660
                     /gene="TPHA0M01210"
                     /locus_tag="TPHA_0M01210"
                     /inference="similar to DNA sequence:INSDC:YDR050C"
                     /note="similar to Saccharomyces cerevisiae TPI1 (YDR050C);
                     ancestral locus Anc_3.288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688130.1"
                     /db_xref="GeneID:11531901"
                     /db_xref="GOA:G8C0I1"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020861"
                     /db_xref="InterPro:IPR022896"
                     /db_xref="UniProtKB/TrEMBL:G8C0I1"
                     /translation="MARNFFVGGNFKLNGSKQSIKEIVERLNNASMPENVEVVICPPA
                     AYLDYTSSLVTKKQVSVGGQNTYFKAAGAFTGENSVEQLKDLNVKWVILGHSERRSYF
                     HEDDKIVAEKTKFALDNGVSVILCIGETLEEKKAGITLKVVERQLDAVIAEVKDWTNV
                     VIAYEPVWAIGSGLAATPEDAQDIHHSIRKYLASKLGDKVADETRILYGGSANGSNAV
                     TFKDKADVDGFLVGGASLKPEFVDIINSRN"
     gene            <250797..>251537
                     /gene="TPHA0M01220"
                     /locus_tag="TPHA_0M01220"
                     /db_xref="GeneID:11531902"
     mRNA            <250797..>251537
                     /gene="TPHA0M01220"
                     /locus_tag="TPHA_0M01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688083.1"
                     /db_xref="GeneID:11531902"
     CDS             250797..251537
                     /gene="TPHA0M01220"
                     /locus_tag="TPHA_0M01220"
                     /inference="similar to DNA sequence:INSDC:YBR071W"
                     /note="similar to Saccharomyces cerevisiae YBR071W;
                     ancestral locus Anc_3.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688131.1"
                     /db_xref="GeneID:11531902"
                     /db_xref="UniProtKB/TrEMBL:G8C0I2"
                     /translation="MLRFSKKSHSNLKDNKKRHSSFFDLNSFDTNNVENGNKNSKNES
                     KKGSKNEKAVFVNNLQQYSKQDSSVQQKNMQHERETANSILREPKEKSNSKTKRQSTI
                     LDENIVKDYHLAIKHFNMEDEKRTSLEYKISNEKHSKSGSVDSNFSSATMDSNMSSLF
                     SSSATVSLRDFLYEEFETNKFLSKTHQTYNNDNCNSVTGKKAFLEIPDDRHKSAKWRK
                     ITDKEKNKIHSESNIDHFDYHRRTELEF"
     gene            <252072..>255026
                     /gene="TPHA0M01230"
                     /locus_tag="TPHA_0M01230"
                     /db_xref="GeneID:11531903"
     mRNA            <252072..>255026
                     /gene="TPHA0M01230"
                     /locus_tag="TPHA_0M01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688084.1"
                     /db_xref="GeneID:11531903"
     CDS             252072..255026
                     /gene="TPHA0M01230"
                     /locus_tag="TPHA_0M01230"
                     /inference="similar to DNA sequence:INSDC:YBR073W"
                     /note="similar to Saccharomyces cerevisiae RDH54
                     (YBR073W); ancestral locus Anc_3.292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688132.1"
                     /db_xref="GeneID:11531903"
                     /db_xref="GOA:G8C0I3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0I3"
                     /translation="MNNPKFQNKPFKPPRRINTLNHDTTKINVTSDSEINKNGIFKRK
                     SANDTIDTTFQEKKIKVHKIDDRFPLSRDISSIFATVYRKKTLKKNKVWTNDGFCILK
                     NDNRLNFYDDAGNFISGLDLKLTTDSLFDELFKIGSLELQIDYKIEDPEETKKTVSII
                     FGRKADNTINSSSLIKNNSTVESHNDGNSNYVNTNQSKNLLNATTSTTTSDINRKLIA
                     SKEIIKSFQTKINNTSKSHLVPLSQLFAKKTTASFRQILIRSESHTPLTTPSSNISSD
                     NQKIFLPVFDLNKISDPIVMNRSKDALVDVIVDPILGKLLRPHQREGVKFMYDCMMGL
                     QRPSTTIVKNTDDDGDSTSKSLTLEYDSDIKGCLLADEMGLGKTLMTITLIWTLLKQT
                     AFPTNVAVSQSGVPLHGAYKKFIIVCPVTLIGNWKREFGKWLGLSAIGILTLSPKNNS
                     EKDKMDVRNFLKVQRIYQVLIIGYEKILSVSDDLFENKDKIDMIICDEGHRLKNGSSK
                     ILNALKRLDVENKVLLSGTPIQNDLNEFFTIIDFINPGILGSFNHFKKKFITPITRAR
                     DVNNRYNEDILSIGSEKSKEMIQITKRFVLRRTNSLLTKYLPPKNDVILFCKPTDAQL
                     NAFSDIFSVSHFDINNLSFTSSLGLITLFKKICNTPMLIKSDSYYQSNLRNSSTTLVY
                     ENKLDSGKLKVFMSLLDHIRNATDEKVVIVSNYTQTLDILENLMRSQNITTCRLDGST
                     PNKQRDSIVTNFNRNANIFGFLLSSKSGGAGLNLIGASRLILFDNDWNPSIDLQAMSR
                     IHRDGQKKTCHIYRLITTGCIDEKIFQRQLMKHSLSQQFLNDQDDNSGSHKNDDLFNK
                     EDLKDLFTIVSDSKCNTHDLICDCDGSTNEDYSISTDDEFEDSKETSISSLTSNGWTS
                     ALNAQKLLEEREKSEKLEKTKIIKKCLAGYRHIDLTIQNSIEDSILEESLPKNLDCVT
                     FAFFKPGKAKSL"
     gene            complement(<255202..>256314)
                     /gene="TPHA0M01240"
                     /locus_tag="TPHA_0M01240"
                     /db_xref="GeneID:11531932"
     mRNA            complement(<255202..>256314)
                     /gene="TPHA0M01240"
                     /locus_tag="TPHA_0M01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688085.1"
                     /db_xref="GeneID:11531932"
     CDS             complement(255202..256314)
                     /gene="TPHA0M01240"
                     /locus_tag="TPHA_0M01240"
                     /inference="similar to DNA sequence:INSDC:YDR047W"
                     /note="similar to Saccharomyces cerevisiae HEM12
                     (YDR047W); ancestral locus Anc_3.294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688133.1"
                     /db_xref="GeneID:11531932"
                     /db_xref="GOA:G8C0I4"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="UniProtKB/TrEMBL:G8C0I4"
                     /translation="MSAAQSIDRSQFAPLKNDLILRAARGEVVERPPCWIMRQAGRYL
                     PEYHDVKGKRDFFETCRDAEVAAEITIQPVRRYKGLIDAAIIFSDILVIPQAMGMKVE
                     LIDGKGPHFPEPLRTPSDLQKVLDYEVDVLKELDWAFKAITLTRKNLNGEVPLFGFCG
                     GPWTLLVYMSEGGGSRLFRYAKEWINLYPELSHKLLQKITDVAVEFLAQQVVAGAQIL
                     QVFESWGGELSSVDFDEFSLPYLKNIVERVPKRLIELGITEHVPMTVFSKGSWYALDK
                     LCNSGFDTVSLDWSWDPKEAVKINNGRVVLQGNLDPGVIYGSDEIITKKVQYMIENFN
                     GSKKNYIINFGHGTHPFMDTEKIRFFLKECHRLGSN"
     gene            <257318..>258676
                     /gene="TPHA0M01250"
                     /locus_tag="TPHA_0M01250"
                     /db_xref="GeneID:11531933"
     mRNA            <257318..>258676
                     /gene="TPHA0M01250"
                     /locus_tag="TPHA_0M01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688086.1"
                     /db_xref="GeneID:11531933"
     CDS             257318..258676
                     /gene="TPHA0M01250"
                     /locus_tag="TPHA_0M01250"
                     /inference="similar to DNA sequence:INSDC:YBR076W"
                     /note="similar to Saccharomyces cerevisiae ECM8 (YBR076W);
                     ancestral locus Anc_3.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688134.1"
                     /db_xref="GeneID:11531933"
                     /db_xref="InterPro:IPR028012"
                     /db_xref="UniProtKB/TrEMBL:G8C0I5"
                     /translation="MQAGSLSFANNNNNYVDRWIDLSSSFFDETHYNNNNNRQNTSSI
                     FSLTNDIGSRPNTSKSSFSTNLFILKDKTNISINSSDYSSVRRKPRRPDTIEKISKHP
                     LVNSFPVLEQEQNAVTNQINEKKQVFYDISKLFLICKHSILRLNSNSSSNEEESLNPN
                     SNSTFNSTSRTNSTNFKSLIFLPRCFQHHQMKKWMKERYKDQGYSIKKNYKCPPSACE
                     RSTQPNAINNFNNNSYNMLSYRYLRYQSDNYQNNKRVKELLCRYCHGVNWLPCESYFK
                     HLFYAHGIMSEINRYTYSDDCCNILSIEKIRTSEFLTCFKQNLKIKEFSRNIFAIVET
                     KLIPEPLKFYSSTINGGFKRMHALCPHCSTWIRLGWCEHDKIMNEEEVYLKNVNTIRN
                     LNNAYYDIFNDNSSLSFIQRRERNKIEGLYENYFRHYIECNYGRFQNRCLYIDIKISP
                     SV"
     gene            complement(<258932..>261067)
                     /gene="TPHA0M01260"
                     /locus_tag="TPHA_0M01260"
                     /db_xref="GeneID:11531934"
     mRNA            complement(<258932..>261067)
                     /gene="TPHA0M01260"
                     /locus_tag="TPHA_0M01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688087.1"
                     /db_xref="GeneID:11531934"
     CDS             complement(258932..261067)
                     /gene="TPHA0M01260"
                     /locus_tag="TPHA_0M01260"
                     /inference="similar to DNA sequence:INSDC:YDR052C"
                     /note="similar to Saccharomyces cerevisiae DBF4 (YDR052C);
                     ancestral locus Anc_3.299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688135.1"
                     /db_xref="GeneID:11531934"
                     /db_xref="GOA:G8C0I6"
                     /db_xref="InterPro:IPR006572"
                     /db_xref="InterPro:IPR013939"
                     /db_xref="UniProtKB/TrEMBL:G8C0I6"
                     /translation="MISPTKLAHRSPLKATDANAHTNTDTHANLKTKNVDITSAMENV
                     KPVLKKRSLEKLEQINNNDPRKRPKIERNRSIEGAVVHINGINAKIDKFNDQTDNTNN
                     DANKSTNNANKNTNSKQNKVSLNELLEWQNNWKKIMKRESKIYFDTTDDTDISKYMKI
                     KLEKKRDLLRKGFAFLGAQITQFFDTSVTIVITRRSTEKIYLLQDTDVLSRAKKNYMK
                     VWNYEKSTRFLKNLDVHLDQLEKSKNSLLHTTTSLSNLLQNEKLYGPSDRDPRTKRDD
                     VHYFKHSYIYMYDLWQTWAPILTLEWKPQELADINNLPYPTLKYGTFGRCPFIGDGAC
                     DEMSYKRVVKRYTRDKSNKSYALRLRQLYQYHAEPNADKTQFVVIPHICLDSKQCYDK
                     WQQLLTVSYSKNDIEQKAGEDLKQLTDHSHTNTADQLVEEDTTKGTPTVNEIETEKKN
                     EDREDSKVTSLLPDKDENEDYITQANEPGETNWKEPLQLPDRKSLSTLSLNHQKLLGT
                     LTRQETEEFPNDLCNSKVVNRFPQEIRASGVHQSNDVATSFGNGLGPTKSSVMSKNLK
                     SLSRFVVDRKLGVKSNTNNQFVSTNKVHENTGASNTNPNLDEEKNNQKLQNNQKSQNN
                     QNDNDEASTASKALTKKTATTKIQQQHQQQQTKEPAIMKNSGYCENCRVKYERLDMHI
                     NSERHQSFAQNEMNFESIDSLISKLHFQF"
     gene            complement(<261706..>262233)
                     /gene="TPHA0M01270"
                     /locus_tag="TPHA_0M01270"
                     /db_xref="GeneID:11531935"
     mRNA            complement(<261706..>262233)
                     /gene="TPHA0M01270"
                     /locus_tag="TPHA_0M01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688088.1"
                     /db_xref="GeneID:11531935"
     CDS             complement(261706..262233)
                     /gene="TPHA0M01270"
                     /locus_tag="TPHA_0M01270"
                     /inference="similar to DNA sequence:INSDC:YBR077C"
                     /note="similar to Saccharomyces cerevisiae SLM4 (YBR077C);
                     ancestral locus Anc_3.300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688136.1"
                     /db_xref="GeneID:11531935"
                     /db_xref="InterPro:IPR020233"
                     /db_xref="UniProtKB/TrEMBL:G8C0I7"
                     /translation="MLNSKNIKEVLESTLDSIAIPLISYESNKLQSSALVSGTTGSVL
                     SFAMSNTDENGFGSSDAHSVNNVKVMSLLVKEKWVDDENTPSEQTTTSCYTYEIPKAA
                     TQGFGMDSDTTEPLITRVYIYELERLRACVAQLPKSDILLLFIASNEYPYGLLVKKMK
                     ASILSFRSLFEYKLE"
     gene            complement(<262582..>263889)
                     /gene="TPHA0M01280"
                     /locus_tag="TPHA_0M01280"
                     /db_xref="GeneID:11531965"
     mRNA            complement(<262582..>263889)
                     /gene="TPHA0M01280"
                     /locus_tag="TPHA_0M01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688089.1"
                     /db_xref="GeneID:11531965"
     CDS             complement(262582..263889)
                     /gene="TPHA0M01280"
                     /locus_tag="TPHA_0M01280"
                     /inference="similar to DNA sequence:INSDC:YDR054C"
                     /note="similar to Saccharomyces cerevisiae CDC34
                     (YDR054C); ancestral locus Anc_3.301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688137.1"
                     /db_xref="GeneID:11531965"
                     /db_xref="GOA:G8C0I8"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8C0I8"
                     /translation="MSNRKSTAASLLLRQYRELTDPKKSIPSFHINLEDDSNIFVWNI
                     GVMVLNEESIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQS
                     GDPMTDELDAETWSPVQSVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRI
                     KMEVERSKQDIPKGFVMPVSGNLAYISVNNLSGYNTSNGNLNINTTTNQQQQKQKQQQ
                     QSSNNNENISNNQNHNGNQIQNNSTLVSHDSINTPGDQDNRLSNSDNNGNNSIYNSIN
                     TIHNSNSTSVQGNIANITHNLADNFWYDSDLDEDDNVDVDNNMGGDDDIYGDDINDGT
                     YNNSTTDNDKRNQEALIYGKENDDIYNYKGNFEDDEDEDIGYYNDNDDEDDSVDNESV
                     MDRKQPKTQTQIWKKNKKLSNEYNAHQWRRYRLFVIKINRFVF"
     gene            <265226..>266500
                     /gene="TPHA0M01290"
                     /locus_tag="TPHA_0M01290"
                     /db_xref="GeneID:11531966"
     mRNA            <265226..>266500
                     /gene="TPHA0M01290"
                     /locus_tag="TPHA_0M01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688090.1"
                     /db_xref="GeneID:11531966"
     CDS             265226..266500
                     /gene="TPHA0M01290"
                     /locus_tag="TPHA_0M01290"
                     /inference="similar to DNA sequence:INSDC:YBR078W,YDR055W"
                     /note="similar to Saccharomyces cerevisiae ECM33 (YBR078W)
                     and PST1 (YDR055W); ancestral locus Anc_3.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688138.1"
                     /db_xref="GeneID:11531966"
                     /db_xref="UniProtKB/TrEMBL:G8C0I9"
                     /translation="MKFSNVLVSGAILSSAASAASTTKSIPSSCTINSSKATATAQTD
                     LDAFSGCETLVGDLTITGDLGNAAIATVKKIEGSLKVFNATNLNTLAADALEEVTDSL
                     ILQQLTILYSASFGSLSSVDSIQLVTLPALQTFTSTLESASEIIISDTSLESIEGFSN
                     LQTVSTFNINNNKYLTEIDSSLKNITTSLILSSNNKETEASFDDLTWANNITISAVAS
                     LSFESLKKVNASFSVLNNTIDSLDLSKLTTVGGSLSFEENNDLTSLDCKNLTTVGGAL
                     VIGNNTDLTNIDGFANVTTIAGALEVIGSFHNLDLSSLKSVKGGADIETTATNFTCSA
                     IDKLHSNGVIEGDSYQCSVPVSSSSSSSSSSSTSASSSSTHSSTMKTSTTSGASSSSR
                     SLTSHGAAVGSFENASFVSIFYAIAAVLVSLL"
     gene            complement(<266838..>269699)
                     /gene="TPHA0M01300"
                     /locus_tag="TPHA_0M01300"
                     /db_xref="GeneID:11531967"
     mRNA            complement(<266838..>269699)
                     /gene="TPHA0M01300"
                     /locus_tag="TPHA_0M01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688091.1"
                     /db_xref="GeneID:11531967"
     CDS             complement(266838..269699)
                     /gene="TPHA0M01300"
                     /locus_tag="TPHA_0M01300"
                     /inference="similar to DNA sequence:INSDC:YBR079C"
                     /note="similar to Saccharomyces cerevisiae RPG1 (YBR079C);
                     ancestral locus Anc_3.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688139.1"
                     /db_xref="GeneID:11531967"
                     /db_xref="GOA:G8C0J0"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR027512"
                     /db_xref="UniProtKB/TrEMBL:G8C0J0"
                     /translation="MAPPVLRPENAIKRADDLVSVGESQAALQSLFDFITARRIRFAD
                     PAAIEPIVVKFLELGIELKKGKNRSKNALHQFKKLIQGNNDGLLIIGSISRKFITMIE
                     AKIVTEHEKLASATENVDENVDLDVAVTPENLLNSVYLKDSNTVSGFNDEEIATWLRF
                     TWESYRTVLDLVRNNSQLEITYSGVVNRTMQFCLKYNRKNEFKRLAEMLRQHLDAANY
                     QQNKNGTNIVDLSDNETLQRYLEQRFQQVNVSVKLELWHEAYRSIEDVFHLMKISKQT
                     PKAPTLANYYQNMARVFLMSGVHNLHTVAWGKFYSLYSKNPNATESDFKQYSSIILLS
                     AVSNALDTLPVIGYDPQLRLYRLVGLESKPTRKDIMDIATEEDIFIHADEDVKKLYNI
                     LEENFDNETVKKELAELLPKLETKPYFKQYIKPLKNVITRKIIVSVSEREASINIDKL
                     YEEITLPAPLNDDYWGLEKSLLQAAVEDYVCIKIDHKSNTVTFASDPFEIISKSEPVV
                     EEEEAEEEEAEEEVDESEIPEGEEEEMEEAQEAEGAKEAEAEPEPVLTRTHYIRRKLN
                     ELSVVLEGLDDFKEASYIQKVKTARENLIAETKNAIENIKKANEERIKRAQEQKQKYL
                     ASAAERAEEDAEMRQKRMLEERTALEAKLAEENQRRAIEKKKREFLELQKIQVKHFID
                     TVNEKGEVELTPEETEGLDIVAIKKLVFKKIAKNKTELEQRIDIALQKLDHTERAYRE
                     SELPLLAKESEALKNEDSIKFEEIKSKILEGAKADHAAKMEDYDRLVVVGDDFRALRD
                     RLYASYQAKHGKAQAEKLAKLEAAKKARVDEIRKQRYDELVAKRQAEIDSVKRQEQAA
                     KQDQIASKQRELGEAAEQKSRAAASQAAKSLFGRGANDERQAKLDAIAQRQREIEEAA
                     ERKAKGSPAASIPATGPADTEKPLTFKEKMRLKREAAGK"
     gene            <271249..>272895
                     /gene="TPHA0M01310"
                     /locus_tag="TPHA_0M01310"
                     /db_xref="GeneID:11531968"
     mRNA            <271249..>272895
                     /gene="TPHA0M01310"
                     /locus_tag="TPHA_0M01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688092.1"
                     /db_xref="GeneID:11531968"
     CDS             271249..272895
                     /gene="TPHA0M01310"
                     /locus_tag="TPHA_0M01310"
                     /inference="similar to DNA sequence:INSDC:YDR057W"
                     /note="similar to Saccharomyces cerevisiae YOS9 (YDR057W);
                     ancestral locus Anc_3.306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688140.1"
                     /db_xref="GeneID:11531968"
                     /db_xref="InterPro:IPR012913"
                     /db_xref="UniProtKB/TrEMBL:G8C0J1"
                     /translation="MIYLIFLLSLINFSEAIITRDDQKFSIHYLPYKSFNENILQNKK
                     IIENGDLIKINSNLCYVPKTKNDPISEFSNSSVTTNFRNYLKDNLRESINIIEKFTEK
                     QQLNNRQCLNYSTGFWSYEFCNGQVINQIHKSVDDFSDHSMVNKLGEVENSLNQFNEK
                     ILNYYTVMIGRKNGYYITEFASNGDICDLNGLPRTIEIQYSCGFSTSQESGTPNIQFL
                     TEPKNCNYQIGIAIPELCKLDIFKPNNIDPFDIDDYYLKETNAKESQEIAFENSLVCL
                     QPHDEEQPLKQDSEVVKEVNSQKSVIDLFYNFKPFFIGSGVYFLKHKTIEANMGSRKP
                     DKLLFSGDISKLDSKLETMLPSLIKLDSFFESELFNYEDHDSFKWIGDIVNLQNKVTD
                     TVLISVTYNTFNNRIERTIQRSYNSTISHYTSNFIEFTKFQNEGTEKVNLFANTINKK
                     TINNIEVLEMINRNALISNKFQNFLSQRKDEFSSDFDWSQANNNKNNIVIQNIEESVV
                     DQIQYFNLEEFENLLTEIYWSRNEKKSHNDNDDTEKNSNA"
     gene            <278702..>280552
                     /gene="TPHA0M01320"
                     /locus_tag="TPHA_0M01320"
                     /db_xref="GeneID:11532018"
     mRNA            <278702..>280552
                     /gene="TPHA0M01320"
                     /locus_tag="TPHA_0M01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688093.1"
                     /db_xref="GeneID:11532018"
     CDS             278702..280552
                     /gene="TPHA0M01320"
                     /locus_tag="TPHA_0M01320"
                     /inference="similar to DNA sequence:INSDC:YBR083W"
                     /note="similar to Saccharomyces cerevisiae TEC1 (YBR083W);
                     ancestral locus Anc_3.310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688141.1"
                     /db_xref="GeneID:11532018"
                     /db_xref="GOA:G8C0J2"
                     /db_xref="InterPro:IPR000818"
                     /db_xref="UniProtKB/TrEMBL:G8C0J2"
                     /translation="MSAAVDVLNRVAEPALDTDKRKHQIDENNNMELVRETKKIKVES
                     EPSTTEIELKKEEINVIDSSDSESKIKENINTASENKQDSPINDENKSDSLQPSDMST
                     QPISTFREVCDKWSHEVESAFIGALRLILKNGTYKIKLLDKNYGRNELISIYIQYKTK
                     EVRTKKQISSHIQVWKKAILSKMTNDVPLSELEKEVLRLIEHGVQQNEHTVKIFYSVF
                     EEIVDPMSYRNDNIKISKSQSNLSLTNSHLHQNIQGQSNLSNFHNAAPHQYTQMQQQN
                     NGYLYPRAHSISAVPDPSSLYRALPSSQMHAGNNVYLQHLQNTSYPHLNKLRVLSESN
                     IYMPNSMPENTVNNNNIVANSQVHQSHSQNEFTNSYTTNAISADLHRNNSIASQSEDA
                     LSIDKNKVQYPKYHSYTNNVIPSQTNSNAYTSQYSSLKLPPVSTMPTYGANNYKKYQY
                     SSGDNSQRSSLGQIQGNVSNTSTTLNQASGMGNGSVSNTLLHQQHNFNTNGLLSYQQS
                     NITQEKPVIPRYSTKSLYTSNVGVPKAQHPMPMPEHVVPNLSAANPTSNSPLSMGISS
                     QQNIPIQQRVNVGTPIRAQPLYLQMQKLSNEVNQPSQVDSQLPNEYIHYK"
     gene            complement(<281263..>282382)
                     /gene="TPHA0M01330"
                     /locus_tag="TPHA_0M01330"
                     /db_xref="GeneID:11532019"
     mRNA            complement(join(<281263..281830,282381..>282382))
                     /gene="TPHA0M01330"
                     /locus_tag="TPHA_0M01330"
                     /product="60S ribosomal protein L19"
                     /transcript_id="XM_003688094.1"
                     /db_xref="GeneID:11532019"
     CDS             complement(join(281263..281830,282381..282382))
                     /gene="TPHA0M01330"
                     /locus_tag="TPHA_0M01330"
                     /inference="similar to DNA
                     sequence:INSDC:YBL027W,YBR084C-A"
                     /note="similar to Saccharomyces cerevisiae RPL19B
                     (YBL027W) and RPL19A (YBR084C-A); ancestral locus
                     Anc_3.312"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="XP_003688142.1"
                     /db_xref="GeneID:11532019"
                     /db_xref="GOA:G8C0J3"
                     /db_xref="InterPro:IPR000196"
                     /db_xref="InterPro:IPR015972"
                     /db_xref="InterPro:IPR015974"
                     /db_xref="InterPro:IPR023638"
                     /db_xref="InterPro:IPR027547"
                     /db_xref="UniProtKB/TrEMBL:G8C0J3"
                     /translation="MANLRTQKRLAASVIGVGKGKVWLDPSEASEIAQANSREAIRRL
                     VKNGTIVKKAVTVHSRSRTRAYAESKRNGRHTGYGKRKGTREARLPSQVVWIRRLRVL
                     RRLLSKYRDAGKIDKHLYHVLYNESKGNAFKHKRALVEHIIQAKANAQRETALKEESD
                     ARRMKNRAARERRAQRVAEKREALLKEDA"
     gene            <283229..>283564
                     /gene="TPHA0M01340"
                     /locus_tag="TPHA_0M01340"
                     /db_xref="GeneID:11532020"
     mRNA            <283229..>283564
                     /gene="TPHA0M01340"
                     /locus_tag="TPHA_0M01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688095.1"
                     /db_xref="GeneID:11532020"
     CDS             283229..283564
                     /gene="TPHA0M01340"
                     /locus_tag="TPHA_0M01340"
                     /inference="similar to DNA sequence:INSDC:YBL028C"
                     /note="similar to Saccharomyces cerevisiae YBL028C;
                     ancestral locus Anc_3.313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688143.1"
                     /db_xref="GeneID:11532020"
                     /db_xref="InterPro:IPR019434"
                     /db_xref="UniProtKB/TrEMBL:G8C0J4"
                     /translation="MAKSLRASTHIKAKSVKRKAVFQHVVNAREQRLSEKLKNDLIKQ
                     KLEDLKKNEGIEMDAASLIKQEEEKAKAKAQEPEKTVSTSGWREASHHNYKKAQIRKN
                     KKKNKFTRF"
     gene            complement(<284121..>285044)
                     /gene="TPHA0M01350"
                     /locus_tag="TPHA_0M01350"
                     /db_xref="GeneID:11532021"
     mRNA            complement(<284121..>285044)
                     /gene="TPHA0M01350"
                     /locus_tag="TPHA_0M01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688096.1"
                     /db_xref="GeneID:11532021"
     CDS             complement(284121..285044)
                     /gene="TPHA0M01350"
                     /locus_tag="TPHA_0M01350"
                     /inference="similar to DNA sequence:INSDC:YBL029W"
                     /note="similar to Saccharomyces cerevisiae YBL029W;
                     ancestral locus Anc_3.314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688144.1"
                     /db_xref="GeneID:11532021"
                     /db_xref="UniProtKB/TrEMBL:G8C0J5"
                     /translation="MLNLEDYLFSSQEFYNPTEIDTNTLAFPTKLNGYKSYRYRDNIR
                     SSHLISPIDMIFDNNEVAPLDASLRALPESSSSSSNDTELVNQLQYYNSEDCNSSVTS
                     KTSQGSTNTLNIFDYPQVEPQSPFHTDDLTRSGSKESAYVKQPRQSRYNTTKEVLRSY
                     SKRNDKINKSDLGIQDNIESNHTKRQRQKKVSDSRLSAHGLAEVLQLDSPEEALEREK
                     NILDIFENELHYPLGYKTWVRDTKKEERMELMHELYNRVNCKYPHYNYNISILETIIR
                     RATYYMMQSRLRRERRAKIKNVKDKRTVELV"
     gene            <289522..>290436
                     /gene="TPHA0M01360"
                     /locus_tag="TPHA_0M01360"
                     /db_xref="GeneID:11531936"
     mRNA            <289522..>290436
                     /gene="TPHA0M01360"
                     /locus_tag="TPHA_0M01360"
                     /product="ADP/ATP carrier protein"
                     /transcript_id="XM_003688097.1"
                     /db_xref="GeneID:11531936"
     CDS             289522..290436
                     /gene="TPHA0M01360"
                     /locus_tag="TPHA_0M01360"
                     /inference="similar to DNA sequence:INSDC:YBL030C,YBR085W"
                     /note="similar to Saccharomyces cerevisiae PET9 (YBL030C)
                     and AAC3 (YBR085W); ancestral locus Anc_3.316"
                     /codon_start=1
                     /product="ADP/ATP carrier protein"
                     /protein_id="XP_003688145.1"
                     /db_xref="GeneID:11531936"
                     /db_xref="GOA:G8C0J6"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8C0J6"
                     /translation="MAEQKQSNFMIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMI
                     KQGSLDRRYDGIVECFKRTAKNEGIAAFWRGNTANVIRYFPTQALNFAFKDKIKALFG
                     FKKEEGYAKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGERQFNGLV
                     DVYKKTIKSDGFAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPVVLTGSLEGSFLASFL
                     LGWVVTTGASTASYPLDTIRRRMMMTSGQAVKYDGAFDAFRKIVAKEGVPSLFKGCAA
                     NILRGVAGAGVISMYDQLQMILFGKKFK"
     gene            complement(<291244..>292263)
                     /gene="TPHA0M01370"
                     /locus_tag="TPHA_0M01370"
                     /db_xref="GeneID:11531937"
     mRNA            complement(<291244..>292263)
                     /gene="TPHA0M01370"
                     /locus_tag="TPHA_0M01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688098.1"
                     /db_xref="GeneID:11531937"
     CDS             complement(291244..292263)
                     /gene="TPHA0M01370"
                     /locus_tag="TPHA_0M01370"
                     /inference="similar to DNA sequence:INSDC:YBL032W"
                     /note="similar to Saccharomyces cerevisiae HEK2 (YBL032W);
                     ancestral locus Anc_3.318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688146.1"
                     /db_xref="GeneID:11531937"
                     /db_xref="GOA:G8C0J7"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:G8C0J7"
                     /translation="MSDSTTPSTTQPLVTDENIADHVISQRLLLSLDEAGAIIGQQGA
                     TIEKIKEDNNVTINISDSKPNCSDRVLTSTGKIQDVANSIGDVCRVLASTAVEDSESE
                     EKVSSEVSPYFFLRFRLPKPSVEEMKETPDKLKDIVNIRVLVTRSQCSAIIGKNGDRI
                     KSYINDFGVKMLATNNFLPRSNERLLEIQGFPVAITKVLTAVDTLVAKEVVPPTNPAR
                     EYYTPYNRNSSQGAQSTGSANRTRTPIRRTGEEFKKLVNIPETYVGAIVGRSGNRIAN
                     LRRATRTSIDIGKRSEEEVASETERVFEIVGSRMIDVERAETMLLKNLETEVKRRAEQ
                     VEDAV"
     gene            <294117..>295025
                     /gene="TPHA0M01380"
                     /locus_tag="TPHA_0M01380"
                     /db_xref="GeneID:11531938"
     mRNA            <294117..>295025
                     /gene="TPHA0M01380"
                     /locus_tag="TPHA_0M01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688099.1"
                     /db_xref="GeneID:11531938"
     CDS             294117..295025
                     /gene="TPHA0M01380"
                     /locus_tag="TPHA_0M01380"
                     /inference="similar to DNA sequence:INSDC:YBL033C"
                     /note="similar to Saccharomyces cerevisiae RIB1 (YBL033C);
                     ancestral locus Anc_3.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688147.1"
                     /db_xref="GeneID:11531938"
                     /db_xref="GOA:G8C0J8"
                     /db_xref="InterPro:IPR000926"
                     /db_xref="UniProtKB/TrEMBL:G8C0J8"
                     /translation="MTISSELPIVECVARARIPTTTGGPDIFLHLYKNNKDDKEHLAV
                     VFGEDIRSKSLFKTRKNDTQQDRMIRGAYVGKLYPGRESADVDDKQKLQLQFDSETGA
                     LVYDANTTWNPENNTLVRIHSECYTGENVWSARCDCGEQFDRAGHLMAIDREPETNII
                     GGNGHGVIVYLRQEGRGIGLAEKLKAYNLQDLGADTVQANLLLKHPADARDFSIGKSI
                     LIDLNIKNARLLTNNPDKIEQANYPPLLNCVERVPMIPINWLNSNNGIKSKEIDGYLR
                     TKMEKMGHLLSKPLNLHTAETVNTLI"
     gene            <295610..>299977
                     /gene="TPHA0M01390"
                     /locus_tag="TPHA_0M01390"
                     /db_xref="GeneID:11531939"
     mRNA            <295610..>299977
                     /gene="TPHA0M01390"
                     /locus_tag="TPHA_0M01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688100.1"
                     /db_xref="GeneID:11531939"
     CDS             295610..299977
                     /gene="TPHA0M01390"
                     /locus_tag="TPHA_0M01390"
                     /inference="similar to DNA sequence:INSDC:YBL034C"
                     /note="similar to Saccharomyces cerevisiae STU1 (YBL034C);
                     ancestral locus Anc_3.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688148.1"
                     /db_xref="GeneID:11531939"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="UniProtKB/TrEMBL:G8C0J9"
                     /translation="MSLDFSNIYDIVIDNNVTINDKIGLLTSFKGHIKKELVNIKLID
                     KYLNALLFILNNYTYITNPNESDANPENNKLISISHSTLCYLIKRVAMQAPTHFDNYT
                     ISRLLFYLIHSVPYEKKFWISSTRAIEAIFLVSPSILENSLKNLCLNDFSIFIDNGMS
                     DDTINMLIKKNDMNKNILAIGELVKTDEKNNRNPLERIDDFNSVFINILNNIDYNDEN
                     SHAFANLAIELLKDLLTKYYNADYLLEFSNQINDENIKKQFLTKNNKNIFKPTNSPTK
                     LPNPNNSSDPSLTFDIKSEIDRILNTDLKLVTTSNNNNENLDSKSFHNFDQLLNEMEN
                     LLVPFLEIKETEQNWKIRQKNIHKFREILNGNIPKESPVKFVLLCRDLQFIECISKAA
                     LSLRTTLTLSAYQLLREFCEILNNNIDITVIEQIFSTLKISLSSTKKISSQNAFYTLI
                     LLVVNTSFNNKLFQNSYTLMSEKNVLPRMCSAVILRIFIMKYPPVSSSTIDTSTNKLS
                     ALTIYIEEWLKKGITDAQTSVREPMRVTFWYYYKCFPLSAKKLLQGSFSNQLRKAIEL
                     SIPQHLEVDYQLTSTISSINSSRRSSLIGSSLNRRFPNYAQPTHSSQHSTIRSTSETT
                     YNENQKGNLLMKGIYLGKNTNRHLSDNIQKTELLNTRKSSAPSSLPIQTHNEILKGNN
                     DIDASMDSLNTTNNGTAQLDITGDLTNNHSHTLLKKYLEINQNNKDYSITKGGAKSKN
                     ENSTLNFDNNSKKLLHLAENCNTLKDTKELLHFLQDMLIRNNEFEFFDIISYLRVAMI
                     RFPKEFRELINISKFYQSIPLQYTIDLYAINSLDVTDLISKFDLNELLETISNLLNTL
                     VNNDGTELSPEGSLYYMKYRQSIFNFCLATINEILQKANINKIENMVLRNLIKKLTDI
                     CGGDFDESLYYETLFKIYTREKFIFVQVLRSLNLVSTKLKIFHEIEHRDPSFTIDEIL
                     ANDKKQSSQQDAQQSEHTENLDPMYMEMTMVNPFGQKRMISDSSVLHHGRDQFDTYNN
                     QNELNEIELGPHTRKLTDMTKVISIYQTASQDDNINDMEIDGDGDGDVNLNNHESETN
                     VNLSDIFRNQEKENTVKFSTDPPKIINNSSAGSNINRESDNDIDLLSDQNFTNNDNVN
                     TEPSFGQPLPPSTDYTLSNPVDVVKSPSLIDELSQNTLSYHILSKFIIFSKTNVAGSF
                     QDMIKAMDRINSKSFSLVHLDKILSFLVISSNQLEFMDWLMSENGYLKLLNICDILLQ
                     SADIAQSIPENIVSRTLLLVNCLLLLKNRYNIQTINADHYINIWNSIVTLTGKIEDFQ
                     NEVFVFSEETISSFYEANLITSKVILKILSLLATSTSESTYISMNCFLLKTLALLTSY
                     PKISLTESNYLEIVEIMSIYTHDNRTELRFESFRVLSNIYHHIQSENSEINNPMTLFA
                     KIDSKSMKIIQKMLSEGLA"
     gene            <300314..>302317
                     /gene="TPHA0M01400"
                     /locus_tag="TPHA_0M01400"
                     /db_xref="GeneID:11531979"
     mRNA            <300314..>302317
                     /gene="TPHA0M01400"
                     /locus_tag="TPHA_0M01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688101.1"
                     /db_xref="GeneID:11531979"
     CDS             300314..302317
                     /gene="TPHA0M01400"
                     /locus_tag="TPHA_0M01400"
                     /inference="similar to DNA sequence:INSDC:YBL035C"
                     /note="similar to Saccharomyces cerevisiae POL12
                     (YBL035C); ancestral locus Anc_3.322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688149.1"
                     /db_xref="GeneID:11531979"
                     /db_xref="GOA:G8C0K0"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR013627"
                     /db_xref="InterPro:IPR016722"
                     /db_xref="UniProtKB/TrEMBL:G8C0K0"
                     /translation="MSFKEELIEQFGNEVDKSDVIAYLENLIKIYALNIEELFIKWEQ
                     FSYHRHETHTAMNTKNLDGFKNFLQKQIEKKAQKFSNTSNVTSSGLKSKIIGSSPSLF
                     GFNSPRTPIIKKRKLNETQPTSSGQKSSQKLGFSSGSNANNKSENIEKSNTTSPSMTG
                     STQINLPSDITVSTPSPLKRSGEAGVTLDSLNPNNIETSEGFDPENDKKVKITPFYDP
                     IKYKFRTMRQNLQDAADVLDEQIEIFCKLAKEHFKLSQSDFGDPTIQSQSEIYAVGRI
                     VPDSPTAEGFLNIDSLALEASRLMGIGRRVRLNFSKINECSLFCGQIIVLKGKNADGD
                     YFMVDEILNLPYPDSPVSTVEDIENSNMIQNGKSMKVIITSGPYFPENDFNVQPIKEF
                     VDKINNKIKPHTLIMFGPFIDITQNCIAKGAIPQFHGVTQQPRTLDEIFTKVLVPLLS
                     GINSSIQVILVPSTRDAISHHAAYPQDSFDRKKLQLPKNFKCFTNPSTFQLNEVFFGC
                     SNVDIYKDLKEVAKGGNTAMRNRFDRVSEHVLQQRRYYPVFPGGIRKTAKILENKKKV
                     IEHISGADLEVPYLGLTEFVGEISPDVIIMPSEMQHFARVVQNVVMINPGRFVRPNGG
                     RGTFAEMTIEPPNVENGKLTKMSDEDLFLHNVWKRSRIDIITN"
     gene            complement(<302438..>305335)
                     /gene="TPHA0M01410"
                     /locus_tag="TPHA_0M01410"
                     /db_xref="GeneID:11531980"
     mRNA            complement(<302438..>305335)
                     /gene="TPHA0M01410"
                     /locus_tag="TPHA_0M01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688102.1"
                     /db_xref="GeneID:11531980"
     CDS             complement(302438..305335)
                     /gene="TPHA0M01410"
                     /locus_tag="TPHA_0M01410"
                     /inference="similar to DNA sequence:INSDC:YBR086C"
                     /note="similar to Saccharomyces cerevisiae IST2 (YBR086C);
                     ancestral locus Anc_3.323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688150.1"
                     /db_xref="GeneID:11531980"
                     /db_xref="InterPro:IPR007632"
                     /db_xref="UniProtKB/TrEMBL:G8C0K1"
                     /translation="MVTVDQSYLIDFVSNHILNKNTQQIEQLSADYCIVIDISNFESI
                     DIISKNLLVLLSTLKQQNLINTSDAAANQLYENVLIRLNGNFLYVFIKTDISQSTTID
                     CTGLNFIKFIVPLNLIYNKKLIDHSISTKIVKDFNHVLPNDNDLIEVLNLNGNQDLFI
                     YFIFFKKYIKSLFKISILGLILRVISFPYEFNLIYSVLLSLNSFYFIISWIYQDKSYY
                     INKSNLVENLIQFNPVSNKNYKLSKSIIAKKIVFLPIILFFVSLLLTAQLFCFSLEII
                     LTQLYPSSGLLKIILSLMPTILLATFVPILNLLYNKYIVNPYVNWENYSNNIVEINKS
                     KLEKNILFTFCTNYIPLLITLFIYTPCGHLINFGVKDAIGKYLTVIDNTFVIDNTRYK
                     TQLFFFIVTNQIIIILTENLLPIIINKIKIKLAKKKGTDDKQKEKENEKIQKQQSIDI
                     IKQYYPDDYRVWNTIDKYQNSLNVWGDFDLDDNYKKIVSQFGYIAMFSSIWPLAPFIS
                     IIFNVIVFRLDILRAYKNCKPMASKISTVNSSICQKSTECKKNIWDLITIFLAIFGSI
                     VTMTTTYMYRFSKLLHPYVADTEVTSKSKRLDTLITSPIDHSAFKIFVMAVIFEHLVV
                     LVYYVMVKVVTANKCDLHSHQNSNLFASVKRVNNKNKNNSHTTSNNQNPTTEQHTTDA
                     FVTKVSSIVDDFSDGKYAAQKDSANDQLDANKSVPQDAIRSKMESKTPVTNSGIENKI
                     KKKNSLISMKSVKDATGTRLVMRDLVDDSSSSIAGATLPLNIPTSKNFNVRYDSDGNL
                     VESVARLQANSKENSTNIVPTNLKEANEKSNTLEETVPKTLDPLASKDGNIKQTLEAT
                     RNKEGANHTSNSIPAVHTKAESKHKSHSTHTPGKSLTSKQPVSNSALNDNHSQASKDI
                     SSKNEASSIINNSHTPSKPRHAAGKDASSISRSETSSKKKKGLFNKLKVKL"
     gene            <306160..>306975
                     /gene="TPHA0M01420"
                     /locus_tag="TPHA_0M01420"
                     /db_xref="GeneID:11531981"
     mRNA            <306160..>306975
                     /gene="TPHA0M01420"
                     /locus_tag="TPHA_0M01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688103.1"
                     /db_xref="GeneID:11531981"
     CDS             306160..306975
                     /gene="TPHA0M01420"
                     /locus_tag="TPHA_0M01420"
                     /inference="similar to DNA sequence:INSDC:YBL036C"
                     /note="similar to Saccharomyces cerevisiae YBL036C;
                     ancestral locus Anc_3.324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688151.1"
                     /db_xref="GeneID:11531981"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR011078"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:G8C0K2"
                     /translation="MLSGLVRLTSLKTTGSTYKHPRLFSTMSDRTTELIQSYELVNSK
                     IRQAAEQYSVDAKNVQLLAVSKLKPASDIKILYDHGIRHFGENYVQELIEKAASLPND
                     ISWHFIGGLQTNKCKDLSKIKNLYAVETVDSLKKATKLNESRLKNSPEDPPINCNIQI
                     NTSNEDVKSGLTDEDEIFRIIEYFLNENTNSIKLNGLMTIGSWNASHQDDPNVDNQDF
                     TKLVEWKKLLDSKYNLNLKLSMGMSADYRQAIRQGTSEVRIGTDIFGVRPPRN"
     gene            <307265..>308335
                     /gene="TPHA0M01430"
                     /locus_tag="TPHA_0M01430"
                     /db_xref="GeneID:11531982"
     mRNA            <307265..>308335
                     /gene="TPHA0M01430"
                     /locus_tag="TPHA_0M01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688104.1"
                     /db_xref="GeneID:11531982"
     CDS             307265..308335
                     /gene="TPHA0M01430"
                     /locus_tag="TPHA_0M01430"
                     /inference="similar to DNA sequence:INSDC:YBR087W"
                     /note="similar to Saccharomyces cerevisiae RFC5 (YBR087W);
                     ancestral locus Anc_3.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688152.1"
                     /db_xref="GeneID:11531982"
                     /db_xref="GOA:G8C0K3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0K3"
                     /translation="MSLWVDKYRPKTISKLSHNDSLTEFLTSLTVQARDLPHLLLYGP
                     NGSGKKTRCMALLEAIFGPGVYRLKIDVRQFVTPSNKKLELNVVSSPYHLEITPSDMG
                     NNDRIVIQELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEADSLTRDAQAALRRTMEK
                     YSKNIRLIMICDSMSSIISPIKSRCLMIRSSAPTDEEIVNILKDIAEKEGVTVASDDI
                     LKKVAIEADGNLRVAILMLESMALTNELSLKSNTVIIKPDWLVVILKLANKIQRERSV
                     ACLVECRAVLYDLLAHCIPARVILENLTFALLKQSGNSSSVKADIINIASIFDERLSL
                     GNKVIFHLEGFIAKVMVALDKS"
     gene            complement(<308508..>309227)
                     /gene="TPHA0M01440"
                     /locus_tag="TPHA_0M01440"
                     /db_xref="GeneID:11531924"
     mRNA            complement(<308508..>309227)
                     /gene="TPHA0M01440"
                     /locus_tag="TPHA_0M01440"
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /transcript_id="XM_003688105.1"
                     /db_xref="GeneID:11531924"
     CDS             complement(308508..309227)
                     /gene="TPHA0M01440"
                     /locus_tag="TPHA_0M01440"
                     /inference="similar to DNA sequence:INSDC:YBL038W"
                     /note="similar to Saccharomyces cerevisiae MRPL16
                     (YBL038W); ancestral locus Anc_3.327"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /protein_id="XP_003688153.1"
                     /db_xref="GeneID:11531924"
                     /db_xref="GOA:G8C0K4"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR020798"
                     /db_xref="UniProtKB/TrEMBL:G8C0K4"
                     /translation="MMLLFKSNSLMGIGLMKRASTICAGNGLMTGWKDVSSKRFTHEY
                     APRYKDQKKNKKGRVPVRFGGSTKGSRLQFGTYGMRLKTEGVRLTAQQLKEADNAIMR
                     YVRPLDNGQLWRRLTTNIAVCIKGNETRMGKGKGAFDHWMVRVPTGKIIFEMAGDNLH
                     EKVAREAFRKAGDKLPGVYEFVTKESKIRVSMHSLKSREEIEEKEKSINYFKELERKP
                     TKKYLNVLKSKEPQYRLYRGY"
     gene            <309998..>311437
                     /gene="TPHA0M01450"
                     /locus_tag="TPHA_0M01450"
                     /db_xref="GeneID:11531925"
     mRNA            <309998..>311437
                     /gene="TPHA0M01450"
                     /locus_tag="TPHA_0M01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688106.1"
                     /db_xref="GeneID:11531925"
     CDS             309998..311437
                     /gene="TPHA0M01450"
                     /locus_tag="TPHA_0M01450"
                     /inference="similar to DNA sequence:INSDC:YPR047W"
                     /note="similar to Saccharomyces cerevisiae MSF1 (YPR047W);
                     ancestral locus Anc_3.328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688154.1"
                     /db_xref="GeneID:11531925"
                     /db_xref="GOA:G8C0K5"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004530"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:G8C0K5"
                     /translation="MLQTKAISSKLLRWNIKGFATARVTYIESACDSLFVNKKEYKVN
                     QEWTNVTPTILNLTARALFLKNNHPIGILRNMIENKMNIIDNSYSIHNNFKPVVSTFE
                     NFDSLGFPMDHPGRSKSDTYYINKDFLLRTHTSAHEIACFKQLKGTPSDVKSGFLISA
                     DVYRRDEIDRTHYPVFHQMEGARIWERGTEDKENDSIEPTHITQMRKDIDKLHKQLEK
                     EETKIIVQDNASLDDNPKQDYMTDLEVDLCQQHLKRSVELVVAEVFNKKIQSMKQSKM
                     NQDEIPKELKVRWIKAYFPWTAPSWEIEVWWQGEWLEICGCGLVRQDVLIKSGYAKDS
                     TIGWAFGLGLDRIAMLLFEVPDIRLFWSLDSRFHDQFQKNEITPFVPYSKYPGTTRDV
                     AFWLPDDNLEVEVHENDIMEIVRNVAGDLVEYVKLIDEFKNPKTGKTSQCYRINYQSM
                     DRNITNEEINKLQETVRKELTRKYNLEVR"
     gene            <311871..>313751
                     /gene="TPHA0M01460"
                     /locus_tag="TPHA_0M01460"
                     /db_xref="GeneID:11531926"
     mRNA            <311871..>313751
                     /gene="TPHA0M01460"
                     /locus_tag="TPHA_0M01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688107.1"
                     /db_xref="GeneID:11531926"
     CDS             311871..313751
                     /gene="TPHA0M01460"
                     /locus_tag="TPHA_0M01460"
                     /inference="similar to DNA sequence:INSDC:YPR048W"
                     /note="similar to Saccharomyces cerevisiae TAH18
                     (YPR048W); ancestral locus Anc_3.329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688155.1"
                     /db_xref="GeneID:11531926"
                     /db_xref="GOA:G8C0K6"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR028879"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8C0K6"
                     /translation="MSSNKIAILYGSETGNAADFAAILSHHLHRLHFAHSLSSMGDYP
                     AADILKCRYMFVISSTTGQGDLPRNVHEMSYGEDRTNTLWSVLKKKNLPNDLLDHLNI
                     AFFGLGDSSYPKFNYAIRKLHQRMVVQLGATEIFERLEADDISMAGSNRDTGLGIESV
                     YFEFEKRILQHLKEKFPNRKVNGEVLKREELSEEIYLEPKTYLKMGDTSNMRKENAHE
                     PKFMGDYSISNGKIIKNLRITSEEHFQDVRQLTFKQDDIKPYSPGDTIAIYPTNTDED
                     VQRFLEVQTHWLEIADEPLSFTDGIPNSLNDGGCIENLTLRNLLKYHCDFNSIPKPSF
                     FMKIWTFATDVSRMERGEEQCTQQREKLHEFAFEQDMQDLYDYCNRPRRSILEVLEDF
                     LSIRLPWKYVIDYMPVLKPRLFSISSSKSNSEIELTVAIVKYKTILRKLRRGVCTNYI
                     SKLRNEDTIRYKVINNSLHLNKQLEHNRDIPCILISPGVGIAPMMSLIRSDICNNVHL
                     FFGNRVKDCDFLYRSELEQFDKSGKIKLYTCFSRDEINSPELKYVQDILWEKKDLIAN
                     LIIDNQAVIYLCGSSGKMPIQVRITIVEILKKSGHFKDDKEAETYLKDMEKNNRYFQE
                     TW"
     gene            complement(<313985..>314761)
                     /gene="TPHA0M01470"
                     /locus_tag="TPHA_0M01470"
                     /db_xref="GeneID:11531927"
     mRNA            complement(<313985..>314761)
                     /gene="TPHA0M01470"
                     /locus_tag="TPHA_0M01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688108.1"
                     /db_xref="GeneID:11531927"
     CDS             complement(313985..314761)
                     /gene="TPHA0M01470"
                     /locus_tag="TPHA_0M01470"
                     /inference="similar to DNA sequence:INSDC:YBR088C"
                     /note="similar to Saccharomyces cerevisiae POL30
                     (YBR088C); ancestral locus Anc_3.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688156.1"
                     /db_xref="GeneID:11531927"
                     /db_xref="GOA:G8C0K7"
                     /db_xref="InterPro:IPR000730"
                     /db_xref="InterPro:IPR022648"
                     /db_xref="InterPro:IPR022649"
                     /db_xref="InterPro:IPR022659"
                     /db_xref="UniProtKB/TrEMBL:G8C0K7"
                     /translation="MLEAKFEEASLFKRIIDGFKDCVQLVNFQCTPKGIIAQAVDDSR
                     VLLVSLEIGTEAFQEYRCDHPITLGMDLTSLSKILRCGNNTDTLTLIADENPDSVLLL
                     FEDTKKDRIAEYSLKLMEIDADFLKIEELQYDSNILMPSVEFSKIVRDLSQLSDSLNI
                     MITKETIKFVADGDIGSGSVILKPFVNMDKPEESIKLEMDQPVDLTFGAKYLLDIIKG
                     SSLSDSVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNEEE"
     gene            complement(<315307..>315588)
                     /gene="TPHA0M01480"
                     /locus_tag="TPHA_0M01480"
                     /db_xref="GeneID:11531969"
     mRNA            complement(<315307..>315588)
                     /gene="TPHA0M01480"
                     /locus_tag="TPHA_0M01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688109.1"
                     /db_xref="GeneID:11531969"
     CDS             complement(315307..315588)
                     /gene="TPHA0M01480"
                     /locus_tag="TPHA_0M01480"
                     /inference="similar to DNA
                     sequence:INSDC:YBR089C-A,YPR052C"
                     /note="similar to Saccharomyces cerevisiae NHP6B
                     (YBR089C-A) and NHP6A (YPR052C); ancestral locus
                     Anc_3.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688157.1"
                     /db_xref="GeneID:11531969"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8C0K8"
                     /translation="MAGPREIKKRTHRRKKDPNAPKRAMSAYMFFANETRDIVRAENP
                     DVSFGQIGRLLGEKWRALTDEDKGPFEAKAQADKKRYESEKELYNATKA"
     gene            complement(<316012..>317295)
                     /gene="TPHA0M01490"
                     /locus_tag="TPHA_0M01490"
                     /db_xref="GeneID:11531970"
     mRNA            complement(<316012..>317295)
                     /gene="TPHA0M01490"
                     /locus_tag="TPHA_0M01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688110.1"
                     /db_xref="GeneID:11531970"
     CDS             complement(316012..317295)
                     /gene="TPHA0M01490"
                     /locus_tag="TPHA_0M01490"
                     /inference="similar to DNA sequence:INSDC:YBR095C"
                     /note="similar to Saccharomyces cerevisiae RXT2 (YBR095C);
                     ancestral locus Anc_3.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688158.1"
                     /db_xref="GeneID:11531970"
                     /db_xref="InterPro:IPR013904"
                     /db_xref="UniProtKB/TrEMBL:G8C0K9"
                     /translation="MNEDTVVETQKQQQQLEEDSADEQLYIKKFSQKLIREKCGNYPL
                     LKRSIDGKIVYPETNGITSNRGNKLLQKSELVTRTNINNTKPIDEECIFYNGSEHNLL
                     QRKRMRFNIPPLDSLDVKGPNTIKLGDEDEDDDDDEYNLNKLVDISKTLSPISSLSDI
                     STKDSISHVYKSKILKELALQTILMVEKEQDSVNKYTKLLEVLLGNLVDPLHQSNLNL
                     KDYDHKLLLEESDNENDPENSTANNTTINEDEEDSNDNKNNNPVDFKEGRQEDHEDED
                     PFFAIPKVDVLTKFDEELDPKNSKKDAQNNTDIISSYSLSYLTKEFPNHEQNMAKIHE
                     ELETSRQLSQIALQRNQEFIRNLSKIRNYLIKANRIKERIYSWSKEIGGIQEEGILIP
                     SLLRDAKRGLIRITTNKTLDSGDEEENPDEEQEEE"
     gene            <317999..>319291
                     /gene="TPHA0M01500"
                     /locus_tag="TPHA_0M01500"
                     /db_xref="GeneID:11531971"
     mRNA            <317999..>319291
                     /gene="TPHA0M01500"
                     /locus_tag="TPHA_0M01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688111.1"
                     /db_xref="GeneID:11531971"
     CDS             317999..319291
                     /gene="TPHA0M01500"
                     /locus_tag="TPHA_0M01500"
                     /inference="similar to DNA sequence:INSDC:YPR054W"
                     /note="similar to Saccharomyces cerevisiae SMK1 (YPR054W);
                     ancestral locus Anc_3.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688159.1"
                     /db_xref="GeneID:11531971"
                     /db_xref="GOA:G8C0L0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C0L0"
                     /translation="MNNLIGDGARGSINNYFYKTKLELPLYDIKNSKKPTEQIEGPRV
                     PRTIHESSKVSLPQRYEVVQVLGKGSYGIVCSVRDLNSNTNNALLAVKKITNIFYKEI
                     LIKRAIRELKFIKYFRGHKNIVSLLDVDIVLDAPYDGLYCYQELIDYDLAKVVHSSVL
                     LTEFHIKYFFYQILCGLKYIHSADVLHRDLKPGNILCTLNGTLKICDFGLARGISQTV
                     LQKANRQNSTNEPVQYYNLDITNYVATRWYRAPELILSHNEYDKSIDIWSCGCILAEF
                     YGRKPVFMGKDAMHQIFEIIKVIGSPSKELLETYGSSKSWTVYNSNMINYKKKEWSEV
                     YPHATAQATDLMENLMKWVSKDRYTVEEAIEHPFLSDVRNKDDEPICPYGEFDFLYEY
                     ELHSMQDLRNYLVNEVNTFKSEKKIIFNKSHSRSQMTI"
     gene            <319931..>322981
                     /gene="TPHA0M01510"
                     /locus_tag="TPHA_0M01510"
                     /db_xref="GeneID:11531972"
     mRNA            <319931..>322981
                     /gene="TPHA0M01510"
                     /locus_tag="TPHA_0M01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688112.1"
                     /db_xref="GeneID:11531972"
     CDS             319931..322981
                     /gene="TPHA0M01510"
                     /locus_tag="TPHA_0M01510"
                     /inference="similar to DNA sequence:INSDC:YPR055W"
                     /note="similar to Saccharomyces cerevisiae SEC8 (YPR055W);
                     ancestral locus Anc_3.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688160.1"
                     /db_xref="GeneID:11531972"
                     /db_xref="GOA:G8C0L1"
                     /db_xref="InterPro:IPR007191"
                     /db_xref="UniProtKB/TrEMBL:G8C0L1"
                     /translation="MDNLAVQSRQGRTRALSVNTYDEQQRNSMSNSLDKLEMDLSLIQ
                     SQWNRIITDDSNPLELALKFLDDTSVGLGHRFDEFNQLKEKIGYDLQNAVNEHYQVFN
                     TNIASYSIAVNSIANAQNNIENIENSVKEANLKINQDKGSLQELNESTMSYTKMIDTI
                     SAIEEIISLPEKMEDFIRKEEYREAQKLLKRAMFLSNTHSLWSISSLTPIKQQIDLAE
                     HNLFQNMIDELHDIIYSKKSASTFDNEILEKIHTSKSDFTSTENYLYTIVSIDIDQQS
                     ENMNIKLKNFLENIKNLKPTKLNSVYIEEGTDYDRIFNLLILINSLDKLPLALRILVD
                     RATKELHDIVIQSSEEIRSRYPSLMKIGGATLDSNFGMSMRNPISIIMREWFWKIFVK
                     ILLAVQRHRVIFESVSVFQQLFNLHISYRFGDIWKKCLIEVRLLLNKYLNDTTMDKKA
                     ILHRRDTSLAKPISTEHIFTLQSNLHDNSIAKNHTAALKTLLQDIFPGFSVPGNINLS
                     SIYVEEESYEEEEALIQPTVFNMRLALEPVLLFIQATSNIIPSGLSEVTKPSMSFLSE
                     YMKKVFIPKFESTLYVIYDSNVFSNNPYAFESNNENKNVLKSVNDFYTLFCNTLTVMN
                     TTYTFRANICSVIINILEKFQIYYEKLFQTLLGVTNENYTRKLLGIWMNDEALMGTEF
                     EYLKHNVSLNVNEAKLLFRHCSQFYYKGNGLKKDDIFNNIDLDIVLHFYNSLEWALKW
                     FSELRKTVDSSVTVLDENSNANDVRLMWSLYDCDELSQVVKTTKLRLSMDVESVKKFD
                     SITEKIENLKYRVLTSLRFDLRARVIFNIGKMFKNNYNWSPDVGSTELESSIGNLISD
                     IRMHDNKLKSNLDEKIRNQVGSGIDIVINYAFISGATSIKSINTNGIKKINRNITYLQ
                     NVCRNVIEDSNSINMNDSLNFYTACGLSELQFFKKLEDNELSFCTKYDLKNIIRLIYG
                     DDAIPATRKQRDTNTHVRATSMSGNKRYNEAIQKINTMTSDNEE"
     gene            <323315..>325168
                     /gene="TPHA0M01520"
                     /locus_tag="TPHA_0M01520"
                     /db_xref="GeneID:11531995"
     mRNA            <323315..>325168
                     /gene="TPHA0M01520"
                     /locus_tag="TPHA_0M01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688113.1"
                     /db_xref="GeneID:11531995"
     CDS             323315..325168
                     /gene="TPHA0M01520"
                     /locus_tag="TPHA_0M01520"
                     /inference="similar to DNA sequence:INSDC:YBR098W"
                     /note="similar to Saccharomyces cerevisiae MMS4 (YBR098W);
                     ancestral locus Anc_3.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688161.1"
                     /db_xref="GeneID:11531995"
                     /db_xref="GOA:G8C0L2"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="UniProtKB/TrEMBL:G8C0L2"
                     /translation="MQESSINFIETHNDGEALEIYSIHSIDSEKSNESKGLEQNGDLR
                     KDNQIGAGGESSLIIIENNSLEIDVPFFEDDANKRNSSQEGKQTTRGKTQLIESRTIL
                     DKILSSDSISSANDSSLANFYGNDNKITSLVNRWRSTKEPSLSQNKQHPEEIANSSTK
                     NSQNILKTFPISSPIQHSQGDSQDNQSVNEFVENISPNKKQLFVPLDTTSIEDIHDLE
                     FSKILNTSTSNAVLSTPLKVSNKDTIIKFPAANVDLITGPQKENLNQTIKRKSLENNY
                     DQLKYYISRGKEYDPDDSKFLISKHMRENKKAFKEVNQNYRDNIDARSTLIVEMSSNL
                     IRLLSSKMDNFSDHIKPSTLQSSSNDNNELIRFLRRSNSEYDFRNDVYYPADFKIVEE
                     NIYLLYYDAFEFFKQYSHNKSALFHQIKEYTKAGKHVLLTLYNLKNLKKAIQTVENND
                     YITKVQNQLTGSPSKQNKRKRMKVIEDLHMSSTSIEKRLRYIDRLWGVKVHTVNSHLE
                     FINSLPNLLSLVGKQYNDSAIKYMKYAYLHVKSAKNKEDVLTKIIHQVGRVPELKAEN
                     ITRAYPTFQQLLKDFDGGKLRSGSDGKYLMTEKIESRLYKLFTSDDPNETI"
     gene            complement(<325398..>326273)
                     /gene="TPHA0M01530"
                     /locus_tag="TPHA_0M01530"
                     /db_xref="GeneID:11531996"
     mRNA            complement(<325398..>326273)
                     /gene="TPHA0M01530"
                     /locus_tag="TPHA_0M01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688114.1"
                     /db_xref="GeneID:11531996"
     CDS             complement(325398..326273)
                     /gene="TPHA0M01530"
                     /locus_tag="TPHA_0M01530"
                     /inference="similar to DNA sequence:INSDC:YBR101C"
                     /note="similar to Saccharomyces cerevisiae FES1 (YBR101C);
                     ancestral locus Anc_3.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688162.1"
                     /db_xref="GeneID:11531996"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013918"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8C0L3"
                     /translation="MEKLLHWSIANAQGDKDAIARAGQPDPRLLQQLFGGAGPDDATL
                     MKESLQVIANEEAELEHKMIAMDNFELLIENIDNANNIENMKMWEPIIGILEHEEADM
                     RAAALSIVGTAVQNNVSAQDNFIKYDAGLEKLIALASERNHQHFNVRVKALYALSNLI
                     RNNETNAKKFYEAKGLDIVAPILSEKSSTPKLKMRTIALLAAFLTSVKIDSKLIDQLR
                     EENIIETTIICLKNETDLNLIDRILNFLSQLISAKITFSESELSKLNEGFTIITEYKD
                     RLNEDDYLTVKHVLN"
     gene            <326764..>327876
                     /gene="TPHA0M01540"
                     /locus_tag="TPHA_0M01540"
                     /db_xref="GeneID:11531997"
     mRNA            <326764..>327876
                     /gene="TPHA0M01540"
                     /locus_tag="TPHA_0M01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688115.1"
                     /db_xref="GeneID:11531997"
     CDS             326764..327876
                     /gene="TPHA0M01540"
                     /locus_tag="TPHA_0M01540"
                     /inference="similar to DNA sequence:INSDC:YPR057W"
                     /note="similar to Saccharomyces cerevisiae BRR1 (YPR057W);
                     ancestral locus Anc_3.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688163.1"
                     /db_xref="GeneID:11531997"
                     /db_xref="InterPro:IPR023251"
                     /db_xref="UniProtKB/TrEMBL:G8C0L4"
                     /translation="MSDKSSQRIDPVFGQSRAFALNDPLVNPDILKYLEGVKEEAIRS
                     TFETYSEKKPRNDEVKHIASMYDDDGDSYNSEVKYAGTEVYKQELRFPERHSYLTKYP
                     ESLIKFQRNMPKWVKWFKRCKIELRDTGYVFEGYDNSTMELILYHLQEYLNIKRKKGF
                     PLHLFNILKDVTNDVEEKDKMTIDSEWLETIFNVLKSRRLKGIADVIAVISEMHSFTP
                     MGFKQWYAYIIKNEPSHSIFVNIINNRNMWILLQYMTKTWVKTINLNKKPTESKRLSQ
                     WLIYMLLHLPEHLTAEYISELRSLAKKCRDIILTNITDTNEATKESNVLPYYTQELID
                     MGLAFGDDGTPTIIELTLSVVSEIYGQRDLTNWENM"
     gene            <328262..>329182
                     /gene="TPHA0M01550"
                     /locus_tag="TPHA_0M01550"
                     /db_xref="GeneID:11531998"
     mRNA            <328262..>329182
                     /gene="TPHA0M01550"
                     /locus_tag="TPHA_0M01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688116.1"
                     /db_xref="GeneID:11531998"
     CDS             328262..329182
                     /gene="TPHA0M01550"
                     /locus_tag="TPHA_0M01550"
                     /inference="similar to DNA sequence:INSDC:YBR104W,YPR058W"
                     /note="similar to Saccharomyces cerevisiae YMC2 (YBR104W)
                     and YMC1 (YPR058W); ancestral locus Anc_3.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688164.1"
                     /db_xref="GeneID:11531998"
                     /db_xref="GOA:G8C0L5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:G8C0L5"
                     /translation="MSGESTPLQIIDDLDVAPQQDKTRVIKDLLAGTAGGISQVLVGQ
                     PFDTTKVRLQTSTTPTSAIDVVKNLLKNEGPSGFYKGTLTPLIGVGACVSIQFGVNEA
                     MKRYFHSVNNLNSETLSLSQYYLSGLAGGVANSFLASPIEHVRIRLQTQTSSGANADF
                     KGPLDCIRKLRAQGGLMRGLSATMLRESHGCGTYFLVYEALVANEVNKLKVKRADIPA
                     WKLCLFGAFSGTTLWMMVYPLDVIKSVIQTDNIKNPKNGNSIRDVAKRIYGRGGLSAF
                     FKGFGPTMLRAAPANGATFATFELFMRLMN"
     gene            complement(<329409..>330176)
                     /gene="TPHA0M01560"
                     /locus_tag="TPHA_0M01560"
                     /db_xref="GeneID:11531888"
     mRNA            complement(<329409..>330176)
                     /gene="TPHA0M01560"
                     /locus_tag="TPHA_0M01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688117.1"
                     /db_xref="GeneID:11531888"
     CDS             complement(329409..330176)
                     /gene="TPHA0M01560"
                     /locus_tag="TPHA_0M01560"
                     /inference="similar to DNA sequence:INSDC:YPR060C"
                     /note="similar to Saccharomyces cerevisiae ARO7 (YPR060C);
                     ancestral locus Anc_3.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688165.1"
                     /db_xref="GeneID:11531888"
                     /db_xref="GOA:G8C0L6"
                     /db_xref="InterPro:IPR008238"
                     /db_xref="InterPro:IPR020822"
                     /db_xref="UniProtKB/TrEMBL:G8C0L6"
                     /translation="MDFTKPETVLNLQNIRDELVKMENSIIFKFIERSNFPTCPSIYD
                     PKHSNLSIPNFEGSFLDWAILQLEIAHSQLRRFESPDETPFFPDKILKPILPSIEYPQ
                     ILAKYSSEVNYNNKIKRIYIDEIVPLISKYSGDQAENFGSVATRDIELLQSLSRRIHF
                     GKFVAEAKFQNNVELYTDLIKRKDVDGIMKNITNSAVEEKILERLTTKAEVYGVDPTD
                     KEGERKITPEYLVKIYKEIVIPITKEVEVEYLLRRLE"
     gene            complement(<330644..>331531)
                     /gene="TPHA0M01570"
                     /locus_tag="TPHA_0M01570"
                     /db_xref="GeneID:11531889"
     mRNA            complement(<330644..>331531)
                     /gene="TPHA0M01570"
                     /locus_tag="TPHA_0M01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688118.1"
                     /db_xref="GeneID:11531889"
     CDS             complement(330644..331531)
                     /gene="TPHA0M01570"
                     /locus_tag="TPHA_0M01570"
                     /inference="similar to DNA sequence:INSDC:YPR061C"
                     /note="similar to Saccharomyces cerevisiae JID1 (YPR061C);
                     ancestral locus Anc_3.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688166.1"
                     /db_xref="GeneID:11531889"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:G8C0L7"
                     /translation="MSILLARQSVTSRYPLTPAASINTLNHHLVIQWIRDYSNHQPRK
                     LEVLHDNYWPKLVKNPSPFQIFNITNKNSIDKKELKKKYHFFVKLYHPDNNGKFNVST
                     HDCATNKFLTNDQKLKRFKIITDAYTKLTSDRVIDTSESYDMNRYNHQNWNTRYHHAY
                     YNSEDWGDINGISKKDHTSNEEFNILTFFSCMLGLIMCIKCLALLNELEATLNKPIQL
                     APHKSMEENLISAYTNYGLDKDKQSRYKRFLWFRTYNIFLNKQSGFSREQFQEEMKKN
                     DILLTELDNKSNSKSNPPP"
     gene            complement(<331907..>332350)
                     /gene="TPHA0M01580"
                     /locus_tag="TPHA_0M01580"
                     /db_xref="GeneID:11531890"
     mRNA            complement(<331907..>332350)
                     /gene="TPHA0M01580"
                     /locus_tag="TPHA_0M01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688119.1"
                     /db_xref="GeneID:11531890"
     CDS             complement(331907..332350)
                     /gene="TPHA0M01580"
                     /locus_tag="TPHA_0M01580"
                     /inference="similar to DNA sequence:INSDC:YBR109C"
                     /note="similar to Saccharomyces cerevisiae CMD1 (YBR109C);
                     ancestral locus Anc_3.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688167.1"
                     /db_xref="GeneID:11531890"
                     /db_xref="GOA:G8C0L8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:G8C0L8"
                     /translation="MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSP
                     SEAEVADLMNEIDVNGNNKIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDTEVDEMLREVSDGSGEINIQQFAALLSK"
     gene            complement(<332934..>334418)
                     /gene="TPHA0M01590"
                     /locus_tag="TPHA_0M01590"
                     /db_xref="GeneID:11531891"
     mRNA            complement(<332934..>334418)
                     /gene="TPHA0M01590"
                     /locus_tag="TPHA_0M01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688120.1"
                     /db_xref="GeneID:11531891"
     CDS             complement(332934..334418)
                     /gene="TPHA0M01590"
                     /locus_tag="TPHA_0M01590"
                     /inference="similar to DNA sequence:INSDC:YPR068C"
                     /note="similar to Saccharomyces cerevisiae HOS1 (YPR068C);
                     ancestral locus Anc_3.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688168.1"
                     /db_xref="GeneID:11531891"
                     /db_xref="GOA:G8C0L9"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:G8C0L9"
                     /translation="MGDENKFKLIISTSHFQSSVIDLLPCNHARKSKLINSLLEAYQL
                     ISKFDVVVDETRLFEGQGLDLVEARALCNYHSQDYLRVIFGKQYNERLSPDDNDREGV
                     RSGKAEQSPDELHDLYELYQSLHESYVGKKRKIPRDRPGHVPGTDPEILKLEYNLNNG
                     DCPIFSFLPMYLDTLINSTMQLAKHLCVDTPEITANIAINWDGGRHHAMKSRANGFCY
                     INDIVSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKDIQIISIHLFEPG
                     FYPCTGGLKFGKPKSNNIINLPVKHGLSNSNMFELVTNIIIPLIELHQSDDIVILCGG
                     DGLNNDYYNEWQLTIIGLTRCIIKIIAAFVGPHQPGSCKNVVLLGGGGYNELLASRFY
                     TYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHEHIDEYEKEYYKYWCY
                     EIENGLDGLSFKRQINYNDTKQKPFTKYIAELRAHYGISRILST"
     gene            <334735..>336480
                     /gene="TPHA0M01600"
                     /locus_tag="TPHA_0M01600"
                     /db_xref="GeneID:11531983"
     mRNA            <334735..>336480
                     /gene="TPHA0M01600"
                     /locus_tag="TPHA_0M01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688121.1"
                     /db_xref="GeneID:11531983"
     CDS             334735..336480
                     /gene="TPHA0M01600"
                     /locus_tag="TPHA_0M01600"
                     /inference="similar to DNA sequence:INSDC:YPR070W"
                     /note="similar to Saccharomyces cerevisiae MED1 (YPR070W);
                     ancestral locus Anc_3.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688169.1"
                     /db_xref="GeneID:11531983"
                     /db_xref="GOA:G8C0M0"
                     /db_xref="InterPro:IPR019680"
                     /db_xref="UniProtKB/TrEMBL:G8C0M0"
                     /translation="MASEDVYLSKLNEIIELFQNYKPGRINLDNITKLCQTLGLESFI
                     DDIDTNISRLSTASKIIVVDIDFDKSLGKVKDVKLVLASNFDNFNYFTDKSLLLNSVN
                     GTNNTNLKEEQTENNILLNSLTNYADLNEFYQNLKYIYLLDTYSCIDLDSNQAKSKSS
                     GNTTVINSGDIISTTNYAVSATDNVSSLQISSTGNMKPNSSPNANANLDVNNAHTATS
                     PVPAQNIDKNDCKLDLFKYYTELADYVRNYFISNNSDFTVITNLRDIFGIYIIWNDDF
                     KNPIARIYLEKSKESKNRLFEFVYLPGDDKWSNEDFEKYTIGVSLVMEIMGETENQTG
                     KHNSIWFPKESISDDLILQSSFTDIIKENIDSNDNNMLNILFKNIQSDNNLSINDYLI
                     FSGKCRLVNDFTTSLINISKFDIGNDHLDLMLEILNWIKWSKMVLTPVFEIISRDNNG
                     STDDFSSYEKANDSNIDENINLQKLKMKTIRSTRRRSSSLAKRPSIVEASILKDEGLQ
                     QFNLHEIMSQPVIEDEKIDGLDYVEESASENPLHNDSNENANEDIEMEDAQGMDFNTE
                     PMLKIENNNKKIIKS"
     gene            338361..338442
                     /gene="TPHA0Mtrna1S"
                     /locus_tag="TPHA_0Mtrna1S"
                     /db_xref="GeneID:11531984"
     tRNA            338361..338442
                     /gene="TPHA0Mtrna1S"
                     /locus_tag="TPHA_0Mtrna1S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /db_xref="GeneID:11531984"
     gene            complement(<338578..>339291)
                     /gene="TPHA0M01610"
                     /locus_tag="TPHA_0M01610"
                     /db_xref="GeneID:11531949"
     mRNA            complement(<338578..>339291)
                     /gene="TPHA0M01610"
                     /locus_tag="TPHA_0M01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688122.1"
                     /db_xref="GeneID:11531949"
     CDS             complement(338578..339291)
                     /gene="TPHA0M01610"
                     /locus_tag="TPHA_0M01610"
                     /inference="similar to DNA sequence:INSDC:YBR111C"
                     /note="similar to Saccharomyces cerevisiae YSA1 (YBR111C);
                     ancestral locus Anc_3.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688170.1"
                     /db_xref="GeneID:11531949"
                     /db_xref="GOA:G8C0M1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:G8C0M1"
                     /translation="MYIAKGLRLKLINQSANPTTKFITRKMSIPKGKPELAELISSRP
                     VVRTDECKWIGLEKLSYKDPNGGTREWDMAVRTTRQAGGIDGVGIIPILKYPDGKPDE
                     ILLQKQYRPPVDGVCIEMPAGLIDGTESVQVAALRELKEETGYVGKIIDDSPVMFNDP
                     GFTNTNLVLLTVEIDMALPENQNPQANLEDNEFIECFTVPLKDFVSEMTKLDKQGYKL
                     DARVQSFAQGISFVQKYKF"
     gene            <339650..>340156
                     /gene="TPHA0M01620"
                     /locus_tag="TPHA_0M01620"
                     /db_xref="GeneID:11531985"
     mRNA            join(<339650..339732,339817..339956,340074..>340156)
                     /gene="TPHA0M01620"
                     /locus_tag="TPHA_0M01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688123.1"
                     /db_xref="GeneID:11531985"
     CDS             join(339650..339732,339817..339956,340074..340156)
                     /gene="TPHA0M01620"
                     /locus_tag="TPHA_0M01620"
                     /inference="similar to DNA sequence:INSDC:YBR111W-A"
                     /note="similar to Saccharomyces cerevisiae SUS1
                     (YBR111W-A); ancestral locus Anc_3.366"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688171.1"
                     /db_xref="GeneID:11531985"
                     /db_xref="GOA:G8C0M2"
                     /db_xref="InterPro:IPR018783"
                     /db_xref="UniProtKB/TrEMBL:G8C0M2"
                     /translation="MTTDANNNLVNLKAQIQQYLVESGNYEKISNDLNKRLLAEGWME
                     SVKKLTLDEINVNDSTKFPQILKNVEPEAINMVSDTTKNEVIEQIKFFLNEVFNTEQ"
     gene            complement(<340500..>343631)
                     /gene="TPHA0M01630"
                     /locus_tag="TPHA_0M01630"
                     /db_xref="GeneID:11531986"
     mRNA            complement(<340500..>343631)
                     /gene="TPHA0M01630"
                     /locus_tag="TPHA_0M01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688124.1"
                     /db_xref="GeneID:11531986"
     CDS             complement(340500..343631)
                     /gene="TPHA0M01630"
                     /locus_tag="TPHA_0M01630"
                     /inference="similar to DNA sequence:INSDC:YBR112C"
                     /note="similar to Saccharomyces cerevisiae CYC8 (YBR112C);
                     ancestral locus Anc_3.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688172.1"
                     /db_xref="GeneID:11531986"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8C0M3"
                     /translation="MNSATAQPAQPLVNAVNMQQQQQQQQKLGQPNSQENIQIQQVQH
                     PPLDPLTQSTAETWLSIASLAETVGDTDRAAMAYDTTLQYNPASTKALTSLAHLYRSR
                     DMFQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNSYQQALYYLSNPNVPK
                     LWHGIGILYDRYGSLEYAEEAFAKVLELDPNFDKANEIYFRLGIIYKHQGKWTQALEC
                     FRYILPQPPSPLQEWDIWFQLGSVLESMGEWQGAKEAYENVLVQNEHHAKVLQQLGCL
                     YGMNNTQFYDPQKALNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNR
                     DSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNKQLND
                     ALDAYKQAARLDPDNVHIRERLESLAQQLQNPNNAQQQAGQHPGAPGQTNDIANAPVM
                     LQPTLQSNDRVNPLNVRPLSLQQQQQGVYGQVLEQHTEQAYAQPLVDVNGELQGLPIQ
                     QVQQMNLQQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAQQAQQAQQAQQAQ
                     QAQQAQQAQQAQQAQQAQQAQQAQQAQQAQQAQQAQQAQRAQLHQLPPAPVLQQEQAN
                     APPVALGSTMVPPLQTTQIAPISIPTSVPGASESVTAPSIPPISMVDHEKMPAPQLQP
                     IQASTIQQPTEPVKTETENDSDGSSNKRTVDDGINTLVNAAVSSESAKTSTEKSEEPS
                     QKKLKRSSPVTVPAEPYSFTRCHRTTVEELPIEPKPVIEATVLPLAIESAVPVAETVA
                     PVGAATPVVDAAAPFVASETPVVESATPIVESATPAAEASAPITETAAPTVTSVTPVA
                     ESTATVNESTYTATETVVTSNADSSVTTSIQEKKVDESISQAVQEETKLAEEGKTESV
                     DSNTVPDSNTDDIPATIEVTKAEPETKSSENIKETPVHAETSTTSPVAPASEIAVTSE
                     GEKKKDEEAKVASEPTIKPTAEALEKLEEEAKLREEDNLEKEVASEQKPTKESFPKEN
                     AVREVEEDENYDE"
     gene            <344410..>344931
                     /gene="TPHA0M01640"
                     /locus_tag="TPHA_0M01640"
                     /db_xref="GeneID:11531987"
     mRNA            <344410..>344931
                     /gene="TPHA0M01640"
                     /locus_tag="TPHA_0M01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688125.1"
                     /db_xref="GeneID:11531987"
     CDS             344410..344931
                     /gene="TPHA0M01640"
                     /locus_tag="TPHA_0M01640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688173.1"
                     /db_xref="GeneID:11531987"
                     /db_xref="UniProtKB/TrEMBL:G8C0M4"
                     /translation="MCAKKSSDRAETNGRSCGRFYWACPKTDVENTETGRGIGGGQKG
                     GTRARTARQFNARFSKLQKFRNFRKLVLCLCFRIFILFMLLCLFVVVFCCRFSVAGLL
                     RRHSGSTVTKRTRFSKFSLSFYWSGNWCAWVPRTLSPRRFCCFVRCQNTSWLHMSVHF
                     SCTGSVITQLGYK"
     gene            complement(<345182..>345661)
                     /gene="TPHA0M01650"
                     /locus_tag="TPHA_0M01650"
                     /db_xref="GeneID:11531988"
     mRNA            complement(<345182..>345661)
                     /gene="TPHA0M01650"
                     /locus_tag="TPHA_0M01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688126.1"
                     /db_xref="GeneID:11531988"
     CDS             complement(345182..345661)
                     /gene="TPHA0M01650"
                     /locus_tag="TPHA_0M01650"
                     /inference="similar to DNA sequence:INSDC:YPR073C"
                     /note="similar to Saccharomyces cerevisiae LTP1 (YPR073C);
                     ancestral locus Anc_3.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688174.1"
                     /db_xref="GeneID:11531988"
                     /db_xref="GOA:G8C0M5"
                     /db_xref="InterPro:IPR000106"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="UniProtKB/TrEMBL:G8C0M5"
                     /translation="MTQDRKISVAFVCLGNICRSPMAEAVFRHTVKQKGLSDRFERIT
                     SFGTAGYHIGEEPDSRSVSTCRKHKVPVDHLAQQIKPKHFKEFDYIICMDDSNFSNLK
                     RIEPEDSKSQVSLFGEWNTNNKYNRIVDDPYYGGIDGFEYNFEQVTYFSEQFLAQEL"
     gene            complement(<345953..>348019)
                     /gene="TPHA0M01660"
                     /locus_tag="TPHA_0M01660"
                     /db_xref="GeneID:11531989"
     mRNA            complement(<345953..>348019)
                     /gene="TPHA0M01660"
                     /locus_tag="TPHA_0M01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688127.1"
                     /db_xref="GeneID:11531989"
     CDS             complement(345953..348019)
                     /gene="TPHA0M01660"
                     /locus_tag="TPHA_0M01660"
                     /inference="similar to DNA sequence:INSDC:YBR117C,YPR074C"
                     /note="similar to Saccharomyces cerevisiae TKL2 (YBR117C)
                     and TKL1 (YPR074C); ancestral locus Anc_3.372"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688175.1"
                     /db_xref="GeneID:11531989"
                     /db_xref="GOA:G8C0M6"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:G8C0M6"
                     /translation="MSKFNDIDRLCISTVRLLAVDAVQKANSGHPGAPLGLAPAMHVL
                     CRDFMNVNHENVDWPNRDRFVLSNGHACALLYSTLHLLGYDYTIDDLKRFRSVGSKTP
                     GHPEYELPGVELTTGPLGQGISNAVGFAIAQAHIAARYNKKDCEISTNYTYVFAGDGC
                     MQEGVSSEACSLAGHLQLGNLIVIYDDNSITIDGKTNLSFTEEVAVRYRGYGWEVIEV
                     KDGNDNLDAISQAIKLAKSNKKQPTLIKLTTTIGFGSLNEGTYNVHGSPLKPDDVKQL
                     KKRFGFNSEESFVVPQEVYDFYKEHMIERGKKANEEWNSTLEEYMRKYPELGAELKRR
                     IAGILPPDWESALPTFKPEDGDLATRKLSASVINSLAKTLPELIGGSADLTPSNLTRW
                     DDAIDFQPDDTKIGSYMGRYIRYGVREHGMSAILNGISAYGYNLKPFGGTFLNFVSYA
                     SGAVRLAALSGYPVIWVATHDSIGLGEDGPTHQPIETVTHFRALPNMQVWRPADGNEV
                     SAAYKVSIESKATPSIICLTRQNVPQLEGSSIEKAAKGGYAISEYHGNTTPKLDLILV
                     SSGSEVSLCCKSAEKYSKDHKVNIRVVSLPDFYTFGKQPFEYRISVLPDEVPILSVEV
                     YATLSMCKYSHEQFGLDRFGMSGKSKEVYEYFEFTPDGVASRIAKVLSFYSDKTIRSP
                     VRKALA"
     gene            <349183..>349998
                     /gene="TPHA0M01670"
                     /locus_tag="TPHA_0M01670"
                     /db_xref="GeneID:11531990"
     mRNA            <349183..>349998
                     /gene="TPHA0M01670"
                     /locus_tag="TPHA_0M01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688128.1"
                     /db_xref="GeneID:11531990"
     CDS             349183..349998
                     /gene="TPHA0M01670"
                     /locus_tag="TPHA_0M01670"
                     /inference="similar to DNA sequence:INSDC:YGR079W"
                     /note="similar to Saccharomyces cerevisiae YGR079W;
                     ancestral locus Anc_3.403"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688176.1"
                     /db_xref="GeneID:11531990"
                     /db_xref="UniProtKB/TrEMBL:G8C0M7"
                     /translation="MSAASGTFNILNNIITCDDIIPIKNNISNEVLDAGKESHPAAPE
                     AGEGSALTSSSEDADLLFSPLGDLTSDNTDGEDEEDEYCHGLLSPVYFHAEYPKRFHH
                     NNPMNSDAGSVVQNTHSITNNIQNSETDTNSDFWNEVPTTAEEAVAFANNDDELLTII
                     NKNSDKANCVESETSILSSLVTDGLENINNSNNKIKIKNWDSDAYIKLFCYRNKTGNF
                     ELKTQIDNPGTSGIGAKNNKIKKIKNGKRKFVRRKSGISQMISTNIGIGEFML"
     gene            complement(350227..350300)
                     /gene="TPHA0Mtrna2V"
                     /locus_tag="TPHA_0Mtrna2V"
                     /db_xref="GeneID:11532011"
     tRNA            complement(350227..350300)
                     /gene="TPHA0Mtrna2V"
                     /locus_tag="TPHA_0Mtrna2V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11532011"
     gene            <351477..>354554
                     /gene="TPHA0M01680"
                     /locus_tag="TPHA_0M01680"
                     /db_xref="GeneID:11532010"
     mRNA            <351477..>354554
                     /gene="TPHA0M01680"
                     /locus_tag="TPHA_0M01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688129.1"
                     /db_xref="GeneID:11532010"
     CDS             351477..354554
                     /gene="TPHA0M01680"
                     /locus_tag="TPHA_0M01680"
                     /inference="similar to DNA sequence:INSDC:YPR097W"
                     /note="similar to Saccharomyces cerevisiae YPR097W;
                     ancestral locus Anc_3.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688177.1"
                     /db_xref="GeneID:11532010"
                     /db_xref="GOA:G8C0M8"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR024554"
                     /db_xref="InterPro:IPR024555"
                     /db_xref="UniProtKB/TrEMBL:G8C0M8"
                     /translation="MEEKIITPVQEHYIKKELLKLELENEIALLDDPFALRKFGYPFC
                     STDPIDNTANKKRSSGMFSSTLIPNSPNYNGIKSKSNISLLSITSGDNGANKLANADV
                     TSLYGNDSDPNAFNMLNYFLKEFIIKFPLLNNSDEALKTKFWQQKVQPFYEYFMSLPF
                     SDSLDREKSSKRKMMSTVINKLVYSFFASNIITANESLYYTKEKQKYLEEQGIEKKSR
                     LKHLGIGMPDTIRYLVTSEELFINNWNINIIGVLENNLKALDKIQKGQNKSSKLGGSK
                     LSATSITSSFGMSSTKKWMKSALSVTSASSTAFISKITTGNSSVSPLSLMSKPTHYFI
                     LEVYNKNEHEVTHKYLQKSYYDFIEFSNILKKEFPAKKLPKLPHKQKATDTSTTSHEG
                     IQTSTSHVRLADALHTGEQKPSIIVNDSEISLDKLNMGIDSAINDAHSEDINFEFVDD
                     KDNNKNNSNLSRDITRTSFRQYLRKLTEDEEIAYSVSLNTFLNSNNVQLDSLPSEIQE
                     DINSRKLVDASNLQDEVSNQEEMEETMHILSQSMSGFRSKLEKDDDYIKNIINEFKMQ
                     NEISLMSDDVQHFSEWLKLTASSVIYHLFLSKRGSRGLFNQVRMLHNLIPYNMMSQIM
                     KVTNPMSIMKGMTDLFLSQPFGGYSLFQTMFITIITEDIRVQTKVIKKLEKKIIEESN
                     GSQTIIDHIKLFVEKNQISNELSLDEIRAESQKMGMPMVLIVLMKYSQLRKVSQKDVD
                     SVIESYTAWKVQNKSVGVVSESEKQESSYFANLKDLQKLYFKNNDKKLMKKVWQDPVL
                     AQLLKAIVNLIYDPMVKLFNIADVDKGLKLFERFMTDLIKLVDKVVFGRLGTCTKFDV
                     ICRIKNLLDKYEDEFLSLLNHFLNNDKENVIEEYIAWVTSILNFLDNKNEVGKNNVLD
                     IEKSIKESDILTEKLTTEIDDIMKNKFAKRKIFNDIVSCWKRKTVILAENSKLSDQDE
                     IRSNMTAIKEIDIELGNLELLFNELMAQHLDRTELNSFREQVFVPFINGKYFG"
     gene            complement(<354767..>355399)
                     /gene="TPHA0M01690"
                     /locus_tag="TPHA_0M01690"
                     /db_xref="GeneID:11532012"
     mRNA            complement(<354767..>355399)
                     /gene="TPHA0M01690"
                     /locus_tag="TPHA_0M01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688130.1"
                     /db_xref="GeneID:11532012"
     CDS             complement(354767..355399)
                     /gene="TPHA0M01690"
                     /locus_tag="TPHA_0M01690"
                     /inference="similar to DNA sequence:INSDC:YGR081C"
                     /note="similar to Saccharomyces cerevisiae SLX9 (YGR081C);
                     ancestral locus Anc_3.409"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688178.1"
                     /db_xref="GeneID:11532012"
                     /db_xref="UniProtKB/TrEMBL:G8C0M9"
                     /translation="MVAKKRTTLRNKAASKKPNNSLNGSEAVFHQLSTPNSFPEDPKA
                     FLHQLRETKKEKQMNKQDTFLTQIKERAAGNPDFAGISKSSIRRRKRNMKNDLKPKMN
                     DLLLSLNKEAGLKEILENDHKTGSLEDEDMMVDTNVTKITKSTKYRHINNETSASVKI
                     KKNQPSIRNQKGAKQLTKDESKRFVQVLNNNAFKADPFGSLKEIIKMQKF"
     gene            <355907..>356479
                     /gene="TPHA0M01700"
                     /locus_tag="TPHA_0M01700"
                     /db_xref="GeneID:11532013"
     mRNA            <355907..>356479
                     /gene="TPHA0M01700"
                     /locus_tag="TPHA_0M01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688131.1"
                     /db_xref="GeneID:11532013"
     CDS             355907..356479
                     /gene="TPHA0M01700"
                     /locus_tag="TPHA_0M01700"
                     /inference="similar to DNA sequence:INSDC:YGR082W"
                     /note="similar to Saccharomyces cerevisiae TOM20
                     (YGR082W); ancestral locus Anc_3.410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688179.1"
                     /db_xref="GeneID:11532013"
                     /db_xref="GOA:G8C0N0"
                     /db_xref="InterPro:IPR002056"
                     /db_xref="InterPro:IPR023392"
                     /db_xref="UniProtKB/TrEMBL:G8C0N0"
                     /translation="MSQSSSFSRFVSIAGAVTALSITGYAIYFDYQRRNNLMFRKNLK
                     KEHKKQMKAAKQQQEEDKQKKLKEVGDSLAKELATDPIPTAPAEREAAFATNVEMGER
                     LASVPGKEMESACKFYKALSVYPSPADLLGIYQRSVPESIYELIVLMIAVYPPTNIAS
                     IINGIQPDSSSVSAAAAELEAMSQGIGIDE"
     gene            complement(<356893..>357470)
                     /gene="TPHA0M01710"
                     /locus_tag="TPHA_0M01710"
                     /db_xref="GeneID:11532014"
     mRNA            complement(join(<356893..357331,357424..>357470))
                     /gene="TPHA0M01710"
                     /locus_tag="TPHA_0M01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688132.1"
                     /db_xref="GeneID:11532014"
     CDS             complement(join(356893..357331,357424..357470))
                     /gene="TPHA0M01710"
                     /locus_tag="TPHA_0M01710"
                     /inference="similar to DNA sequence:INSDC:YPR098C"
                     /note="similar to Saccharomyces cerevisiae YPR098C;
                     ancestral locus Anc_3.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688180.1"
                     /db_xref="GeneID:11532014"
                     /db_xref="InterPro:IPR025423"
                     /db_xref="UniProtKB/TrEMBL:G8C0N1"
                     /translation="MSFVKPASHLLLYSFAFGGATFYSYVASPLMFKTLEKDQFSKMQ
                     SKIFPGYFCMQTVTPVILGLTSPVALSKGSITCLLTAVASGLVNFVYLQPKSHKIKEE
                     RHALAARLEGKELMAFDEDLKKSFGRTHGISLLFNFTNNASMLVYGVYLAKNLLRYIP
                     K"
     gene            complement(<357834..>358796)
                     /gene="TPHA0M01720"
                     /locus_tag="TPHA_0M01720"
                     /db_xref="GeneID:11531957"
     mRNA            complement(<357834..>358796)
                     /gene="TPHA0M01720"
                     /locus_tag="TPHA_0M01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688133.1"
                     /db_xref="GeneID:11531957"
     CDS             complement(357834..358796)
                     /gene="TPHA0M01720"
                     /locus_tag="TPHA_0M01720"
                     /inference="similar to DNA sequence:INSDC:YGR084C"
                     /note="similar to Saccharomyces cerevisiae MRP13
                     (YGR084C); ancestral locus Anc_3.414"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688181.1"
                     /db_xref="GeneID:11531957"
                     /db_xref="UniProtKB/TrEMBL:G8C0N2"
                     /translation="MSARLTFKRYVSDVAAKERLDQFLGYYATKHALRPLVYRPKNSN
                     ILLTMDLKDSKTGKPLKPHEPFRPIAKTVLHEYIGSLKVSADETNELAQWYKSWTSIS
                     TRKREVYKYFNGAHLQDILFKAFFQTGSYSHLLSSMYSNIPKFQKAGNVEAYDIDHFF
                     NAILTCNLHRNKIKVYNDPTIALKKINVAFTNSKGTDTFGLAKPLIQQLAKQLNFSAD
                     ELISKYKMAQEINLPQLEETNKPSKFYLEQRGTYIITRTLEEFATETVDPKIVAFNRS
                     YRSLADSLGHNTDVYDSYMSTVNEVWKDTQAAENTKETETEENK"
     gene            <359320..>359838
                     /gene="TPHA0M01730"
                     /locus_tag="TPHA_0M01730"
                     /db_xref="GeneID:11531958"
     mRNA            <359320..>359838
                     /gene="TPHA0M01730"
                     /locus_tag="TPHA_0M01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688134.1"
                     /db_xref="GeneID:11531958"
     CDS             359320..359838
                     /gene="TPHA0M01730"
                     /locus_tag="TPHA_0M01730"
                     /inference="similar to DNA sequence:INSDC:YPR101W"
                     /note="similar to Saccharomyces cerevisiae SNT309
                     (YPR101W); ancestral locus Anc_3.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688182.1"
                     /db_xref="GeneID:11531958"
                     /db_xref="GOA:G8C0N3"
                     /db_xref="InterPro:IPR008409"
                     /db_xref="UniProtKB/TrEMBL:G8C0N3"
                     /translation="MSFLPFVDVEEVEYQEQIEKLYEETREQVMDGAEMHPEVVKMLA
                     VSELDERKRAMPDDCDDPDSKRKQPRISLQRYSIDEGSSVESLMINEAYLRHQELVLK
                     ELLPKTMMNQWIINNECMKDDGQHLQETMDRQLKQIVDLNKHRERLQMEGNVTLQELE
                     KQWHNQLIKNLQ"
     gene            complement(<360029..>360553)
                     /gene="TPHA0M01740"
                     /locus_tag="TPHA_0M01740"
                     /db_xref="GeneID:11531959"
     mRNA            complement(<360029..>360553)
                     /gene="TPHA0M01740"
                     /locus_tag="TPHA_0M01740"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_003688135.1"
                     /db_xref="GeneID:11531959"
     CDS             complement(360029..360553)
                     /gene="TPHA0M01740"
                     /locus_tag="TPHA_0M01740"
                     /inference="similar to DNA sequence:INSDC:YGR085C,YPR102C"
                     /note="similar to Saccharomyces cerevisiae RPL11B
                     (YGR085C) and RPL11A (YPR102C); ancestral locus Anc_3.416"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_003688183.1"
                     /db_xref="GeneID:11531959"
                     /db_xref="GOA:G8C0N4"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:G8C0N4"
                     /translation="MSAKAQNVMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVHSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEIIERGLKVKEYQLRDRNFSATGNF
                     GFGIEEHIDLGIKYDPSIGIFGMDFYVVMGRPGARIARRKRCRATIGNSHKTSKEDTI
                     SWFKQKYDADVLNK"
     gene            <361278..>362138
                     /gene="TPHA0M01750"
                     /locus_tag="TPHA_0M01750"
                     /db_xref="GeneID:11531960"
     mRNA            <361278..>362138
                     /gene="TPHA0M01750"
                     /locus_tag="TPHA_0M01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688136.1"
                     /db_xref="GeneID:11531960"
     CDS             361278..362138
                     /gene="TPHA0M01750"
                     /locus_tag="TPHA_0M01750"
                     /inference="similar to DNA sequence:INSDC:YPR103W"
                     /note="similar to Saccharomyces cerevisiae PRE2 (YPR103W);
                     ancestral locus Anc_3.417"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688184.1"
                     /db_xref="GeneID:11531960"
                     /db_xref="GOA:G8C0N5"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:G8C0N5"
                     /translation="MQAIANGFNQNSLIKELQYDNEDNLNEDFILGNNNFSKIAPSLT
                     MPPISAPRDFLRAHTDDATNPDCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGNWVAS
                     QTVNKVIRINPFLLGTMAGGAADCQYWETWLGSQCRLHELKEKERISVAAASKILSNL
                     VYQYKGAGLSMGTMICGYTKKEGPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNY
                     KWDLTVDEALYLGKRSILAAAHRDAYSGGSINLYHVTENGWVYHGNHDVGSTFWEIKE
                     KEGSFNNVVG"
     gene            complement(<362411..>365506)
                     /gene="TPHA0M01760"
                     /locus_tag="TPHA_0M01760"
                     /db_xref="GeneID:11531896"
     mRNA            complement(<362411..>365506)
                     /gene="TPHA0M01760"
                     /locus_tag="TPHA_0M01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688137.1"
                     /db_xref="GeneID:11531896"
     CDS             complement(362411..365506)
                     /gene="TPHA0M01760"
                     /locus_tag="TPHA_0M01760"
                     /inference="similar to DNA sequence:INSDC:YPR104C"
                     /note="similar to Saccharomyces cerevisiae FHL1 (YPR104C);
                     ancestral locus Anc_3.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688185.1"
                     /db_xref="GeneID:11531896"
                     /db_xref="GOA:G8C0N6"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:G8C0N6"
                     /translation="MNEDLSASSNANSINTDALPNEDIKSTEDNSLLYRDYERIKDEE
                     PNVGNPNEHDIEAGIHSLELPEHDFSKLLEFDSKHNDAILSAANDILNSTDIDKKDTI
                     ESQEEHNETTGNTDKHNKVQLNTKEGETNPNANEITSTNSEISDKTIKKEEEKFLSTE
                     TPNESKPNPDHFKIMNSPQSIIYEKNTLFNRQRKNSLTPTTFKNHEFPASSTRIPNQN
                     ISNASTTNNIVSGHSLTNSNISNQNKSSNNDGSMPLVEEQPTISAYARLDFQSFTFYV
                     QTLHVIIGRRSDNDFSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSVIGKNGAFID
                     DVFIERGNTVPLRNTTKIQIGQIPFQFILPEKDKSNEKNNSKTKNAESATNVSKTDTT
                     KKSKKKPSTAKTKTTAVAKDTNTKETVPQTTKEDKKPIASPKKKKAKAAAADEKKAPK
                     PPKKVYSINEIPVEYRTKPLSSYSSLLTTCLKKYSTQKGMSLSEIYSGIKELFPYYKY
                     CPDGWQSSVRHNLSLNKSFKKISKEGKGWLWGLDEQHIAERELQKKKQAENAAAKAQA
                     NQLKLDQQKGRKTTSRTKKSGSSDGTGKEQNISQTLAANRSTVKENKVDDHQRTMKYL
                     QEQLMILTKDRKGLSKPVIASILTQALAMTINQVTQAAKNKGITGNPLTALMDKNPQH
                     LNLILAAAVNAATSKVTNGKIKQLVNLSLSAAMVSAPAPKAKQSTLASSSVKKSTAAN
                     NSSATEPVKSSVKSTPPVTKSTNSGSSFDPTSLSRFFQPRQPARVTPTPELKRTIPKK
                     RALSTASDSSGEEGESSSDDNSSNESSSEGEDDEEDGENTNENNKSDNSGSETSSDES
                     ESNDESDNSDVEVGDPEKTTPKVTASKVEYQNKNSGTNGKEDTAADKLEAENSNNPTT
                     GAETSISHQNTKTQDTAGVTKVGPTSDDILDSKLEDIHTLEKTNVSIVPTSVSIEDAL
                     SEALLEDNDLIEHSDDLNIDTSGITSIANNNSLEKSHNIEAMDVDELNDPENIENHNN
                     S"
     gene            complement(<366308..>366940)
                     /gene="TPHA0M01770"
                     /locus_tag="TPHA_0M01770"
                     /db_xref="GeneID:11531897"
     mRNA            complement(<366308..>366940)
                     /gene="TPHA0M01770"
                     /locus_tag="TPHA_0M01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688138.1"
                     /db_xref="GeneID:11531897"
     CDS             complement(366308..366940)
                     /gene="TPHA0M01770"
                     /locus_tag="TPHA_0M01770"
                     /inference="similar to DNA sequence:INSDC:YPR107C"
                     /note="similar to Saccharomyces cerevisiae YTH1 (YPR107C);
                     ancestral locus Anc_3.422"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688186.1"
                     /db_xref="GeneID:11531897"
                     /db_xref="GOA:G8C0N7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:G8C0N7"
                     /translation="MSVVHPETNKYNFKFEPFLRQEYSLSLDPDRPICEYYNGISSDS
                     CPLGNNCPKKHVLPIFHNKIVCKHWLRGLCKKNDNCEYLHEYNLRKMPECVFFSKNGF
                     CTQTPECQYLHIDPLNKIPKCEDYELGYCAQGPNCNKRHISKTLCQRYLTGFCPLGKG
                     CDSAHPVFNIWNMNDDSIRIKKDEEINTRQSDAEKERRLNAIINGEIDFD"
     gene            <368492..>371146
                     /gene="TPHA0M01780"
                     /locus_tag="TPHA_0M01780"
                     /db_xref="GeneID:11531898"
     mRNA            <368492..>371146
                     /gene="TPHA0M01780"
                     /locus_tag="TPHA_0M01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688139.1"
                     /db_xref="GeneID:11531898"
     CDS             368492..371146
                     /gene="TPHA0M01780"
                     /locus_tag="TPHA_0M01780"
                     /inference="similar to DNA sequence:INSDC:YGR089W"
                     /note="similar to Saccharomyces cerevisiae NNF2 (YGR089W);
                     ancestral locus Anc_3.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688187.1"
                     /db_xref="GeneID:11531898"
                     /db_xref="UniProtKB/TrEMBL:G8C0N8"
                     /translation="MQDHQNHHVHGLNIMSLMTSNKLIDTFAIFIILLNLNNFYLLVL
                     SFLFIISKRYTHFKSDVFITILLYKIPSYNDLHLENFKKGILNDNKTISKNLKDNKHI
                     IEFLVNIGIASFLRTYFKYDIIKYIQKFALSIIASSMVNQQSNRLLFAVLSCLMIITI
                     SWTKEYAQHGLFLQTFLRQRNELYKLLGENIIYFENIKQRTNLLMNSYNNYEITNPFM
                     FNTEVNNYIDILFYLLSFHLIVVQLLHDVNAKLKGSENQKFMQATDNYTQQGSKYNTN
                     NTDDSIRGGELITVFSDAISNYNFCEQVSASYNSQTVAMTDPIVANGFNSKQKGNRDS
                     SNLKDNTNIIKNKFYQLNIDSSRLGSDESTLNEVNNGNFNDFNAKDNNSRKNNYSNEK
                     FNIQITETTNIENFIRYLFQWKRNYSLSPLWSMFFIVRATIFEKKYLKGMTTTKDNIN
                     NINNTKHSESSQSNQNSDSNNLNAEVVKKSLFNTTEADNSMALISRSASDEYKRLNII
                     STNENIFNRGNNDYKLCIINISCNSITFHIENLHEGQLIVLVNGVIWSEVSCALLLNR
                     EGEEYVEVNGLVPLSSYDIQFINRLEDSFDYLISDVVVRTSSALGSRNGTDDSDQSSI
                     SESLTYGRKSNSTNMPASMNNMYTIDFSFPSFYHRKFLSPLLTLKHSVLTTNTNLAEE
                     RVKLRKSKKEISKKLNAIKQEIDNCKSKIDQNIFHDEKSTTKMDNLKISLKKSEEMNS
                     KLEQQLKEISEFELKTEERYLKEKDLHLKRVLEYSKLEENLRTSYEDNDKKLSNLKSD
                     ELNLISKLEKLKSKYDKLEKEANQDSTETDELKSRFINKRLQDRSKREEARIKNSTEF
                     QFAIKALEQDISRIESENQNFQRIIPNY"
     gene            <371496..>372491
                     /gene="TPHA0M01790"
                     /locus_tag="TPHA_0M01790"
                     /db_xref="GeneID:11531899"
     mRNA            <371496..>372491
                     /gene="TPHA0M01790"
                     /locus_tag="TPHA_0M01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688140.1"
                     /db_xref="GeneID:11531899"
     CDS             371496..372491
                     /gene="TPHA0M01790"
                     /locus_tag="TPHA_0M01790"
                     /inference="similar to DNA sequence:INSDC:YNR027W"
                     /note="similar to Saccharomyces cerevisiae BUD17
                     (YNR027W); ancestral locus Anc_6.334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688188.1"
                     /db_xref="GeneID:11531899"
                     /db_xref="GOA:G8C0N9"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8C0N9"
                     /translation="MTGNNNNQEISERTKRVLSIQSHVVHGYVGNKAATFPLQYQGWE
                     VDALNTVQFSNHPGYQFFTGYSSSPNELVDIISKGLIDESELSYDAILTGYISDVEGL
                     RKIGDLISQLCKDSKKIKWLLDPVLGDNGKLYVSEENIKIYQEILRTASIYVVTPNQF
                     EMEVLTNVKITDLPSLRVAFEVFREHYPTIQNVVVTSVELPEHPDVLTSACSTFNNAD
                     KNKLYIDIFEVPIIPAKFSGSGDLFSAILLNNLFSYKPVPKNEGELLKSALHRTLIQE
                     DAILKRTYELTLKEFNHTQTIDNLSIVKDLKLIQSKDLLVDESLYSNVSFKCSSI"
     gene            <372912..>374525
                     /gene="TPHA0M01800"
                     /locus_tag="TPHA_0M01800"
                     /db_xref="GeneID:11531953"
     mRNA            <372912..>374525
                     /gene="TPHA0M01800"
                     /locus_tag="TPHA_0M01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688141.1"
                     /db_xref="GeneID:11531953"
     CDS             372912..374525
                     /gene="TPHA0M01800"
                     /locus_tag="TPHA_0M01800"
                     /inference="similar to DNA sequence:INSDC:YCR068W"
                     /note="similar to Saccharomyces cerevisiae ATG15
                     (YCR068W); ancestral locus Anc_6.335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688189.1"
                     /db_xref="GeneID:11531953"
                     /db_xref="GOA:G8C0P0"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8C0P0"
                     /translation="MGILLKEKQQLQSTDILLSQLKGAIFVLTFILSIFAYFKLSRQA
                     DLGIPEESRQLSGSFKLTRIYRHGIGMYHDKHQILEIDDTNMESLRANYQSELYIMNT
                     NEHDEGMDQLWTSNPMYTTDNPFNYEFKLGAKNKNLLRLVNRDPEFIEAYLDSYGSSN
                     VFENKVLEWKEGGEDVLVPDVTDMNTVISLALMSSNAYVKLPQTGDWRNVTEPWKESR
                     SDGYGWDSDGLRGHIFYNEVNDIVVLSVKGTSAQGIPGAGDDETTTNDKLNDNLLFSC
                     CCARVSYLWTTVCDCYTKSYTCDESCLEQSMKRKDGYYQAVMEIYKDILEAYPTASVW
                     LTGHSLGGALSALLARTYGLPAITFEAPGEALAAKRLHLPYPPGLPEYEEHIWHIGHT
                     ADPIFMGTCNGASSSCSIAGYAMETQCHSGYECVYDVVKDKGWHVNILNHRIHTLIDK
                     ILNEYDEVAQCVRPEECIDCYNWNFIPNQDETSSAITTTSNKKTKTNTRSKTATKTTS
                     TTNTKTTTAVRCIGRNWVGICTDYGPAPT"
     gene            <375523..>376464
                     /gene="TPHA0M01810"
                     /locus_tag="TPHA_0M01810"
                     /db_xref="GeneID:11531954"
     mRNA            <375523..>376464
                     /gene="TPHA0M01810"
                     /locus_tag="TPHA_0M01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688142.1"
                     /db_xref="GeneID:11531954"
     CDS             375523..376464
                     /gene="TPHA0M01810"
                     /locus_tag="TPHA_0M01810"
                     /inference="similar to DNA sequence:INSDC:YCR069W,YNR028W"
                     /note="similar to Saccharomyces cerevisiae CPR4 (YCR069W)
                     and CPR8 (YNR028W); ancestral locus Anc_6.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688190.1"
                     /db_xref="GeneID:11531954"
                     /db_xref="GOA:G8C0P1"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:G8C0P1"
                     /translation="MWFNKLSFVSTFLFFVTLVLALDKEKIYEPNPPTTHRVFMTIKY
                     FDVKADKFKEQEITIDLYGTVVKKTVFNFASLAEGVKARIQGQDPNDIKVLGYKGTKF
                     TKVVPNGMILGGDVIPEIGPFSVHGPSFPDENFFLKHDRPGRLAMANNGPDSNNSQFF
                     ISTKLEPATELDNRSVVFGQVVSGLEGLLDSVQNVETGPNNKPVRDVEITYSVVNELK
                     LADPEGLHTAYIQKVEKFRRGDESQGISIKQMLTEGSKKKKSVKGKAKGKKSATGFQP
                     IQALYIILGLAGLAIIIQFIRKSLKKKSKNTAALRTD"
     gene            <377036..>378745
                     /gene="TPHA0M01820"
                     /locus_tag="TPHA_0M01820"
                     /db_xref="GeneID:11531955"
     mRNA            <377036..>378745
                     /gene="TPHA0M01820"
                     /locus_tag="TPHA_0M01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688143.1"
                     /db_xref="GeneID:11531955"
     CDS             377036..378745
                     /gene="TPHA0M01820"
                     /locus_tag="TPHA_0M01820"
                     /inference="similar to DNA sequence:INSDC:YNR030W"
                     /note="similar to Saccharomyces cerevisiae ALG12
                     (YNR030W); ancestral locus Anc_6.338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688191.1"
                     /db_xref="GeneID:11531955"
                     /db_xref="GOA:G8C0P2"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8C0P2"
                     /translation="MRWSVADSAVIAVVSFYLIQAPFTKVEESFSIQAIYDILKYGVV
                     DISQYNHFSFPGAVPRSFVGPLIIACLSKPLVLVSEYISRTSKPITDFDTQLLVRCVI
                     GLTNAISLIYLKNSAIRCLELDKERLQEEDRKRKEESRSLKSRVPEVNLYTVGNWFLA
                     FTISSFHLMFYSSRPLPNFIMAFPLTNIVFSWILLGEYRYAIALCAIVATVFRIEVAA
                     LGIGLTLFSLTFKKITVFNALKFGIIGTLTGITISLVIDSYFWHGYCVPEIDAFIFNV
                     VEGQASKWGVESPLAYFTHYLRLIYIPPTILLLCILGYSVAPSPLRITFLTSLFHILA
                     LSLQPHKEWRFIVYSLPMITLAGSVAAAYLWENINMNTTFKMGLISLLPLSPIISGTA
                     SLIFLFISKLNYPGGNALVQFNEMIVNNNITNVTVHMCVPAKMTGITLFGELNPDVYG
                     VVYDASEDTQILREKWSSFDYLISAEPEASYLPFEKKPENNWELINTASMFGGINTEF
                     LVDFFVSGNQTAYSICKDMLFNGSVTDNLNNFLDSAVRHDNVLFIYKRIGYDIEEEDK
                     GTN"
     gene            complement(<378923..>380470)
                     /gene="TPHA0M01830"
                     /locus_tag="TPHA_0M01830"
                     /db_xref="GeneID:11531956"
     mRNA            complement(<378923..>380470)
                     /gene="TPHA0M01830"
                     /locus_tag="TPHA_0M01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688144.1"
                     /db_xref="GeneID:11531956"
     CDS             complement(378923..380470)
                     /gene="TPHA0M01830"
                     /locus_tag="TPHA_0M01830"
                     /inference="similar to DNA sequence:INSDC:YCR072C"
                     /note="similar to Saccharomyces cerevisiae RSA4 (YCR072C);
                     ancestral locus Anc_6.340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688192.1"
                     /db_xref="GeneID:11531956"
                     /db_xref="GOA:G8C0P3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8C0P3"
                     /translation="MATVIPPPSKKQRKAAQQEREVDIIPTSLPNVLVKFQASDTNET
                     LGGSIRVPGAITEKQLEELLNQLNGTSDDPVPYVFSCNVKGKNKIDPEQIIDIVDNLY
                     STLLKPGHNTTEDIITLIYTPRAIFKVRPITRSSAAIAGHGSTILCSSFAPHTSSRMV
                     TGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSPDGELIATGSMDNTIRLWEGKNG
                     KPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDTGRRVCLYTLSG
                     HVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYAL
                     RVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKST
                     KPISRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQV
                     AWSSDCRLLASCSKDTSLKVWDIRTKKLSVDLPGHLDEVYTVDWSVDGKRVCSGGKDK
                     MVRLWTH"
     gene            complement(<380953..>385818)
                     /gene="TPHA0M01840"
                     /locus_tag="TPHA_0M01840"
                     /db_xref="GeneID:11531832"
     mRNA            complement(<380953..>385818)
                     /gene="TPHA0M01840"
                     /locus_tag="TPHA_0M01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688145.1"
                     /db_xref="GeneID:11531832"
     CDS             complement(380953..385818)
                     /gene="TPHA0M01840"
                     /locus_tag="TPHA_0M01840"
                     /inference="similar to DNA sequence:INSDC:YCR073C,YNR031C"
                     /note="similar to Saccharomyces cerevisiae SSK22 (YCR073C)
                     and SSK2 (YNR031C); ancestral locus Anc_6.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688193.1"
                     /db_xref="GeneID:11531832"
                     /db_xref="GOA:G8C0P4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C0P4"
                     /translation="MEQLSPQLPQYSRSEKEISPVPASPSHGLYTHHDSGINTPIRNN
                     SSNSGYFSPVVDNSISQKILKDGLTPTHSIEQSPIKVPRPIHDLKSPSIASESRPSNY
                     LEFVNNKGDDDGDKNNSIPVYNYKHRRPSSSVSTGSLHQGNGMKLYMDGTNSPSKVLR
                     SNTIGSATNVKGQMNNISRIKSNGYSKGSVGSTADIHKLKSHSSMNLKQNPHGIYQYN
                     GTSAVSNKHLNTLQQVNSTSNRSSSSQISMNGKILDNNNSNTKLTGIITNPNIEKIAS
                     HELVAKNGNLASNSPTVMNNETKRQSSWNEKLYLEKIRKYVPHDYYTRGIVASTLKDD
                     DVDLDLEIDDMIGNSISNEDDDVDFGSNFFTENIDSNSISMSSRYLLHRLEWLKLADP
                     ENEIVKEVFKNIGIKSEFDKDILVSSFAKLSYDNQNLLSRLSEHPLVIERFEWQTMLS
                     NVLKGDIVKSEKSKLATHARPAGIGKQLNISIWLELKAWMNGKSVEDQTKSLTALRDS
                     TDAFFNEIVTFKLPENSNAEDCEMILTPLINKYFKVVKYWCNLQQMYEHKPITKTPEF
                     VNRIDTIVSWLNFKANFETHINLLKEWVGNSELDITKVNKPSISIEGVYENARSFAEQ
                     IMKEKNVEQIFQRKIFHPLAPWILKAKSSIQYYSPVVDDLNLVYLNDELELLLMFPVI
                     LIKEIILIRLEYAKKLENPTMMMIDEMIDDFSSYIRLAVQMKYTVNEYCADWQFEVNM
                     DSQFDETVVKAISYLFSLINLKLLDSGKVSLKSLKEADELFDFWEKLRNVGHYIDKAG
                     KLIAKEFNKLSLRILHRLHMYMLQDTNIPETITDGADAEKWLLQLFENIGTRKRKLNR
                     FTNVLVKAFQNSMNFKINDHDLLLKQLHETGHFLIYTGSKLEQKGYYLIGSPELLDSN
                     ENEILTILNKPDICCDLIPKIEIKNSLAMYNSTKSSSDTYLTRTPDFGPEHFNFYEDT
                     VKKLQRVPSDTFEEHDPKTELLEIEAKLQSLGYVLVLAPKEPVLWEGEIYTLSENIKT
                     KFDNLNIKASPDHFTLVSQGSSHSLEYSSEKLLQVAGNCVTFVERKSSYSSVEDGLQR
                     INKAYFRITYTAISNFPKILNTFYKFCPDNELLNSIFLFTRDFGRSFLRVNVATYSKK
                     SVIIMLLMKASTTWLTFLVERCDPTDIKTFRWCVPAMEFAMRLTCGWNILGLDEKQFT
                     TLKQRISTCMTLLISHFDVMGARALEAERANQQFRPQIDIEEDVNDDEILMVNSQLRV
                     KAIEELENTMTHNPRQIGKVLDDTDSGNKYLLSLASSMSNVSIKWQKRQFVGSGTFGT
                     VFSAVNLGNGEILAVKEIKIQDAKAMKKVFPLIKDEMSVLEMLNHPNIVQYYGIEVHR
                     DKVNLFMEFCEGGSLAGLLEHGRIEDEMVTQMYSLELLEGLVYLHQSGIVHRDIKPEN
                     ILLDFNGIIKFVDFGAARKIAENNTKVEGQNDSISDNEGTIEDATSSKGVHNIVGTPM
                     YMAPETITGSAVKGQFGADDVWSLGCVILEMITGKRPWAHLDNEWAIMYHVAAGHIPP
                     FPNKNELSKAGFTFLKRAIVQKPDKRATAVELLTHPWIVEIRELAFGSADSEQSADVS
                     NEDVNVSKVAE"
     gene            <386485..>387678
                     /gene="TPHA0M01850"
                     /locus_tag="TPHA_0M01850"
                     /db_xref="GeneID:11531833"
     mRNA            <386485..>387678
                     /gene="TPHA0M01850"
                     /locus_tag="TPHA_0M01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688146.1"
                     /db_xref="GeneID:11531833"
     CDS             386485..387678
                     /gene="TPHA0M01850"
                     /locus_tag="TPHA_0M01850"
                     /inference="similar to DNA sequence:INSDC:YNR032W"
                     /note="similar to Saccharomyces cerevisiae PPG1 (YNR032W);
                     ancestral locus Anc_6.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688194.1"
                     /db_xref="GeneID:11531833"
                     /db_xref="GOA:G8C0P5"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8C0P5"
                     /translation="MMEPDQCLQYLYKGQLLPEATIKALCFKLKEMLVKESNVVYIQS
                     PVTVVGDIHGQFHDLLEIFEIGGRVPDTNYLFLGDYVDRGLYSIETILLLIVLKLRYP
                     NRVHLIRGNHESRQITQSYGFYTECLNKYGSSSKVWQYITDLFDYLILCCVIDDRLFC
                     VHGGLSPNVQTIDQIKIIDRFREIPHDGAIADLVWSDPEEHNLMANPSNREELYQETS
                     QHFQISPRGAGYTFGRSVVEKFLEINGMDRIYRAHQLCNDGYQIYFDGLVTTVWSAPN
                     YCYRCGNKASILELYSADEYYFNVFVEAPENRLLNDQVMNSVANRNTISEYFSDYQLS
                     ITNGKDNTNDTSYDYKEFYKNGGNDVDELETDLMKMSLSTNSDIFSDSFQAQSARNRK
                     VEYFL"
     gene            <388224..>390533
                     /gene="TPHA0M01860"
                     /locus_tag="TPHA_0M01860"
                     /db_xref="GeneID:11531834"
     mRNA            <388224..>390533
                     /gene="TPHA0M01860"
                     /locus_tag="TPHA_0M01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688147.1"
                     /db_xref="GeneID:11531834"
     CDS             388224..390533
                     /gene="TPHA0M01860"
                     /locus_tag="TPHA_0M01860"
                     /inference="similar to DNA sequence:INSDC:YNR033W"
                     /note="similar to Saccharomyces cerevisiae ABZ1 (YNR033W);
                     ancestral locus Anc_6.344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688195.1"
                     /db_xref="GeneID:11531834"
                     /db_xref="GOA:G8C0P6"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR010117"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8C0P6"
                     /translation="MNQFHVLFIDSYDSFTYNVVRLIEQQIAKGYSSIHVTIIHNNSF
                     NDINELDNYLKYFDCIVIGPGPGNPMNGLDDVGIINSLFDEKYKEIPMLGICLGFQAM
                     CLSQDAQVKELDAIKHGQIYNIKLTGPQNSNSIFAGYPSNFNSTRYHSLHVSGWNDAI
                     EPLAFTSDENGEVLMAAKIKNKNWFGVQYHPESCCSELGNVLIDNFLRLANEMNIESG
                     RITLKKSLRQDSELEFNNVIKYLDKCTSIAPLYHIDEKDIASDNPIYLEEFSISQDPN
                     YSLKLCDAINESKFLMASSSISQNRGEWSIIALPNSDSTVFTHYDQLHKTTIHKWQDP
                     RLNTATMKESLLSLDAINHPETNGLEIVNEDKSHFWITLSHFMKDKFVKNNQDIPFIG
                     GLIGILGYEMGNYVSNDLNPSDILIPDAKLVFIENSIVINHCSGRLYVISLSHNFPKH
                     ILKVIKNLDIAKELEWPKTLPKGTTFDIQMPSKDDYSDAFNKCQEYIHRGDSYEICLT
                     TQTKIIPSIYLEPWKIFQTLIQQNPAPFSSYFEFNDLVDSSENNSSLCLISTSPERFL
                     KWNNEFCELRPIKGTVKKGKKMTTEKATEILKTPKEFGENLMILDLIRNDLYELLSQV
                     KVDEFMSVEEYKTVYQLVSVIKGFFGKERNGNSYYGLDVFRHSLPAGSMTGAPKKITV
                     EILQNEIEKTLNKHVNGGVRGVYSGVTGYWSINNNSDWSVNIRCMYSYNRGQTWKIGA
                     GGAITVLSTLEGEREEMFTKLESALQVFM"
     gene            complement(<390700..>392445)
                     /gene="TPHA0M01870"
                     /locus_tag="TPHA_0M01870"
                     /db_xref="GeneID:11531835"
     mRNA            complement(<390700..>392445)
                     /gene="TPHA0M01870"
                     /locus_tag="TPHA_0M01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688148.1"
                     /db_xref="GeneID:11531835"
     CDS             complement(390700..392445)
                     /gene="TPHA0M01870"
                     /locus_tag="TPHA_0M01870"
                     /note="ancestral locus Anc_6.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688196.1"
                     /db_xref="GeneID:11531835"
                     /db_xref="UniProtKB/TrEMBL:G8C0P7"
                     /translation="MSLTLLIGSLFAFAYSLIVINRYFSFKLHKNTFPLTLCIISFNM
                     IILLSTTYLLPLDLFFAAHLNDGEGNHNGTMPSINGTLVNEEKIVSFVEHLSLNLLEV
                     DYSEKRLRAVWLSIYWSEFIICWLIIPVLISYVSFKYAVPLGDFRGRLIKAILQNLKF
                     YSISLAVIMAGGVYLVASTGHNLFDFKPLLISLAHIYSLSYALILLSTGLILLPKDLL
                     QQGNLPTESSNNKLFVELSKTNDDLNGCEFSMMENANSILNTEELQNGDITVNELLRS
                     CKLEVNSLLTGLRLNNENRPFRNPSDLSTVAIITVDKLNSTYNKFITHYYNYLYSQTH
                     SNSIIHKLAHVESPYYSNIKRIVLVVIGVICTIASLVVFFMEILPTKWAHGWIFTKTH
                     WYNFGLQFLFLSYTMLVSLYAMSKFKFSNFHLIPNGNSNPSNTLYYSLYSSRLLFPIC
                     FNLMTLIPTKNDDERHVSSFESTLYKDISLIPVVNVLNRYAPILFLIIIPLNHHFNLK
                     EKVLMKVLGEEYYYQFFGMMMYEPVEDPNVNQEGDPLEDDSLRRIEEDYAYSLQDGRH
                     LFERASSNYSLTERT"
     gene            <392816..>393061
                     /gene="TPHA0M01880"
                     /locus_tag="TPHA_0M01880"
                     /db_xref="GeneID:11531828"
     mRNA            <392816..>393061
                     /gene="TPHA0M01880"
                     /locus_tag="TPHA_0M01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688149.1"
                     /db_xref="GeneID:11531828"
     CDS             392816..393061
                     /gene="TPHA0M01880"
                     /locus_tag="TPHA_0M01880"
                     /inference="similar to DNA
                     sequence:INSDC:YNR034W-A,YCR075W-A"
                     /note="similar to Saccharomyces cerevisiae YNR034W-A and
                     YCR075W-A; ancestral locus Anc_6.348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688197.1"
                     /db_xref="GeneID:11531828"
                     /db_xref="InterPro:IPR021591"
                     /db_xref="UniProtKB/TrEMBL:G8C0P8"
                     /translation="METSRNKLQQLPHVVGTLTFDENNNVVTVTGIASDRILDIDSIS
                     KVELDSEGFGLVQINNLICNIYRQDNNTVVIYQDKNN"
     gene            complement(<393266..>394222)
                     /gene="TPHA0M01890"
                     /locus_tag="TPHA_0M01890"
                     /db_xref="GeneID:11531829"
     mRNA            complement(<393266..>394222)
                     /gene="TPHA0M01890"
                     /locus_tag="TPHA_0M01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688150.1"
                     /db_xref="GeneID:11531829"
     CDS             complement(393266..394222)
                     /gene="TPHA0M01890"
                     /locus_tag="TPHA_0M01890"
                     /inference="similar to DNA sequence:INSDC:YCR076C"
                     /note="similar to Saccharomyces cerevisiae YCR076C;
                     ancestral locus Anc_6.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688198.1"
                     /db_xref="GeneID:11531829"
                     /db_xref="InterPro:IPR013886"
                     /db_xref="UniProtKB/TrEMBL:G8C0P9"
                     /translation="MSDKLILNKLGLSVEIILSYLKNRIGEYRVDEFSKETKLVTVKL
                     VLNKQIEVKQLKIVVVEIEVDKECMVSVVTNSESLAQSIFNYHDDLSISSELQFPLNH
                     LENGDYESQYTIIDAKLKLPLKLGYVDVQDEKRNASGESRELKEAGNQSSLYPSTDLD
                     IADNPTSRKGDWNPKRPDDMPGFEDEYEIKDNTRTPFNDNRFPGLNIHPPNAQGYGDK
                     DLYPGGQKFPDFNNPVGGILEDPTYLRGQGGMAFDPKIRPGDSRNRGPGYISGSKYDD
                     PLGNHSDATDGFNNDNSGGPGFGGPGFGGPGFGASGFGGGFM"
     gene            complement(<394557..>397247)
                     /gene="TPHA0M01900"
                     /locus_tag="TPHA_0M01900"
                     /db_xref="GeneID:11531830"
     mRNA            complement(<394557..>397247)
                     /gene="TPHA0M01900"
                     /locus_tag="TPHA_0M01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688151.1"
                     /db_xref="GeneID:11531830"
     CDS             complement(394557..397247)
                     /gene="TPHA0M01900"
                     /locus_tag="TPHA_0M01900"
                     /inference="similar to DNA sequence:INSDC:YCR077C"
                     /note="similar to Saccharomyces cerevisiae PAT1 (YCR077C);
                     ancestral locus Anc_6.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688199.1"
                     /db_xref="GeneID:11531830"
                     /db_xref="InterPro:IPR019167"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q0"
                     /translation="MSFFGFNSKLPNEGNRQRHDHGKKDNNNSPLDFEDTYKGYGEYE
                     REEDDYLNDETFGDDVAFGTDFDFGHGSSSANSGMISTNQSQGQQGFNDPVGMQGAQA
                     QQQQFQMHSSYAAAASTTVPQQQAQMNVTMDMRPMESLWSNQPDMSTQVGQNEVLSME
                     ELERQQIQMQQQQQHPPPQMFMPNYPNQQPQQPQQQFQNNYQNNFQNNFQNPQNMNNQ
                     FQQPPPPQIFNQPPPPNQQQTQAQMNQAPVHMDSPGQFNPQHMHAMHAVPGGMPMPMQ
                     MNNQISNHLHHQQFDPSLELKNQNQHRQQQVMGQNIGQNELLENDQALSTPSPKPTHQ
                     VLQREDGSIASNGNNNQSYIHIKDKGPRRMSRRSEPLSSEEQKRLQIRHAKVEKILKN
                     AGLMTPRDKDFITRYQLSQIVTEDPYNEDFYFQVYKIIQTGGVAGKSNKDLIARAYLE
                     HSGHRLGGRYKRADVALQRMQNQVEKAVTVAKERPQKNKDNTDSAREGVLGKISSSLN
                     SKAPRRQLQIPSPKLSDEEDESKLSSHASSESLEEVTESLNNVGINQSSRSRRRSSYA
                     FSSVDQISVLSRSGGRKFVLSLIETVYEEVLELEAQLRSGNETDSTGLWESLHIGDEA
                     YDVSPFISMLSFDKGVKIMPRIFNFLDKASKLKLLQTFFNELSHLNVIIISSFKTNPT
                     PTEAQLKKIELFQGVFLKIIVSFLSSSADFIEIMGLLLHLIRNNNVSFISTSTLGLNL
                     ITILISRAAIIKQDCNRTNSLSSPDIQAWNEIYDKLFISLETKLSLVFPPQEYRDTVV
                     KETSQSGQLQQSNTQYFDQSYIWQFLASLALSGKLNHQRIIIDEVRDEIFGTINCAEQ
                     MKSLPDQSSAYRRDKLYQDLNLFLNVMGLVARDGEISELK"
     gene            complement(<397815..>398336)
                     /gene="TPHA0M01910"
                     /locus_tag="TPHA_0M01910"
                     /db_xref="GeneID:11531831"
     mRNA            complement(<397815..>398336)
                     /gene="TPHA0M01910"
                     /locus_tag="TPHA_0M01910"
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /transcript_id="XM_003688152.1"
                     /db_xref="GeneID:11531831"
     CDS             complement(397815..398336)
                     /gene="TPHA0M01910"
                     /locus_tag="TPHA_0M01910"
                     /inference="similar to DNA sequence:INSDC:YNR036C"
                     /note="similar to Saccharomyces cerevisiae YNR036C;
                     ancestral locus Anc_6.352"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /protein_id="XP_003688200.1"
                     /db_xref="GeneID:11531831"
                     /db_xref="GOA:G8C0Q1"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q1"
                     /translation="MSFFSRFTRRSALSLRAFGASQILNPISINNTSRKFLHQSTILN
                     ATLNQIKRGAKQPPRNKKVSMAPDLENCPIRKGVVLRVMVLKPKKPNSAQRKAARVKL
                     TNGNVVSAYIPGEGHNAQEHSIVYVRGGRCQDLPGVKYHLVRGAGDLSGVVNRITSRS
                     KYGAKKPAAQKAE"
     gene            <399103..>400599
                     /gene="TPHA0M01920"
                     /locus_tag="TPHA_0M01920"
                     /db_xref="GeneID:11531836"
     mRNA            <399103..>400599
                     /gene="TPHA0M01920"
                     /locus_tag="TPHA_0M01920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688153.1"
                     /db_xref="GeneID:11531836"
     CDS             399103..400599
                     /gene="TPHA0M01920"
                     /locus_tag="TPHA_0M01920"
                     /inference="similar to DNA sequence:INSDC:YCR079W"
                     /note="similar to Saccharomyces cerevisiae PTC6 (YCR079W);
                     ancestral locus Anc_6.353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688201.1"
                     /db_xref="GeneID:11531836"
                     /db_xref="GOA:G8C0Q2"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q2"
                     /translation="MVASQSFIRIKPVNLVKLSAQRNGRAATHMSSVSETVESAKNDQ
                     HMLRIPLKRFPSVIGHSTSRISRRFNEDTYSMSLLKLPSITQELLISQKLKNGEVLDD
                     VELRSRSILNLSVFDGHGGDRVSKLLAEKLHDEVSNDFITKEDFYELLRRYKDLIKGR
                     YWENLYRTRDTFYEKFIKNCNTKEEQVLFGLDNQGSRMIFDKWGNIIDKISLLTEQER
                     LRIFYAYLKFDLESCCGYGKTGDSSTMSLQDRVETFKGGSTASSIFISAYGNEHNLFD
                     ESFFVDPRSLLKLVVTQVGDSKILLCDSNGIAHSLTKIHSASSKRESKRLLYQDDMEV
                     NNDTSLNSEADIIEEDAFGDKRFLNNFANTRSFGDLIGKPEGLSSEPDIYSYLIGSTK
                     TIPHSEKSKLQFGGDECFITLISDGVSNILSDQEVVDLITSTVNLRGLKKATPQYVAD
                     EVIKFISALSNRNSDNATCVVLRLPNWGNWPNIDRSGAERELKLLNVP"
     gene            complement(<400849..>401124)
                     /gene="TPHA0M01930"
                     /locus_tag="TPHA_0M01930"
                     /db_xref="GeneID:11531837"
     mRNA            complement(<400849..>401124)
                     /gene="TPHA0M01930"
                     /locus_tag="TPHA_0M01930"
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /transcript_id="XM_003688154.1"
                     /db_xref="GeneID:11531837"
     CDS             complement(400849..401124)
                     /gene="TPHA0M01930"
                     /locus_tag="TPHA_0M01930"
                     /inference="similar to DNA sequence:INSDC:YNR037C"
                     /note="similar to Saccharomyces cerevisiae RSM19
                     (YNR037C); ancestral locus Anc_6.354"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /protein_id="XP_003688202.1"
                     /db_xref="GeneID:11531837"
                     /db_xref="GOA:G8C0Q3"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q3"
                     /translation="MIPTIRLLARSAWKGPNIVPLPIKEAIKNGVPIRTNARSATILP
                     QFVGLKFQVHNGKEYVAFEVVEDMIGCKLGEFVPTRKRFKYSQTKNK"
     gene            <401463..>403469
                     /gene="TPHA0M01940"
                     /locus_tag="TPHA_0M01940"
                     /db_xref="GeneID:11531838"
     mRNA            <401463..>403469
                     /gene="TPHA0M01940"
                     /locus_tag="TPHA_0M01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688155.1"
                     /db_xref="GeneID:11531838"
     CDS             401463..403469
                     /gene="TPHA0M01940"
                     /locus_tag="TPHA_0M01940"
                     /inference="similar to DNA sequence:INSDC:YNR038W"
                     /note="similar to Saccharomyces cerevisiae DBP6 (YNR038W);
                     ancestral locus Anc_6.355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688203.1"
                     /db_xref="GeneID:11531838"
                     /db_xref="GOA:G8C0Q4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q4"
                     /translation="MFALRFNPTEAVTDVPDQLEGKPKKLIPLKRNKSSDDEKESDDE
                     EPDVVDSSSSVLEELDFQEEESSDESAEESEVNIPDADRIEKNAEQKENKQGEDQEHM
                     DIDTDEESSTKHSMVFSRFQQTLSLQDKMKKSSMVNDDGEEEEEEEEVEQHDLESIPQ
                     PARVRDSTIEYSKTGEHKDTAWKFTEKIHYDNSMIKSFDDYKNQLDPKLLKNIQEKFS
                     TETFPIQTILLDTVLPSLNFALGITKKNLTRRVGDILVNASTGSGKTLAYSIPILQAL
                     IKRNVNKLRAIIIVPTKLLINQVFNTLNSLASGSSLIISTSRLESSLNEEHQKLLANE
                     PDIVVVTPGRLVDHLQMGSISVKNLKFLVLDEADRLLNQSFQNWCNELLSKIRTQKSD
                     IMPGNIIKMVFSATLTTNTEKLHSLQFYHPKLFVVDSVKLYNIPKKLQEFNFAIPTAK
                     SIYKPLFLLRLLDQLSNAKVLVFVKSNQNSLRLTSLLSKLIEQNLGKKHTIESVNSNN
                     SRGTNRKIVNDFSDDRLKKDVCTVLITTDIMSRGIDINNITDVINYDLPISSQQYVHR
                     VGRTARAGTEGTTYNLLVGKGERKFWTDHINVDIARDADGYKPKYVGQGEHIGTETDN
                     KDQANDADQQRQRFEYTNPLLEIAQKDINNYKDALSSLHELTNQ"
     gene            <404072..>408352
                     /gene="TPHA0M01950"
                     /locus_tag="TPHA_0M01950"
                     /db_xref="GeneID:11531839"
     mRNA            <404072..>408352
                     /gene="TPHA0M01950"
                     /locus_tag="TPHA_0M01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688156.1"
                     /db_xref="GeneID:11531839"
     CDS             404072..408352
                     /gene="TPHA0M01950"
                     /locus_tag="TPHA_0M01950"
                     /inference="similar to DNA sequence:INSDC:YCR081W"
                     /note="similar to Saccharomyces cerevisiae SRB8 (YCR081W);
                     ancestral locus Anc_6.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688204.1"
                     /db_xref="GeneID:11531839"
                     /db_xref="GOA:G8C0Q5"
                     /db_xref="InterPro:IPR019035"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q5"
                     /translation="MNPAKYVLIPPDELHPLVEDNDGKFKNSYPDFEPWVHTRQDDEI
                     MLHFVAKGYYSSSKVNFESISARSSMQESLPKLADELANQFSDIIKIRELEINKISSE
                     AETYNSDTRFSILSGPGFSLPSRMTLSDQRKDQWLNDLSSPYVSLTQMSKFLPHGLKR
                     RGLLEQCCLRKVPIIKAIWLLKCCYSMEWTQLKLKSKDNKDHKDDKEINSQLLKEWTE
                     NFIYILEKMLLDMANYYNDPEKLKNWKSGIQYYLKLLGNCYRLELIDKQIFLYWLVEF
                     VGKVENLEYFPLTFHILTIFWQDITTVAENDALMKPLFLVTKITDILLHKYVTISQSR
                     SMISDEKYIINDIKKNNKIKESFLLMIRNLICDLFQNQLLEIFLFPSAKWEIYKPYLY
                     EITNYLGNSEDIHNEAKKKLELISYRNESLKINSTLRSSNVNADELTSVENKNVDLHH
                     VKLNCIDTVLAQALDDNSIDFDWASYVDREITQLSQVVQLVLWAISPSKRKHYEAHQI
                     VARIILLIINSLANLREYVIEDIIWSVVFQIPKLSDEERTLFISLPDLYRLLNTLVNY
                     GIVKVPTYIRKLISSGILYLTSSDDKFFHCTVLINLKISPLMKNQYNMVLRNVMEYDS
                     HYFEDYNFDTINNQVEILRPELMSGESFDYDTLTYNTKTLLGEKILSSICGEELIMVN
                     KQILLKNFDILCVKLDTFHLFYKWVEYIVYHQLIDNTETLEILCDILLRYSKLFSQYI
                     NDHILFTKTLILIYTKIVKVNDNVAYSVSSLMPFWKFFMKSFPYAIKYDENLRNELGA
                     IYEEEKLKADKLCKDRFLLKSINEALHGNIANSTGSTFNFPEVFQTNLRTFLSENIDN
                     ATRKNSRYMMMLLMNVNRRDYNKFIAVYLKRKTFKIEDLIYLISYKLLTFEQIQNTLT
                     MDFVLTVLSYNHSESSRYNEHIQFYAISKASYISSNFKSIIHSTMKKIDELYEFFLDI
                     LVEFGTYSKHLENTIEAIVQFLKDEKCSHYDLIIDLINYGVENKDKDDTQEIVLNESN
                     NLYEFLDFTNLWIFQGYTKYLLQKYLLESNDFERTREFLFETVLASRYSCLCSRLFWA
                     ISDPEIMKAVITIFEERFFKNCLDDSEEYNVMWEVIIEIITSLSQQLKVNNNRTSSQS
                     IGVANTRSPSLNNIDFISKNYNTDSWDLNSEDTAEVSSFSIYIESFDAIISHFAKMDK
                     DKLLGMRCKLDSFLKISILNQISIFNFVTKLIKKNEVKYLNDLLENIFTLFHKISFDL
                     SLELMLYEILSSLKSYCIFFATTENSKNKNQNSQSNTNSGSSNISISKAPDKKNNAFV
                     IPSILMELSPFKVSSFTRKERVDEIDDNISLGINTVDTTRENTNRKKSPNNFFFYDKV
                     QNTYLCKFYDEPYHCINNYQSEATSDSFNNSCLNLSFFDAVYERKNPK"
     gene            <409080..>409469
                     /gene="TPHA0M01960"
                     /locus_tag="TPHA_0M01960"
                     /db_xref="GeneID:11531880"
     mRNA            <409080..>409469
                     /gene="TPHA0M01960"
                     /locus_tag="TPHA_0M01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688157.1"
                     /db_xref="GeneID:11531880"
     CDS             409080..409469
                     /gene="TPHA0M01960"
                     /locus_tag="TPHA_0M01960"
                     /inference="similar to DNA sequence:INSDC:YCR082W"
                     /note="similar to Saccharomyces cerevisiae AHC2 (YCR082W);
                     ancestral locus Anc_6.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688205.1"
                     /db_xref="GeneID:11531880"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q6"
                     /translation="MITPEHIQSNIKYFQENDIENDNDYQLLMQQKHVMEQKLMERNY
                     YHKNFQLLYSLVEKSRNYQEFVDILVNNKTLLKEIFTLEGQLRRSHHLINSDNVEIDW
                     LHKFGIDIMEYIVKDPKLFSLYNNGLL"
     gene            <410065..>410958
                     /gene="TPHA0M01970"
                     /locus_tag="TPHA_0M01970"
                     /db_xref="GeneID:11531881"
     mRNA            <410065..>410958
                     /gene="TPHA0M01970"
                     /locus_tag="TPHA_0M01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688158.1"
                     /db_xref="GeneID:11531881"
     CDS             410065..410958
                     /gene="TPHA0M01970"
                     /locus_tag="TPHA_0M01970"
                     /inference="similar to DNA sequence:INSDC:YNR040W"
                     /note="similar to Saccharomyces cerevisiae YNR040W;
                     ancestral locus Anc_6.360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688206.1"
                     /db_xref="GeneID:11531881"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q7"
                     /translation="MVANLSVAKVLNGLLSKNTPTVIYAKPLKRSIKVATALLSFSFF
                     GYGISFASWSWESSLSRLRDLKQRDEIAKGSTWEKVKFYASTLSPFILPILPLTISVG
                     ALLVRSRVVSKVTYYPPITAGSKPLVEFTRNSLLLSRPVVTKRLVPSINTVGKTKIFT
                     GEGTNGAENKSSYIFYLTDKNPLVEHFWDKIFIFQRSGSFFMDDPRTFDALFGGDSIK
                     SLDSLKRSKQLSNVTNNRTDTYQQEEKEAEDNKRLLSKLSEKQLQRAKIHSNSAKSIV
                     QNINSNHKKIINIFWRTAIEL"
     gene            complement(<410969..>412075)
                     /gene="TPHA0M01980"
                     /locus_tag="TPHA_0M01980"
                     /db_xref="GeneID:11531882"
     mRNA            complement(<410969..>412075)
                     /gene="TPHA0M01980"
                     /locus_tag="TPHA_0M01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688159.1"
                     /db_xref="GeneID:11531882"
     CDS             complement(410969..412075)
                     /gene="TPHA0M01980"
                     /locus_tag="TPHA_0M01980"
                     /inference="similar to DNA sequence:INSDC:YNR041C"
                     /note="similar to Saccharomyces cerevisiae COQ2 (YNR041C);
                     ancestral locus Anc_6.361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688207.1"
                     /db_xref="GeneID:11531882"
                     /db_xref="GOA:G8C0Q8"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q8"
                     /translation="MVSSFNGSQFIKKSVVSCKSFCEVNGSLFTRGQFRGYSSAKVPE
                     DKPVFTEDELKNARKDRLENLGPFVSKLPQKWIPYAELMRLEKPVGTWLLYLPGTWAI
                     TMAAIQTSASLGATVWMLGLFGLGSLVMRGAGCTINDIWDKNLDDKVIRSVERPIASK
                     RVSTKNASIFLVAQTVVGMGVLAQLPAQCWWMGLASLPIVFTYPLFKRFTYYPQIALS
                     ACFNWAALLGFPAMGIMDWSTMLPLYTGSFLWCMIYDTIYAHQDKAFDVKAGIKSTAL
                     AWGKNTKKISTVLATAQFSLFTIAGINAGLILGPGFIGGLAIFAYRVFTMIKNVDLNN
                     PADCWKYFTSNIKTGLYFSYALFFDYLLTLLGFL"
     gene            <412659..>413849
                     /gene="TPHA0M01990"
                     /locus_tag="TPHA_0M01990"
                     /db_xref="GeneID:11531883"
     mRNA            <412659..>413849
                     /gene="TPHA0M01990"
                     /locus_tag="TPHA_0M01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688160.1"
                     /db_xref="GeneID:11531883"
     CDS             412659..413849
                     /gene="TPHA0M01990"
                     /locus_tag="TPHA_0M01990"
                     /inference="similar to DNA sequence:INSDC:YNR043W"
                     /note="similar to Saccharomyces cerevisiae MVD1 (YNR043W);
                     ancestral locus Anc_6.362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688208.1"
                     /db_xref="GeneID:11531883"
                     /db_xref="GOA:G8C0Q9"
                     /db_xref="InterPro:IPR005935"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR029765"
                     /db_xref="UniProtKB/TrEMBL:G8C0Q9"
                     /translation="MTLHVASATAPVNIATLKYWGKRDKDLNLPTNSSISVTLSQDDL
                     RTLTSVACGPELQEDKLWLNGKEESLGSERTQNCLKDLRDLRAKMEASDSSMPTMSQW
                     KLHIVSENNFPTAAGLASSAAGFAALVVAITKVFQLKEDYSEISKIARKGSGSACRSL
                     FGGYVAWEMGQSIDGSDSKAVPVSTKEDWPNMKAAVLVVSDVKKDTPSTSGMQLTVKT
                     SDLFQERIKNVVPKRFEEMKKSIVEKDFATFADLTMKDSNSFHATCLDSYPPIFYMND
                     TSRKIIRLVHNINAFYNETIVAYTYDAGPNAVLYYLEENEEKLFAFIYKYFNKVSGWD
                     TKYNASELQNFLKKFDAVEEKLNFQTDEDIYKGVSRVILTRVGDGPQSTDQCLINKET
                     GLPN"
     gene            complement(<414262..>416361)
                     /gene="TPHA0M02000"
                     /locus_tag="TPHA_0M02000"
                     /db_xref="GeneID:11531884"
     mRNA            complement(<414262..>416361)
                     /gene="TPHA0M02000"
                     /locus_tag="TPHA_0M02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688161.1"
                     /db_xref="GeneID:11531884"
     CDS             complement(414262..416361)
                     /gene="TPHA0M02000"
                     /locus_tag="TPHA_0M02000"
                     /inference="similar to DNA sequence:INSDC:YCR084C"
                     /note="similar to Saccharomyces cerevisiae TUP1 (YCR084C);
                     ancestral locus Anc_6.363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688209.1"
                     /db_xref="GeneID:11531884"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8C0R0"
                     /translation="MSAPPNKVNDLLEAVRQEFAQVSQEANSYRLQNQKDYDSKVNQQ
                     LAEMQQIRNTVYELELTHRKMKDAYEEEINRLKIELDQRGLQLSSLSAHHSQQQQLQQ
                     QQHQQQQQGSPNTANAVFPQHIQQPYQAPVGSMPQLVPAHLQQSQLPSSGAQTLPFPP
                     GSISVAAAGQPQAPPVVAAPAPALTQPAQSEFAGSPATAPASVAPAKPAPVAAPVAPA
                     APIIAAVEKPAAPLPAASAAAASAAVPAVPVEPKQEAAPVPVPAIASKTEDKKTEAPA
                     PAKEAKATSATKESHYLVPYDQRANHTKPIPPFLLDLDSQTIPAGLKKQTDDYYILYN
                     PALPRNIDVELHKSLDHTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDD
                     SASHITPGQNSKDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRL
                     IRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTLS
                     IEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSV
                     VFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQG
                     DEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGD
                     CKARIWKYRKIADSDKM"
     gene            <417174..>417746
                     /gene="TPHA0M02020"
                     /locus_tag="TPHA_0M02020"
                     /db_xref="GeneID:11531885"
     mRNA            <417174..>417746
                     /gene="TPHA0M02020"
                     /locus_tag="TPHA_0M02020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688162.1"
                     /db_xref="GeneID:11531885"
     CDS             417174..417746
                     /gene="TPHA0M02020"
                     /locus_tag="TPHA_0M02020"
                     /inference="similar to DNA sequence:INSDC:YCR086W"
                     /note="similar to Saccharomyces cerevisiae CSM1 (YCR086W);
                     ancestral locus Anc_6.364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688210.1"
                     /db_xref="GeneID:11531885"
                     /db_xref="InterPro:IPR020981"
                     /db_xref="UniProtKB/TrEMBL:G8C0R1"
                     /translation="MANTLEQYKKLIGERLDNADLLVSKLVLENSLLKQQLESKDEQL
                     KLLNGRLEHLAAQEQRHASALQDANEATEIVKDLFEHMCGVRLHKSYEDDTGLWFDTS
                     QGSSKGVMDYKLGFVKAQASDSAGSADSSTSAGGTQVIYVPLLKQRSAEELKKLQEQL
                     PDYMFDTLSFPLASLNQFYTKLTRSLNKHE"
     gene            complement(<417871..>418290)
                     /gene="TPHA0M02030"
                     /locus_tag="TPHA_0M02030"
                     /db_xref="GeneID:11531886"
     mRNA            complement(<417871..>418290)
                     /gene="TPHA0M02030"
                     /locus_tag="TPHA_0M02030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688163.1"
                     /db_xref="GeneID:11531886"
     CDS             complement(417871..418290)
                     /gene="TPHA0M02030"
                     /locus_tag="TPHA_0M02030"
                     /inference="similar to DNA sequence:INSDC:YCR087C-A"
                     /note="similar to Saccharomyces cerevisiae YCR087C-A;
                     ancestral locus Anc_6.365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688211.1"
                     /db_xref="GeneID:11531886"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="UniProtKB/TrEMBL:G8C0R2"
                     /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPNAYYTCIDCSTTFDDGYS
                     YQKHTECITEDEKYQKALYQGKKKGGKKTEVKKAEAKKPEAKKTEAKKPEAKPKFTLT
                     KGESLYKIMKTLKDKDAKKELLKRLIVDESGNLILKE"
     gene            <419072..>422623
                     /gene="TPHA0M02040"
                     /locus_tag="TPHA_0M02040"
                     /db_xref="GeneID:11531887"
     mRNA            <419072..>422623
                     /gene="TPHA0M02040"
                     /locus_tag="TPHA_0M02040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688164.1"
                     /db_xref="GeneID:11531887"
     CDS             419072..422623
                     /gene="TPHA0M02040"
                     /locus_tag="TPHA_0M02040"
                     /inference="similar to DNA sequence:INSDC:YCR089W,YNR044W"
                     /note="similar to Saccharomyces cerevisiae FIG2 (YCR089W)
                     and AGA1 (YNR044W); ancestral locus Anc_6.367"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688212.1"
                     /db_xref="GeneID:11531887"
                     /db_xref="UniProtKB/TrEMBL:G8C0R3"
                     /translation="MAKLQLTKQSFLCALLLTQFATASQTDYSVRYSNNTVNESDTFS
                     ALSTAANEDSVYSSGDTSSLLGDYSSSITSSDIRIPSASLSDTGTSTHEVYNESRLDY
                     DTELSKESSQIAFTSSYLDSTLISTSSQNIATSIATSHYEYDESSTIQQEKSISIGEI
                     DSTQESETITQKEIHQSSYLMDSSLSTLTTENLEDSESAKPNDSTHELETNTFKSYGQ
                     SSIEITDSPSTSQVQNYSVESSKENSSTNEYESSSNLYSTLSKSSYNYETTFTTSSDS
                     YDIDMTRSSNDYDVIVSTTSDYNSQMTISANEYSDDSITSTITLATEHTLSSDDYTSE
                     VETSNIEFSEKLSIDSNYNFTITTITTQESATSIRYDENSSAITITSVYPTTITSTIC
                     DLCTEKPLSSTAGKVTTIYYTSSSQDTTISSNTDSYQLTTIQITTSNSDDIEYTTESI
                     ALVSTSTTWIDETQIVYTTWCPLSSQSVTPINSTSYLDAPPSDLEFNTTSGSYLLSTV
                     ATDVDSTYTTLISLTDESFSSSSSTSEESSISETTLSSSEHYSSEDLVLTSSTVTSQF
                     SLSSKPFIASISSLTVSPLSESSMSLTTSNITLTDSPSTLDKTAISSYYHSVESISYT
                     LPSSELETSSVISTTTYDKETANTGKDITNKTSALVKSSTELVPTSQEVYSIQPESFS
                     EEVVTSLSITVITSTIEVCSNDICTKSLDFITSTSIVMISSDHSISTTPTLTQQISSS
                     SIPISISSIYTEPSFNETTTRSPTTIVEICTEETCIDSSDETDSSAEATSSSTTVSSY
                     VVKWTSSTITTTISGIKTIYTTYCPLTDISSSTSSSTITSQPTIRSASILISSTSTSV
                     STSKWTSSTITTTISGVKTVYTTYCPLTDTDSSASSSAITSQPTSTPSTFTAHSTTTS
                     NSATTSVSSTLSPSTTTSPAASKWASSTITTTISGIRTIYTTYCPLTEISSSIFTYST
                     TSQSVILSSSATATSLSASKWISSTITTTVSGMETIYTTYCPFTDVSSSPTIASTIEV
                     PSSTTVSTIISSSSYLPVSPSTVTSPSNTALNPATTNTSGTETTVTSYITSTSKLTSS
                     TDINVTRSGVDYSTNENLPFSTETSTSSIIVETPVSKTLAAITDSSLTTVSILQQTSN
                     SHYGTSTTSGIQDYNGSASSLKISNFIIALLSLFMLI"
     gene            complement(<422774..>423334)
                     /gene="TPHA0M02050"
                     /locus_tag="TPHA_0M02050"
                     /db_xref="GeneID:11531904"
     mRNA            complement(<422774..>423334)
                     /gene="TPHA0M02050"
                     /locus_tag="TPHA_0M02050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688165.1"
                     /db_xref="GeneID:11531904"
     CDS             complement(422774..423334)
                     /gene="TPHA0M02050"
                     /locus_tag="TPHA_0M02050"
                     /inference="similar to DNA sequence:INSDC:YCR090C"
                     /note="similar to Saccharomyces cerevisiae YCR090C;
                     ancestral locus Anc_6.368"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688213.1"
                     /db_xref="GeneID:11531904"
                     /db_xref="InterPro:IPR008584"
                     /db_xref="UniProtKB/TrEMBL:G8C0R4"
                     /translation="MLYLVAEALFSENIRSISVKNDPSSPAEFSFNLVCTNCREEHES
                     AVSINTFEKHDMPGSKGEASFILKCKFCDKDCSVNMNTFEDVFYNIENSQNTSELEAI
                     ALQREKKGIKNIKGNQSVLLEFDCRGCEVTKFHISSVPYKVNLNNKKTLEFEFEEGDN
                     EWYDYDDDSAEEVSITEFNTEIMRGK"
     gene            <423979..>425589
                     /gene="TPHA0M02060"
                     /locus_tag="TPHA_0M02060"
                     /db_xref="GeneID:11531905"
     mRNA            <423979..>425589
                     /gene="TPHA0M02060"
                     /locus_tag="TPHA_0M02060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688166.1"
                     /db_xref="GeneID:11531905"
     CDS             423979..425589
                     /gene="TPHA0M02060"
                     /locus_tag="TPHA_0M02060"
                     /inference="similar to DNA sequence:INSDC:YNR045W"
                     /note="similar to Saccharomyces cerevisiae PET494
                     (YNR045W); ancestral locus Anc_6.369"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688214.1"
                     /db_xref="GeneID:11531905"
                     /db_xref="UniProtKB/TrEMBL:G8C0R5"
                     /translation="MPSLLNRKFQLSRGYARWYSRRIRRSGLFSMRFKHNTLLYISKN
                     DYSATNILWKYFNAPGNVLFVTTNIVTFTGMVAYNTCVSNGKENALDENILSIQTALE
                     KGPNTSEGISLNDYPIIDSELERYLPLRTEYPPNINAVPELDRKEVEETEMSPFKTIT
                     KEDLQLEGTARTVNFESQLAKLSIFNLLYSYYMYKSVLYNIKGRNKPNEGKFYNTFNL
                     WHKETEEMSEQYLASEAGESSVDKIPLNGFYSLWKTNFTNSIKSFSEVQNLKLPNWRI
                     YPKNLQKLCESLYNNDMTIIADFAEFYHELNDDKYKEVRNLLRLWLYDNMTLFKETNS
                     KSKIFSNSSKYNLRKIKHANEIFYNELLDDSKDDITLFLKYSSIALNSQNKNRRNFMF
                     PKLLIDSEKDNNSVTIQIDVPTISLETLLNVLDGFVRLKENKGIDCHDSIVKIISMLK
                     KDCILSKTQDKNATMTGTRKDHVSVILLPNDLEQRVEIACQLDNKLKTINNYELMNHH
                     DDLRKKCYRIVSTNPKAIQLLEKISQWE"
     gene            <425953..>426378
                     /gene="TPHA0M02070"
                     /locus_tag="TPHA_0M02070"
                     /db_xref="GeneID:11531906"
     mRNA            <425953..>426378
                     /gene="TPHA0M02070"
                     /locus_tag="TPHA_0M02070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688167.1"
                     /db_xref="GeneID:11531906"
     CDS             425953..426378
                     /gene="TPHA0M02070"
                     /locus_tag="TPHA_0M02070"
                     /inference="similar to DNA sequence:INSDC:YNR046W"
                     /note="similar to Saccharomyces cerevisiae TRM112
                     (YNR046W); ancestral locus Anc_6.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688215.1"
                     /db_xref="GeneID:11531906"
                     /db_xref="InterPro:IPR005651"
                     /db_xref="UniProtKB/TrEMBL:G8C0R6"
                     /translation="MKFLTTNFLKCSVGACDNSNDNFPLRYEGSKCQIVQDETVEFNP
                     QFLLNILDRVDWNAIVTVARELGNQSLPVTKPQFTHQNGDANTASNLTEDELAVLQDL
                     HVLLLQTSIAEGQMSCRNCNHIYHIKNGIPNLLLPPHLA"
     gene            <426966..>429635
                     /gene="TPHA0M02080"
                     /locus_tag="TPHA_0M02080"
                     /db_xref="GeneID:11531907"
     mRNA            <426966..>429635
                     /gene="TPHA0M02080"
                     /locus_tag="TPHA_0M02080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688168.1"
                     /db_xref="GeneID:11531907"
     CDS             426966..429635
                     /gene="TPHA0M02080"
                     /locus_tag="TPHA_0M02080"
                     /inference="similar to DNA sequence:INSDC:YCR091W,YNR047W"
                     /note="similar to Saccharomyces cerevisiae KIN82 (YCR091W)
                     and YNR047W; ancestral locus Anc_6.371"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688216.1"
                     /db_xref="GeneID:11531907"
                     /db_xref="GOA:G8C0R7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:G8C0R7"
                     /translation="MVEKDQLNEKSRTVSFSKMLQKSLRLNSNSGNNDPATAPREMFS
                     DDDSRARKSNSIELDAEQARNRSLADFNGNGDNFSNDNDNDNDNDNKTNKSNTSRLLR
                     LKSFFSSTNSSMDNASSAFSDKNSSSNVSKVSAFLKQNSNVNITSSGGTPATDSNNEL
                     AARKLDPKGNKHSYKSRSNSNLSSRVEQNTDMHRSRSPLAHSKNSKNALNMVDLTDLT
                     FENTPTSSKKIIGDISPSGNSQSSFQEFPSLESNATASLSSPPQKHVFQVQSLMVSSH
                     SQEQLDIDSQRFLQQVNSISSLKDIRNPSLNSLTEIKEDERLDHFYNSMLAKNHDFES
                     NGTFGNENKLVESRRDTITTNYSDLSLSLSNDEFQPFTTITIDFDNNNEKNQNEQQPT
                     EFDIPNKAFAATKSLSPVRTRPHRTSSEPNYYQSSVSRKNQSNLIKNNIASQDALNLS
                     APPKLFDAFEEPKRSNRLRAKSFSNKFQDIVVSPQAFEKIRLLGQGDVGKVYLVREKA
                     SSRLYALKIFSKAEMIKRKKIKRVLVEQEILATSEHPFIVNLYHSFQSEDYLYLCMEY
                     CMGGEFFRALQTRKTKCISEDDARFYAAEVVAALEYLHLMGFIYRDLKPENILLHKSG
                     HIMLSDFDLSIQTTSSKEPVVKKLAQSAVVDTKICSDGFRTNSFVGTEEYIAPEVIRG
                     NGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNDTFCNILKDDVTFPNNNEISRNCKDL
                     IKKLLTKNELKRLGSKTGAADVKRHPFFKKVQWSFLRNQDPPLIPVLSEDGCDFSKLS
                     TNKKKSKDISDAISLTTIDKQEKNMFEETVEFDDDVSEDDPFHNFNSMSIMKQDNNSL
                     VYGDNNSYGKVSYTTNANRVRSDSHRSFFKRNL"
     gene            <430238..>436132
                     /gene="TPHA0M02090"
                     /locus_tag="TPHA_0M02090"
                     /db_xref="GeneID:11531908"
     mRNA            <430238..>436132
                     /gene="TPHA0M02090"
                     /locus_tag="TPHA_0M02090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688169.1"
                     /db_xref="GeneID:11531908"
     CDS             430238..436132
                     /gene="TPHA0M02090"
                     /locus_tag="TPHA_0M02090"
                     /inference="similar to DNA sequence:INSDC:YCR093W"
                     /note="similar to Saccharomyces cerevisiae CDC39
                     (YCR093W); ancestral locus Anc_6.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688217.1"
                     /db_xref="GeneID:11531908"
                     /db_xref="InterPro:IPR007196"
                     /db_xref="UniProtKB/TrEMBL:G8C0R8"
                     /translation="MNEAEFKPNNYEEVFVDDLKLTESAHIHSLLLNIDELNYEKIKR
                     TILFYLEEVSEYAFIKYWKTILSINSNFIINSERRFRDLEEEPEDDRIMIHLLYDSLQ
                     ELQYISMSKILLITDIILNDTFLSTICENMKLSHILRHLDPIIDDIIIKRLQIRNNYI
                     PVESQLEEASKNIEKEFINIVASSNESNFWLKSSLLLEYADDNDRMKMLSLFITKLLI
                     SDKSILYLFPSSTNLEDVVNYLYKNNKLKNETMSFARYKALNWNNIFQVINKNISSED
                     VNAITPKSILFILALFNNIGIWKEFFGFPWDEDFVTTLLSFVRHFDERIKGSFLYSEL
                     NEQVIYQQNKLSEFHSEIPIFAYFNTITFLRFGFSKSVDMLSSDLKKLSIGIYDIPDN
                     YLLTIMNNFEYLRNVIKEEATLINFTNNLLDQLMMQHPTTFEPLFQNINDLTILPLLL
                     KKNEKKATYFNYFKENFDKINKMDIFLEALDIEDKLLFQKTEDPNKFTSVPKLNVNEI
                     KLLINYLDEIVKSKVCTYTALELGQLLLETRNYLLKNEFDSTFDDKEYRLLMKFPKII
                     LHDKFEGIELSENNLIIQKSVDNEVQKKLISLYKNELLLDDLIQYLIKLKLSTSIQDN
                     ELYCAFIYFLIFESDFFFQYPKTILEITAELWGLLIQNNVVEAVSLDVFCKIITKFQK
                     SEDERLKLFATISSNIFNDKEIITLPKFLKTIKVNNPSNNTLFSSEMILESDNNANSK
                     PTSFTRYFKDTPYSAKKDQIKPELVSDSKIYVLLLNLTEKNFTTNLKHFKVLVTPPYF
                     TYFCRTILSKFISQTNDNKVFEKLIFGMNSKQLIECMIHETVSALLVLLDTDSCDISE
                     LHKLALWLGLITIAHDIEIANNILPLRQILIDSVENGYIDKVISTVCGILVHAKESHT
                     FRFPNIWTSSILQELFQIYHLSVLSIPHLFEIEFLFNELFGNIKNFKMPELVAEYDRL
                     SENDIPLGKKINNTKIEPQLSRKSVNHLTVFRIDKISNKATSTSILAIVSNLVGSSTL
                     VSNKDLRETFGMAISKSVYTVVTNLYETGFEHVLPICLMETEKLYNVDMNEERLNLII
                     VEIMNKVPLKKLLLDATQCIKVDTKQNMELLCSMNSLKDLSMETDIDGTLQENESLIY
                     KIFSSLLTELFFYEIKKFIMQKHKSELDSQDNIKCLREALKVSNLQKNNHQINNISMT
                     AIKNETMAHDTPPGLSIISNQVARKPTVHNYLTTPENDDKNAVAHLINLYLRNLKSNI
                     LNSTDNGINLNGVISLNIQICTKILELFPKYNTNAELKSIIFHEVFQLLVITQNDSFK
                     EIMFQFLKEFKHEFSNFKVFINWWFIKFLPLHPIYSKELLRFSFEKIIGNEDLDFILS
                     SILLTNRSSSFIEFLCEFFFQCISNKSEMLLKSEFISTVEALSRFNNDAAKHVLNVFD
                     SYSLLQNIESSSQTKKNKYILILIEFISLLKNSSTEGKVILVFLKQLFQKKVFCDTND
                     LIEFFNILLQYSEQMFTASTSATDALLVVDAVVVLFMNLLIYLDIDNLLRKDVVELFM
                     SQISFHFNEQHNINKLNERFYFRLYSSLLCQWSSMVTDDFKSVENESIQHDLKEFIPI
                     FYNTITSALHSFQPVLFPGFSFAFLSLISHRMLLPFYLQNESYWMDITLLFGDVLKFI
                     DLYSTQEYVSTIIEVLTNGMINIFEKISDEYPQYLIANHSQLIALLPESSVKLKNIVL
                     SSSPVGFETECYRKELDETVVNDSSAPSIKTDPTLIISRIKKPLVSYIRMPSSSSLMQ
                     INKDIYLRNLKTVNGIGYNVITVDPKKIRAIILFILIQLANELKKLSYKVVFNLNSSY
                     YTLLKSMIFVDGSDKEEVRYRLISVIVEQLRYPNIHTFWCIYFLENIYQNHDETDDEI
                     VLKEVQEIILRCIFERLLIVNDGPYPWGCVELLIHLINLRKVDITDLQLIKNNATFKS
                     KLEQFF"
     gene            <436568..>437755
                     /gene="TPHA0M02100"
                     /locus_tag="TPHA_0M02100"
                     /db_xref="GeneID:11531909"
     mRNA            <436568..>437755
                     /gene="TPHA0M02100"
                     /locus_tag="TPHA_0M02100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688170.1"
                     /db_xref="GeneID:11531909"
     CDS             436568..437755
                     /gene="TPHA0M02100"
                     /locus_tag="TPHA_0M02100"
                     /inference="similar to DNA sequence:INSDC:YCR094W,YNR048W"
                     /note="similar to Saccharomyces cerevisiae CDC50 (YCR094W)
                     and YNR048W; ancestral locus Anc_6.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688218.1"
                     /db_xref="GeneID:11531909"
                     /db_xref="GOA:G8C0R9"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:G8C0R9"
                     /translation="MILPKIKKSFKTIVGYGSDKGGTKVSRRPANTSFRQQRLKAWNP
                     ILSPQNVLPLLILLACILAPIGIGLIISVISVQDTIIEYTNCSSESTTTSFTQIPDKY
                     IKYHFKQKLNMEPMWRSFVNTDSDETICQLRFEIPNDVKTPINVYYKLTNFYQNHREY
                     VDSIDIDQLKGEAIPYSDLDDKCDPFREYNGKTVYPCGLIANSMFNDTFASEFVGIDD
                     TRNYKLTNNNTAWSTDKHRYKKTKYDINDIVPPVNWIKKFPNGYTEENLPDLNTWQEF
                     QVWARPAALPNFYKLILKNETVTLPTGNYTFDIGLNYPVDSFDGTKSFVLTTNTIVGA
                     RNITLGVVYLIVAGISTLFAFIFLIKVLLSPKENSDHLYLRNAHLTGRNGTRPELPIR
                     EIL"
     gene            complement(<437928..>438590)
                     /gene="TPHA0M02110"
                     /locus_tag="TPHA_0M02110"
                     /db_xref="GeneID:11531910"
     mRNA            complement(<437928..>438590)
                     /gene="TPHA0M02110"
                     /locus_tag="TPHA_0M02110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688171.1"
                     /db_xref="GeneID:11531910"
     CDS             complement(437928..438590)
                     /gene="TPHA0M02110"
                     /locus_tag="TPHA_0M02110"
                     /inference="similar to DNA sequence:INSDC:YNR049C"
                     /note="similar to Saccharomyces cerevisiae MSO1 (YNR049C);
                     ancestral locus Anc_6.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688219.1"
                     /db_xref="GeneID:11531910"
                     /db_xref="InterPro:IPR028095"
                     /db_xref="UniProtKB/TrEMBL:G8C0S0"
                     /translation="MSAYTSNSDSDNLWNKFTKSTKSISNSLSQLSVKSDSDGNSIET
                     TLVHKALVKYYQNQQPFQGFPGWLGHKEDLPDENKILKKQMGQQEKLQKKSEPSSGGG
                     VFMSTRNRNSYTNMLNEPIRQIPEPTPKPEVTKVKQKPTASMSFQSIYSSFNDKNALQ
                     NTNDYTKMPTQNLGEKHGLHNQQQTNTRTSSSPERSQSSSSLMMRDRLKKQTRNGFGF
                     QQ"
     gene            complement(<439003..>440343)
                     /gene="TPHA0M02120"
                     /locus_tag="TPHA_0M02120"
                     /db_xref="GeneID:11531911"
     mRNA            complement(<439003..>440343)
                     /gene="TPHA0M02120"
                     /locus_tag="TPHA_0M02120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688172.1"
                     /db_xref="GeneID:11531911"
     CDS             complement(439003..440343)
                     /gene="TPHA0M02120"
                     /locus_tag="TPHA_0M02120"
                     /inference="similar to DNA sequence:INSDC:YNR050C"
                     /note="similar to Saccharomyces cerevisiae LYS9 (YNR050C);
                     ancestral locus Anc_6.376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688220.1"
                     /db_xref="GeneID:11531911"
                     /db_xref="GOA:G8C0S1"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C0S1"
                     /translation="MVKKVLLLGSGFVAKPVVDVLSKTGDIEVTVACRTLKNAQELAK
                     GTNSGAISLDVTDETALDKVLSENDVVISLIPYIYHSTVVKSAIRLKKNVVTSSYISP
                     ALRELEPEIKKAGITVMNEIGLDPGIDHLYAVKVIDEVHKKKGKITSFISYCGGLPSP
                     EDSDNPLGYKFSWSSRGVLLALRNSAKYYKDNQLVQVSSEDLMSSAKPYFIYPGYAFV
                     CYPNRDSTAFKELYEIPEAETVIRGTLRYQGFPEFVKVLVDMGMLKDDENDIFTKPIS
                     WSEALQRYLQSESSSKQDIIKKIDSLTQWKSDEDRERILNGFQWLGFFSTTPITPKGN
                     ALDTLCATLEELMQYTENERDMVVLQHKFGIEWADGTTETRTSTLVDYGKVGGYSSMA
                     ATVGYPVAIATQMVLNGQIEGPGLLAPYTPEINDPIMKELKDKYDIYLVEKTIA"
     gene            complement(<441494..>442825)
                     /gene="TPHA0M02130"
                     /locus_tag="TPHA_0M02130"
                     /db_xref="GeneID:11531920"
     mRNA            complement(<441494..>442825)
                     /gene="TPHA0M02130"
                     /locus_tag="TPHA_0M02130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688173.1"
                     /db_xref="GeneID:11531920"
     CDS             complement(441494..442825)
                     /gene="TPHA0M02130"
                     /locus_tag="TPHA_0M02130"
                     /inference="similar to DNA sequence:INSDC:YCR095C"
                     /note="similar to Saccharomyces cerevisiae YCR095C;
                     ancestral locus Anc_6.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688221.1"
                     /db_xref="GeneID:11531920"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8C0S2"
                     /translation="MLVPPANFGIAEEGIYRCAKVETLNLSFLETLNLKTVLFIGGQE
                     PSKYFKEFFKNSNICWHSIRNIDFSPPQEVVDIYKQSGDTINPESNPGPSNSNDSLVQ
                     ALDASKDNNHKKATNITNNNDNQNSKDNEIKDNETSELITEDSDSKSKSRYRKYVLND
                     NDESMIIKAICLKKTFEYLMNIDHHNILLVDRTNIVVGILRKLQKWNIASILNEYRLF
                     AGKNGNYFAETFLDIIKLSIKQDIDKIKKTTSINQIQMKQTEKKFDKKDKNDKGGKNT
                     KKKVHSGSNKNKSKVELVNEDDLLKAPSVPSRILKLIGDVEVETQSRMKSVQEEENET
                     NSKNDNKSHGIFGNEYRLAFNKRELGEYEYYKTSQKELTTKKTKEKKIDDEKIDEPTN
                     KQLTSKSEDNTVIIQVPVESKLPSWFIYQRNLWEQTNVIEEHNFYAENIFS"
     gene            complement(<443756..>445036)
                     /gene="TPHA0M02140"
                     /locus_tag="TPHA_0M02140"
                     /db_xref="GeneID:11531921"
     mRNA            complement(<443756..>445036)
                     /gene="TPHA0M02140"
                     /locus_tag="TPHA_0M02140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688174.1"
                     /db_xref="GeneID:11531921"
     CDS             complement(443756..445036)
                     /gene="TPHA0M02140"
                     /locus_tag="TPHA_0M02140"
                     /inference="similar to DNA sequence:INSDC:YNR051C"
                     /note="similar to Saccharomyces cerevisiae BRE5 (YNR051C);
                     ancestral locus Anc_6.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688222.1"
                     /db_xref="GeneID:11531921"
                     /db_xref="GOA:G8C0S3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:G8C0S3"
                     /translation="MATSVNEIGFAFLNIYYERMKKDPSKVSALYSNTAELTHINYQV
                     NLDENSDTVETVKLTGKENISKFFTRNNKKVCDLKVRLDSCDMQATGQSQSNIIILTT
                     GELFWTGTPTYKFCQAFVLQRSQENKNIFDITNDIIRFIPDSLEKYVIKQQENTPVDN
                     SDDGPKELEGNTGIGKPKENKVNTSTVEPVSEKQAPEMDDKNQQNDKSDENVDSSKVD
                     KQVTEQSTTKMSWASKLSSVAQKPNQVPATKTSNEESQSKNLEKSTLSDNSKKENSSN
                     KATKKKQVFSTVNKDGFFPIYIRGTTGINEDRLKKILEKEFGNIMKITSADNFAVVDF
                     ENQKSQTDALEKKKLKIDDIEVQLERKTVKRVTSTTPSPGSMNSNSNGNANNTNNISG
                     NNNTSSNNAANNTNANANANARQAKKHHSKKRDQ"
     gene            complement(<445915..>447393)
                     /gene="TPHA0M02150"
                     /locus_tag="TPHA_0M02150"
                     /db_xref="GeneID:11531922"
     mRNA            complement(<445915..>447393)
                     /gene="TPHA0M02150"
                     /locus_tag="TPHA_0M02150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688175.1"
                     /db_xref="GeneID:11531922"
     CDS             complement(445915..447393)
                     /gene="TPHA0M02150"
                     /locus_tag="TPHA_0M02150"
                     /inference="similar to DNA sequence:INSDC:YNR052C"
                     /note="similar to Saccharomyces cerevisiae POP2 (YNR052C);
                     ancestral locus Anc_6.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688223.1"
                     /db_xref="GeneID:11531922"
                     /db_xref="GOA:G8C0S4"
                     /db_xref="InterPro:IPR006941"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G8C0S4"
                     /translation="MQSINPQLPLFPGGNEQMFNQQQQQQAPNNQMFSPQINQARLIN
                     QQQPNQVLPAGMNLMNMNPGANNNNINPNKNNNQNMLNSLVMKQKLQVLQQQQQQQSQ
                     NIQAQAQAQALSQAQAQQPLNINNNNQNMPPGMNVLQRSIPSMIMNGQQQQQQQPAEL
                     LHMNVGTPSNAHVNINNANLNLNRADISNANSVPSNINNYRNNLLPPPNHLFIRDVWN
                     GNLHSEFSNLRNLIQHYNRVSISTEFAGTLARPIGNFRSKTDYHYQTMRSNVDFLNPI
                     QIGISICDANGKKPDNGPSSWQFNFKFSIEDEIVSADSLDLLKKSGINFENHKNNGIE
                     VFEFAQLLMDSGLVLEKNVTWIAFHAAYDFGFLIHLLMNDMMPNNTKDFEWKVNKYLP
                     NFYDLNLIYKIIDDFKEQLKLSQQPQQQQQQPQQQNQLSLTSLAEELGIPRFPIFTTT
                     GGNSLLTSLVFSQLSNMSMKKLPNGLEFSHYKNLIFGILNDS"
     gene            <448670..>450370
                     /gene="TPHA0M02160"
                     /locus_tag="TPHA_0M02160"
                     /db_xref="GeneID:11531923"
     mRNA            <448670..>450370
                     /gene="TPHA0M02160"
                     /locus_tag="TPHA_0M02160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688176.1"
                     /db_xref="GeneID:11531923"
     CDS             448670..450370
                     /gene="TPHA0M02160"
                     /locus_tag="TPHA_0M02160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688224.1"
                     /db_xref="GeneID:11531923"
                     /db_xref="GOA:G8C0S5"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR025724"
                     /db_xref="UniProtKB/TrEMBL:G8C0S5"
                     /translation="MQQSNGSFKQIGYAVGDLYILGNPARPLVDVSQYSFLAADKLVP
                     TVKPGLSHQSLTHARLGHPSVGLYNRLASIINEPRISETTFMPCPSCSLSKATMNKGK
                     PSATHYEHVLELIQVDLCGGFRYNGYEDNKYFMTIRDAASRYYSVIHLNSKAGAAKEL
                     MSWITKAETQFTHRGLKVLKLRTDNGTEFVSQVLHEFCSSKGIEHQLTVPHNSFQNGG
                     VERAHRTIMDKARTLLVSGGVPPYLWPEAVSCAAYLINRLPVPGKRNRVPYCVWNNVS
                     PDQLNLGHLRAFGCLAYTTLPPALRDGKFAPTAIAAVMVGYDSQRKSYRLYHPESKNI
                     YTSNQFRFDEQSYPLAESMETEVSHKFATSTLGGVPTYPKSGSITTLPHTGNYPPLTA
                     PDKFTDVTTNSAAITDSAEITDSAEITDSASTINGATTSVSDDNVQSTDNNDVTSSPV
                     NSDSEFRPSHYLRRSIVPSVEPESPALQAQIQQLHSALKAQQEAAALDIERLTSSNIR
                     LMNQIDELKVNHTTELNKAKQEFGRHIERIRPHNHTDESILGLSLPEVDVCAWLKVDI
                     "
     gene            complement(<450353..>451534)
                     /gene="TPHA0M02170"
                     /locus_tag="TPHA_0M02170"
                     /db_xref="GeneID:11531944"
     mRNA            complement(<450353..>451534)
                     /gene="TPHA0M02170"
                     /locus_tag="TPHA_0M02170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688177.1"
                     /db_xref="GeneID:11531944"
     CDS             complement(450353..451534)
                     /gene="TPHA0M02170"
                     /locus_tag="TPHA_0M02170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688225.1"
                     /db_xref="GeneID:11531944"
                     /db_xref="UniProtKB/TrEMBL:G8C0S6"
                     /translation="MSSQYAQVLTQQVMSPVANDFYFDVKLNGEDNFNFWYAPFSNKL
                     SIIRLELFEYFENNGNVTTIPVEVQENSIIKKSVLNLLDTAVKAVILTSSEAHVQAVI
                     RKYTSTHFNQSSIQVMAFLKETYGRVKVSTTAMLFNQNQSMFNKSIKEQHSWASKSLR
                     TVAKQIIAAERGTYLSDSEKENNMQKVLDHFEALMLIALNPDHQATCLNLLGRNETIN
                     SSDVISVISNNVSANSTAMTASSRSRSQKAGTKQRKRKCQLCEKDHYLNECPRFKEAF
                     PDAAIIKHYANKKNDRSWITAAETDINKDNWIFDNGSTVHICNDKTMFTEFQNGTGSQ
                     ISVVAGNVKIKGYGSVVTDTHIHHFVFYIDNLTFPLSLLQTVYTEYCGRGTPLDSNVY
                     F"
CONTIG      join(HE612868.1:1..452480)
//
DBGET integrated database retrieval system