GenomeNet

Database: RefSeq
Entry: NC_016534
LinkDB: NC_016534
Original site: NC_016534 
LOCUS       NC_016534             413379 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 15, complete genome.
ACCESSION   NC_016534
VERSION     NC_016534.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 413379)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 413379)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612870.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..413379
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="15"
     gene            <3014..>3394
                     /gene="TPHA0O00100"
                     /locus_tag="TPHA_0O00100"
                     /db_xref="GeneID:11530644"
     mRNA            <3014..>3394
                     /gene="TPHA0O00100"
                     /locus_tag="TPHA_0O00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688368.1"
                     /db_xref="GeneID:11530644"
     CDS             3014..3394
                     /gene="TPHA0O00100"
                     /locus_tag="TPHA_0O00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688416.1"
                     /db_xref="GeneID:11530644"
                     /db_xref="UniProtKB/TrEMBL:G8C1F4"
                     /translation="MSNFASAIKGGSQKKECGSSDVYVLTKDGGNWEVAWSTWTSGSN
                     CDTTASWQEIGWVLKNAVNDEEYNRKMAFCVRLDHGGTWHADVRVQRSWNRPYGNIWD
                     MPCGDLQQAYTVTNECAVDRATDF"
     gene            <7364..>7969
                     /gene="TPHA0O00110"
                     /locus_tag="TPHA_0O00110"
                     /db_xref="GeneID:11530600"
     mRNA            <7364..>7969
                     /gene="TPHA0O00110"
                     /locus_tag="TPHA_0O00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688369.1"
                     /db_xref="GeneID:11530600"
     CDS             7364..7969
                     /gene="TPHA0O00110"
                     /locus_tag="TPHA_0O00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688417.1"
                     /db_xref="GeneID:11530600"
                     /db_xref="GOA:G8C1F5"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="UniProtKB/TrEMBL:G8C1F5"
                     /translation="MKKILPYISPWGMIGFHYTIIVIFISKGHQFIRNIGSAFLCFIP
                     LTLYFIITWFSSFFLVRFLTNRMQRNKKYVTEEEFSDSDYCGCEKEYLLAGKAYGKNT
                     CGASYAVTMTQCFTTASNNFELSLAVSISLYGNRSKQAIAATFGPLLEIPILLALAYF
                     AKYLEHAFVWSDIKKESSTNADNSDIQTQIDITDLGATAKI"
     gene            complement(<9227..>9867)
                     /gene="TPHA0O00120"
                     /locus_tag="TPHA_0O00120"
                     /db_xref="GeneID:11530622"
     mRNA            complement(join(<9227..9751,9847..>9867))
                     /gene="TPHA0O00120"
                     /locus_tag="TPHA_0O00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688370.1"
                     /db_xref="GeneID:11530622"
     CDS             complement(join(9227..9751,9847..9867))
                     /gene="TPHA0O00120"
                     /locus_tag="TPHA_0O00120"
                     /inference="similar to DNA sequence:INSDC:YKL214C"
                     /note="similar to Saccharomyces cerevisiae YRA2 (YKL214C);
                     ancestral locus Anc_1.535"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688418.1"
                     /db_xref="GeneID:11530622"
                     /db_xref="GOA:G8C1F6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR025715"
                     /db_xref="UniProtKB/TrEMBL:G8C1F6"
                     /translation="MDDISENKPGEQHRVARYRRRDVRNLDNKLGFRGQAEEPVKKRV
                     KFSNLPVDVSDFTVEDMVKEFGTPVFSRFYEYKDGRTAVFELETPGAMEKVVEKYNDF
                     EINGSKIAVEMFDLRQRKPKSSFTPVYARGSRGSHYAEIREQPFTSNKSSHGSRKKAT
                     QPAKPTVEELDAELEAYMKST"
     gene            complement(<10287..>11756)
                     /gene="TPHA0O00130"
                     /locus_tag="TPHA_0O00130"
                     /db_xref="GeneID:11530623"
     mRNA            complement(<10287..>11756)
                     /gene="TPHA0O00130"
                     /locus_tag="TPHA_0O00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688371.1"
                     /db_xref="GeneID:11530623"
     CDS             complement(10287..11756)
                     /gene="TPHA0O00130"
                     /locus_tag="TPHA_0O00130"
                     /inference="similar to DNA sequence:INSDC:YKL211C"
                     /note="similar to Saccharomyces cerevisiae TRP3 (YKL211C);
                     ancestral locus Anc_1.532"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688419.1"
                     /db_xref="GeneID:11530623"
                     /db_xref="GOA:G8C1F7"
                     /db_xref="InterPro:IPR001468"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013798"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:G8C1F7"
                     /translation="MSANRKVVLIDNYDSFTWNIYEYLCQEGADVEVYRNDTITVEEV
                     ARLSPEVLVISPGPGHPKTDSGVSREAIEYFTGKIPVFGICMGQQCMFEVFGGEVAYA
                     GEIVHGKTSPIFHDNKGFFKNVPQGVSVTRYHSLAGTNETLPDVLEVSAKTESGVIMG
                     VRHKKYTVEGVQFHPEAILTEEGHLMIRNILTVTGGTWEENELNKKKQAIVSNGGGSI
                     LDKIYAQRKEDLAEQAKVPGFTERDLETNFKLGLAPSAHNFYEKLRTAKGSAAVIAEV
                     KRASPSKGDIFIDAIAAEQGLKYAEAGAAAISVLTEPHWFKGSLQDLVNIRKALDKKY
                     ESSPLQRPCILRKEFIFNKYQIIEARLAGADTVLLIVKMLSQEQLLDLYTYATKEMGI
                     EPLVEVSSKEELDCAVEIGAKVIGVNNRDLHTFNVDLQTTTSLVASTPKDTLLIALSG
                     ISTKADADKYKKEGVHGFLVGEALMRSSNVSQLITDLSV"
     gene            <12225..>13442
                     /gene="TPHA0O00140"
                     /locus_tag="TPHA_0O00140"
                     /db_xref="GeneID:11530624"
     mRNA            <12225..>13442
                     /gene="TPHA0O00140"
                     /locus_tag="TPHA_0O00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688372.1"
                     /db_xref="GeneID:11530624"
     CDS             12225..13442
                     /gene="TPHA0O00140"
                     /locus_tag="TPHA_0O00140"
                     /inference="similar to DNA sequence:INSDC:YJR076C"
                     /note="similar to Saccharomyces cerevisiae CDC11
                     (YJR076C); ancestral locus Anc_1.531"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688420.1"
                     /db_xref="GeneID:11530624"
                     /db_xref="GOA:G8C1F8"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1F8"
                     /translation="MSGIIEASSALRKRKHLKRGINFTLMVVGQSGCGRSTLINTLCG
                     QQVVNTSTTVMLPTDTATEIPVQLREETVELEDEESVKIQLNIIDTPGFADSLDNSQS
                     FELISDFIRHQYDEILLEESRVRRNPRFKDGRVHACLYMITPSGHGLKELDIVFMRQL
                     GVLVNVIPVISKADSLTLEELKVNKTLIMEDIDKYDLPVYNFPFDEHDISDEEYETNM
                     YLRSLLPFSIIGSNDVFDNGDGIMIRGRKYPWGTLDVEDATVSDFVVLRNMLLISHLN
                     DLKEYTHEILYERYRTDALSGDTQNNAITYTRPDGSDPNYASPQLPSVTRALGNTHID
                     NGSNLNSPNPQDTYLAREEQIKLEEERLKAFEDRVQQELQMKRQELLQRGKRTKRNRR
                     QIRERSQIQSRGQ"
     gene            complement(<14255..>15595)
                     /gene="TPHA0O00150"
                     /locus_tag="TPHA_0O00150"
                     /db_xref="GeneID:11530601"
     mRNA            complement(<14255..>15595)
                     /gene="TPHA0O00150"
                     /locus_tag="TPHA_0O00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688373.1"
                     /db_xref="GeneID:11530601"
     CDS             complement(14255..15595)
                     /gene="TPHA0O00150"
                     /locus_tag="TPHA_0O00150"
                     /inference="similar to DNA sequence:INSDC:YJR075W"
                     /note="similar to Saccharomyces cerevisiae HOC1 (YJR075W);
                     ancestral locus Anc_1.530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688421.1"
                     /db_xref="GeneID:11530601"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C1F9"
                     /translation="MTKLKRGAIIRRLVVAFTVGFFILIGLFKLKSHHKDTDLNSLIP
                     NLPIDIRQNLLAATNDRKHDTETMQKFEELFKEIKKNQEEQSKQLEKQRRLLDSKIQK
                     IKVQNKKEATLRESLAFTYEYDQSRKLPAYIWQLYPTDKKQQLELKKKIEQARAEGKE
                     ISQEMSDTEQVDLNKWEAKNPGFVHEVFNHVVMKALVQHFYANIPAVVEAFETLPSDI
                     LKVDFFKYLILYARGGVYADIDTDPIQAIPNWIPENVNPKSVGLLIGIEHDAELPGWE
                     NFYVRRLQFGTWIIQAKPGHPIIKEVIARITEETLKRKRENNLNVNLRNNLNLMSWTG
                     SALFTDTIFAYFNNYLKSGISTPVTWREFHKLTEPVLLSDVLVFPRGSFNVQKKAKVT
                     DQSGTAKDKLVINEEEADPLDKILLDKSLQLVSHNIENFWKAPKQKVDQAAKKQ"
     gene            complement(<16002..>19763)
                     /gene="TPHA0O00160"
                     /locus_tag="TPHA_0O00160"
                     /db_xref="GeneID:11530602"
     mRNA            complement(<16002..>19763)
                     /gene="TPHA0O00160"
                     /locus_tag="TPHA_0O00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688374.1"
                     /db_xref="GeneID:11530602"
     CDS             complement(16002..19763)
                     /gene="TPHA0O00160"
                     /locus_tag="TPHA_0O00160"
                     /inference="similar to DNA sequence:INSDC:YKL209C"
                     /note="similar to Saccharomyces cerevisiae STE6 (YKL209C);
                     ancestral locus Anc_1.527"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688422.1"
                     /db_xref="GeneID:11530602"
                     /db_xref="GOA:G8C1G0"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1G0"
                     /translation="MKFEHLYMYVSLRKDFLLLAFLALSTIANGLVPAITSILTGRVF
                     ELLSKFTKAEEYGIGYLQHQLTLKSMAILALGAAGIPSMWMSISSWMALGERQGFRVR
                     SKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAEASAVTYQNCVAIIALIC
                     VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAADLLMWTMDSSQT
                     VKLSCTQSKEIKKFETLVSKCNDYFIRTSLFTAANIGILRFLTLSMFVQGFWFGSTMI
                     RKGKLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAKIQKFINESPELPSKT
                     LTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGKSGSGKSTIT
                     NLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNILLGSKYT
                     SQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVALARAFLRDT
                     DILILDEAVSALDIMQREILMRNISKVRQNKTTIILTHDLNQINDNDYIYLFENNEIK
                     ENGFKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDKDEVYEKKDDFVISPISG
                     ETFDVMKYYSEESSDDTESILSSKNTDTESSNPNSKVPIKYIIKRMVRTCKMKPTLFM
                     GLFCAVVAGVTNPLFSWGFSYLLNGILPSSSGIGSSYYLLKWSLIVLAIALADGTFNF
                     IKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV
                     TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYK
                     SAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSML
                     TTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQIPDVSRGQR
                     AASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQD
                     LNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEI
                     CVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVD
                     IGLLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDIL
                     TIVITHNRQMMQCCSRLVVLDVGRVVEDGQFDDLHQPGRILHSILSSGE"
     gene            <20586..>21284
                     /gene="TPHA0O00170"
                     /locus_tag="TPHA_0O00170"
                     /db_xref="GeneID:11530603"
     mRNA            <20586..>21284
                     /gene="TPHA0O00170"
                     /locus_tag="TPHA_0O00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688375.1"
                     /db_xref="GeneID:11530603"
     CDS             20586..21284
                     /gene="TPHA0O00170"
                     /locus_tag="TPHA_0O00170"
                     /inference="similar to DNA sequence:INSDC:YKL208W"
                     /note="similar to Saccharomyces cerevisiae CBT1 (YKL208W);
                     ancestral locus Anc_1.525"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688423.1"
                     /db_xref="GeneID:11530603"
                     /db_xref="UniProtKB/TrEMBL:G8C1G1"
                     /translation="MSHKASKFLLKTTNAPRYAYRHLLEPMARTTDASFLGLQRSTRA
                     SKYHECLRHSDLVVMVNWVQTDLVFNQPYYWKMFAKKLEDGVFHHEPVDSKLYNELFG
                     IPDADPSSNKTDVRIWTQDKLNLQTLNHLLEMVRRDDSKFSISSIGINVNAKEHEMNA
                     ATYIQHLVRESTEKYNNINYEKLLQIAREQRTTPTSHERIFKDLLLNLADLELTRTSL
                     AKDKRWIFFTAPVP"
     gene            <21648..>22430
                     /gene="TPHA0O00180"
                     /locus_tag="TPHA_0O00180"
                     /db_xref="GeneID:11530661"
     mRNA            <21648..>22430
                     /gene="TPHA0O00180"
                     /locus_tag="TPHA_0O00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688376.1"
                     /db_xref="GeneID:11530661"
     CDS             21648..22430
                     /gene="TPHA0O00180"
                     /locus_tag="TPHA_0O00180"
                     /inference="similar to DNA sequence:INSDC:YKL207W"
                     /note="similar to Saccharomyces cerevisiae YKL207W;
                     ancestral locus Anc_1.524"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688424.1"
                     /db_xref="GeneID:11530661"
                     /db_xref="GOA:G8C1G2"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:G8C1G2"
                     /translation="MVLQSGVAAELVLDERLKYWVLLPISIVMILVGVLRQSIIGLIG
                     PGTRGTAVVKLTETNYVNKGRALMGNGSNVCYESFDMRREYLSQVLGEGKYIARLNEE
                     PAAGGATNPFSDPGLSDSIMSMAKGNMANYIPQTLIMWWVNHFFAGFVLMKLPFPLTI
                     RFKEMLQSSIMTPDLDVRWVSSISWYFISVLGLDPVYNLLLSSTEGIDMMQQQQQQMP
                     SLGGPGQPQPEALMKGISNDLTIAQHQCCFDDIEKRVLKMYA"
     gene            <22867..>24024
                     /gene="TPHA0O00190"
                     /locus_tag="TPHA_0O00190"
                     /db_xref="GeneID:11530662"
     mRNA            <22867..>24024
                     /gene="TPHA0O00190"
                     /locus_tag="TPHA_0O00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688377.1"
                     /db_xref="GeneID:11530662"
     CDS             22867..24024
                     /gene="TPHA0O00190"
                     /locus_tag="TPHA_0O00190"
                     /inference="similar to DNA sequence:INSDC:YJR072C"
                     /note="similar to Saccharomyces cerevisiae NPA3 (YJR072C);
                     ancestral locus Anc_1.523"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688425.1"
                     /db_xref="GeneID:11530662"
                     /db_xref="GOA:G8C1G3"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1G3"
                     /translation="MKTVICIGMAGSGKTTFMQRLNSHLRAGKKTPYVINLDPAVLKI
                     PYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVISLVEKKRENYEHVI
                     VDTPGQIECFVWSASGSIITESFASTFPTVIAYIVDTPRNTSPTTFMSNMLYACSILY
                     KTKLPMIVVFNKTDVTKADFAKEWMTDFEAFQDAVRSDQEMNGETGMGSGYMGSLVNS
                     MSLMLEEFYSRLDMCGVSSFTGDGFDEFLDIVDKKADEYNEVYKAERERLIKEKEVKE
                     QKRKEKSINGLMKDLGLSEQKERSNEDDSADVISDIEEGEEDGLVERDEDIGVEREYT
                     FAGDERQGEITEENNPDLQKNIKKHLKTLVNLQVVKLQKILHAISESRLFT"
     gene            complement(<24128..>24955)
                     /gene="TPHA0O00200"
                     /locus_tag="TPHA_0O00200"
                     /db_xref="GeneID:11530663"
     mRNA            complement(<24128..>24955)
                     /gene="TPHA0O00200"
                     /locus_tag="TPHA_0O00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688378.1"
                     /db_xref="GeneID:11530663"
     CDS             complement(24128..24955)
                     /gene="TPHA0O00200"
                     /locus_tag="TPHA_0O00200"
                     /inference="similar to DNA sequence:INSDC:YKL206C"
                     /note="similar to Saccharomyces cerevisiae ADD66
                     (YKL206C); ancestral locus Anc_1.522"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688426.1"
                     /db_xref="GeneID:11530663"
                     /db_xref="InterPro:IPR016562"
                     /db_xref="InterPro:IPR019151"
                     /db_xref="UniProtKB/TrEMBL:G8C1G4"
                     /translation="MPSLILPLVSTGNVPQLCVDLLLHSVSDEFEFLANVDSTYLHPF
                     VGPLDHLAGQDSPVLYAKTPSKKYTTPMELFATRDKEVYVLQQRTPVIEGYLNNFVKT
                     VLVPLVMKLEIDEIVILDSFGSLDEDLAVPSSISTRCGNPLSVGTINVSSISDMSNIF
                     ESNLHLDTDTMQHVSKSLYNFAEDSLQREVSTSQQIFKYTYHLLNSQITSLKEIKYCS
                     LFVHEGDNSYDAQTLCQKLPEIVPNLPVISSFKPPISWTGVYGFNPAPTAFDEGLYM"
     gene            <25277..>25846
                     /gene="TPHA0O00210"
                     /locus_tag="TPHA_0O00210"
                     /db_xref="GeneID:11530610"
     mRNA            <25277..>25846
                     /gene="TPHA0O00210"
                     /locus_tag="TPHA_0O00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688379.1"
                     /db_xref="GeneID:11530610"
     CDS             25277..25846
                     /gene="TPHA0O00210"
                     /locus_tag="TPHA_0O00210"
                     /inference="similar to DNA sequence:INSDC:YJR069C"
                     /note="similar to Saccharomyces cerevisiae HAM1 (YJR069C);
                     ancestral locus Anc_1.520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688427.1"
                     /db_xref="GeneID:11530610"
                     /db_xref="GOA:G8C1G5"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:G8C1G5"
                     /translation="MSQQQEIIFVTGNANKLKEVQQILKDAPCTLTNVALDLDELQGS
                     SLEAVATAKLKQAVVQAGSGKAIFVEDTALSFTAFNGLPGAYIKWFVQSMGLAKIVQM
                     LDAFEDKSAQAITTIAYADAEGQTHVFKGITDGTIVASRGPTDFGWDSIFEPYDSHGK
                     TYAEMDKPSKNKISHRGKAFEAFKSFLQN"
     gene            <26416..>29754
                     /gene="TPHA0O00220"
                     /locus_tag="TPHA_0O00220"
                     /db_xref="GeneID:11530611"
     mRNA            <26416..>29754
                     /gene="TPHA0O00220"
                     /locus_tag="TPHA_0O00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688380.1"
                     /db_xref="GeneID:11530611"
     CDS             26416..29754
                     /gene="TPHA0O00220"
                     /locus_tag="TPHA_0O00220"
                     /inference="similar to DNA sequence:INSDC:YKL205W"
                     /note="similar to Saccharomyces cerevisiae LOS1 (YKL205W);
                     ancestral locus Anc_1.519"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688428.1"
                     /db_xref="GeneID:11530611"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8C1G6"
                     /translation="MLNRIKEVVVIANNPATDALTKKQALDYLESLKNDAGSVEVLAS
                     LLVDNSLDDLTLFVILQLIGDMIGTTITNVNNMNEIVLIKGSVISLLRRIIENNLANP
                     EYIRNKISELVTKIFYFTYGDVNNNVWSSFFNDIIPILCIDALLTSNIETIMNNQVSF
                     SEVGYDFFTRICISINSEIADQTFLRSKEVQVINNHLKDYMRITDVNTMTLIWYNGLL
                     HFKNKIALEGQHVKTNASKLANLTLACIGNYISWINVTLIVNQNYIDVIYSFMDYNTT
                     KIACSQCLIEIISKKMKPLEKLQLLNMLNLTEKLITNKEKNFTDNEDLEIIEQLAKLT
                     SCVGLEYSIILEQCNENNSNNNNNSSSNNSNNNNGLSTTDADQNLDQIAVTADQQILT
                     EVAPLVLKFFIHEYDSVTEQCFDFISQYLNFLKKIFAIGGKPGTAISINSKKQPLDQE
                     HSSFLVSLINGIFKKMKIDSDTVDVDDDSIQEFNDTIRSKLKNFQDVIAIINPNLYLE
                     QISNNITACLSAKYWPDMELAIFQMHNLSESIRNNLFGLNKSDISTSPATAVMGKFLH
                     ILLTSSNLFSIDNRYVQILFFELVVRHYTFLTPEIRDELSLLNIFCSEFGMFNRVEKV
                     RVRVWYLFTRFIKTTKPKLSTVVLTQIVSKISPLLVIEPVQLNANGSEDLNNVTFDNQ
                     LYIFEGVGLLIGANSDYNYDILDQVLTPLFTELEKCISTQSQTLNQQNQHVILQSHHI
                     LMAVGTIARGTHIGLVPENQVNNALVNEKYIHKSLIEKFSNIAEVVLVTFSYFNKHET
                     IRDASRFTFARLIPILNNGIVSYANKLIYLFLESELKVIELNDFLGFLGQMLHTFHQD
                     ESFYKLFDELLTIIIEKIHILLDQLDTENNDGYNLTSASNSGAKDSNMSGKTVVVTDS
                     FRDRILLKKAYYTFLQTLVTNNVTSLLLTQRNRSVLPTILTDLLEYSPQEIQETYIMK
                     LALSVIHNFIKCFGSGACTDNLDRHANEVGKLDGLNEFFITKTIPLMFEIPFKPEYKF
                     DIKDGSCRVMACDISRILKELCIQSGGQDITSNPALKYLTEIYFPQIQLPSEISLELI
                     QALVNQDMKPFEKYFVSLITRLTT"
     gene            <30550..>32424
                     /gene="TPHA0O00230"
                     /locus_tag="TPHA_0O00230"
                     /db_xref="GeneID:11530664"
     mRNA            <30550..>32424
                     /gene="TPHA0O00230"
                     /locus_tag="TPHA_0O00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688381.1"
                     /db_xref="GeneID:11530664"
     CDS             30550..32424
                     /gene="TPHA0O00230"
                     /locus_tag="TPHA_0O00230"
                     /inference="similar to DNA sequence:INSDC:YKL204W"
                     /note="similar to Saccharomyces cerevisiae EAP1 (YKL204W);
                     ancestral locus Anc_1.518"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688429.1"
                     /db_xref="GeneID:11530664"
                     /db_xref="UniProtKB/TrEMBL:G8C1G7"
                     /translation="MNVVQDESMLQSPNGSTQISSDELSKFFQDIKKRSENRVQGSFN
                     NNVAEVTDVKQTANVNKDKVVVMNDVLSKLPPYTADYKVDPSMSAKEFTYSINELLFI
                     KEIIPESYYEEIEAMLPKKKFWRLTGRFENGQHNNSSSNNVNNNNGNSNNYNNKNNSK
                     NMRNSNSNSNSNSTNNSITSASGEGHSYARRNSKGKVRGTNQNKKMSKYDKTDRYVEE
                     NDIKVKNNALMELEAEFQPTGNSMADFEAWRAKMKELDNKKKGILNSSEISKRDNASS
                     DSPKSIGSSSISNFLKMSATSKNSESTSLDDSENAVSVSENNLNVANKNETTASVSSR
                     FSGFFTSTPSNSISTEQKTTVEAISANSTTKNIDRDSKLMSFFKNNGIQGASDNGNVA
                     RGRGKENVQAPMRAAQDLNQPQQQQQQQQQQQQQQQQQQQQQQHHRLPGQAPTSVQMP
                     PMNNQMNHMQRLPIHSQNPTDNSNFFQGLLNKGKSGEQINIPPGMRMPNGPNVPQQMP
                     INGPISGYPVGMPPPHMMPPPGFSMYQGQPPNMPNNNNAITGDNKRTGKRPQAGLPQQ
                     FINGPAPPNFPPNMPFPPNMMQGNVNHFYPPMPQQQKPRMNNMNSFMTQTGPTGNLQK
                     "
     gene            complement(<32729..>33787)
                     /gene="TPHA0O00240"
                     /locus_tag="TPHA_0O00240"
                     /db_xref="GeneID:11530665"
     mRNA            complement(<32729..>33787)
                     /gene="TPHA0O00240"
                     /locus_tag="TPHA_0O00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688382.1"
                     /db_xref="GeneID:11530665"
     CDS             complement(32729..33787)
                     /gene="TPHA0O00240"
                     /locus_tag="TPHA_0O00240"
                     /inference="similar to DNA sequence:INSDC:YJR068W"
                     /note="similar to Saccharomyces cerevisiae RFC2 (YJR068W);
                     ancestral locus Anc_1.517"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688430.1"
                     /db_xref="GeneID:11530665"
                     /db_xref="GOA:G8C1G8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1G8"
                     /translation="MITGFGNATKKRKIQPEGDLDNNKPWVEKYRPRNLDDVAAQDHA
                     VAVLKRTLGSANLPHMLFYGPPGTGKTSTILALTKELFGPQLVKSRVLELNASDERGI
                     SIVREKVKNFARLTVSKPSKDDLENYPCPPYKIIILDEADSMTADAQSALRRTMETYS
                     TVTRFCLICNYVTRIIDPLASRCSKFRFKALDETNALDRLKYVATQESTKYEEGTLEK
                     ILQISAGDLRRAITLLQSVSKSSTFNKSDMITIKKVEELAGVVPESIINQILKIIESK
                     DVDAITAFTRTFIKNGWSGAAVVDQLHDHYITSDNYSTQFKNSVSWILFNADSKLLNG
                     TNEHIQLLNVLVKISLIE"
     gene            <34308..>34769
                     /gene="TPHA0O00250"
                     /locus_tag="TPHA_0O00250"
                     /db_xref="GeneID:11530666"
     mRNA            <34308..>34769
                     /gene="TPHA0O00250"
                     /locus_tag="TPHA_0O00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688383.1"
                     /db_xref="GeneID:11530666"
     CDS             34308..34769
                     /gene="TPHA0O00250"
                     /locus_tag="TPHA_0O00250"
                     /inference="similar to DNA sequence:INSDC:YJR067C"
                     /note="similar to Saccharomyces cerevisiae YAE1 (YJR067C);
                     ancestral locus Anc_1.516"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688431.1"
                     /db_xref="GeneID:11530666"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:G8C1G9"
                     /translation="MKVHDNNLDDVWGSDNSEDDNQHQYDISKLKTIHNDRGYLDGIT
                     SSKETNLQDGFNAGFPNGSNLGYRVGKILGTLQSLSYILNNQETSGKESGFSQSVRQD
                     LVDAQQELKINKVLIKSLFDNNLDLTENSHDILEKWESKIKTYTKYYNIDF"
     gene            complement(35301..35374)
                     /gene="TPHA0Otrna5N"
                     /locus_tag="TPHA_0Otrna5N"
                     /db_xref="GeneID:11530650"
     tRNA            complement(35301..35374)
                     /gene="TPHA0Otrna5N"
                     /locus_tag="TPHA_0Otrna5N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11530650"
     gene            <37148..>37906
                     /gene="TPHA0O00260"
                     /locus_tag="TPHA_0O00260"
                     /db_xref="GeneID:11530693"
     mRNA            <37148..>37906
                     /gene="TPHA0O00260"
                     /locus_tag="TPHA_0O00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688384.1"
                     /db_xref="GeneID:11530693"
     CDS             37148..37906
                     /gene="TPHA0O00260"
                     /locus_tag="TPHA_0O00260"
                     /inference="similar to DNA sequence:INSDC:YCR004C"
                     /note="similar to Saccharomyces cerevisiae YCP4 (YCR004C);
                     ancestral locus Anc_1.421"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688432.1"
                     /db_xref="GeneID:11530693"
                     /db_xref="GOA:G8C1H0"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:G8C1H0"
                     /translation="MTKIAIITYSTYGHVDTLAKEIQKSIQDASKGFNDDVVDLFRLE
                     ETLSDDVLQAMHAPEKDASVPVIKVEDLINYDAFVFGIPTRFGSAPAQWLHFWDQTSS
                     LWAQGQLYGKMASFFLSSGTYGGGLESTVRNTLSYLVHHGIIYVPLGYKNAFAELSNT
                     EEVHGGTPWGATTLADTDGSRQPSDLELRIANIQGKTFYETVKRFAGESTEVQKKEKK
                     TKITALQTVEKQAKKKEEKKEESKNFLTACCTLM"
     gene            complement(<38086..>38700)
                     /gene="TPHA0O00270"
                     /locus_tag="TPHA_0O00270"
                     /db_xref="GeneID:11530651"
     mRNA            complement(<38086..>38700)
                     /gene="TPHA0O00270"
                     /locus_tag="TPHA_0O00270"
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /transcript_id="XM_003688385.1"
                     /db_xref="GeneID:11530651"
     CDS             complement(38086..38700)
                     /gene="TPHA0O00270"
                     /locus_tag="TPHA_0O00270"
                     /inference="similar to DNA sequence:INSDC:YCR003W"
                     /note="similar to Saccharomyces cerevisiae MRPL32
                     (YCR003W); ancestral locus Anc_1.420"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /protein_id="XP_003688433.1"
                     /db_xref="GeneID:11530651"
                     /db_xref="GOA:G8C1H1"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:G8C1H1"
                     /translation="MVFQAISNILRKSTLNTEVNSISRLLRNSFLNVNDAFNSSGLAL
                     APAGLNSIDKELGSIDKELGSIDNDNEGNIWDIFKNNNGFLLAVPKKKVSHQKKRQRL
                     YAPGSKQLKLKNNLTKCPSCGHYKLANTLCTFCVDEIHHIWKKHTINDKKGTPEIPLQ
                     EQDLSAIDLRVLYPGKKDTEYVKKLKDKDSYLKRKIRSLPVEEK"
     gene            complement(<39335..>40510)
                     /gene="TPHA0O00280"
                     /locus_tag="TPHA_0O00280"
                     /db_xref="GeneID:11530652"
     mRNA            complement(<39335..>40510)
                     /gene="TPHA0O00280"
                     /locus_tag="TPHA_0O00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688386.1"
                     /db_xref="GeneID:11530652"
     CDS             complement(39335..40510)
                     /gene="TPHA0O00280"
                     /locus_tag="TPHA_0O00280"
                     /inference="similar to DNA
                     sequence:INSDC:YNL001W,YCL001W-B"
                     /note="similar to Saccharomyces cerevisiae DOM34 (YNL001W)
                     and YCL001W-B; ancestral locus Anc_1.418"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688434.1"
                     /db_xref="GeneID:11530652"
                     /db_xref="GOA:G8C1H2"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:G8C1H2"
                     /translation="MKLINLSEASGTSTEVSLTVLPEDKEDLFILYQIIKNDDEVFCR
                     KMVSSKEDGRKKISEIMKLKLQIISNEFDMHSESLRYKGITVPDETGRANQNVSIGKY
                     FSFNVVYQQSLTIIKDDFNSYERKLVEEACNVEGKADTAAVVLQEGVSHVCLLTESST
                     ILKQKIEYSLPKKKRDTDTMKFDEKTEKFYKATYEAMKKNFDFNKLNLVILCSPAFYA
                     KTLLEKVIKYAAEDDYTPIVENQNIFLVAHSSTGYLQGISEVLKNPNYSSKLSDTKYS
                     KQAMIMDEFLLHLNDDDMKAWYGEKEVLKASELGAVDVLLITDSLLRSDDVSKRMLYI
                     KLIEDIEDAGGSVQVVSVFHSTGEELAQLTGVACILRYPISDLDEGLYDDEQEEEED"
     gene            complement(<41046..>41591)
                     /gene="TPHA0O00290"
                     /locus_tag="TPHA_0O00290"
                     /db_xref="GeneID:11530545"
     mRNA            complement(<41046..>41591)
                     /gene="TPHA0O00290"
                     /locus_tag="TPHA_0O00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688387.1"
                     /db_xref="GeneID:11530545"
     CDS             complement(41046..41591)
                     /gene="TPHA0O00290"
                     /locus_tag="TPHA_0O00290"
                     /inference="similar to DNA sequence:INSDC:YCL001W"
                     /note="similar to Saccharomyces cerevisiae RER1 (YCL001W);
                     ancestral locus Anc_1.417"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688435.1"
                     /db_xref="GeneID:11530545"
                     /db_xref="GOA:G8C1H3"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:G8C1H3"
                     /translation="MNEGGSTNPIMAKFNALKTIYRFYIDKTVPHVKVRWASLSGFIL
                     LFLTRVVLAQGWYVVCYGLFIFLLNQFLAFLTPKFDVSLQQDEANKELEAGERSEEFR
                     PFIRRLPEFKFWYNAARATAASLLMSFFSIFNLPVFWPILLMYFILLFFLTMRRQIQH
                     MMKYNYIPLDIGKKKYSKSSK"
     gene            <42120..>42935
                     /gene="TPHA0O00300"
                     /locus_tag="TPHA_0O00300"
                     /db_xref="GeneID:11530546"
     mRNA            <42120..>42935
                     /gene="TPHA0O00300"
                     /locus_tag="TPHA_0O00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688388.1"
                     /db_xref="GeneID:11530546"
     CDS             42120..42935
                     /gene="TPHA0O00300"
                     /locus_tag="TPHA_0O00300"
                     /inference="similar to DNA sequence:INSDC:YCL002C"
                     /note="similar to Saccharomyces cerevisiae YCL002C;
                     ancestral locus Anc_1.416"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688436.1"
                     /db_xref="GeneID:11530546"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:G8C1H4"
                     /translation="MFVTLFQSISKFIFVIAIWNQWKYNRNHRSIYGISYDLFAATFF
                     SHLCLVWCTLNYKYSSLLITQAVNRFPLFYNTNNETPGTGNIPISLLILCNDILNIIG
                     SIWVFKQLIFYRKTKHIYQGISPIFISVVCLFTVFNFFTLVCSLSNLPNNSGKFGIFY
                     LEHINYIWVIGNLLESFKILPQISLNWMGRSTSGLSSTFILMNLFSATLMLVTSIFDG
                     NSTVSYFLRPYNYQPIFVTVFQFILAVILFIQEKYVYINSKPYLQKGKESSIV"
     gene            complement(<43081..>44685)
                     /gene="TPHA0O00310"
                     /locus_tag="TPHA_0O00310"
                     /db_xref="GeneID:11530547"
     mRNA            complement(<43081..>44685)
                     /gene="TPHA0O00310"
                     /locus_tag="TPHA_0O00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688389.1"
                     /db_xref="GeneID:11530547"
     CDS             complement(43081..44685)
                     /gene="TPHA0O00310"
                     /locus_tag="TPHA_0O00310"
                     /inference="similar to DNA sequence:INSDC:YCL004W"
                     /note="similar to Saccharomyces cerevisiae PGS1 (YCL004W);
                     ancestral locus Anc_1.415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688437.1"
                     /db_xref="GeneID:11530547"
                     /db_xref="GOA:G8C1H5"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR016270"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:G8C1H5"
                     /translation="MNKSLTTKLSTTVNIITIKSFIPINKRMSTVSSTPKHQDTIELS
                     YTDQIRTKLKYLSTKFYFKKKEVEILNDPDCFYNTLKQKISNAKERVFLATLYIGKSE
                     DELVECISDALKYNSKLKVYFLLDGLRGTRESPSKCSAQLLSQLTHDYKDRVDIRLYK
                     TPAYIGWKKALIPSRFDEALGLQHMKIYGFDNEVMLSGANLSNDYFTNRQDRYFLFKN
                     KLFANYHFALHQLISSLSYKLEYSTNQMKYQLLWPSTNICSEPLKGRRKFIRKTSKVL
                     SDFLHNPNDNLLQSINEPVDKNIYPTTVYPISQFSPLFHSFEDKSTEKPTILNLISCI
                     KSPSINWMFTTGYFNMLPEIRDQLLKTPSNNSIVITASPYANGFFESKGISKHLPAAY
                     LFLSKKFLKSVHNANKSNYIHLREWKKGVITQPGGWSYHAKGLWISKEEANQGKNESD
                     IIKEIPFATVIGSSNYTKRAYSLDLESNAVIVTDDMELRLELYKELRNLLKNTKEINL
                     EDFRNDKDRKIPTGVKVATSILGKKL"
     gene            45665..45736
                     /gene="TPHA0Otrna10R"
                     /locus_tag="TPHA_0Otrna10R"
                     /db_xref="GeneID:11530548"
     tRNA            45665..45736
                     /gene="TPHA0Otrna10R"
                     /locus_tag="TPHA_0Otrna10R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGA"
                     /db_xref="GeneID:11530548"
     gene            <46339..>49686
                     /gene="TPHA0O00320"
                     /locus_tag="TPHA_0O00320"
                     /db_xref="GeneID:11530706"
     mRNA            <46339..>49686
                     /gene="TPHA0O00320"
                     /locus_tag="TPHA_0O00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688390.1"
                     /db_xref="GeneID:11530706"
     CDS             46339..49686
                     /gene="TPHA0O00320"
                     /locus_tag="TPHA_0O00320"
                     /inference="similar to DNA sequence:INSDC:YJR039W"
                     /note="similar to Saccharomyces cerevisiae YJR039W;
                     ancestral locus Anc_1.463"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688438.1"
                     /db_xref="GeneID:11530706"
                     /db_xref="UniProtKB/TrEMBL:G8C1H6"
                     /translation="MFQIKNKSVLVVETEFVINCFLKKNSLSLKYEYIESKKQKTIGY
                     TVNASYFYDALYDNEYIFLIKDNGFLEILGKDFTQVDLLDTEIPFKEDYANIYFVFNF
                     KNNQLYINLEKRRIFAIDIKLTKDSLVFSPKDKILTCIFESTSNIIQFDGSINLDHTN
                     EKEFFGLSLLTSKWDYESNCNLYSIIALQLHSKSKSFPFSILMEEKDLKFNLDDIDDT
                     MIPILKMVPNMGLFIFTNQTLYFFEFLMDIRHNISDTLVDKSYEFSYNSQNFGNITPN
                     ILVSKNADNIIFTLATTKSFLVHISLRLLLEHPDEYVFYWSEFQVVNTLLDYCPNQVF
                     SCGGNSQEILGQSTSGEIYESIHDNDIISSTIIKYYKSKNFSCYNSELVGYSVKKLIN
                     SIGSYNDNIGYIRVCYRGYENILKNEKCLKSTNSKVTGVWITNSSIYWKDNENRIYKD
                     TEELKDVKGAIHVTKDNRFIEVDTKNDMLIIADVPNDDSYTYINKHGYLLNSKNKLIS
                     CKIKNFKGEFLSKYCLFSIKSAKSYLHLVINESTISIVEDSNYVTNPIDIGSFVNDAC
                     FFPNIDKFNVIIASDVHGSIFIIRTENDWRSYEIEEQMLTNQKLKLHLLVNLQQLIIY
                     GPDSSFILSHNETHHGYDIFVADMNSNIEYISSSPDEQSICVLTKENMIYGYQIGLLK
                     ADMISYQIKTDNHFIMKSVSLPSSLKFIVSCSVFNFYDNILKKFKLFYQLLTFDLHER
                     KLVDSFDIAKYFPNSRVSDMITMPFNIPERTLDNKVDYAKRLVYNRCFLVSLDIEENE
                     SFSLPNILLFSLDEETGQIDLQCQISSQFQISKLINYSGNIFIACGEELQMFEVNFRV
                     NDNAFVLKECSNNFVTNAIYGDTFIIPGVETAEISRNYPLSKKSRTNIKPVSNLHLFN
                     YFKGLQTFSISKNINKKFELKQINSMSRIDNLNLPSESMISAYAHSTHETSSVFAICV
                     APNKIFIYNETELLSFRLPYKVVNIISANKTADISWKNVSRSSFKQSRHPEMSLLFII
                     NTENEGCYFLKVPSNSKTLLLNKLQTLKQYDLISTDSITEDEEFETMMQDNEQEELDL
                     EYNNIIKQHSTIFFDSRSYSSDFSIPF"
     gene            <49952..>53122
                     /gene="TPHA0O00340"
                     /locus_tag="TPHA_0O00340"
                     /db_xref="GeneID:11530549"
     mRNA            <49952..>53122
                     /gene="TPHA0O00340"
                     /locus_tag="TPHA_0O00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688391.1"
                     /db_xref="GeneID:11530549"
     CDS             49952..53122
                     /gene="TPHA0O00340"
                     /locus_tag="TPHA_0O00340"
                     /inference="similar to DNA sequence:INSDC:YEL025C"
                     /note="similar to Saccharomyces cerevisiae YEL025C;
                     ancestral locus Anc_1.464"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688439.1"
                     /db_xref="GeneID:11530549"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8C1H7"
                     /translation="MMAVTLTEEEKDFRSSYKSINFKSFKFTPLARHSDEVVSLYLDD
                     KKLTLFIFCKRFIYIYSSFELIHKVDIKDEPVLANKNDYNFVYSYAESHYLYFESSGL
                     VLFKANVINNKVTYSFNDRFKGIGNTFLTQGPIDCLMTSYKNGIYFSGDRYKIIKLEL
                     NLALELKNITDGSLVYFEFLTKPNIKDSLPSLICLVQSKLGYLYVEHSICIETSKTVT
                     ISKKIISNKCNYNHNEFYVKKITEQIIVLFLNGKLYKVTGSDCQLIWENSTLKSNMIA
                     NIIPEERNQQDKTFCWLIYTMDGTIHKLHTKNATDSKKLTVSYKLMETNIKSVIENDD
                     LKFLFTLKFNQQLLVTSMYKVILCSVKKNYYKVEKKLKKIFHRAPLFTDCISYNKQGF
                     EINSLIISGSHGEGTGFIEKRYPSAQTAFDLIDQWNVPDDCGIIKDFWVTKKSIFYDS
                     LNCYYEGSSRHSKENKSIINVSDDNTIIFDSHLLNSETDKSKILFYCQVKYSVSKLFL
                     LLKSSRNIEVCEVSSQCTKTIDQFELTYLKEEIICDLKSLVYNNELLIIAASSKTLTI
                     YSNSRLLNSIRINNRESIFHIEVILTTNKDHSEQVFNTVTSLIGGTVRVYNHDLSTVV
                     MELKAVSTESLQILAFSDNSPLVIVYNKFEVFLMDLQNLTYGSIVFNINTSIFKIRET
                     NKSLFLLSSDDIVYHYITNSNWKHRPSMNLELQSHMLETKLDIPIKIIRTNMEERFII
                     VSDEKSSKVKRLHLLNSGNMSFIDSFKIGKHNLNSISSNFVSNHNHSLSDEENNSTNL
                     LFTVTVTEQKSLLYVLRIHSQEITKVQTIKLTLKVMTIKYLLNENLLVVVCDEDNQLV
                     IIFFKQNFLDNNDLKFNEFERKYIPLKLKENIKAIFTKNRLILMNATEEFNAIDITVN
                     KNFEHKLTIKWKIQDMTSLLKNIISDRRQSLEIDKDSIEHLHIKFPSDLGNKTNISKL
                     SPTHWQSDFEFINITYFPKLSYILCFDRVGALQLLEYFRFHEDIITASPLDKSFTLIN
                     SIFLKHRAYFKEPNLLYFWFVKVIYI"
     gene            complement(<53304..>56819)
                     /gene="TPHA0O00350"
                     /locus_tag="TPHA_0O00350"
                     /db_xref="GeneID:11530730"
     mRNA            complement(<53304..>56819)
                     /gene="TPHA0O00350"
                     /locus_tag="TPHA_0O00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688392.1"
                     /db_xref="GeneID:11530730"
     CDS             complement(53304..56819)
                     /gene="TPHA0O00350"
                     /locus_tag="TPHA_0O00350"
                     /inference="similar to DNA sequence:INSDC:YJR041C"
                     /note="similar to Saccharomyces cerevisiae URB2 (YJR041C);
                     ancestral locus Anc_1.467"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688440.1"
                     /db_xref="GeneID:11530730"
                     /db_xref="InterPro:IPR018849"
                     /db_xref="UniProtKB/TrEMBL:G8C1H8"
                     /translation="MLSQIPDTAEGITKLLRSKNTTASDVVEVVFKFSELKTNFPNKE
                     VFVLELIQDRWNDQRVLDYKNNYQIWRLYNDMWSTINNSITVKKLFKNLKFPQLVLQS
                     TQIIEQNKWEFLNEFYRTCTLINSEVTVAFTFEIALKCLASILGMLCDVRDEVTLTHE
                     FRANIIDAVIKLTDLNNIKPEVSIKYSNTYCETLLLPTLKYMVRFNDTDFNSTLNDKE
                     HPPNDNTIEKLLEYSGYYLYDSSLHTPQQLEKLIKKSGASISFADSKLLFNLSINFLS
                     KQNFKDLEKILILLTNLHQDILPDLLIKLALKRKTLSHEFLETLFKTTVENAQKNMLY
                     DETFWSLITHILELDIEIGIKNTNQILVLIENQYSNNHNSTFLVFEKLITCYVNAREY
                     PNFISIWAKYVLAKDPEQNNLFFSENLFTNALSRNITALSISQLSSVLASYIHDIQVE
                     KKNARVKGLLEILLHGLKYVSPTILPELKIVLIKVFDDNLKSNKTLWRIRFLIMEAFD
                     DIVTEESIEEICSKDFKSLLKSADDPKYLFFNYFKIREYKEFKLTDIIEEFIKYLKKT
                     EKNEMRDISGYIFLHWPTLISNEFSKSQVDYIIDLLINGDMEEVMSKLFEDDDFFEEP
                     RLVSTLVAKLASEYKNDIAIRYLREIPIQCIQKNVRIQLIDSIGSKAKISQGDLELVN
                     HLLQYPTFKTKIETDIEKLYVFTKSQSKKYDLINPIFERVWSNYLSQMKERSQKEFID
                     NMINMLLSNISKGHKFFEISFLICKISPTVLVDQLQSKLIEISLTQMKKSKDDELIWN
                     LNCLFTIFKKSDYSISAALNKSVKDEIANILKTGFNKLNKELMSITFLIYSSVYDNDL
                     QYLFAHYLKLRNLGIPTLKIIEGVNFAIKQDQTKNFNGFNLVFSDIINEFSNVPSDMS
                     GFLLELFISLLDNIEKENVVAVNLFQKSLSDFFTSSGRFINNKEDFILVLKTFEQLLL
                     SKPWLFSQYSIELLFPICYNAAVLFNDGYHSNDDIFIITTKVISKILLVHRVKLSNRN
                     HLLNSFFCSYLELLSLNETFGLTEASAGPLARLISNFCEPSNISSSRSQSNKEIIDSK
                     ISMIRHSLRKDVPVLLINYIHLSINNKFKAEIRHELIPCIYSVLNLLSRQELNIVNAA
                     LDNAGKQYFRTIYQDYTKKGKWSED"
     gene            <57394..>59634
                     /gene="TPHA0O00360"
                     /locus_tag="TPHA_0O00360"
                     /db_xref="GeneID:11530731"
     mRNA            <57394..>59634
                     /gene="TPHA0O00360"
                     /locus_tag="TPHA_0O00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688393.1"
                     /db_xref="GeneID:11530731"
     CDS             57394..59634
                     /gene="TPHA0O00360"
                     /locus_tag="TPHA_0O00360"
                     /inference="similar to DNA sequence:INSDC:YJR042W"
                     /note="similar to Saccharomyces cerevisiae NUP85
                     (YJR042W); ancestral locus Anc_1.468"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688441.1"
                     /db_xref="GeneID:11530731"
                     /db_xref="InterPro:IPR011502"
                     /db_xref="UniProtKB/TrEMBL:G8C1H9"
                     /translation="MSTMNNPLDLLMNVDELQLLDDEQNYPGQFDQTNVDVNKDIVLG
                     LDKTSGVPIYSLAGDVEEQPLKSGENGDLHYNLNSNSTQNIGFLANKSQTKLYPSKLP
                     RLVISKEYSHYISKLFEIYNNLGEDHRTFSKPTIGLISRSSRIEHNQTVNLALETLVT
                     ELEFYIDSIKHIDTEFDKFIELEDCLTILNCMKTFYFTVEGDMDDDNQRNDFMDRLLN
                     WVNRSDGEPSEQLIEKVFSTSGEGQKHVYNSSSFWKLINKLLLRGLFTQAKGCLNRSG
                     IISSLESQCEVSRNAIHDMIALLEQYPKDSPSAYRNWKSLILELQQTFSNSETKINGE
                     LRDNIEDSLLLLSGNQSKIFQYSSTWYESFCGLMLYYIPSNKLLTEYLQLSLDACPLN
                     VTNIWEQPCVDIINGKIFSILPILESLDTCTTAFVAGLCDAKGLLEDYSYANDASQNE
                     TIEDLLSRKNGMASYLLDNFAFELCSHDDKTLWPVAIGLISISPVNSSNAIRAAISEL
                     LPRYPFSTNDDIEWMLTICAKWRLPEVSKKIFLTVANNLLSEGNLIEAITNFSKAGAF
                     DLVKHHAWMIFETSLLSKEPVDDIILTAIVKNETNNIIPNELSHSLVTDAMRQALSPY
                     AVLYEFYELLKMKEMKEALNKIRSLIEFQYLPKKYFVILLVQFLFPLFILKDEFKMDE
                     DVILSVIERCDEMLKAEDAELQKVYSEIIQNVKENEEITLPANLSLFEQTLRKKLNIK
                     LCQEYM"
     gene            complement(<60006..>60491)
                     /gene="TPHA0O00370"
                     /locus_tag="TPHA_0O00370"
                     /db_xref="GeneID:11530732"
     mRNA            complement(<60006..>60491)
                     /gene="TPHA0O00370"
                     /locus_tag="TPHA_0O00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688394.1"
                     /db_xref="GeneID:11530732"
     CDS             complement(60006..60491)
                     /gene="TPHA0O00370"
                     /locus_tag="TPHA_0O00370"
                     /inference="similar to DNA sequence:INSDC:YEL027W"
                     /note="similar to Saccharomyces cerevisiae CUP5 (YEL027W);
                     ancestral locus Anc_1.469"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688442.1"
                     /db_xref="GeneID:11530732"
                     /db_xref="GOA:G8C1I0"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:G8C1I0"
                     /translation="MSTDLCPVYAPFFGAMGCAAAIIFTSFGAAYGTAKSGVGICATC
                     VLRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSG
                     LAAGFAIGIVGDAGVRGNSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVV
                     C"
     gene            complement(61028..61099)
                     /gene="TPHA0Otrna5M"
                     /locus_tag="TPHA_0Otrna5M"
                     /db_xref="GeneID:11530576"
     tRNA            complement(61028..61099)
                     /gene="TPHA0Otrna5M"
                     /locus_tag="TPHA_0Otrna5M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:11530576"
     gene            complement(<62737..>63159)
                     /gene="TPHA0O00380"
                     /locus_tag="TPHA_0O00380"
                     /db_xref="GeneID:11530692"
     mRNA            complement(<62737..>63159)
                     /gene="TPHA0O00380"
                     /locus_tag="TPHA_0O00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688395.1"
                     /db_xref="GeneID:11530692"
     CDS             complement(62737..63159)
                     /gene="TPHA0O00380"
                     /locus_tag="TPHA_0O00380"
                     /inference="similar to DNA sequence:INSDC:YJR044C"
                     /note="similar to Saccharomyces cerevisiae VPS55
                     (YJR044C); ancestral locus Anc_1.473"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688443.1"
                     /db_xref="GeneID:11530692"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:G8C1I1"
                     /translation="MFEIKVSPLTKIISLSGFLSMGFLLVILSCALFHNYYPLLDILF
                     FLLAPLPNALSKSRYGSADFMSDSSSQNGNDFSHFLTGMFVTSGIVLPLVLQHCQLIA
                     AESCVMSIMGGSIIYCSIITFSWFFQSSFDGEDDQLFT"
     gene            complement(<63814..>65790)
                     /gene="TPHA0O00390"
                     /locus_tag="TPHA_0O00390"
                     /db_xref="GeneID:11530577"
     mRNA            complement(<63814..>65790)
                     /gene="TPHA0O00390"
                     /locus_tag="TPHA_0O00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688396.1"
                     /db_xref="GeneID:11530577"
     CDS             complement(63814..65790)
                     /gene="TPHA0O00390"
                     /locus_tag="TPHA_0O00390"
                     /inference="similar to DNA sequence:INSDC:YEL030W,YJR045C"
                     /note="similar to Saccharomyces cerevisiae ECM10 (YEL030W)
                     and SSC1 (YJR045C); ancestral locus Anc_1.474"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688444.1"
                     /db_xref="GeneID:11530577"
                     /db_xref="GOA:G8C1I2"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8C1I2"
                     /translation="MLSARNILNKRSVGSSIKLAARFNSSSTKTKGPVIGIDLGTTNS
                     AVAIMEGKIPKIIENAEGARTTPSVVAFTKDGERLVGIPAKRQAVVNPENTLFATKRL
                     IGRRFEDQEVQRDIKQVPYKIIKHTNGDAWVEARGQSYSPAQIGGFVLNKMKETAEAY
                     LSKTVTDAVVTVPAYFNDSQRQATKNAGQIVGLNVLRVVNEPTAAALAYGLEKSESKV
                     VAVFDLGGGTFDISILDISNGVFEVKSTNGDTHLGGEDFDIILLREIVKKFKSESGID
                     LENDRMAIQRIREAAEKAKIELSSTVSTDINLPFITADASGPKHINLKFSRAQFETLT
                     EPLIKRTVDPVKKALKDANLSTSDISDVILVGGMSRMPKVIETVKSLFGKEPSKAVNP
                     DEAVAIGAAIQGAVLAGEVKDVLLLDVTPLSLGIETLGGVFTRLIPRNTTVPCKKSQI
                     FSTAAAGQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVSFDIDADGI
                     INVSARDKASNKDASITVAGSSGLSDAEIEQMVNDAEKFKTQDEARKKSIETANKADQ
                     LANDTENSLKEFEGKIDKVEAQKVKDQITQLREFIARVQAGEEVNSEELKTKTDDLQT
                     SSMKLFEQMYKNENNNNNNNNNSSDANPSGESKQ"
     gene            complement(<66476..>70138)
                     /gene="TPHA0O00400"
                     /locus_tag="TPHA_0O00400"
                     /db_xref="GeneID:11530578"
     mRNA            complement(<66476..>70138)
                     /gene="TPHA0O00400"
                     /locus_tag="TPHA_0O00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688397.1"
                     /db_xref="GeneID:11530578"
     CDS             complement(66476..70138)
                     /gene="TPHA0O00400"
                     /locus_tag="TPHA_0O00400"
                     /inference="similar to DNA sequence:INSDC:YEL031W"
                     /note="similar to Saccharomyces cerevisiae SPF1 (YEL031W);
                     ancestral locus Anc_1.476"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688445.1"
                     /db_xref="GeneID:11530578"
                     /db_xref="GOA:G8C1I3"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:G8C1I3"
                     /translation="MGTTSFVESPIVKDSKLLVPRTLTSKPYLLPFLPLYATFFQIYF
                     TNYEKYIGGSEWTFVYLGAIISLNVLVILMPFWNVNIKARFDYVSSNNVAEATHIMIF
                     TTANNGSDDIAPIQRVQEEGHLQTFFEFQKKRFLWDEKTNLFSSPKFIIDDSPKIGDF
                     TNHKGLSGDLTNLRRLYGQNSFDIPIPTFIELFQEHAVAPLFIFQLFCIALWLLDDFW
                     YYSLFNLFVVVSMEAAAVFQRLTTLKEFRTMGIKPFDINVYRDGKWETMKTNELLPND
                     LVSVTRTSEESALPCDLILVDGSCIVNEAMLSGESTPLLKESIKLRPKDDLLQVNDLD
                     KNSVLHGGTKALQVTAPDGTTAVPLAPDNGALGIVTKTGFETSQGSLVRVMIFSSERV
                     SVDNKEALFFILFLLNFAIVASWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPME
                     LTMAVNSSLAALSKFYVYCTEPFRIPLAGRVDVCCFDKTGTLTGEDLVFESLAGLSNN
                     VDDVRHSFRADEAPEVTALVIGAAHALVKLDDGDLVGDPMEKATLKAFGWSVNTKVVT
                     SHKKYGDVNILRRFQFSSALKRSSSVASHKGEYFAAVKGAPETIRERLTSVPANYDDI
                     YKSFTRSGSRVLALATKRLSKMSTADIDSLSREDIEEQLDFSGFLIFHCPLKSDAIET
                     IKMLNESSHRCIMITGDNPLTALHVAKEVAIVERDSLILDKADTNGDGSKLMFFNVDE
                     TIKMDFDVKTDKFDQAKIFDKYDIAVTGAALQALVETDHDQLRQLIRHTWVYARVSPK
                     QKEYILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVALLNGSEEGMKKLADERKANGM
                     KTVYDKQVELFTRWGQPIPVVPEIIADYYPPGPKNPHYLKALEKKGKTITPELRKLVT
                     EANNKPVEVPKPIDKKNIKPSGSDFSTLLMSAQANGDGDDEEVPTLKLGDASCAAPFT
                     SKLSNVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSVIYLAGVKFGDGQATA
                     SGLLLSVCFLSISRGKPLEKLSKSRPQKGIFNIYIMGSILSQFAIHIVTLIYITKEIY
                     ILEPREPQIDLEKEFTPSLLNTGIFLIQLVQQVSTFAVNYQGEPFRENIKNNKGMYYG
                     ILGVAGLALAGATEMLPELNEALNFVPMTDIFKTKLTLTLLLDFFGSFACEYFFKYFF
                     MDDKPADITVKSIQIV"
     gene            complement(<70756..>73572)
                     /gene="TPHA0O00410"
                     /locus_tag="TPHA_0O00410"
                     /db_xref="GeneID:11530631"
     mRNA            complement(<70756..>73572)
                     /gene="TPHA0O00410"
                     /locus_tag="TPHA_0O00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688398.1"
                     /db_xref="GeneID:11530631"
     CDS             complement(70756..73572)
                     /gene="TPHA0O00410"
                     /locus_tag="TPHA_0O00410"
                     /inference="similar to DNA sequence:INSDC:YEL032W"
                     /note="similar to Saccharomyces cerevisiae MCM3 (YEL032W);
                     ancestral locus Anc_1.477"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688446.1"
                     /db_xref="GeneID:11530631"
                     /db_xref="GOA:G8C1I4"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:G8C1I4"
                     /translation="MDVDTDATTFTPDAAFSDRVRRFQEFLDSFSIYKDHIRSIQSHN
                     ANVLNSLDGKDYSDVDLDLDSGDIDKTGVKEGSRVSEPLPLRITISLDELREFDRSFW
                     SGMLIDPSNFILPAEKAITDLASSIDDLPNLQSNSASLSSKKSWKLSFRGAFGAHALS
                     PRSLNSLFLNKLVSIEGIVTKTSLVRPKLIRSVHFAENTGRFHYRDYTDATTTLTTRV
                     PTPAIYPTEDSEGNKLTTEYGYSTFLDHQRITVQEMPEMAPAGQLPRSIDIILDDDLV
                     DTTKPGDRVNIIGVFKSLGAGGMDQDSSALTAFKTLIIGNTVYPLHARSTGVAARQAL
                     TDVDIRNINKVSKRSDIFDLLSQSLAPSIYGHDHIKRAVLLMLMGGMEKNLDNGSHLR
                     GDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLE
                     AGAMVLADRGIVCIDEFDKMSDADRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAA
                     NPVFGQYDINRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPP
                     GYLEGEPIRERINLSLAVGVDDEDENDAQNEANANDDDENQIFEKYNPLLQAGAKLAK
                     NKGNHNGTEIPKIVTIPFLRKYVQYAKERIQPQLTKEATDVIVKNYADLRNDENSKKS
                     PITARTLETLIRLATAHAKVRLSRVVNKRDALLAVNLLRFALLGEDVGNDIFYEDSDA
                     EESLMNRSPKKSPRKKTRGSARSSPVKSTPRKGTVSSPVSNSARRNLGIVDSDYEQDE
                     PINIEDEEQLEDRIRRGLRVSPRRREQLSQQSAENAGPLSDTPRLSNMSNSTHTTSFD
                     IENVSNSKISTARLSLLSGITARLMQSGIFEDESYPLEGLFGLINEELPDEEKFTEEE
                     YMAGLMIMAERNNLMLADNKVWRV"
     gene            complement(74035..74116)
                     /gene="TPHA0Otrna9S"
                     /locus_tag="TPHA_0Otrna9S"
                     /db_xref="GeneID:11530632"
     tRNA            complement(74035..74116)
                     /gene="TPHA0Otrna9S"
                     /locus_tag="TPHA_0Otrna9S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:11530632"
     gene            complement(<74592..>75068)
                     /gene="TPHA0O00420"
                     /locus_tag="TPHA_0O00420"
                     /db_xref="GeneID:11530608"
     mRNA            complement(<74592..>75068)
                     /gene="TPHA0O00420"
                     /locus_tag="TPHA_0O00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688399.1"
                     /db_xref="GeneID:11530608"
     CDS             complement(74592..75068)
                     /gene="TPHA0O00420"
                     /locus_tag="TPHA_0O00420"
                     /inference="similar to DNA sequence:INSDC:YEL034W,YJR047C"
                     /note="similar to Saccharomyces cerevisiae HYP2 (YEL034W)
                     and ANB1 (YJR047C); ancestral locus Anc_1.478"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688447.1"
                     /db_xref="GeneID:11530608"
                     /db_xref="GOA:G8C1I5"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:G8C1I5"
                     /translation="MSEEEQHTFETADAGSSLTYPMQCSALRKGGFVVIKGRPCKIVD
                     MSTSKTGKHGHAKVHLVAIDVFTGKKMEDLSPSTHNMECPFVKRTEYQLLDIDDGFLS
                     LMSNDGETKDDVKAPEGELGDKLQEAFDEGKDLNVVIISAMEEEAAISFKEANGSA"
     gene            <76318..>77964
                     /gene="TPHA0O00430"
                     /locus_tag="TPHA_0O00430"
                     /db_xref="GeneID:11530633"
     mRNA            <76318..>77964
                     /gene="TPHA0O00430"
                     /locus_tag="TPHA_0O00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688400.1"
                     /db_xref="GeneID:11530633"
     CDS             76318..77964
                     /gene="TPHA0O00430"
                     /locus_tag="TPHA_0O00430"
                     /inference="similar to DNA sequence:INSDC:YEL036C"
                     /note="similar to Saccharomyces cerevisiae ANP1 (YEL036C);
                     ancestral locus Anc_1.479"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688448.1"
                     /db_xref="GeneID:11530633"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C1I6"
                     /translation="MKYNKKVSHVVSSNLVSVIGSLFTALVVLKFLISNSLISLPSLL
                     KFVQLNPSHSYVPDFRDTPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRF
                     FDHLDKMSYPHNLIDLSFLVSDSSDDTMGVLLSNLQTAQSQRDKSKRFGNIEIYEKDF
                     GQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVALKPYHSWVYWRDVDIETAPRTIM
                     EDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEGGLQLANQLNEDAVIVEGYP
                     EYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVFRSGSHFPAFSFEKHAETE
                     AFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHMEWMAEEETRRIEEEKLREFYNKV
                     WDLGFDDVREEWSFEKDSILKNIDNNEAVNNKLANENEWYENTLEEKNKLLELQKEKS
                     REAAKKKAREEFKNKEKANAERSLNGNKEMKDSLNKGKTENKKESTEKKQDNTNKNMN
                     NEQNPKQEEKGQPGENTNKDAPKQKEAKQNVPADFDPQKQ"
     gene            <78697..>79806
                     /gene="TPHA0O00440"
                     /locus_tag="TPHA_0O00440"
                     /db_xref="GeneID:11530555"
     mRNA            <78697..>79806
                     /gene="TPHA0O00440"
                     /locus_tag="TPHA_0O00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688401.1"
                     /db_xref="GeneID:11530555"
     CDS             78697..79806
                     /gene="TPHA0O00440"
                     /locus_tag="TPHA_0O00440"
                     /inference="similar to DNA sequence:INSDC:YEL037C"
                     /note="similar to Saccharomyces cerevisiae RAD23
                     (YEL037C); ancestral locus Anc_1.480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688449.1"
                     /db_xref="GeneID:11530555"
                     /db_xref="GOA:G8C1I7"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8C1I7"
                     /translation="MVSILFKDFKKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKL
                     IYSGKVLQDSNSIEGCGLKDGDQVIFMISKKKSTVTQVTEPTESKEVAAPEVAASAPV
                     AESTETATEAAPAHSTTEGQQPVTASNDPGFVVGSQRNEAVDRIMEMGYEREEVERAL
                     RAAFNNPDRAVEYLLMGIPDHLQQQQQQPQVTQEAQEPTSGSTEVAQTAGEQGDINED
                     DLFAQAAQNNATDGSTGASAAGSQPGSIGLTMEDLLALRQIVAGNPEALGPLLENLST
                     RYPQLREQILSNPEVFVSMLLEAVGDNLQGSMDSEFDNLGLTEGAEGDEGEESELAQP
                     PISLTEADEQAISRLCELGFERSLVVQVYFACDKK"
     gene            complement(<80090..>81247)
                     /gene="TPHA0O00450"
                     /locus_tag="TPHA_0O00450"
                     /db_xref="GeneID:11530556"
     mRNA            complement(<80090..>81247)
                     /gene="TPHA0O00450"
                     /locus_tag="TPHA_0O00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688402.1"
                     /db_xref="GeneID:11530556"
     CDS             complement(80090..81247)
                     /gene="TPHA0O00450"
                     /locus_tag="TPHA_0O00450"
                     /inference="similar to DNA sequence:INSDC:YEL041W,YJR049C"
                     /note="similar to Saccharomyces cerevisiae YEF1 (YEL041W)
                     and UTR1 (YJR049C); ancestral locus Anc_1.484"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688450.1"
                     /db_xref="GeneID:11530556"
                     /db_xref="GOA:G8C1I8"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:G8C1I8"
                     /translation="MAEPTTKHAGADDIVDDMKSLSLGTSSHIYKNIMLVVKLGDASL
                     VYLTRELIQWMLTNFPKITIYLQDVFDGSKELDAKELIADCKTRHERLQYWSVGSIKE
                     VHENIDLVITLGGDGTVLFVAGLFQMKAPPIMSFALGSLGFLTTFNFENFKKDLKTVL
                     NGENRLNVRMRLFCKHFTRKPNSVDEETGETVYTYEVAREYHVLNEATIDRGPCPYLS
                     DIEIYGDGTLFTEAQGDGVIIATPTGSTAYSLSAGGSLVHPRVNAIAITPICPNTLSF
                     RPIILPEDMVLQIKVPVTARGTAWVCLDGKVNFELAKGDYVIMAASPFPIQTVESSAA
                     QYIHSIRRTLNWNRRMPQKSFSDILSPKNKVKYDDCQRAKLPIDVVDKIED"
     gene            complement(<81615..>83513)
                     /gene="TPHA0O00460"
                     /locus_tag="TPHA_0O00460"
                     /db_xref="GeneID:11530557"
     mRNA            complement(<81615..>83513)
                     /gene="TPHA0O00460"
                     /locus_tag="TPHA_0O00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688403.1"
                     /db_xref="GeneID:11530557"
     CDS             complement(81615..83513)
                     /gene="TPHA0O00460"
                     /locus_tag="TPHA_0O00460"
                     /inference="similar to DNA sequence:INSDC:YEL042W"
                     /note="similar to Saccharomyces cerevisiae GDA1 (YEL042W);
                     ancestral locus Anc_1.485"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688451.1"
                     /db_xref="GeneID:11530557"
                     /db_xref="GOA:G8C1I9"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:G8C1I9"
                     /translation="MHFLLLHHHSFHRPPSPHTITHRRTMRVLGIRLPRVMYGLVALV
                     VVLLFFNIIKVFGPSSAGLQTMGSSIAAPDFLGLFSQAQEQFKDTSSGPGDQSASVGA
                     NGGPESREAEALRAAQKENAAKLDQKMNGDVNPENKDPAKSDAGAAPGLDAPVAQGED
                     SLAESLDRAASGGSPASSDPDAAAASNDIDSLNLKKGGAEAAKGSCGTAHQFVIMIDA
                     GSSGSRVHVYEFDVCSQPPVLVHETFHMLKPGLSSFDTDTNGAAHSLDPLLEIAVRVV
                     PDDVKACTPIAVKATAGLRLLGDQKSDLILDAVKTHLTGSYPFAVVQGNGIEIMGGDD
                     EGVYAWVTANYLLGNIGSGNKVGTSAIFDLGGGSTQIVFEPSFELDEEMAPGEHQYDL
                     TFDDNTYSLYQFSHLGFGLNQARNAINSLLVEEAIQNSKIVRGDTLSPHKLISPCLPQ
                     GTVVENVKVQMPSGFEYTIEFSGPSKPSSLQCRWLADQILKKDGDCAQPPCSIDGAHQ
                     PSLVHAFKSTNDIYAFSYFFDRTQKLGLPSTFTLKQLKDLSKSVCKGPNEWQKAFANE
                     QIVEELRSDSLYCQDLTYMVALLQTGYNIPLHRELKAVERIANNEIGWCLGAALPLIK
                     SDSWSCRN"
     gene            <83915..>84625
                     /gene="TPHA0O00480"
                     /locus_tag="TPHA_0O00480"
                     /db_xref="GeneID:11530604"
     mRNA            <83915..>84625
                     /gene="TPHA0O00480"
                     /locus_tag="TPHA_0O00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688404.1"
                     /db_xref="GeneID:11530604"
     CDS             83915..84625
                     /gene="TPHA0O00480"
                     /locus_tag="TPHA_0O00480"
                     /inference="similar to DNA sequence:INSDC:YJR050W"
                     /note="similar to Saccharomyces cerevisiae ISY1 (YJR050W);
                     ancestral locus Anc_1.486"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688452.1"
                     /db_xref="GeneID:11530604"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:G8C1J0"
                     /translation="MSRNVDKANSVLAVYQEAQAEQTGGYRDFSRLKRPTRVNSVSSL
                     EEAREWRRQLVLEIKAKITRLFDRSLNLLQIRELSDDIDELLREKGKWDWNIRHRLGG
                     GRADASEDNGRLFGGRVVMGTRYFGRALELPEVVALTARQRLQDEQQAALKNVVDPGL
                     LPRDTDSPYYKGASSDAEQWHRSCQALTDSLQAKAPDQADSQLAATLQSLEVPTLKDV
                     EHWLVMRRKEKLLRQLDL"
     gene            <84871..>86364
                     /gene="TPHA0O00490"
                     /locus_tag="TPHA_0O00490"
                     /db_xref="GeneID:11530605"
     mRNA            <84871..>86364
                     /gene="TPHA0O00490"
                     /locus_tag="TPHA_0O00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688405.1"
                     /db_xref="GeneID:11530605"
     CDS             84871..86364
                     /gene="TPHA0O00490"
                     /locus_tag="TPHA_0O00490"
                     /inference="similar to DNA sequence:INSDC:YEL047C,YJR051W"
                     /note="similar to Saccharomyces cerevisiae YEL047C and
                     OSM1 (YJR051W); ancestral locus Anc_1.490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688453.1"
                     /db_xref="GeneID:11530605"
                     /db_xref="GOA:G8C1J1"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:G8C1J1"
                     /translation="MPRLRKILFYLVVLVSFFLVRRSFVNDSGKEQFPVVVIGSGLAG
                     LSAVNQLLNDDVPAVLLDKASSFGGNSVKAASGISGAGTSVQKKHHVEDSPELFLQDT
                     LSSAKGRGVEKLMKVMADESAGAIAWLQERFGLKLDLLSQLGGQSVPRTHRSDGPLPP
                     GAELVKALTRRIKNVSRDYPDKVKIQLDAKVTDIKINKETNRVEYVVYRDASNQEQVL
                     RTGNVLVATGGFSYSQDMLKKYAPQVAGLPTTNCLLTTGDGLNILQSLGAHLVDMDQI
                     QIHPTGFVDPKDRKNNWKFLAAEALRGLGGILVNPSTGKRFVNELETRDTVTESIRKA
                     CKKSEGVSLLVISENTFQDYKSSVEFYISKGLVQKMPISSLVSEYNLPISATEIASDL
                     IEYSTEKKDKFDRVHKINTFGDAVTADTEVYVAEITPVVHFTMGGVKIDEFSQVLNES
                     DSPVADGLYAAGEITYGVHGSNRLGGSSLLECVVFGRIAAQHISRNF"
     gene            <86715..>87494
                     /gene="TPHA0O00500"
                     /locus_tag="TPHA_0O00500"
                     /db_xref="GeneID:11530606"
     mRNA            <86715..>87494
                     /gene="TPHA0O00500"
                     /locus_tag="TPHA_0O00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688406.1"
                     /db_xref="GeneID:11530606"
     CDS             86715..87494
                     /gene="TPHA0O00500"
                     /locus_tag="TPHA_0O00500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688454.1"
                     /db_xref="GeneID:11530606"
                     /db_xref="UniProtKB/TrEMBL:G8C1J2"
                     /translation="MSQTKDSKFRQLLRSLKRNNKSKEPRDSDKITFNIREKLRHIKF
                     RIHNKKSSKSHLKTEKKFIKPLNSNHINTVKPCLPTFDTHLIIIDSPLEMTTLDPGKR
                     VGDTVLENKCIQPEFSDFEKCLDERFRLHGVRKHAVINTNLPETKKNNSNIINIKQSR
                     TNRNDIEVLSGTIPHNKLVKNNFIRGATNSLQETEEVSECSIESRNMHPSVNELISLI
                     DNEYDYYNSLPRTLLIKPDMPTSDNILSLDNTLISEYSLCY"
     gene            88612..88682
                     /gene="TPHA0Otrna7G"
                     /locus_tag="TPHA_0Otrna7G"
                     /db_xref="GeneID:11530653"
     tRNA            88612..88682
                     /gene="TPHA0Otrna7G"
                     /locus_tag="TPHA_0Otrna7G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11530653"
     gene            <88883..>90622
                     /gene="TPHA0O00510"
                     /locus_tag="TPHA_0O00510"
                     /db_xref="GeneID:11530696"
     mRNA            <88883..>90622
                     /gene="TPHA0O00510"
                     /locus_tag="TPHA_0O00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688407.1"
                     /db_xref="GeneID:11530696"
     CDS             88883..90622
                     /gene="TPHA0O00510"
                     /locus_tag="TPHA_0O00510"
                     /inference="similar to DNA sequence:INSDC:YJR052W"
                     /note="similar to Saccharomyces cerevisiae RAD7 (YJR052W);
                     ancestral locus Anc_1.492"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688455.1"
                     /db_xref="GeneID:11530696"
                     /db_xref="UniProtKB/TrEMBL:G8C1J3"
                     /translation="MYRNRRRRGNNDQGITGPNSALTQFLREEGISAETIRQRWLETN
                     GINTEEVVKEEVEEKVEEVVVVKRETKKNTIKSKRKTEFSDESSDELSSEDDGAQYRR
                     RLNIISKDSDEEEYEDDDTSVASSLIQSPPRKSARLNPNDPNVLKRQQEVLKTRKRRR
                     VRAVNILNKKTFSVPSLQYLCITNISKNILRIQMESEENETDNSPSVIYSRVRKTLGG
                     ISLDNLTNLSNALSKNRSLNDQTLQLFLRTDLQSLTFHDCSKISFDGYKSLAIFSPNI
                     SHLSLQMCGQLNNESLLYIAEKLPNLISLKLDGPFLINEDTWKEFFQAMKGRLQEFHI
                     SNTHRFNDSSLQSLLTNCASSLVSLGFSRLDTLSNYSLLPQYLNNKEFHTLSIQYPYN
                     EQDVDDEVIINLLGQVGSTIKHINLNGCQNLTDSVLLNGFCALLNGNKGIESLSFSEL
                     DQITDDGLIYFFSQVSLPNLKDCNLQRCLKIGDMAIMELVLNEAKSSLLHLNLNSLKE
                     LSSAVFEAMSFPNLETLNIGFIPCIDDATIETIQKQNEKLKIIEVFGDNKISATAEVK
                     KGVTLIGRQSDNI"
     gene            complement(<90698..>92599)
                     /gene="TPHA0O00520"
                     /locus_tag="TPHA_0O00520"
                     /db_xref="GeneID:11530654"
     mRNA            complement(<90698..>92599)
                     /gene="TPHA0O00520"
                     /locus_tag="TPHA_0O00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688408.1"
                     /db_xref="GeneID:11530654"
     CDS             complement(90698..92599)
                     /gene="TPHA0O00520"
                     /locus_tag="TPHA_0O00520"
                     /inference="similar to DNA sequence:INSDC:YML046W"
                     /note="similar to Saccharomyces cerevisiae PRP39
                     (YML046W); ancestral locus Anc_1.493"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688456.1"
                     /db_xref="GeneID:11530654"
                     /db_xref="GOA:G8C1J4"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:G8C1J4"
                     /translation="MTIIDEGQLTAANALADLDSTFKDDNPELVIAYSNIQWDDIISL
                     NTMVEEVEKVVLKYKSPNAKIKNSLTLMMRQLLQKYPLFFGYWKKYTAITYQLFGLDA
                     SIKVLNDATIAFPNSLELWLDYLNVLCANNPESVKLIREKFQAAKLSIGHQFMSDPFW
                     DKYIEFETAHSEWEKLKDIYSELITYPIYHYAKYGIAYKKFIKLQRMNIQESNVDAQI
                     KATQGIVNAIWKYENKIKQNFFNLTPVSKGELENWDGYLTFLVTNKKRFGFSLRFLQS
                     VFERSLIPCHYYEYFWNKYLDFLKTEDIDNREIIETLYKGIKTLPEDNDSFRINYLSF
                     LKDRYLTDKDFIFSTFQKTVGYLLRIWPNEIKLMTEYLSLLKKHKFPSDLNQSDKDIL
                     TQQTLYTSFLHVAIDNYLKNNIDDEVYLQRITTDITFPIIAVELIKMNWLVLKNTMQT
                     IKLLTQFMKLQILKSSSTFWLTYYKFEKSSKNFNKLNVFVSQLGKEINLPTEVINDIM
                     TDYQTFYLTNSNIASHQFTSSSRRKNNETSTYLFKKQIISYNKYGFNPNIKKFKRSEW
                     NKQTDFKENGHLGIILDKPQITNSILEVQSKAFKNKPPSLPSFKNIDKLNQPIKYSNI
                     ISKEYIDKK"
     gene            <92973..>94919
                     /gene="TPHA0O00530"
                     /locus_tag="TPHA_0O00530"
                     /db_xref="GeneID:11530655"
     mRNA            <92973..>94919
                     /gene="TPHA0O00530"
                     /locus_tag="TPHA_0O00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688409.1"
                     /db_xref="GeneID:11530655"
     CDS             92973..94919
                     /gene="TPHA0O00530"
                     /locus_tag="TPHA_0O00530"
                     /inference="similar to DNA sequence:INSDC:YJR053W"
                     /note="similar to Saccharomyces cerevisiae BFA1 (YJR053W);
                     ancestral locus Anc_1.494"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688457.1"
                     /db_xref="GeneID:11530655"
                     /db_xref="UniProtKB/TrEMBL:G8C1J5"
                     /translation="MSIRPVNFDELPDMSFEDIDTTLNKVDVHKSYSKKTNKKKLEIK
                     SKGELSPVHKNKHLNGITTPSLTASSEGTTFSNHDRKFSIDSKTDDDNFDGISDKIKI
                     DNEFFNDFEEFQNAKDGFDEALKIHFKLDNSSPVIDDNDDVDEEDEEYANDDYGNGDD
                     NCNKNDMYGVMGRDSRNTEMDILSSRFDKALNWNSQDTNLNNNRQLRKPSSMMELKPY
                     GLTRYHRTNSKETNRHNLQGSKSSSNLRARKNGTMQIKKSMPSLDSRYRLSDTYNNEE
                     AYPSKGYTHNVGLDRKTFNSNFETNQRLSTFEEESFDDNDEDFFFNENFIKPQFSNNP
                     NLIKNRIRSPTRISISPSQYDIVQDETLLTPSLKKRQKEWNNRSEQLKTFKEYGVNQR
                     EQNRVKFPNAVNRIKTIKQEIDHNTPIKKGKMYYNPKTLNWEGNDKILDKFQVIKDNE
                     KKRPILIRSKSPDKTTKNKVSSVNINNDNPRIVGKMMFDEANLRWVSLNEYENDPFQN
                     IPDFKIPPKSYSNNNGINGSTLSLRKKESIANLSPFLRSQSHRVETSNNAEKMSRFYS
                     AGTYSSHFSSEELSAFQISSKIIEKFYHEENKWVNEINGWMTLNKNAESDLESHLDVT
                     QELNINKNKYMYEIRNMVLNSSRG"
     gene            complement(<95392..>96570)
                     /gene="TPHA0O00540"
                     /locus_tag="TPHA_0O00540"
                     /db_xref="GeneID:11530715"
     mRNA            complement(<95392..>96570)
                     /gene="TPHA0O00540"
                     /locus_tag="TPHA_0O00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688410.1"
                     /db_xref="GeneID:11530715"
     CDS             complement(95392..96570)
                     /gene="TPHA0O00540"
                     /locus_tag="TPHA_0O00540"
                     /inference="similar to DNA sequence:INSDC:YML048W"
                     /note="similar to Saccharomyces cerevisiae GSF2 (YML048W);
                     ancestral locus Anc_1.496"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688458.1"
                     /db_xref="GeneID:11530715"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:G8C1J6"
                     /translation="MEVYVRFNGDADHDYAFQINEDDTVKTKIEPIFTDTSKTGLGNL
                     MVLRPTIFHKRVPSKFYKSNHPGYLSEGACLLFDNDADYPQYLVDLDESKPLIKQLWP
                     GQLIVPQWEYSPFNVIVYTSLMLLWLYTDLPDMISPTPGICLSNQISRYLVLPFMEMY
                     GLPDMTQKLKDEITVNYNTPLAQIAFFVLHVIKVAIISLVLKLGIGNPISFNPIKIFQ
                     TRIINLNDPTLKKTLFNIGWMGARRAGFYDYQPNYYNYIMKKYGGPVAAYKANKLRTA
                     ARPGLVLAEGEGFQTPLKDRFTNSTFKTMEEKKKFVLSEEYYIELEKNLKENIDLCEG
                     DIGKMNNEIRRFRRFGLYEVSPKLRQLVLDRKSVEPEAIIDGLPAPTKPDTKEEKKEK
                     "
     gene            complement(<98059..>98952)
                     /gene="TPHA0O00550"
                     /locus_tag="TPHA_0O00550"
                     /db_xref="GeneID:11530716"
     mRNA            complement(<98059..>98952)
                     /gene="TPHA0O00550"
                     /locus_tag="TPHA_0O00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688411.1"
                     /db_xref="GeneID:11530716"
     CDS             complement(98059..98952)
                     /gene="TPHA0O00550"
                     /locus_tag="TPHA_0O00550"
                     /inference="similar to DNA sequence:INSDC:YML050W"
                     /note="similar to Saccharomyces cerevisiae YML050W;
                     ancestral locus Anc_1.498"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688459.1"
                     /db_xref="GeneID:11530716"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8C1J7"
                     /translation="MQIKYKTIESFNNLKVFNKINLKLPLDKQIDTVGKLPPIPNYEK
                     HLMIIDKNDDSNNWMQGWGSRLEMNDSWPYNLVGLFKNEINKYKKNGVMTSVVKLKQS
                     TDVFTEIRGNPTNDSALIYVIPDMKLYTIRNDESTAVEFIKYVIKDLKVSEQLHFQDY
                     LKKGGLKTPTVTKADSIVGVTKRFEGRKLTNDWILVCGHNERDCRCGYLAPLLVDEYM
                     KFDKRSNIGIISHVSGHKFAGNVIHYKYEPSKNSMDSFWFGRVLPPMVHSLVENLKNN
                     IVIKNVFRGSKELREPPCQKQ"
     gene            complement(<99362..>100315)
                     /gene="TPHA0O00560"
                     /locus_tag="TPHA_0O00560"
                     /db_xref="GeneID:11530717"
     mRNA            complement(<99362..>100315)
                     /gene="TPHA0O00560"
                     /locus_tag="TPHA_0O00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688412.1"
                     /db_xref="GeneID:11530717"
     CDS             complement(99362..100315)
                     /gene="TPHA0O00560"
                     /locus_tag="TPHA_0O00560"
                     /inference="similar to DNA sequence:INSDC:YML052W"
                     /note="similar to Saccharomyces cerevisiae SUR7 (YML052W);
                     ancestral locus Anc_1.501"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688460.1"
                     /db_xref="GeneID:11530717"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G8C1J8"
                     /translation="MNRYMSILVKLSTLLFLAGNTLLLILIIISGSTNDYPINNFYWV
                     EADTANIPNAPDVTRWTFWGACGVENGDETNCGSNLSPAAPISPVDNFHTTINVPSKF
                     VNDRNTFYYLTRFSFCLFWISLAFIGITFLLYIISWFSYEFTKVCFLLVSIGCLFNVT
                     GVVLQTAASVLARNAFNKTGVNHSKLGSDLFGIAWASVALSLLEAIALAVTHINNVYQ
                     RRSNNSISQVNDVYDPIYGTAQRRSNSYTTNSRGFKKFFTISRKNRTTSQQLNNQQIP
                     NPPMHTDEYIAEQPLQEHQRKGINFFTIRNTKSKSTIDDSV"
     gene            complement(<101208..>101720)
                     /gene="TPHA0O00570"
                     /locus_tag="TPHA_0O00570"
                     /db_xref="GeneID:11530718"
     mRNA            complement(<101208..>101720)
                     /gene="TPHA0O00570"
                     /locus_tag="TPHA_0O00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688413.1"
                     /db_xref="GeneID:11530718"
     CDS             complement(101208..101720)
                     /gene="TPHA0O00570"
                     /locus_tag="TPHA_0O00570"
                     /inference="similar to DNA sequence:INSDC:YJR056C"
                     /note="similar to Saccharomyces cerevisiae YJR056C;
                     ancestral locus Anc_1.502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688461.1"
                     /db_xref="GeneID:11530718"
                     /db_xref="InterPro:IPR029196"
                     /db_xref="UniProtKB/TrEMBL:G8C1J9"
                     /translation="MEKLQNLEACLPPEQPPTVQTIDHLQNEISREFKSAANSVAKLY
                     RLSNEKKSLLQHKGYLDCIDDILQTIHDGKEETSVHDIELWCMKKRNELLGPKSNFNF
                     DKNSDNNKKEKEYQLSMIPLSIERDKTKERQNVSRTNRDGGSEITDDIDLNDDLFEME
                     GGHTEKRPKL"
     gene            complement(101898..101987)
                     /gene="TPHA0Otrna3Y"
                     /locus_tag="TPHA_0Otrna3Y"
                     /db_xref="GeneID:11530630"
     tRNA            complement(join(101898..101934,101948..101987))
                     /gene="TPHA0Otrna3Y"
                     /locus_tag="TPHA_0Otrna3Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11530630"
     gap             102505..102704
                     /estimated_length=200
     gene            103531..103601
                     /gene="TPHA0Otrna8G"
                     /locus_tag="TPHA_0Otrna8G"
                     /db_xref="GeneID:11530710"
     tRNA            103531..103601
                     /gene="TPHA0Otrna8G"
                     /locus_tag="TPHA_0Otrna8G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11530710"
     gene            complement(<104398..>104883)
                     /gene="TPHA0O00580"
                     /locus_tag="TPHA_0O00580"
                     /db_xref="GeneID:11530698"
     mRNA            complement(<104398..>104883)
                     /gene="TPHA0O00580"
                     /locus_tag="TPHA_0O00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688414.1"
                     /db_xref="GeneID:11530698"
     CDS             complement(104398..104883)
                     /gene="TPHA0O00580"
                     /locus_tag="TPHA_0O00580"
                     /inference="similar to DNA sequence:INSDC:YFR011C"
                     /note="similar to Saccharomyces cerevisiae YFR011C;
                     ancestral locus Anc_1.370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688462.1"
                     /db_xref="GeneID:11530698"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="UniProtKB/TrEMBL:G8C1K0"
                     /translation="MGGQASKSSETQVFIPRSQVDFSESLLATLESSKETDYTRSQIA
                     ERYIEQRVSDRLSQLEEDTLKKFETKLELSLNSNTEDSTKEPILSTKLLQNKIEELNK
                     RLSLFENKDSEKKITLQSLDDDKGVRRELLKCLLDNSGKPLNCYDLIQQFKQKVSEST
                     P"
     gene            <106289..>107764
                     /gene="TPHA0O00590"
                     /locus_tag="TPHA_0O00590"
                     /db_xref="GeneID:11530593"
     mRNA            <106289..>107764
                     /gene="TPHA0O00590"
                     /locus_tag="TPHA_0O00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688415.1"
                     /db_xref="GeneID:11530593"
     CDS             106289..107764
                     /gene="TPHA0O00590"
                     /locus_tag="TPHA_0O00590"
                     /inference="similar to DNA sequence:INSDC:YGL160W"
                     /note="similar to Saccharomyces cerevisiae YGL160W;
                     ancestral locus Anc_1.379"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688463.1"
                     /db_xref="GeneID:11530593"
                     /db_xref="GOA:G8C1K1"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:G8C1K1"
                     /translation="MHIVYCFLLLLRRYVVIKENTTKIVRAVYDLNPYVHMLLIGFAI
                     VIPFYDPKYSKPTVFFKRLGRLSYVLITLNLILMLRPNWLLTKNYTYTDFIPIHKWLS
                     RFIVIISLVHGIAFLIWWKVNPSPTVSINIKLQNNYNAVGLAISIISVILMVFSLGPL
                     RRWNYNVFYILHNFSNIAFVFFTPIHARPGVSIPYFIINITILAAICYQKIINATAVQ
                     LVSRESFTHHHEAQSLVCVKLERKAIGSEFIPACHIRISSYSIINPLYWLLPSHPYTV
                     ISLPTDDHIELVLLEHISKSSFRLHMERNYTVVNEFNPSVPKICLTEANRICITCAGT
                     GISFGLPLYRYFLKKLQNGEQDIQYIKLVWIVKHKMSLELFEKLTSITNLMNDNCFLR
                     NIEVYITNSTQAVSNFDDDNIELQDMNSIENSIQDKYNFGSIKFGRRIDWATDLSTFV
                     DKTNGTEKTWLLACGPDSFVKSSKVYASKSGINFASEPYSF"
     gene            complement(<107944..>112062)
                     /gene="TPHA0O00600"
                     /locus_tag="TPHA_0O00600"
                     /db_xref="GeneID:11530594"
     mRNA            complement(<107944..>112062)
                     /gene="TPHA0O00600"
                     /locus_tag="TPHA_0O00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688416.1"
                     /db_xref="GeneID:11530594"
     CDS             complement(107944..112062)
                     /gene="TPHA0O00600"
                     /locus_tag="TPHA_0O00600"
                     /inference="similar to DNA sequence:INSDC:YLR256W"
                     /note="similar to Saccharomyces cerevisiae HAP1 (YLR256W);
                     ancestral locus Anc_1.380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688464.1"
                     /db_xref="GeneID:11530594"
                     /db_xref="GOA:G8C1K2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:G8C1K2"
                     /translation="MENNFMNESINKNNHSSIKNCTLKMRTEPENLSTNEVNSSNQSS
                     ENTENHSEEMNLTQNSSPSTDDTKPKMKRKRNRIPLSCTICRKRKVKCDKTRPHCDPC
                     SKTGVAHLCHYMEQTWAEEAEKELSKENELQQLKERVKSLEKTIVKLRNQHEMINDNM
                     DNDNIKDKEITVKRESLHIPSIAMTDGKMNKVTFKNDALLFKTSESVSKGQLSLSATN
                     SNSKYANDELDLTRNFDMLHIKSTGTVHLGATHWLAIMKGDPYLKLLWGHIFSMREKL
                     NEWYLKKNSAMIKNNNNLKSLQPLGRCPVINSEQKKLSLEDSSPNTNCNTEINASSNL
                     NRTKILDITSTSKNRSLNSTKAPNKCPIDHTKYQELAITSKVNNQPITSASIQKSEEE
                     KIPIIQMTSPKIIKNIPLESTNPLPSFHSLASKFPIVHDANNNINSSEVGKKKRKLNI
                     SDDASLNDSSIHMLSKDLTIKKVCDLLPPIDIIELYLNYFFNHIYPFIPILDESTFRD
                     NTKIILGVCPVNNEKDTITNKISRVTKLKITKQADYCILGILLIILRITWLSLPSNSS
                     KINLGDNDKVTTASKKASTGTNSQEKDECLLMKHEIKKEAINLVGKRLIRFDELSSIS
                     NNNVSLVTIQFAIFLKLYLMCCPNEANDLSISPISNTGNSQDNESHQVLLSSIIQMCL
                     SCGLHRDPDNFPQLNSVTSNDSTLSTFSTDPTSLSNNQQSQTERFKHTWRKTWYYVVS
                     LDVDQSLSLGIPRLLRNLNDFSDTKLPSASKLDYVSDIKELVIVKNYTLFFQIDLVII
                     SVLNHILNISIAKKVKKHQLDSLIMSLKELTEGSKSIFAVISNLHDENLLNKSEGVID
                     NMNIDKNYGLSTMDELIYNNGIKSTKYDSDKYLENGHITATKALFFSKHMLIRMLLYI
                     VSYILFTYYEPLGNENPETTIIAKEYAQKTLNYAMDGYKNCLLFFEKTGSSGCCNSIF
                     NFMGVVLAPRCLDIGNRAIQFMICLIMRSKCGPLSGMGESTVLSTSGTNSNDDDTQNK
                     VKEFKRTSLSVAKSFPNAELDINGNLTDILTSKMIVFHKLASQLSSKYPYANRNVKST
                     AFFLSLLAPETLKNEISKTSRDISKISGILKNVPSLLLSGDKDSLQRCPVYQDALGFV
                     DNKPGKVSSLLNPSQTIQKSYSAGRYELPPLKSYMPVTYSNESSPQSTLDPEIKRRKI
                     DAEATEFITNSINNISLPVLPSYQPNSNSSIGYQNANRNTDTVNQSMTMDSNPQINGF
                     NSGIEFLDNMDQATSSSVNMENNPPNQNTVTQFAPDFEEFIAENSNFNGMVLNPNSLV
                     EVFGMNLEDPAIPGNLGSTDFLPIDNIGFEGIADLDNSDFWSNADRNTMSYL"
     gene            complement(<112981..>113658)
                     /gene="TPHA0O00610"
                     /locus_tag="TPHA_0O00610"
                     /db_xref="GeneID:11530595"
     mRNA            complement(<112981..>113658)
                     /gene="TPHA0O00610"
                     /locus_tag="TPHA_0O00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688417.1"
                     /db_xref="GeneID:11530595"
     CDS             complement(112981..113658)
                     /gene="TPHA0O00610"
                     /locus_tag="TPHA_0O00610"
                     /inference="similar to DNA sequence:INSDC:YLR251W"
                     /note="similar to Saccharomyces cerevisiae SYM1 (YLR251W);
                     ancestral locus Anc_1.384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688465.1"
                     /db_xref="GeneID:11530595"
                     /db_xref="GOA:G8C1K3"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:G8C1K3"
                     /translation="MLNTFFTFYRNSINKRPVLTNSLTTGFLFATGDVLAQKLFPNSR
                     SSGTEISSKATRYDYRRTLNSIIYGSVIFSPIGLRWYQLLSKIKTNYKILNFSAIKSF
                     ENKFKINIKNTILRVGVDQLLFAPLSIPFYFICMSVLEHPTNKIPVHVPEIKEKLNKL
                     WLSTLLTNWKIWPFFQLINFSIIPLQFRLLTVNFMAIFWNTYLSYTNNYRTPIAKKPV
                     YYPPLNE"
     gene            <114205..>115830
                     /gene="TPHA0O00620"
                     /locus_tag="TPHA_0O00620"
                     /db_xref="GeneID:11530596"
     mRNA            <114205..>115830
                     /gene="TPHA0O00620"
                     /locus_tag="TPHA_0O00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688418.1"
                     /db_xref="GeneID:11530596"
     CDS             114205..115830
                     /gene="TPHA0O00620"
                     /locus_tag="TPHA_0O00620"
                     /note="ancestral locus Anc_1.385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688466.1"
                     /db_xref="GeneID:11530596"
                     /db_xref="UniProtKB/TrEMBL:G8C1K4"
                     /translation="MFLDFSGRRRYYPINETFGELYVEVLHFYWIKKDATGLDKKDLI
                     QLQLNYLKNFAIEGIDARIETLVVDDFIINNEWILQKLLLLIAVLKQIKSVGDVIKSC
                     LTIYFLDIKLFQLEYTFENDYRQVEIIDIYNYIYEELSWYYNTILVNIRRGIINLQPD
                     FGITKYDNWDFSQKLLFFHLDVGLNEFSRPTQNFILVPKAFPRKYLLAGKEFTYFHDQ
                     LGLNNSYRCFKIELDEGSDMNFIFLQDRNLVISPLESPLQFNWCDKDKIDYIGSLTEE
                     SSPKKLQSKLKLNNRTILKNVTNNNGLPQRNLNMLNLFEKETHNKVNQNEVVQDSKSL
                     IDVDEGYIKGREVTTGLEATAMDDSIEDSGELLQQYSSEIVLIEKSPVQENILKELSK
                     TVDRLSIASMELKLLEYPETPVIYNVLRPQTTLNLQNSYGAEELSKKSNNYMSTDNFV
                     FHSTEELKSSALITNSRKSSITYEKPWNIKRDIVDNWKYNNIETITENLASDKYLETI
                     PIRDAFKQKYSKVKEQCRYFKTFVKYRLNEEQS"
     gene            complement(<115953..>117737)
                     /gene="TPHA0O00630"
                     /locus_tag="TPHA_0O00630"
                     /db_xref="GeneID:11530634"
     mRNA            complement(<115953..>117737)
                     /gene="TPHA0O00630"
                     /locus_tag="TPHA_0O00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688419.1"
                     /db_xref="GeneID:11530634"
     CDS             complement(115953..117737)
                     /gene="TPHA0O00630"
                     /locus_tag="TPHA_0O00630"
                     /inference="similar to DNA sequence:INSDC:YLR173W"
                     /note="similar to Saccharomyces cerevisiae YLR173W;
                     ancestral locus Anc_1.386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688467.1"
                     /db_xref="GeneID:11530634"
                     /db_xref="UniProtKB/TrEMBL:G8C1K5"
                     /translation="MEERDLETQQLLNQPAAPENDIRQRALIRERTKKSVIVSCFFLG
                     IIILTSFYIFIKSNIPPNDVIQQSIFDISQVEVNRVSLDGWTDGGDALNNDGGKFLQI
                     SAFTNITLNYDKWNSKNYTSELTDFQKKSLRNINEHVIKELCIDFENISTYNGMNEES
                     KELGTIFLKDTICINVRNNITTPIKITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDM
                     SLKLSKKSYLLFGANLRFYTLDNIKLNWQKFINWKKNEEGADQLRHLFDNITINSIRV
                     TDSETGFDADFTAEIPTFIDYSKLIEIPRNMKLPKLKWQLKLPNCNGVFDISLHNIDL
                     LTNSFPIRNVEKIKIGGSASIFDFFPNELMNDICWYNDENIQTPMSRLIDKLLNSTEL
                     ITIQTKPSLVEDENCQNCLIPGQIMKEAFDVFPFLPVKANITANFDKLVDNFTIEDLK
                     IKWINTDSGQRKLSMVGKLIGLLNLSFYQTSGQKISVQNLKGNISLYHNEIHFLSLPM
                     KVWHNATSEIIHDINDGHSLMKLYLELPNDEIEIINKWELTKFLNEIMFGGSSLVHAI
                     MDLDVNIKTIVGEIVLFGVKTENDVIVR"
     gene            118032..118104
                     /gene="TPHA0Otrna7A"
                     /locus_tag="TPHA_0Otrna7A"
                     /db_xref="GeneID:11530635"
     tRNA            118032..118104
                     /gene="TPHA0Otrna7A"
                     /locus_tag="TPHA_0Otrna7A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11530635"
     gene            <119474..>120484
                     /gene="TPHA0O00640"
                     /locus_tag="TPHA_0O00640"
                     /db_xref="GeneID:11530695"
     mRNA            <119474..>120484
                     /gene="TPHA0O00640"
                     /locus_tag="TPHA_0O00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688420.1"
                     /db_xref="GeneID:11530695"
     CDS             119474..120484
                     /gene="TPHA0O00640"
                     /locus_tag="TPHA_0O00640"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688468.1"
                     /db_xref="GeneID:11530695"
                     /db_xref="GOA:G8C1K6"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C1K6"
                     /translation="MAVLVTGASGFIALHVINLLLSQNYKVIGTVRSQDKVDKIIKQF
                     NNPNLSFELVTDITKLDAFDETLKKHSNEIDYVIHMASPLPDEGNTDFENHYLLPAVN
                     GTKSVLSAIKKFAPKGVKHVVMTSSIVAMLNVNDDSAITTEKDWNPITWEQAKTSSFL
                     CYFGSKTYSEKAAWDFLKENKDEVDFKFTTVNPVMVFGRQMFDEDVKDTLNVSCEYVN
                     KILYLPPTEKLSQDYAMSYVHVDDVALAHVMAMREDRLDGERLLLSAGTYSDQLVANS
                     INKQFPQVKGTIPAAIENCDKLMIRYDSIATQKQLGIEWKSFDVAVYDIAHQALKRLG
                     KL"
     gene            complement(<122303..>123689)
                     /gene="TPHA0O00660"
                     /locus_tag="TPHA_0O00660"
                     /db_xref="GeneID:11530636"
     mRNA            complement(join(<122303..123169,123171..>123689))
                     /gene="TPHA0O00660"
                     /locus_tag="TPHA_0O00660"
                     /product="hypothetical protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_003688421.1"
                     /db_xref="GeneID:11530636"
     CDS             complement(join(122303..123169,123171..123689))
                     /gene="TPHA0O00660"
                     /locus_tag="TPHA_0O00660"
                     /artificial_location="low-quality sequence region"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688469.1"
                     /db_xref="GeneID:11530636"
                     /db_xref="GOA:G8C1K7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="InterPro:IPR024650"
                     /db_xref="UniProtKB/TrEMBL:G8C1K7"
                     /translation="MLSDFEKRFRKYTDPNKVLNSINQLSEARLGIEKLNSEFRRLWK
                     MMPPDHWTEKGAMAIYMRLFNQNTYHLVLIHSPQSLTKMMDAAYETIAITGRFAEPSR
                     LDAPRYDNDGDYLMAAIQSRTKNPSARTIRNATREDCRRLNLCFYCKKPGHRLSECKK
                     RLARNNASSSNNAVLDQSKKSDEVYNSSKTLYPIINTILNPVVGTTLTTQLTVQGTQL
                     NVLLDSGSPTSFIRKDIVQKLKLPYHEASPFSFKGFTSNEIKHTSLAAQIPVSTTNQV
                     ITIWAYIMNHMEHDLLIGNPILDKYPTLKEGPRIESAESAESVKSLKSLKSVKSAKFV
                     KSESLKSVKSAKFVKSESLKSEPLKSEPLTSESLKTAKEAKSEMLECINPEPAEILKP
                     VESIMARQSEIAEEAQEQHLSTISEPNLDNAILNNPGLISDIETATMMVCIKKVSQSE
                     DMTLLTSCPMS"
     gene            124062..124135
                     /gene="TPHA0Otrna11V"
                     /locus_tag="TPHA_0Otrna11V"
                     /db_xref="GeneID:11530637"
     tRNA            124062..124135
                     /gene="TPHA0Otrna11V"
                     /locus_tag="TPHA_0Otrna11V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:11530637"
     gene            <125331..>127088
                     /gene="TPHA0O00670"
                     /locus_tag="TPHA_0O00670"
                     /db_xref="GeneID:11530708"
     mRNA            <125331..>127088
                     /gene="TPHA0O00670"
                     /locus_tag="TPHA_0O00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688422.1"
                     /db_xref="GeneID:11530708"
     CDS             125331..127088
                     /gene="TPHA0O00670"
                     /locus_tag="TPHA_0O00670"
                     /inference="similar to DNA sequence:INSDC:YGL158W,YLR248W"
                     /note="similar to Saccharomyces cerevisiae RCK1 (YGL158W)
                     and RCK2 (YLR248W); ancestral locus Anc_1.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688470.1"
                     /db_xref="GeneID:11530708"
                     /db_xref="GOA:G8C1K8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G8C1K8"
                     /translation="MFKLKTFFGKKKQDIKESGDSIKKQQPIVNNDKKSNVDNINNAN
                     TDGSTSSLSKTSLSSSIVAEGDDIAVVNNKDSSRKVPDESVPPRTTKREHIDIDLVSS
                     GSNISNADLLSGDDDDDDSQLNIPDAIFIEQNELKGYKLINKIGTGAFSKVFRAIPSK
                     ETFVNKHYNEVAIKVIKKDDLASITGNTSASSINHNDKSLKNQKNTKSSSREQVLKEV
                     AIHQAVSTNCENIVSFVEFQESEGYYYIVQELLSGGEIFSEIVRLTYFSEDLARHVIK
                     QLAIAVKHLHSMGVVHRDIKPENLLFETIDFVPSKKPQLRKSDDPNTKVDEGEFTINV
                     GAGSIGTVKLVDFGLSKQIHSANTQTPCGTIGYTAPEVVKDEKYSMKVDMWGIGCVLY
                     TILCGFPPFYDEKINVLTEKIANGNFTFLNPWWDEISDGAKHAVSKLLEVNPENRYDA
                     DEFLNDPWLNNYDCLKNHPEHQNELVAKQQMLQKKKKRMLKKVLQKDNSILYSPAAVA
                     MRDAFDISNAVQRIEDDRFNMNKTLDELNEEEELDIQFDNSKANPFNVNKLEEDMFEL
                     KLNTSTIINRRKNKNAPLA"
     gene            <128579..>131713
                     /gene="TPHA0O00680"
                     /locus_tag="TPHA_0O00680"
                     /db_xref="GeneID:11530638"
     mRNA            <128579..>131713
                     /gene="TPHA0O00680"
                     /locus_tag="TPHA_0O00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688423.1"
                     /db_xref="GeneID:11530638"
     CDS             128579..131713
                     /gene="TPHA0O00680"
                     /locus_tag="TPHA_0O00680"
                     /inference="similar to DNA sequence:INSDC:YLR249W,YNL014W"
                     /note="similar to Saccharomyces cerevisiae YEF3 (YLR249W)
                     and HEF3 (YNL014W); ancestral locus Anc_1.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688471.1"
                     /db_xref="GeneID:11530638"
                     /db_xref="GOA:G8C1K9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015688"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1K9"
                     /translation="MSDSEQSVKVLNELFEKLSVATPETRGEVSVEVSSFLNGGIIEH
                     DIPEQFFAQLNKALKDKKVAANALSAIAHIASEANLSPSVEPYIVATVPEICAKCGDK
                     DKDVQALASDALVAVVKAINPVAVKVLLPHLTNALSSTNKWQEKISILAAISALVDTA
                     KTQVALRMPELIPVLSEAMWDTKKEVKDAATATIAKATETVENKDIEKFIPKLIACIA
                     DPNQVTETVHLLGATTFVAEVTPATLSVMVPLLARGLAERETSIKRKAAVIIDNMCKL
                     VEDPQVVAPFLGKLLPGLKNNFATIADPEAREVTLRGLKTLRRVGNVGENDELPEVSH
                     AGDVKTTSAVLRNLLKDVKIAPRFEIVVEYVAAMGADLIDERVIDQQAWFVNILQYMT
                     IFLHEREAKDILDDFRKLAVDNIPVGPNFDEEEDEGEDLCNCEFSLAYGAKILLNKTQ
                     LRLKRGVRYGLCGPNGAGKSTLMRAIANGQVDGFPTQEECRTVYVEHDIDGTHADTSV
                     VDFVFEGNVGTKEVIVAKLIEFGFTDEMINMPISALSGGWKMKLALARAVLKNADILL
                     LDEPTNHLDTVNVAWLENYLNTCGITSINISHDSGFLDNVCQYIINYEGLKLRKYRGN
                     MTEFVKKCPTAQAYFELAASDLEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKP
                     QISDISFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTEGEVYTHENCRIAYIKQHA
                     FAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRQINESDAEAMNKIFKIEGTPRRIQ
                     EILSRRKFKNTYEYECSFYLGENIGMKSERWVPMMSVDNAWIPRGELVESHSKMVAEV
                     DMKEALASGQFRPLTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQR
                     PHLIVLDEPTNYLDRDSLGALSKALKAFEGGVIIITHSAEFTKDLTEEVWAVKDGIMT
                     PSGHNWVTGQGAGPRIEKKDDEGDKFDAMGNKIASAKKKSKLSSAELRKKKKERMKKK
                     KELGDAYVSSDEDF"
     gene            <132443..>133153
                     /gene="TPHA0O00690"
                     /locus_tag="TPHA_0O00690"
                     /db_xref="GeneID:11530550"
     mRNA            <132443..>133153
                     /gene="TPHA0O00690"
                     /locus_tag="TPHA_0O00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688424.1"
                     /db_xref="GeneID:11530550"
     CDS             132443..133153
                     /gene="TPHA0O00690"
                     /locus_tag="TPHA_0O00690"
                     /inference="similar to DNA sequence:INSDC:YLR250W"
                     /note="similar to Saccharomyces cerevisiae SSP120
                     (YLR250W); ancestral locus Anc_1.393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688472.1"
                     /db_xref="GeneID:11530550"
                     /db_xref="GOA:G8C1L0"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:G8C1L0"
                     /translation="MKLSNILLLGSSLVFNIVAADVAANKNPEVNVEVETPPEGLSWE
                     EWHMQHEHQMKEYDPESFFALHDIKKKGYFDDDDILALYGLNRGEVVGKGDGMGEHDS
                     SELIDEENSKRVVTFIKKLLDVDDDSRIAKEEYLAFAKKGHKFPDLGVGVGHHADFEL
                     EYELHHWNKFHRDTDPDVKNVHKEDIEHELLHHFHEIEHEEKVQRGASKGTVITDDEL
                     ESRIDIKNIPKKFKNGFF"
     gene            <133723..>134448
                     /gene="TPHA0O00700"
                     /locus_tag="TPHA_0O00700"
                     /db_xref="GeneID:11530551"
     mRNA            <133723..>134448
                     /gene="TPHA0O00700"
                     /locus_tag="TPHA_0O00700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688425.1"
                     /db_xref="GeneID:11530551"
     CDS             133723..134448
                     /gene="TPHA0O00700"
                     /locus_tag="TPHA_0O00700"
                     /inference="similar to DNA sequence:INSDC:YNL010W"
                     /note="similar to Saccharomyces cerevisiae YNL010W;
                     ancestral locus Anc_1.395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688473.1"
                     /db_xref="GeneID:11530551"
                     /db_xref="GOA:G8C1L1"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR006384"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:G8C1L1"
                     /translation="MVKSVIFTDFDGTITLQDSNDHLVDSTGIGKERRLKIFEGIIDG
                     SKTFREAFTEMMDSVKLPYEDCIKILEKDISLDPGFKDTFNWAQENNVPIIVVSSGTA
                     AIIRHLIGKFLGEENLDKLDIVANDIEYSDDGEWHVKYRDETGFGHDKSRTITEYKNK
                     FEAQLKAGEERPTYFYCGDGVSDLSAAKECDLLFARAGKDLITYCKNENVPYHEFTTF
                     ADILAGMKQVLNGEKTVVQLMDN"
     gene            <135136..>136050
                     /gene="TPHA0O00710"
                     /locus_tag="TPHA_0O00710"
                     /db_xref="GeneID:11530552"
     mRNA            <135136..>136050
                     /gene="TPHA0O00710"
                     /locus_tag="TPHA_0O00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688426.1"
                     /db_xref="GeneID:11530552"
     CDS             135136..136050
                     /gene="TPHA0O00710"
                     /locus_tag="TPHA_0O00710"
                     /inference="similar to DNA sequence:INSDC:YNL006W"
                     /note="similar to Saccharomyces cerevisiae LST8 (YNL006W);
                     ancestral locus Anc_1.399"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688474.1"
                     /db_xref="GeneID:11530552"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8C1L2"
                     /translation="MSVILVSAGYDHTIRFWEALTGVCSRTIQHPDSQVNKLEITNDK
                     KLLAAAGSNNIKLYDVNTSNSNPIASFDGHKNNVTSINFQVENKWMVTSSEDNTIKLW
                     DIRSPSSPRTYKHNCPVNEVIIHPNQGELISCDKDGNIRIWDLGENQCTHQLTPEDND
                     ISIQSISLANDGSMLVAANNKGNCYVWDMPNKIDASNLKPITKFKAHDSYITKILLSS
                     DVKYMATCSADHTARIWSVEDNFTLDKTLTGHQRWVWDCAFSADSAYLVTASSDHYVR
                     LWDLSTNEIVRQYSGHQKGATCVALNDI"
     gene            complement(<136275..>137711)
                     /gene="TPHA0O00720"
                     /locus_tag="TPHA_0O00720"
                     /db_xref="GeneID:11530553"
     mRNA            complement(<136275..>137711)
                     /gene="TPHA0O00720"
                     /locus_tag="TPHA_0O00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688427.1"
                     /db_xref="GeneID:11530553"
     CDS             complement(136275..137711)
                     /gene="TPHA0O00720"
                     /locus_tag="TPHA_0O00720"
                     /inference="similar to DNA sequence:INSDC:YCL011C,YNL004W"
                     /note="similar to Saccharomyces cerevisiae GBP2 (YCL011C)
                     and HRB1 (YNL004W); ancestral locus Anc_1.408"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688475.1"
                     /db_xref="GeneID:11530553"
                     /db_xref="GOA:G8C1L3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8C1L3"
                     /translation="MSDVEYNERRRSRSRSPASRYENSDRDNRRGYYSNDARGSSYRR
                     PVRGYNESRYGDAYSSRRGNSRRTDGRVMRYDDRYESSRYDNGYSDHRGRRNDRYPSG
                     GRGGGRRGGREDRGFRSDDRRSRGYQGGRARGDYGPRLDKDLDSSYEEKVNRNYINSI
                     FVGNLTYDCTPEDLRQLFESIGEVVRADIITSRGHHRGMGTVEFTNPSDVDEAIKEFD
                     GTFFMERQIFVRQDNPPPEESRREKREREPVDFRTNGRNKRDDRATLENNFNGYEILI
                     SNLPYSINWQALKDMFKECGTVLRADVDLDEHGYSQGTGVVLMADKEAMERSISKYDG
                     YNIEGNVLEIREGNNNDIKETEDGNEPVSMHTKNENDGENNDKIEDTKSSTKAFLEGV
                     VGGGEKSTLVYCSNLPFSTARSDLYDLFETIGKLKNAELNQDASGAPTGIAVIEYENI
                     DDAEICIDRLNNYNYGGCDLDISYGKRQ"
     gene            <138265..>139410
                     /gene="TPHA0O00730"
                     /locus_tag="TPHA_0O00730"
                     /db_xref="GeneID:11530554"
     mRNA            <138265..>139410
                     /gene="TPHA0O00730"
                     /locus_tag="TPHA_0O00730"
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /transcript_id="XM_003688428.1"
                     /db_xref="GeneID:11530554"
     CDS             138265..139410
                     /gene="TPHA0O00730"
                     /locus_tag="TPHA_0O00730"
                     /inference="similar to DNA sequence:INSDC:YNL005C"
                     /note="similar to Saccharomyces cerevisiae MRP7 (YNL005C);
                     ancestral locus Anc_1.410"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /protein_id="XP_003688476.1"
                     /db_xref="GeneID:11530554"
                     /db_xref="GOA:G8C1L4"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="InterPro:IPR018261"
                     /db_xref="UniProtKB/TrEMBL:G8C1L4"
                     /translation="MSLFTGIKGLQGKNFACNVLVQVRNSTKKAAGSRTSMKDSAGRR
                     LGPKKYEGQTVRSGEIIMRQRGTKFFPGENVGIGKDHTIFATEPGVVRYYLDPFHPKR
                     KFIGVSLKRDVPLPIPHFEPSVRRFGRQIIPDGSRSQEIYEIGKGESKSRFQIANQSK
                     ILKELEYRETKRAQLSKEFNDFVSKTVKSPLSDSDTAIKYLLRYRSCLRNGFNLNDSQ
                     FNAKQYFILQTELLAKREKWDSAKLSDTLETLNKDIELLNSSIGFDNKHQIMEFISES
                     DKKQMKNHLIEELKKLTLDSSNSDFKLTKKSREEIKKLFVNASKFLTLSEEVHLRRQY
                     LKPVLPENKFTVSEKPSKGSVVVRRFNYEKHEVTTMSRPKEAFLNRL"
     gene            complement(<139642..>140538)
                     /gene="TPHA0O00740"
                     /locus_tag="TPHA_0O00740"
                     /db_xref="GeneID:11530711"
     mRNA            complement(<139642..>140538)
                     /gene="TPHA0O00740"
                     /locus_tag="TPHA_0O00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688429.1"
                     /db_xref="GeneID:11530711"
     CDS             complement(139642..140538)
                     /gene="TPHA0O00740"
                     /locus_tag="TPHA_0O00740"
                     /inference="similar to DNA sequence:INSDC:YCL009C"
                     /note="similar to Saccharomyces cerevisiae ILV6 (YCL009C);
                     ancestral locus Anc_1.411"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688477.1"
                     /db_xref="GeneID:11530711"
                     /db_xref="GOA:G8C1L5"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /db_xref="InterPro:IPR019455"
                     /db_xref="UniProtKB/TrEMBL:G8C1L5"
                     /translation="MLRLVSGNVKRSLIRHSSSSTSALAYKQLHKHNTPPPLPTLETP
                     SWNVDTAVSSILYETPAASTEPRTNHVLNCLVQNEPGVLSRISGTLAARGFNIDSLVV
                     CNTEVKDLSRMTITIKGQDGVIEQARRQIEDLVPVYAVLNYTNAEIVKRELVLARVSL
                     LGAEYFEDLLLHHHQTTGNVDSSELVSEVREKTFHPSNLPLSEVLRLKHEHLNDITNL
                     AKNFGGRVVDISEASCIVELSAKPKRISAFLKLIEPFGVLECARSGMMALPRTPVKTA
                     GAEEDDEAKISNIVDISQLPPG"
     gene            complement(<141016..>142269)
                     /gene="TPHA0O00750"
                     /locus_tag="TPHA_0O00750"
                     /db_xref="GeneID:11530712"
     mRNA            complement(<141016..>142269)
                     /gene="TPHA0O00750"
                     /locus_tag="TPHA_0O00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688430.1"
                     /db_xref="GeneID:11530712"
     CDS             complement(141016..142269)
                     /gene="TPHA0O00750"
                     /locus_tag="TPHA_0O00750"
                     /inference="similar to DNA sequence:INSDC:YCL008C"
                     /note="similar to Saccharomyces cerevisiae STP22
                     (YCL008C); ancestral locus Anc_1.412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688478.1"
                     /db_xref="GeneID:11530712"
                     /db_xref="GOA:G8C1L6"
                     /db_xref="InterPro:IPR008883"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:G8C1L6"
                     /translation="MSHSTSTIPQAVIQWLFDVIQPIYPNPDYKKKIFNDTILVLSAF
                     PNLKPRTRVFTNSKGISSLLLCIYGSFQLGGAPDVPVLLWIPKDYPIEPPLLLIDLAT
                     LDSSYVIAKGRQVDSNGVVRLPIFDSWNFNTNGLLDVINDFLSTNNDDNCPVIELPEN
                     MANLSISATTNPPVLPPKPTVPEKINVQTELRSPAVLAPPVPAKPPVPAKPPVPERPA
                     VGSAAPSSQSSDGITSPVMNLMDVASENSSMSMLRKDLIGKLQEVVNELAFEDKSRTE
                     NDLKIRIQSLKDAIDQFKKIHEYDSQSLQAANASIEASKKQLKENIRLLEIEKDKIFK
                     FEERNGTNIDPITYLTTNSIALEQLYGLVAKDQAIGETIHSLSALLDRDLINIDVFVK
                     KTRELAREQFMARMHIRKISTHLDN"
     gene            <143539..>144177
                     /gene="TPHA0O00760"
                     /locus_tag="TPHA_0O00760"
                     /db_xref="GeneID:11530713"
     mRNA            <143539..>144177
                     /gene="TPHA0O00760"
                     /locus_tag="TPHA_0O00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688431.1"
                     /db_xref="GeneID:11530713"
     CDS             143539..144177
                     /gene="TPHA0O00760"
                     /locus_tag="TPHA_0O00760"
                     /inference="similar to DNA sequence:INSDC:YEL024W"
                     /note="similar to Saccharomyces cerevisiae RIP1 (YEL024W);
                     ancestral locus Anc_1.461"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688479.1"
                     /db_xref="GeneID:11530713"
                     /db_xref="GOA:G8C1L7"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="InterPro:IPR014349"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:G8C1L7"
                     /translation="MLRLNPNSRTAALAVSKRLFSNNARALSSSYRTPNFGSNIKEDR
                     NADKSRSYAYFMVGSLGLLSSVGAKSTVETFVSSMSASSDILAMAKIEVNLAAIPEGK
                     NVVVKWQGKPVFIRHRTSEEIKEANDIDISSLKDPQADSDRVQNPEWLVMLGICTHLG
                     CVPIGESGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPKYAFDGEKVIVG"
     gene            <144789..>149213
                     /gene="TPHA0O00770"
                     /locus_tag="TPHA_0O00770"
                     /db_xref="GeneID:11530714"
     mRNA            <144789..>149213
                     /gene="TPHA0O00770"
                     /locus_tag="TPHA_0O00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688432.1"
                     /db_xref="GeneID:11530714"
     CDS             144789..149213
                     /gene="TPHA0O00770"
                     /locus_tag="TPHA_0O00770"
                     /inference="similar to DNA sequence:INSDC:YEL022W,YJR031C"
                     /note="similar to Saccharomyces cerevisiae GEA2 (YEL022W)
                     and GEA1 (YJR031C); ancestral locus Anc_1.455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688480.1"
                     /db_xref="GeneID:11530714"
                     /db_xref="GOA:G8C1L8"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:G8C1L8"
                     /translation="MVGNSRSHSISPTDSVTIVIKECIKLSTAMRKYSNFTSQSSVSA
                     LLSGSSELFYNKQEFLQSNKVNESEIDDNMSLFSAEAISLDGLVVKLRDTNLMNPNKN
                     SAQHNTAHTNPIKQNDPLLAGLLQLRLMLNKLDSLNDIDSLTLIQPFLVVIATGKIST
                     YITSLALDSLHKFLALDIINESMDNFIVNYREIVNAVINCKTDNQKISNTPSATASNV
                     SNIDDTILIRILSILSIVINSQHFNSLSDSNVHEILTIIMSVACNKKKSEVLRKNAES
                     IMSSITIKLFSKLNDMKSKTTGTVYINDESYSKDALKDVFENDTEGKDDVSETIHKNE
                     EQVQEVTDDDRTMVSKNIESSSTTRNIEPNFGVPVLRLYLNMLLSLITPENQTRHTNS
                     TKILALQFINMSVELSGDDILSHPQLFNVISDPIFKSILFIIQNSNKLSLLQAALQLF
                     TTLFLNLHCHLQMQIELTLNKIFEVLLEGTNKTNKEVETDGPSKSRPPKVKELLIEQI
                     SILWTRSPSFFTSLFINFDCNLDRSDVAINFLKALTTLSLPESSITSTETVPPICLEG
                     LVSFVDDLYTDLRNVNRQQFLLEKDTIDLIKKRERKTMFIKCAEEFNIKPKIGIPMLI
                     EKGFIKSDQDSDLAEFLFENNSRVNKKQIGLLLCDPKRTGLLNEFIKLFNFENLRVDE
                     AIRILLTKFRLPGESQQIERIVEAFSSGYVSSQKYDSTKLENPSENDNATVQPDSDSV
                     FVLSYSIIMLNTDLHNPQVKEHMSFEDYSGNLKGCYNSQDFPHWYLDKIYCSIRDKEI
                     VMPEEHHGDEKWFEDAWNNLISSTTVMTEIKTDFRTAIEKYGEIEMAHFNRAVFKNVG
                     PSILSALFQIFVAASDEYITTRMLTTIEKCSSIASFFNFKGLFNDILRNISKITTLAI
                     PENEILSPEMDTIPLVEIKAEDSNFVIPVSTRSVYFGKNYKGQLSTIVYFRIIRRNRL
                     INMMNDITWKETIAMLLNMYENLLFPGDIFVEFQKKVHLTKLLAPEPVVKLNKNEESR
                     GLFSTFASYLTGGEEPTAEEIDYSIRTMNCLQISKIKTSLFGNGTNLTTDVIDYFLDA
                     IPEKKTRENARFYEAELLFITEISVALFSLGKNGEQFSDSLLHRLTDLRSRKDISKKT
                     VCRLTQYVLILLSIMDNKTDYLVELLSKEIGGHPDVFDNDFFQSEEGLGFVHSLLNLV
                     NISNYQEKLFGEETLWNILKLVTPIYRYGLITFDFLETSISNNPDISNTDNFFHMISL
                     LDVISSIGAVGNAWEEEYENLVKSGHKVNSENPHKNEIELAIKSIDLCLKFIRDNSIF
                     SKLDDTKRCTLIQVLCHQCQNPCKEIRTYTTKALETILCFNNEKAMNLPVSDIESLIE
                     GGFMPLLENDQSHITDILGIVGKFYISYLENDKATNDTFIKILSIFNKFVEDTEVEKQ
                     LQQLIIDKKDIIKKLKNTSTMTTPSISPSPSPIPKESD"
     gene            <149666..>150463
                     /gene="TPHA0O00780"
                     /locus_tag="TPHA_0O00780"
                     /db_xref="GeneID:11530612"
     mRNA            <149666..>150463
                     /gene="TPHA0O00780"
                     /locus_tag="TPHA_0O00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688433.1"
                     /db_xref="GeneID:11530612"
     CDS             149666..150463
                     /gene="TPHA0O00780"
                     /locus_tag="TPHA_0O00780"
                     /inference="similar to DNA sequence:INSDC:YEL021W"
                     /note="similar to Saccharomyces cerevisiae URA3 (YEL021W);
                     ancestral locus Anc_1.453"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688481.1"
                     /db_xref="GeneID:11530612"
                     /db_xref="GOA:G8C1L9"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="UniProtKB/TrEMBL:G8C1L9"
                     /translation="MSTLTYEQRAKTHPNKVASKLLNLMAEKKTNLSGSLDVRTTKEL
                     LRLADILGPYICVLKTHVDILDDFSYEGTIKPLKELAAKHKFLIFEDRKFADIGNTVK
                     LQYSSGVYKIVEWADITNAHGVTGSGIVAGLKAAAEECTKEPRALLMLAELSSKGSLA
                     HGEYTRGTVDIAKSDKDFVIGFISQKDMGGKDEGFDWLIMTPGVGLDDKGDSLGQQYR
                     TVDDVVSTGSDIIIVGRGLFANGRDPKVEGERYRKAGWDAYLKRIGK"
     gene            <151111..>151374
                     /gene="TPHA0O00790"
                     /locus_tag="TPHA_0O00790"
                     /db_xref="GeneID:11530613"
     mRNA            <151111..>151374
                     /gene="TPHA0O00790"
                     /locus_tag="TPHA_0O00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688434.1"
                     /db_xref="GeneID:11530613"
     CDS             151111..151374
                     /gene="TPHA0O00790"
                     /locus_tag="TPHA_0O00790"
                     /inference="similar to DNA sequence:INSDC:YEL020W-A"
                     /note="similar to Saccharomyces cerevisiae TIM9
                     (YEL020W-A); ancestral locus Anc_1.452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688482.1"
                     /db_xref="GeneID:11530613"
                     /db_xref="GOA:G8C1M0"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:G8C1M0"
                     /translation="MEALNSREQQDFQKLVEQKQMKDFMRLYSNLVERCFNDCVNDFT
                     SSKLTNKEQTCLMRCSEKFLKHSERVGQRFQEQNAAMGQSLQR"
     gene            complement(<151545..>153428)
                     /gene="TPHA0O00800"
                     /locus_tag="TPHA_0O00800"
                     /db_xref="GeneID:11530614"
     mRNA            complement(<151545..>153428)
                     /gene="TPHA0O00800"
                     /locus_tag="TPHA_0O00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688435.1"
                     /db_xref="GeneID:11530614"
     CDS             complement(151545..153428)
                     /gene="TPHA0O00800"
                     /locus_tag="TPHA_0O00800"
                     /inference="similar to DNA sequence:INSDC:YCR023C"
                     /note="similar to Saccharomyces cerevisiae YCR023C;
                     ancestral locus Anc_1.451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688483.1"
                     /db_xref="GeneID:11530614"
                     /db_xref="GOA:G8C1M1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8C1M1"
                     /translation="MAKKSLTFNEQMKGFPWYQLFFLSMIRIVEPMSFTSLFPYVYYM
                     VKDFHVSPDNAQVSKYSGYLASCFALCQVLTAYNWSKVSQQYGRKPTLLLGLFGTGIS
                     LLVLGFAKYYYQTLLARGMMGLLNGNVSIIRTVIGELATERRYQGVAFSMLPLLFETG
                     AVIGPMVGGYLVFREENNTYPPNWFPASVKRLVKIYPYSLPNIAIFAYILISILVNFL
                     FLEETHPDYKNRKDYGLIIGDFIKKHIFSIKVKQRAWNTNYAGNHSNVDPEQDHIINE
                     TTPLVHSSTTQEISSPYHRNNMTENIDHDDIDESENTSEAESIQSLPLLTRRESVALI
                     RTYSIVENTDITPTDTNVAFDGCAENSAIHHVLHTSVFYPISVSFIMALHTIVFNEFL
                     PIFLAYELEKDPSDSTQLVSKFPWKISGGIGYSSEQTGTLLSTTGIFGVLVVIFIFPT
                     IDRKYDCLTIFRTLVKIYPVLYLIIPYVVFLQKDWIPRWATVCYLYFITGSKTLCSSL
                     TNPQITLLIHNSSPLSCRAVINGATISISSSARFVGPLIWGYLMSWTQEYEIAWLGWW
                     SLGIISAIAWLQSYKIDPIDDEDEEEEDNENTGSMRRRTLLERSSSLRSLRNKSKVSL
                     HGG"
     gene            complement(<153912..>155408)
                     /gene="TPHA0O00810"
                     /locus_tag="TPHA_0O00810"
                     /db_xref="GeneID:11530615"
     mRNA            complement(<153912..>155408)
                     /gene="TPHA0O00810"
                     /locus_tag="TPHA_0O00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688436.1"
                     /db_xref="GeneID:11530615"
     CDS             complement(153912..155408)
                     /gene="TPHA0O00810"
                     /locus_tag="TPHA_0O00810"
                     /inference="similar to DNA sequence:INSDC:YCR024C"
                     /note="similar to Saccharomyces cerevisiae SLM5 (YCR024C);
                     ancestral locus Anc_1.449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688484.1"
                     /db_xref="GeneID:11530615"
                     /db_xref="GOA:G8C1M2"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:G8C1M2"
                     /translation="MLSRSSTICLKRALSTISKCHISSLKRLNNSLVLPSSVTDVNGW
                     VKSVRVLKNIAFIDLSDGTTMNSVKVVIPLKNTETDTIDSEVLEHLKKFKTGQSITIK
                     HADLELTPHREQKYELKVNKPISDLSILGDVSENYALQKKYQSLPYLRSNPILKHRTT
                     YLGSLMKFRSQFDFALNKFFNLEDYTKIAAPVLTANDCEGAGELFKVESKNYLDDENK
                     NGMSYFGSSTYLTVSAQLHLEILALALSKCWSVTPCFRAEESDTNRHLSEFWMLEAEM
                     CFTKNITDLTTFVKAMLQYSVKECYDNFNELIPNNAPEGCLSKEKVKERWDLLLNDSS
                     WSSITYTEAIKLLKIQHSKIPFPKYVPRWGEALQTEHEKWLAETCFKGPVFVTDYPSE
                     TKSFYMKLNKDEKTVACFDLLLPEIGEIVGGSLREESFEKLSDAIHKRGINKNGDLDW
                     YLELRKEGTVPHGGFGLGLERIILYLYGNYNIRDSIPFYRAAKSKISL"
     gene            complement(<155829..>156713)
                     /gene="TPHA0O00820"
                     /locus_tag="TPHA_0O00820"
                     /db_xref="GeneID:11530616"
     mRNA            complement(<155829..>156713)
                     /gene="TPHA0O00820"
                     /locus_tag="TPHA_0O00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688437.1"
                     /db_xref="GeneID:11530616"
     CDS             complement(155829..156713)
                     /gene="TPHA0O00820"
                     /locus_tag="TPHA_0O00820"
                     /inference="similar to DNA sequence:INSDC:YEL019C"
                     /note="similar to Saccharomyces cerevisiae MMS21
                     (YEL019C); ancestral locus Anc_1.448"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688485.1"
                     /db_xref="GeneID:11530616"
                     /db_xref="GOA:G8C1M3"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR026846"
                     /db_xref="UniProtKB/TrEMBL:G8C1M3"
                     /translation="MSIIPESAPMHPDSSKAFHSLRAVDVQDYYKSCINQFYQCIYDL
                     LNLNDTSDLEDESESNIPTYLHYEVLDPIVRSTCESYLKLLTQMKQSKQLTDDTARVK
                     KEYKLLSDQCETFTLDTWDKYVSKELTAPKLSELFNDRSQLNNPNTQTANALPTIELE
                     KDKLLRVLPYLWQNPANVIPDEVIRGAPINQSNTDDDLKIEGGVIELTCPITCKTYRR
                     PMISKKCGHVFDEQGIKSYLETQGERDCPQAACSQKVKLSDFSLDKIMILRCKINKIK
                     QLRVKEDNDKLNQELDIL"
     gene            <156988..>157923
                     /gene="TPHA0O00830"
                     /locus_tag="TPHA_0O00830"
                     /db_xref="GeneID:11530686"
     mRNA            <156988..>157923
                     /gene="TPHA0O00830"
                     /locus_tag="TPHA_0O00830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688438.1"
                     /db_xref="GeneID:11530686"
     CDS             156988..157923
                     /gene="TPHA0O00830"
                     /locus_tag="TPHA_0O00830"
                     /inference="similar to DNA sequence:INSDC:YEL018W"
                     /note="similar to Saccharomyces cerevisiae EAF5 (YEL018W);
                     ancestral locus Anc_1.447"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688486.1"
                     /db_xref="GeneID:11530686"
                     /db_xref="InterPro:IPR026226"
                     /db_xref="UniProtKB/TrEMBL:G8C1M4"
                     /translation="MSSPKNSSTHVGLRPEISELIVLQMIYSLLMAKNGGRGQQVLSS
                     SGGVNESMQDSSMSNSGAPNGPLFRVSLVKLTNEIQNNILINQVISIQENQSMNKIGI
                     NDILKIISNLFPGHKTSLVDGQISFHNLQLNSLRTDLIKKYTNFKTQKLQTINKLEER
                     ISSVKNHNEAPSSGAATPVWGTKASMNKVTKKDKSRSMMDPKREKLLQLYRDTVLNKL
                     QGKSKIFDDLYRTIDENEKQKKTIPIGIVKSKIEMEHIKTKTPQSVHDLQLILQKSIC
                     DGLMRFPVGSKEWKLAKQVQLDFDDTVQFMRRALE"
     gene            complement(<158376..>158498)
                     /gene="TPHA0O00840"
                     /locus_tag="TPHA_0O00840"
                     /db_xref="GeneID:11530687"
     mRNA            complement(<158376..>158498)
                     /gene="TPHA0O00840"
                     /locus_tag="TPHA_0O00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688439.1"
                     /db_xref="GeneID:11530687"
     CDS             complement(158376..158498)
                     /gene="TPHA0O00840"
                     /locus_tag="TPHA_0O00840"
                     /inference="similar to DNA
                     sequence:INSDC:YCR024C-A,YEL017C-A"
                     /note="similar to Saccharomyces cerevisiae PMP1
                     (YCR024C-A) and PMP2 (YEL017C-A); ancestral locus
                     Anc_1.446"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688487.1"
                     /db_xref="GeneID:11530687"
                     /db_xref="InterPro:IPR012589"
                     /db_xref="UniProtKB/TrEMBL:G8C1M5"
                     /translation="MTLPGGVILVFILVGLAVIAILSTIAYRKWQARQKGLQRF"
     gene            <158966..>159487
                     /gene="TPHA0O00850"
                     /locus_tag="TPHA_0O00850"
                     /db_xref="GeneID:11530688"
     mRNA            <158966..>159487
                     /gene="TPHA0O00850"
                     /locus_tag="TPHA_0O00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688440.1"
                     /db_xref="GeneID:11530688"
     CDS             158966..159487
                     /gene="TPHA0O00850"
                     /locus_tag="TPHA_0O00850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688488.1"
                     /db_xref="GeneID:11530688"
                     /db_xref="UniProtKB/TrEMBL:G8C1M6"
                     /translation="MERCVCVCVCVDMSTCAVQTNIACFRVECLDTRFSFQCQRPRSF
                     EGLKSKVLLFLFFMSSVVAVACVLCVLVERYSTAAVLCEIKIRKQSEQHPLKVLVGAQ
                     DKSGWIWWDKRGPLNLGCLFVESTFLFGSKILIGRCGCGCILFLFADCLCEVGGHRHC
                     FWKTLALVLFLFR"
     gene            complement(<159566..>162028)
                     /gene="TPHA0O00860"
                     /locus_tag="TPHA_0O00860"
                     /db_xref="GeneID:11530689"
     mRNA            complement(<159566..>162028)
                     /gene="TPHA0O00860"
                     /locus_tag="TPHA_0O00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688441.1"
                     /db_xref="GeneID:11530689"
     CDS             complement(159566..162028)
                     /gene="TPHA0O00860"
                     /locus_tag="TPHA_0O00860"
                     /inference="similar to DNA sequence:INSDC:YCR026C,YEL016C"
                     /note="similar to Saccharomyces cerevisiae NPP1 (YCR026C)
                     and NPP2 (YEL016C); ancestral locus Anc_1.444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688489.1"
                     /db_xref="GeneID:11530689"
                     /db_xref="GOA:G8C1M7"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR024873"
                     /db_xref="UniProtKB/TrEMBL:G8C1M7"
                     /translation="MSDIDSFDIDSEVDGVNEILNSDSHPTNSNVWNNVKYWFYRNRL
                     YWQSINNNYVGENGTSRDNGRGIPLYDLDNSGGRLDREHDGSLEFNHSVFNGKHSGLS
                     SFIIRRKLLIRLISVLALFLTFTMLVSGSIKSTHPDQFTSASFLNNLINSHDFDPYKK
                     YTNGSHPFYPLTMMISIDGFHPALISKKNTPFLHSLYTLEKEDYNITSTPYMIPSFPA
                     QTFPNHWSLVTGDYPIDHGIVSNYFHDSVLDDIFEPQNEDPLFWYNASEPIWETIQRA
                     YAKRDSSGKLIDLPYKVATHMWPGSNVDYSKLEKLINVKVPEERTPFYNVKYNQKETF
                     DEKLKNILAYIDVEAISDRPQMILSYIPQIDAFGHLNGYPISVRNGIDEKNTKSGKAF
                     VKLLKELDTFFETLFMEIKARNIEKFTNVLIVSDHGMSDIDVPENVIPYEELLSAESR
                     KSLVSHAIYEGPILTLNVDKKATINSVYQELKRNLNQQLLSPFFNIYLSGQFPPEFNY
                     NFDVESKENDILAKRRVPPIWVVPEPGFAIMDSSDIKKKKDTIIGSHGYNNTHIDMRS
                     LFIGVGPYFNKGYVESFENVEIYKLLCDISGIKLKDRHISFRERKSINSAVESSSNKN
                     EEEDDFETSLIKHNKDIFDANNFDLLLIEDDFSYIEDKFSKWNTYNYIWGGSKAWEEG
                     YDDEDDETLENDTDSYIGGNITMASMPVPGIPSIISSLISSSAIITTDSSGTAHTTTL
                     LQPNTIASTTSATTSASAIASSSASELVPSNSTLGDNVINWFGNLIDDAKDLIDGTKE
                     LIDNVVDEVEEMMNNEETSESI"
     gene            complement(<162632..>163369)
                     /gene="TPHA0O00870"
                     /locus_tag="TPHA_0O00870"
                     /db_xref="GeneID:11530690"
     mRNA            complement(<162632..>163369)
                     /gene="TPHA0O00870"
                     /locus_tag="TPHA_0O00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688442.1"
                     /db_xref="GeneID:11530690"
     CDS             complement(162632..163369)
                     /gene="TPHA0O00870"
                     /locus_tag="TPHA_0O00870"
                     /inference="similar to DNA sequence:INSDC:YCR027C"
                     /note="similar to Saccharomyces cerevisiae RHB1 (YCR027C);
                     ancestral locus Anc_1.443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688490.1"
                     /db_xref="GeneID:11530690"
                     /db_xref="GOA:G8C1M8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1M8"
                     /translation="MESDSLMFGGTHSIQDAPKGLQFKICIFGGKAVGKTSLCVQYVE
                     SHFVESHYPTNVQNEFTKMLKYNNQDYTLEIIDTAGQDETSMINSKCLNGCKGIILCY
                     SVNNRHSFDLIKIIWEKLVDQLENINDIPVIVVANKIDSRDTSECKLDRNSIVKKSEG
                     EQLTKYISNSLMSIKQQRNGNKNGHIDNSNNSPVQHIANLPKVGFIEVSTKLNINVDE
                     SILILLKEMEYLAANGPLGDDAKCTVM"
     gene            <163839..>165482
                     /gene="TPHA0O00880"
                     /locus_tag="TPHA_0O00880"
                     /db_xref="GeneID:11530645"
     mRNA            <163839..>165482
                     /gene="TPHA0O00880"
                     /locus_tag="TPHA_0O00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688443.1"
                     /db_xref="GeneID:11530645"
     CDS             163839..165482
                     /gene="TPHA0O00880"
                     /locus_tag="TPHA_0O00880"
                     /inference="similar to DNA sequence:INSDC:YEL015W"
                     /note="similar to Saccharomyces cerevisiae EDC3 (YEL015W);
                     ancestral locus Anc_1.442"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688491.1"
                     /db_xref="GeneID:11530645"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="InterPro:IPR019050"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="UniProtKB/TrEMBL:G8C1M9"
                     /translation="MTDYYGYGVRVELKDGKLIQGKIAKATSKGLTLNEVRFGDGGTS
                     QAFKVRASRLKDLKVLSVGSAKHRGNNNSGNSSTANNGSPRPQSGQNADWKNDDVAGI
                     KKQDDFDFQSSLKMFNKKDIFAQLKQQDEINPDNRLVSHNKKQGTKQDKYDIDELVLP
                     DAKDDAWDTLHTNTSGDVAIAGEGEEDDDDDDYDEDDVDNDKYFPVTKSINITHLLHS
                     ASSKNPNEDKSSSGDKTTTDELLTKLGQMIINQSATKDNESRRNSSVRQQALQAKDIK
                     LTVPMATAIQLWEIQRVTSENYGITSTMTNENFAVNASNYIKQKLGGRARLRSQNMNA
                     QPLVIILTSESARVGARALAVGRHLCSNNYIRVITMFTNDINEIKDPLVKEQLDIYTK
                     CGGKFVNTVSQLENTIEKLNSPVELVIDAMQDLNCNLGDLVDDNDNAERKILNMIHWC
                     NEQARKDKQVWSIDIPSGYDNGSGLENFPSSVSATSVLSSGWPLLALPRIQENANTLQ
                     DVVVVDIGTPHAAYTHNITLRKFQNCDLFVQHGSLPLII"
     gap             166051..166213
                     /estimated_length=163
     gene            <166245..>167951
                     /gene="TPHA0O00890"
                     /locus_tag="TPHA_0O00890"
                     /db_xref="GeneID:11530646"
     mRNA            <166245..>167951
                     /gene="TPHA0O00890"
                     /locus_tag="TPHA_0O00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688444.1"
                     /db_xref="GeneID:11530646"
     CDS             166245..167951
                     /gene="TPHA0O00890"
                     /locus_tag="TPHA_0O00890"
                     /inference="similar to DNA sequence:INSDC:YEL013W"
                     /note="similar to Saccharomyces cerevisiae VAC8 (YEL013W);
                     ancestral locus Anc_1.441"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688492.1"
                     /db_xref="GeneID:11530646"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8C1N0"
                     /translation="MGACCSCLKSDSNEEPNILPISDNEREAVTALLGYLEDKDRYDF
                     YSGGPLKALTTLVYSENLNLQKSAALAFAEITEKYVRLVDRSVFDPILVLLKSSDPQI
                     QVAACAALGNLAVNNENKLLIVEMGGLKPLINQMMGDNVEVQCNAVGCITNLATQDDN
                     KHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSGENRKELVGAGAVPVLVSLL
                     SSTDPDVQYYCTTALSNIAVDEVNRKTLAQTEPRLVSKLVSLMDSPSQRVKCQATLAL
                     RNLASDTSYQLEIVRAGGLPHLVTLIQSDSMPLVLASVACVRNISIHPLNEGLIVDAG
                     FLKPLVKLLDFKGSEEIQCHTVSTLRNLAASSEKNRNEFFESGAVEKCKQLALDSPIS
                     VQSEISACFAILALADVSKMTLLNLNILDALLPMTFSDNQEVSGNAAAALANLCSRIN
                     NYSKIMDAWDQPSDGIRGFLVRFLQSNYITFEHIALWTILQLLESHNDRIVQLVKNDK
                     EIIDGVRHMADITYERLQRSETDSKNAGNNDIVDSTNSDYVDDASMDLYNITQQILQF
                     LN"
     gene            complement(<168712..>169011)
                     /gene="TPHA0O00900"
                     /locus_tag="TPHA_0O00900"
                     /db_xref="GeneID:11530647"
     mRNA            complement(<168712..>169011)
                     /gene="TPHA0O00900"
                     /locus_tag="TPHA_0O00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688445.1"
                     /db_xref="GeneID:11530647"
     CDS             complement(168712..169011)
                     /gene="TPHA0O00900"
                     /locus_tag="TPHA_0O00900"
                     /inference="similar to DNA sequence:INSDC:YCR020C-A"
                     /note="similar to Saccharomyces cerevisiae MAK31
                     (YCR020C-A); ancestral locus Anc_1.438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688493.1"
                     /db_xref="GeneID:11530647"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:G8C1N1"
                     /translation="MDKLQLHDFIGKTLYININDTRVIRGSLVALDAQLNLLINHAQE
                     LCIGDRINEKGESVDNARLMGLVSVPQASILSIKIAKNDMDNIISFKKDLLKSVI"
     gene            <169410..>169637
                     /gene="TPHA0O00910"
                     /locus_tag="TPHA_0O00910"
                     /db_xref="GeneID:11530648"
     mRNA            <169410..>169637
                     /gene="TPHA0O00910"
                     /locus_tag="TPHA_0O00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688446.1"
                     /db_xref="GeneID:11530648"
     CDS             169410..169637
                     /gene="TPHA0O00910"
                     /locus_tag="TPHA_0O00910"
                     /inference="similar to DNA sequence:INSDC:YCR020W-B"
                     /note="similar to Saccharomyces cerevisiae HTL1
                     (YCR020W-B); ancestral locus Anc_1.437"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688494.1"
                     /db_xref="GeneID:11530648"
                     /db_xref="UniProtKB/TrEMBL:G8C1N2"
                     /translation="MTTTNNIDIDNEIKQYNNVTLKSLTASQLLSQRENICELFQLID
                     DTAIHGMIVNEKRQTSTLNGLKSQLEILKKD"
     gene            <170342..>171022
                     /gene="TPHA0O00920"
                     /locus_tag="TPHA_0O00920"
                     /db_xref="GeneID:11530649"
     mRNA            <170342..>171022
                     /gene="TPHA0O00920"
                     /locus_tag="TPHA_0O00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688447.1"
                     /db_xref="GeneID:11530649"
     CDS             170342..171022
                     /gene="TPHA0O00920"
                     /locus_tag="TPHA_0O00920"
                     /inference="similar to DNA sequence:INSDC:YEL012W"
                     /note="similar to Saccharomyces cerevisiae UBC8 (YEL012W);
                     ancestral locus Anc_1.436"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688495.1"
                     /db_xref="GeneID:11530649"
                     /db_xref="GOA:G8C1N3"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:G8C1N3"
                     /translation="MSSGNTKRRIETDVMKLLMSDHDVRLVNDNMQEFYVKFHGPKDT
                     PYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLL
                     NIIEWMIPGLLKEPNGSDPLNNEAAGLQLHDKKIYEEKIKEYIDKYATLAKYKARFCT
                     GSDSDDDEEDREGVDDSAEEEKESATVLAQHNGNVDSRYEASDDEISDVHSDELSDIA
                     VSSDEEFE"
     gene            complement(171384..171456)
                     /gene="TPHA0Otrna13K"
                     /locus_tag="TPHA_0Otrna13K"
                     /db_xref="GeneID:11530720"
     tRNA            complement(171384..171456)
                     /gene="TPHA0Otrna13K"
                     /locus_tag="TPHA_0Otrna13K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:11530720"
     gene            <171805..>174780
                     /gene="TPHA0O00930"
                     /locus_tag="TPHA_0O00930"
                     /db_xref="GeneID:11530709"
     mRNA            <171805..>174780
                     /gene="TPHA0O00930"
                     /locus_tag="TPHA_0O00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688448.1"
                     /db_xref="GeneID:11530709"
     CDS             171805..174780
                     /gene="TPHA0O00930"
                     /locus_tag="TPHA_0O00930"
                     /inference="similar to DNA sequence:INSDC:YCR017C"
                     /note="similar to Saccharomyces cerevisiae CWH43
                     (YCR017C); ancestral locus Anc_1.434"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688496.1"
                     /db_xref="GeneID:11530709"
                     /db_xref="GOA:G8C1N4"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:G8C1N4"
                     /translation="MVAVNGKIIPLTHTICASAAFLVALIVGCSLHYHKIVENAHYGY
                     PDEWFPSVSATIGDRYPERSIFQILIALTSFPRFLLLLGHYYLNGSTTTFLVGVLRTV
                     TCGGWVYITSTDDHNIHDIFMISYMVLTIPWNYFIIKYSSIKRRQTIVASMFYIVLFP
                     LIYWYIQHQVHHVGGAYSMYAYFEWSLIVIDIAFDSLAYADFNRFTINLGFTNKDSEL
                     NWFFKIDQTKSLSIERSENDVKVVDEDNEVVYEEREIDTKVIKSSDEIIEILIENEKD
                     ISILSSTEPAPQYDSFIYILTTFFNSFIFWTAITGLGCSVWHFPLWYMGISGYEAAIL
                     GYGGCVVLFLPMMSTIIYQYGSLVGGLILLGSYLVSVPESRLLVVCAGAVILIAQFTL
                     NLQAISNASINSGFTVLWILGLVFSVVLKMGFYSNNPLWPIMNETNGGWNKTGLIIVS
                     IFGVLSPYTNSVHFSENNNQFKSQNHVSFFSKLSLGLGFGSLMFSIHQMLSDASTIIY
                     WSWEGYNEVSQGPLQWPWSSVTCLTMLGACIFSVVFTGRSFVPCVLLAASTTILCLRS
                     IKEWDNFIYGGLPYVVAIILIIPTYLSALSNIKSLWVFAIGALLYVIYILAHVWVVAY
                     AFVPFGWLLRERIEVVLSSTTIFIIMGAVLNNGNVLKRGSALGKKFTLWLYFFSVLIA
                     TLTGVFTKQLQPIGVPQPYHPESKLITAGIWTIHFGLDNDMWASEDRMIELLKDMELD
                     VFGVLESDTQRIVMGNRDLTSKLGHKLNMYSDYGPGPNKHTWGCALFSKFPIINSTHH
                     LLPSPDGELAPAIHATLKTYNDQLVDVFVFHSGQEEDDEDRRLQTEALSKLMGSTDRP
                     AILLSYLVTEPLEGNYNTYVSDISGMHDIDPSDDDRWCEYILYKNLLRTGYARVARGT
                     ITDTELQVGKFRVLPEIALEKLGDALYMNSYTNFPQDDDLKFPDMFLGEGERGHFYHV
                     FDEPRYYRPGSPQNDEIYD"
     gene            complement(<174968..>175429)
                     /gene="TPHA0O00940"
                     /locus_tag="TPHA_0O00940"
                     /db_xref="GeneID:11530721"
     mRNA            complement(<174968..>175429)
                     /gene="TPHA0O00940"
                     /locus_tag="TPHA_0O00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688449.1"
                     /db_xref="GeneID:11530721"
     CDS             complement(174968..175429)
                     /gene="TPHA0O00940"
                     /locus_tag="TPHA_0O00940"
                     /inference="similar to DNA sequence:INSDC:YNR004W"
                     /note="similar to Saccharomyces cerevisiae YNR004W;
                     ancestral locus Anc_1.433"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688497.1"
                     /db_xref="GeneID:11530721"
                     /db_xref="UniProtKB/TrEMBL:G8C1N5"
                     /translation="MSIDEIIIDDDILIVFLNNFTENPELLNEFSDSLSVIYESIAKN
                     RIFSSLASSMCQQVFNRWENRNKTVDKNVLRCCLDMWLIIKGTDYDIPKFEEIVSNLI
                     IEEADVSQYFSENDERLEFDEITNEVLVDPLSNLILEEVEVTEFVDEEENE"
     gene            complement(<176003..>177682)
                     /gene="TPHA0O00950"
                     /locus_tag="TPHA_0O00950"
                     /db_xref="GeneID:11530722"
     mRNA            complement(<176003..>177682)
                     /gene="TPHA0O00950"
                     /locus_tag="TPHA_0O00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688450.1"
                     /db_xref="GeneID:11530722"
     CDS             complement(176003..177682)
                     /gene="TPHA0O00950"
                     /locus_tag="TPHA_0O00950"
                     /note="ancestral locus Anc_1.432"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688498.1"
                     /db_xref="GeneID:11530722"
                     /db_xref="GOA:G8C1N6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8C1N6"
                     /translation="MKSSTKDKILLRNVQFEGSLYKKFPKIYNVYFIAIISCISGLML
                     VFDISSMSSMLGTAPYKKYFGSPDATIQGGITASMSAGSFVGSLISPTISEAFGRRVS
                     LHLCATFWIIGAVIQCASHNVAMLVCGRLISGIGVGFGSSAAPVYCSEIAPPKIRGLI
                     GSLFQFSVTFGIMILFYIGYGCSFLDSSASFRITWGLQMVPGFILLVCTFFIPESPRW
                     LGNKGNWDECINVITRINNTTKDTMTEEVALQVEEMKQAVNEDVANSDFGYIDLFKKK
                     TIRKTIVGMSAQMWQQLCGMNVMMYYIVYIFEMAGHTGNNTLVSCSIQYVLNVVMTIP
                     ALFLVDKVGRRPLLLIGGVLMFSWLFAVSGLLATYSIPAPDGFEGDDTVRIRIPDENK
                     SAADGVIACCYLFVCSFAPTWGVGIWLYCSEIFNNKERAKGSALSTSVNWIFNFAIAL
                     FVPSAFKNITWKTYIVFGVFSVALTIQTYFMFPETKGKSLEEIDMMWAANLPAWRTKS
                     WVPDVIIPQLDVEPLEKGGSEGSTEFVEGSPYNDEKPITTHFEGSSDNDSI"
     gene            <178259..>178717
                     /gene="TPHA0O00960"
                     /locus_tag="TPHA_0O00960"
                     /db_xref="GeneID:11530723"
     mRNA            <178259..>178717
                     /gene="TPHA0O00960"
                     /locus_tag="TPHA_0O00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688451.1"
                     /db_xref="GeneID:11530723"
     CDS             178259..178717
                     /gene="TPHA0O00960"
                     /locus_tag="TPHA_0O00960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688499.1"
                     /db_xref="GeneID:11530723"
                     /db_xref="UniProtKB/TrEMBL:G8C1N7"
                     /translation="MGSRDFSVLYYVSIYHMPCVISFSYFVFCFRFWRRLDVLGSVQK
                     NARTYYQLYYPASSFPPPSLEPLPSLNNTRTRNCVYENTNETESMTTRTTGSGSHTPA
                     EKTRNKNNKQRRANLKRKSSVRQGISPRKTIVLLKWSVLGSLDLGCKRGQ"
     gene            complement(<179610..>180488)
                     /gene="TPHA0O00970"
                     /locus_tag="TPHA_0O00970"
                     /db_xref="GeneID:11530724"
     mRNA            complement(<179610..>180488)
                     /gene="TPHA0O00970"
                     /locus_tag="TPHA_0O00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688452.1"
                     /db_xref="GeneID:11530724"
     CDS             complement(179610..180488)
                     /gene="TPHA0O00970"
                     /locus_tag="TPHA_0O00970"
                     /inference="similar to DNA sequence:INSDC:YCR016W"
                     /note="similar to Saccharomyces cerevisiae YCR016W;
                     ancestral locus Anc_1.431"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688500.1"
                     /db_xref="GeneID:11530724"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:G8C1N8"
                     /translation="MSNLHIPAWKRINIVKDAQKAEGIDVNEDPLNVTTHLSTGSLTK
                     RQKKQIINKTLSKGKENKVSKNTKDSQRNKIKVKKSERDSKPRILRDQVKYLIEFYLG
                     KINDELPEPVKKLDFVSANLSIFNKKTDDDGGVIEVWKFSKQKQNWLLKHFFNIELIP
                     VELNQLLFDYFELLNGFSKKQLVEECQKKIISWNDFIDEQEIQMAKLVEGDATEEEKK
                     DADGSEDKTKNTTPSVDSEKPTETKLVLPPNKDEVRRARKMLETWLTVMKKKPEDHNR
                     EELDAFESVMNLKSFD"
     gene            <181280..>182977
                     /gene="TPHA0O00980"
                     /locus_tag="TPHA_0O00980"
                     /db_xref="GeneID:11530540"
     mRNA            <181280..>182977
                     /gene="TPHA0O00980"
                     /locus_tag="TPHA_0O00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688453.1"
                     /db_xref="GeneID:11530540"
     CDS             181280..182977
                     /gene="TPHA0O00980"
                     /locus_tag="TPHA_0O00980"
                     /inference="similar to DNA sequence:INSDC:YCR014C"
                     /note="similar to Saccharomyces cerevisiae POL4 (YCR014C);
                     ancestral locus Anc_1.429"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688501.1"
                     /db_xref="GeneID:11530540"
                     /db_xref="GOA:G8C1N9"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027421"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:G8C1N9"
                     /translation="MLFYNKKFLILPNAESSHMQFIIKLIKKNGGAIVKWAPDVMKVI
                     DRSSIVLINDSYVDSNNKLKQYDIFKRELRPWLVTDWEKVVDYRLNCVNIKKIHTWLD
                     NGNFKITSNDLIETISVENSGKRVLDSQNELELSSNKRLKQNEMIIDNNDNPIENKSN
                     SGESTNPKRTEIKSVTSDTNDIRDNKFLADALQILSKRCGLKGEKFRARSYQLAADSI
                     LKAQFAIKSGHQAQKNMMHIGPSISRKIDILLKEGTLPGLSVKSEKDDNIAYFMGCHN
                     IGIGLAKKWELLKIKTFKEALEKQPTDFQTTWPTLFGISYYEDWSRPIMREECEEHLK
                     TVQDELRLIDKDCKVELQGSYRRGAKTCGDIDLLFYKEGCDDIAQLGKVIEDLAISLY
                     ERNYVQCFLLSSSKIANIFDDKINERYKVAGIERKYRKSNETIKKLFLGVKLPNRNTD
                     SLKLDPKMKLKDDDLFLSLNSKAGESVCRRMDFFLSRWSELGACRIQYTGSTDYNRKM
                     KIIAMNKSMKISPHGLFKDDVLLESFDERKIFDILNIKYVEPEQRVNTVTLLPDKIK"
     gene            complement(<183157..>184404)
                     /gene="TPHA0O00990"
                     /locus_tag="TPHA_0O00990"
                     /db_xref="GeneID:11530541"
     mRNA            complement(<183157..>184404)
                     /gene="TPHA0O00990"
                     /locus_tag="TPHA_0O00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688454.1"
                     /db_xref="GeneID:11530541"
     CDS             complement(183157..184404)
                     /gene="TPHA0O00990"
                     /locus_tag="TPHA_0O00990"
                     /inference="similar to DNA sequence:INSDC:YCR012W"
                     /note="similar to Saccharomyces cerevisiae PGK1 (YCR012W);
                     ancestral locus Anc_1.428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688502.1"
                     /db_xref="GeneID:11530541"
                     /db_xref="GOA:G8C1P0"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="UniProtKB/TrEMBL:G8C1P0"
                     /translation="MSLSSKLSVTDLDLAGKRVFIRVDFNVPLDGDKITSNQRIVAAL
                     PTIKYALEKGAQYVVLASHLGRPNGERVAKYSLKPVQAELSTLLGKPVEFLNDCVGPE
                     VEAACKAAPKGSVILLENLRYHIEEEGSKKVDGKKVKATDDEVATFRKQLSSLADVYI
                     NDAFGTAHRAHSSMVGFDLPQRAAGFLLEKELKYFAMALENPKRPFLAILGGAKVADK
                     IQLIDNLLDKVDSIIIGGGMAFTFKKVIENAQIGDSIFDEAGAEIVPKLMEKAKAKGV
                     KVVLPIDFVIADDFSATANTKIVSDKEGIPAGWQGLDNGPETRKLFAATVAEAKTIVW
                     NGPPGVFEFEKFAAGTKSLLDAAVASCQSGNTVIIGGGDTATVAKKYGVTDKISHVST
                     GGGASLELLEGKVLPGVAFLSEK"
     gene            <185595..>188630
                     /gene="TPHA0O01000"
                     /locus_tag="TPHA_0O01000"
                     /db_xref="GeneID:11530542"
     mRNA            <185595..>188630
                     /gene="TPHA0O01000"
                     /locus_tag="TPHA_0O01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688455.1"
                     /db_xref="GeneID:11530542"
     CDS             185595..188630
                     /gene="TPHA0O01000"
                     /locus_tag="TPHA_0O01000"
                     /inference="similar to DNA sequence:INSDC:YCR011C"
                     /note="similar to Saccharomyces cerevisiae ADP1 (YCR011C);
                     ancestral locus Anc_1.427"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688503.1"
                     /db_xref="GeneID:11530542"
                     /db_xref="GOA:G8C1P1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1P1"
                     /translation="MVFLAKLYLIWILSFVLYWNKGHGKSTGIDSLKVISLNGISENS
                     NNNNDNETCPPCFNCMLPMFECKQFSTCNEFNGQCDCIEGFGGADCSVPLCGSPSHDN
                     KNRPLRNDTVSDACDCDEGWSGINCNLCEVDSVCNRFMPDNSIEGTCNKNGMIVNKIN
                     SNCNVVNSKILKILNGKIPQITFICDKNENKCNFQFWIDQVESFYCDLNTCQFDIDLQ
                     NNQTSYHCDDISCKCISDTMLCGQNGSIDISDFLTEEIKGPGKFQCAIDIENSQEHDC
                     KFEEAKMNDLISTIFGDDYIQLSCNSTECLHYSQVPGYLPPDLKHGQRKLSWTFNLLL
                     TLIILILGSSFYYITNNISKSPFFTNITTAIGQNQVELPNDQYDFLKNDIPATLTFEN
                     VSYSITESEGIRRDEGKSNVKILQNVSGVAKPGEIMAIMGGSGAGKTTLLDILAMKDK
                     TDGDVSGAIKINGKQLEKSYFRKLIGFVDQYDYLFPTLSVYETVLNSALLRLPSSMSF
                     AAKQLRVLQVLDELRILEIKDRLIGNDYQRGISGGEKRRVSIACELVTSPSILILDEP
                     TSGLDSNNANNVINCLVRLAQNHNRTIIVSIHQPRSNIFYSFNKLILLSNSRLIYSGE
                     ASNVTKFLEANKLYCPPGYNVADYLIDITVTNERVDADSVNKNNERIEPMASVGNNSS
                     KQELGQESDILSDSFMESSFHTNVASEIRESIEFNTTDNNELPTINTSATFSEQLMIL
                     CSRTFKNVYRNPKLLIENYLLSIFLAFFLGTLYYNLSLDISGFQNRMGLFFFILTYFG
                     FVTFTGLSTFAQERMIFIKERANNYYTPLAYYISKIVSDILPLRVFPPLFISLIIYPL
                     AGLNIIDGYNNFLKFIVILILFNLGISLEILTAGIVFKDLNNSIIISVLILLGSILFS
                     GLFINTDEIPYAAFKYFKSLSIFYYAYEALLVNEVKTLVLKEKKFGLDIEVPGATILS
                     TFGFKVRNLALDINGLIAFNIVFLIVGYIALKYIVVEKR"
     gene            <189679..>190530
                     /gene="TPHA0O01010"
                     /locus_tag="TPHA_0O01010"
                     /db_xref="GeneID:11530543"
     mRNA            <189679..>190530
                     /gene="TPHA0O01010"
                     /locus_tag="TPHA_0O01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688456.1"
                     /db_xref="GeneID:11530543"
     CDS             189679..190530
                     /gene="TPHA0O01010"
                     /locus_tag="TPHA_0O01010"
                     /inference="similar to DNA sequence:INSDC:YCR010C,YNR002C"
                     /note="similar to Saccharomyces cerevisiae ADY2 (YCR010C)
                     and ATO2 (YNR002C); ancestral locus Anc_1.425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688504.1"
                     /db_xref="GeneID:11530543"
                     /db_xref="GOA:G8C1P2"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:G8C1P2"
                     /translation="MSGNYSNIASTVSGVSSFNENSFPNSQRGTSNNENSELSRIYTS
                     GKNNEYVNIGKEKFLRDDLLEAFGGSLNPGLRVPSEHKFANPAPLGLSAFALTTFLLS
                     MYNVQARGVKIPNAIVGPAFFYGGLVQIIAGIWCIAVENTFGGTALCSFGGFWMSFAT
                     FFVPWFGILDAYKNDLDQLDNAIGIFLIGWALFTVFLCLCTMKSTLLFFSLFFFLSVT
                     LFLLAVGKFTNSTALAKTGGVFGIVTAFISWYNAFEGLTDKHNSYLVLTSMKLPTNEY
                     SYPCSRG"
     gene            <190997..>191794
                     /gene="TPHA0O01020"
                     /locus_tag="TPHA_0O01020"
                     /db_xref="GeneID:11530544"
     mRNA            <190997..>191794
                     /gene="TPHA0O01020"
                     /locus_tag="TPHA_0O01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688457.1"
                     /db_xref="GeneID:11530544"
     CDS             190997..191794
                     /gene="TPHA0O01020"
                     /locus_tag="TPHA_0O01020"
                     /inference="similar to DNA sequence:INSDC:YCR009C"
                     /note="similar to Saccharomyces cerevisiae RVS161
                     (YCR009C); ancestral locus Anc_1.424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688505.1"
                     /db_xref="GeneID:11530544"
                     /db_xref="GOA:G8C1P3"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:G8C1P3"
                     /translation="MSWDGFKKAINRAGQSVHVKNIDKTVDKNYDIEERRYRSLEKCG
                     EAICLEARGYHDSLKQVAQSQLKIAEVISSLYDDTNNGATGSFNVGKSYFDTVTEFDE
                     EIIKQLDVPFMETVITPLEKFSYYFKEIDDAITKRDHKKQDYDAAKSKVRRLTEKPTK
                     DSGKLPRAEKELESAKDAYEQLNEQLKSELPQLLSLRVPYYDPTFESMIKIQMRFSTE
                     GYTKLAQVQQYLDQQARDDYANGLLDAKLDEILQKMMQLDICTLGYK"
     gene            complement(<191875..>193890)
                     /gene="TPHA0O01030"
                     /locus_tag="TPHA_0O01030"
                     /db_xref="GeneID:11530572"
     mRNA            complement(<191875..>193890)
                     /gene="TPHA0O01030"
                     /locus_tag="TPHA_0O01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688458.1"
                     /db_xref="GeneID:11530572"
     CDS             complement(191875..193890)
                     /gene="TPHA0O01030"
                     /locus_tag="TPHA_0O01030"
                     /inference="similar to DNA sequence:INSDC:YCR008W"
                     /note="similar to Saccharomyces cerevisiae SAT4 (YCR008W);
                     ancestral locus Anc_1.423"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688506.1"
                     /db_xref="GeneID:11530572"
                     /db_xref="GOA:G8C1P4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C1P4"
                     /translation="MSNSTVSRRHTLPKKIVSLFSSKTSHNTNNDDDVVQKRNVSDVV
                     SKNSVNSTSKQSIGSPAAQRHKKIDANLVSPVSSITSSFSGLSLNATPNNNNANITIH
                     VDKYNSTSNSTLNSNNSTTHTNNNSNVNSNAILSQNSRSRQNNDKIVSNSNLSSTTNV
                     ELKLNKNPERMSSNHSQSGNSIKTSTTPAQSSSNLNLEAVTSNVDHVSLNSSSNSQTQ
                     QPTATQTTKRFVLHENGSHTHSLKATRRQEKLRNMLKNILGSSDEKIRGQAKSAVPEI
                     MKDTKNFVTTEDPNPPTLLAGLVKQVEIMKKDTSSTNLQNSNNSVNPTQSYSSLTTIS
                     SHQSDIIPFSGASYGGDKIIYKNQFPTDYQDEFIKSFMNKKDSLSFGEKYGRCQEVIG
                     KGAFGVVKLCHKKDPNNSKNEIVYAVKEFKRTSTEPIEKYSKRLIAEFCISSSLRHTN
                     IIDAFDLFQDANGDYREVLEYCSGGDLFTLIIAAGKLEVAEADCFFKQLIRGVSYMHG
                     VGVCHRDLKPENLLLTASGVLKITDFGNAECFKIAWEKDIHLSAGVCGSSPYIAPEEF
                     IKEEFDPRPVDIWACGVIYMAMTTGRQLWSSATRDDIFFCKYYKSRKETGKFTPIESL
                     QRTQCRNVIYSMLDPNPTGRLTPKQILQTEWGRDIKCCNEGLPKKLA"
     gene            complement(194868..194940)
                     /gene="TPHA0Otrna9T"
                     /locus_tag="TPHA_0Otrna9T"
                     /db_xref="GeneID:11530573"
     tRNA            complement(194868..194940)
                     /gene="TPHA0Otrna9T"
                     /locus_tag="TPHA_0Otrna9T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11530573"
     gene            <196178..>197554
                     /gene="TPHA0O01040"
                     /locus_tag="TPHA_0O01040"
                     /db_xref="GeneID:11530609"
     mRNA            <196178..>197554
                     /gene="TPHA0O01040"
                     /locus_tag="TPHA_0O01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688459.1"
                     /db_xref="GeneID:11530609"
     CDS             196178..197554
                     /gene="TPHA0O01040"
                     /locus_tag="TPHA_0O01040"
                     /inference="similar to DNA sequence:INSDC:YJR065C"
                     /note="similar to Saccharomyces cerevisiae ARP3 (YJR065C);
                     ancestral locus Anc_1.514"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688507.1"
                     /db_xref="GeneID:11530609"
                     /db_xref="GOA:G8C1P5"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR015623"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:G8C1P5"
                     /translation="MSYLNNPAIVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNA
                     KSSANAPQGLGNAKAGVSNPATSNPYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDL
                     DFYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERFWENSIFKYLRAEPEDHFFLLT
                     EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSAQVTDRSLTGTVIDSG
                     DGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLLRERGEADSSLKTAERIKQEYC
                     YVCPDIVKEFNKFDRQPEKFAQFIIENQDKTTKKVIDIGYERFLAPEIFFNPEIASSD
                     FLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDVKSIVSNRIAQ
                     NEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEHGPEIVR
                     NFSLFNMV"
     gene            complement(<197941..>198318)
                     /gene="TPHA0O01050"
                     /locus_tag="TPHA_0O01050"
                     /db_xref="GeneID:11530574"
     mRNA            complement(<197941..>198318)
                     /gene="TPHA0O01050"
                     /locus_tag="TPHA_0O01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688460.1"
                     /db_xref="GeneID:11530574"
     CDS             complement(197941..198318)
                     /gene="TPHA0O01050"
                     /locus_tag="TPHA_0O01050"
                     /inference="similar to DNA sequence:INSDC:YJR063W"
                     /note="similar to Saccharomyces cerevisiae RPA12
                     (YJR063W); ancestral locus Anc_1.512"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688508.1"
                     /db_xref="GeneID:11530574"
                     /db_xref="GOA:G8C1P6"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:G8C1P6"
                     /translation="MSVVGSLIFCLECGNLLGNPNEAVGSQLECSQCQKCYLKSEFTN
                     LKVVTTTADDAFPSALRSKKSVVKTSLKKNELKDGATIKEKCPKCGNEEMQYHTLQLR
                     SADEGATVFYTCPSCNYKFRTNN"
     gene            <199359..>200621
                     /gene="TPHA0O01060"
                     /locus_tag="TPHA_0O01060"
                     /db_xref="GeneID:11530575"
     mRNA            <199359..>200621
                     /gene="TPHA0O01060"
                     /locus_tag="TPHA_0O01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688461.1"
                     /db_xref="GeneID:11530575"
     CDS             199359..200621
                     /gene="TPHA0O01060"
                     /locus_tag="TPHA_0O01060"
                     /inference="similar to DNA sequence:INSDC:YJR062C"
                     /note="similar to Saccharomyces cerevisiae NTA1 (YJR062C);
                     ancestral locus Anc_1.510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688509.1"
                     /db_xref="GeneID:11530575"
                     /db_xref="GOA:G8C1P7"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:G8C1P7"
                     /translation="MSSKIKVALKVGIIQVNPQIGEVEKTVARVWNALEELEKKLNYD
                     ESLYPDLLVFPEFSLIGYHFESKEQIRPYAATGDMKNGPSYELAAKISKKFNCYTVIG
                     MPEIYIDHNDNDREIFYNSSLMVNKEGEILYRYRKSFLYTQDYKWGCEENPEGYQNFD
                     LEFKGKGTNLTTGEKNIDVTLKTGLGLCMDMSPYKFKSPFHDYEYSTWHLDHGTELMI
                     FSMCWLHSSAFSEMSEQTAEEVIEDIEENLKLRNLPPIGSQGDFTFNLDNDDDIERIA
                     NPNTTKISYTNLKEPDMQNINYWILRFSPFVSMNIRQEVFDSGLVESQLNKPSQIRRS
                     SYIGCTIEKPWGFEDKQAILLLANRCGIEQKCKVFAGSSNIMKFNGKYQETAYGMDST
                     NESVELLGGLTLGYEGILLRDVNITVNR"
     gene            complement(<200967..>204008)
                     /gene="TPHA0O01070"
                     /locus_tag="TPHA_0O01070"
                     /db_xref="GeneID:11530567"
     mRNA            complement(<200967..>204008)
                     /gene="TPHA0O01070"
                     /locus_tag="TPHA_0O01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688462.1"
                     /db_xref="GeneID:11530567"
     CDS             complement(200967..204008)
                     /gene="TPHA0O01070"
                     /locus_tag="TPHA_0O01070"
                     /inference="similar to DNA sequence:INSDC:YKL201C,YJR061W"
                     /note="similar to Saccharomyces cerevisiae MNN4 (YKL201C)
                     and YJR061W; ancestral locus Anc_1.509"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688510.1"
                     /db_xref="GeneID:11530567"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:G8C1P8"
                     /translation="MSTGSKMKRANSSFKIFAKVWKRLILLLCFVFIIFTSLFSNPNA
                     NAVSSETNNLRKFMLPSLNYYISSLKGFAFNSNNDADMQDFISGLYRKVMYNATFEYL
                     DNYYLNKNLLTVPLGKKKGMILNSIDEIDFYNNDPRLVWSVYFHHLTNLHDPTFEKIP
                     FSWYDFADFQELNKLIAVEDTRIQCPFLMDAAFEKETLLKVESELGEPLFESDRKKYD
                     MVKWYSRARKGVDINAINSSSKYCRKLESKDIKSKRANGLPKFRLPFSIFNIHDRVKP
                     EVLKLQARNYLLSTVENPLSITFLDGSDAAYRFNVEQKEQSNIIQSGLLKKYLESNNH
                     SVDPTTAPNQGRTDHIFDHYDHYNSFLKSDIAPRAKLHIEGADYGLFDNDTFELKHEY
                     FRFNAKDKIKELEEKAKRDSKLNVHEQNYLESLKYSVRTHPSLMKKYFKESSNVQQYA
                     LGHHRDRKFFNGGIIDDPMLYAQKMNSMIRTFQKFTKANGLVSWLSHGTLYGYLYNGR
                     TFPWDNDYDLQMPIKHLHLMAQHFNQSLILEDPREGNGKYMIDVGSSITVRVKGNAKN
                     NIDARFIDIDSGIYIDLTGISVSSSVPRDYLNGDVTERLKHIDWSQYVAEKDINLEYG
                     EGLADMDITQLHDYSIKHPKKLSRDQRNDIKNYYEKEEKIKKGSSPMKDLSADERYLR
                     SEVLNIYYCRNEHAVFHDDLSPLVNTYFHGVPALIPHRSINILKREYKIPLEIGLLNF
                     KGNKYIPELRSWVNKLMIEKLVNQFGWYPELLHIDKELKNFTVENVKVLYFNMMLGKY
                     NDVIASLYTSFDNDVYRTKELEITMDTTIKNDDKIKILHALRTEVGKRTQQTPYKDPF
                     LFQLQRSLYESIISTMAGPQVRDLINAVDINVIRDIWIKLDNVHSRKLPDFDINVNGL
                     SESINNKTINEFGLDVFKSSSKKEVFVTLPDLYLNSPENPNPLMPNAPPKIEAPAEED
                     SLANIDIPVKEDTPVKEDTPVKEDAPVKEDAPVKEDVPVKG"
     gene            complement(<205407..>207653)
                     /gene="TPHA0O01080"
                     /locus_tag="TPHA_0O01080"
                     /db_xref="GeneID:11530568"
     mRNA            complement(<205407..>207653)
                     /gene="TPHA0O01080"
                     /locus_tag="TPHA_0O01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688463.1"
                     /db_xref="GeneID:11530568"
     CDS             complement(205407..207653)
                     /gene="TPHA0O01080"
                     /locus_tag="TPHA_0O01080"
                     /inference="similar to DNA sequence:INSDC:YJR059W,YKL198C"
                     /note="similar to Saccharomyces cerevisiae PTK2 (YJR059W)
                     and PTK1 (YKL198C); ancestral locus Anc_1.507"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688511.1"
                     /db_xref="GeneID:11530568"
                     /db_xref="GOA:G8C1P9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C1P9"
                     /translation="MPSNNGSRERSSSFKLFNKIGNTLKMENDQPGHYSEIENRSLKK
                     QSTSPGSTFGHHLSSALFNKKSSPTVLKTAIHVKSSSSLSNLVAHSHNPFANKQDNIG
                     GGSSISGSRGAKISHGHNHRNDANDNPLKSRHLHMENIVYNPYGINNNTTQPQNDISF
                     YMQEGENSERLLPLPVSSPDDFLPDHLKQKSYQLTDGFNFDKDNKFLGAGSSSEVKRV
                     KSAFDHKEIYALKKLTMIHKETPERFYKRCSKEFIIAKTLSCNIHVSSTFYLMKIPTS
                     KFTSRGWGFVMELCVGDLFQYLERSGWKNVPVSEKFCIFKQVAEGLKFIHSKGIVHRD
                     VKPENILLTKDGICKLTDFGISDYYHEIHDDLTSPIKLCEGIIGSTPYAPPEVMVFDD
                     KREHPKEQKKPYNPVLMDCYGLGILFFAIMNSYLPFTESSPFDPKFRDFETSYDNFIF
                     HQNKNFRVKGNYKPGPGGEYKLGRGFLSTEASRVGWRLLDPNPETRYNMDDLFDDPWF
                     KQVETCIDSNATEYNDTHYRVSFPQLSTNTMNKDSVDMTPDTGSIHSIASVSTAATKN
                     DVPDLPRPRTMVDIALSPDLTKKKKKVKELSSIDSAEDSPANDIDVKKHIHDIQEHKI
                     VFTLDDAEAEEAQQDTSDFKTSDVRANALSQDVPDKIDELLEGSVETNEDSGITKDLK
                     NVKLDGDGRSASGSGKGNIFRNEAMSTSSSLTSLKSNSSKKAVIHHHLDVPNSIPNAP
                     SMRSFSDR"
     gene            complement(<208519..>211680)
                     /gene="TPHA0O01090"
                     /locus_tag="TPHA_0O01090"
                     /db_xref="GeneID:11530569"
     mRNA            complement(<208519..>211680)
                     /gene="TPHA0O01090"
                     /locus_tag="TPHA_0O01090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688464.1"
                     /db_xref="GeneID:11530569"
     CDS             complement(208519..211680)
                     /gene="TPHA0O01090"
                     /locus_tag="TPHA_0O01090"
                     /inference="similar to DNA sequence:INSDC:YKL197C"
                     /note="similar to Saccharomyces cerevisiae PEX1 (YKL197C);
                     ancestral locus Anc_1.506"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688512.1"
                     /db_xref="GeneID:11530569"
                     /db_xref="GOA:G8C1Q0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q0"
                     /translation="MHKMISNKLYFENINLVFNNEIKGNFIRLPLKIIIELESTNKSI
                     NEFGVIIKGHNGKDLTLLGWDGIPSSDSLSLEINPSLLKHGDMVNKEVNVELKHFGDF
                     CLAKEVYVEPTTSNDWEIIEKNAVYFKDYILHQTRFVSLDNDFICYVNNDNNLFCKFK
                     IKKIVINDSRDDNVTSARISEGVLIIVSPLENKSRAKPSKKTPKILQTSYFRSCFYAL
                     KNDEHDTIDLTCYINDTLTASKYNFARLTIIQNPMESTDNNKSKSIFVNIKHSKLILE
                     NHISLNNYVHDTLLLPVQNGYRVKSEFIDVDHWSSPSKRSDNIKILANFSKLNEAITV
                     DTNAVLNHLLNSKSDVLLVNGMTVLKDNYKLTFKLVDNLNNCIIPFINFNRKWKSNIE
                     TEITRNIKKIGNDYENYHYDYMNHEEDILNEEQLAEIIKYVSSPALPSNCILIEGGTG
                     IGKTTLVNKLKLRLTLNSHQYIHYVDCNNILSQGNNFKVDDLSKLIANIVYTAYWYSP
                     SIIIFDNFEVWVPKKERDNPGANQNNTSLSYKLSIQLMQLVNDIARINPLTLRVILTS
                     NSKNSLNNILFEKHFICKVWSLKVPDNSKRIALIKKYCEDLVDNDIEFENDNELLNLA
                     VKADGYSTLDLKILMDRIYYQLQISNNSSANKINGKCNLILNNSIVEKALEGFTPFSL
                     RNVHLTKNTGVGWDDIGALFEAKQMLLETLEWPTKYSKIFEKNPLRLRAGILLYGYAG
                     CGKTLLASAVAEQCGLNFISIKGPEILNKYIGASEQSIRELFDKAQSVKPCVLFFDEF
                     DSIAPKRGHDSTGVTDRIVNQLLTQMDGAEGLDGVYVLAATSRPDLIDSALLRPGRLD
                     KSIICDLPGKPERYDILKSITSTDHNSKKIKIQPDTNLTELSNITEGFSGADLQGLCY
                     NAYLKAVHKYLERYETVKVDQKTEKEDVLNGVQFKLVNTGLKNLGHGDFQKLRQRIQE
                     YFESNSELQVKNNASDSDSSFASLLISTQDFYEALKDTKASISPNEYQKLKLIYDKFR
                     NDRNGKMPSGEGSRDVGTRSSLM"
     gene            <212900..>213343
                     /gene="TPHA0O01100"
                     /locus_tag="TPHA_0O01100"
                     /db_xref="GeneID:11530570"
     mRNA            <212900..>213343
                     /gene="TPHA0O01100"
                     /locus_tag="TPHA_0O01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688465.1"
                     /db_xref="GeneID:11530570"
     CDS             212900..213343
                     /gene="TPHA0O01100"
                     /locus_tag="TPHA_0O01100"
                     /inference="similar to DNA sequence:INSDC:YJR058C"
                     /note="similar to Saccharomyces cerevisiae APS2 (YJR058C);
                     ancestral locus Anc_1.505"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688513.1"
                     /db_xref="GeneID:11530570"
                     /db_xref="GOA:G8C1Q1"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q1"
                     /translation="MGIQFILCFNKQGVVRLVRWYEQLEKNEDTQAYISSIYKLLSSR
                     DHKNQSNFIESFTEKTKLVYKRYAGLYFVMGIDTKDEEAIHLSNIHLFVEVLDAFFGN
                     VCELDIVFNFYKAYMTMDEMFIGGELQEISKEVLLERLSYLDGLE"
     gene            214258..214347
                     /gene="TPHA0Otrna4Y"
                     /locus_tag="TPHA_0Otrna4Y"
                     /db_xref="GeneID:11530719"
     tRNA            join(214258..214297,214311..214347)
                     /gene="TPHA0Otrna4Y"
                     /locus_tag="TPHA_0Otrna4Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11530719"
     gene            <214776..>217202
                     /gene="TPHA0O01110"
                     /locus_tag="TPHA_0O01110"
                     /db_xref="GeneID:11530691"
     mRNA            <214776..>217202
                     /gene="TPHA0O01110"
                     /locus_tag="TPHA_0O01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688466.1"
                     /db_xref="GeneID:11530691"
     CDS             214776..217202
                     /gene="TPHA0O01110"
                     /locus_tag="TPHA_0O01110"
                     /inference="similar to DNA sequence:INSDC:YFR013W,YOL017W"
                     /note="similar to Saccharomyces cerevisiae IOC3 (YFR013W)
                     and ESC8 (YOL017W); ancestral locus Anc_1.373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688514.1"
                     /db_xref="GeneID:11530691"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q2"
                     /translation="MSDEEVPTVHEDVSNKENENLADTSIVSDSGFGLRRSTRTPKPR
                     VLIDKATETEERNAAEAAERRRISNAKAKQKAKLKQKALEKEKQMLIVKKEKEKERLK
                     KQKLKQKEKEKAKKAKEKEKEKNKKKLLQLKAIKKNPTIAGGKIDKNVKVKEASLDYI
                     PPVNTENWTPMLPLSTLDFKNAHSVISRFKNPNLMAVPYAGDVMKLMSFINKFYIFFD
                     NELLNLSFQDFEIGLDLYPVTPQDIGMEFDNKKLLYQDYISVKEVIACQDKMNLVFLS
                     LLRLLFDSSDSDRSREHNPVASLADLQTSKKVYAKYIEKLRETSLDWGYPQEWRKQIN
                     EGDDISKPKSKMFENDDTIPVDPKNPLILTENIYEWQKLAPIDEEDNPLFVPDIEKIG
                     ILALYPNDRIILFRALVDWCSANSPKVHNEIHFLSHFKKDPTFGIQTQHVPRYFLEGS
                     KTTMLQFQRLCEIMEIRMEVRSKRKHVKKQIAEGKNEDFAKKMEILNHIKASYSSLTA
                     EEKKKSIIENYDNWTKLFKGELHDNPLSDPYEDELYKLRSQEFFISRIPQVGDFYIPR
                     LHSYSDSPVSVSTYTDLRSLENLLDKFNDGKYDTHYLFENFGQALSSQFKLLYHDTPT
                     LISDMGKPRAKKGKVYWYEMCQDSNTLLEFIDFLDYKIASPVEKPKKKVKEEVENNTS
                     ENLQAIPEAKEPEPENVETDVKNEEPENLDPTINKKPLPKESRFNASRRKLKQLQDYL
                     KRLYHILHAFEQLKKEYAGMKSGKRTLRRIQRRITYNDSDFDEDDERDNDEDNDEDEY
                     PRANKKYRRE"
     gene            complement(<217462..>218751)
                     /gene="TPHA0O01120"
                     /locus_tag="TPHA_0O01120"
                     /db_xref="GeneID:11530558"
     mRNA            complement(<217462..>218751)
                     /gene="TPHA0O01120"
                     /locus_tag="TPHA_0O01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688467.1"
                     /db_xref="GeneID:11530558"
     CDS             complement(217462..218751)
                     /gene="TPHA0O01120"
                     /locus_tag="TPHA_0O01120"
                     /inference="similar to DNA sequence:INSDC:YFR014C,YOL016C"
                     /note="similar to Saccharomyces cerevisiae CMK1 (YFR014C)
                     and CMK2 (YOL016C); ancestral locus Anc_1.374"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688515.1"
                     /db_xref="GeneID:11530558"
                     /db_xref="GOA:G8C1Q3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q3"
                     /translation="MVDKSEIQEPTPIEGHKVAKFLQKISGQPSSYINKEDYIFGKTL
                     GAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQMLYDELSILQRLHHPHIVAF
                     KDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLDAVKYIHSQNVVH
                     RDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYVAPEVLTVNGHG
                     KACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWDKISDEAKKF
                     ILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFREAVEIVKLN
                     NRIKKLRETYCVGDETESDIELNSGQTSLQSLVNATNKLNLSSDSKSTMSEEQKRKLK
                     STLTQNTFAQLVVAAANNKEKLKQYDNELERKQSETP"
     gene            complement(<219435..>221573)
                     /gene="TPHA0O01130"
                     /locus_tag="TPHA_0O01130"
                     /db_xref="GeneID:11530559"
     mRNA            complement(<219435..>221573)
                     /gene="TPHA0O01130"
                     /locus_tag="TPHA_0O01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688468.1"
                     /db_xref="GeneID:11530559"
     CDS             complement(219435..221573)
                     /gene="TPHA0O01130"
                     /locus_tag="TPHA_0O01130"
                     /inference="similar to DNA sequence:INSDC:YFR015C,YLR258W"
                     /note="similar to Saccharomyces cerevisiae GSY1 (YFR015C)
                     and GSY2 (YLR258W); ancestral locus Anc_1.375"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688516.1"
                     /db_xref="GeneID:11530559"
                     /db_xref="GOA:G8C1Q4"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q4"
                     /translation="MGRDLENQLLFEVATEVANKVGGIYSVLKSKALVTIAQYHDNYT
                     LIGPLNRATYQTEVEELDWENMHSHDSDSTASIKKVLIRMSERGVRFVYGNWLIEGSP
                     KVILFELNSLSGYLNEWKADLWNLVGIPSPENDNETNDAILLGYVVTWFLGELAYINE
                     SDTIIAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGDVDFYNNLQNFD
                     VDHEAGKYGIYHRYCIERAAAHSADVFTTVSHITALEAEHLLKRKPDGILPNGLNVKK
                     FQAYHEFQNLHALKKEKINDFVKGHFHGSLDFEIDDTLYFFIAGRYEYKNKGVDMYIE
                     ALARLNYRLKVSGCKKTVVAFIIMPAKNNSFTVEALRGQAVVKSLENTVNEVTELIGK
                     RIFDHALKYPHMGITTELPTTLEDLLTDSDKILLKKRTLNLRRADGELPPVVTHNMAD
                     NSSDPVLNKIRSVQLFNNSSDRVKMIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSY
                     YEPWGYTPAECTVMGVPSITTNVSGFGAYMEDLIEANQAKDYGIYIVDRRFKNPEESI
                     EQLVDYIEDFVNKNRRQRINQRNRTERLSDLLDWKRMGLEYIKARQLALFRAYPDEFK
                     NQISQSTKMTEDSNLDSMTGETKFKISRPLSVPGSPKNSVIKTPNGNNDIRTVFMTPG
                     DLGTLQDANNADDYFHLGLNDDDDDDGSTY"
     gene            complement(<222403..>224268)
                     /gene="TPHA0O01140"
                     /locus_tag="TPHA_0O01140"
                     /db_xref="GeneID:11530560"
     mRNA            complement(<222403..>224268)
                     /gene="TPHA0O01140"
                     /locus_tag="TPHA_0O01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688469.1"
                     /db_xref="GeneID:11530560"
     CDS             complement(222403..224268)
                     /gene="TPHA0O01140"
                     /locus_tag="TPHA_0O01140"
                     /inference="similar to DNA sequence:INSDC:YFR016C"
                     /note="similar to Saccharomyces cerevisiae YFR016C;
                     ancestral locus Anc_1.377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688517.1"
                     /db_xref="GeneID:11530560"
                     /db_xref="GOA:G8C1Q5"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q5"
                     /translation="MSSSQAISHENSATRLESLMDGIENFLNDGEIVIDYTNAESTNI
                     LNHQDKKLSEQLIAGEIYSTDHLRKRSPQHSEDNLNAFEGENKPAMETTKPVHEVETY
                     AIVNSISETANNEENSIAGAEALGYDTVKSNTEVSGVERTQVRSENVQVEIEEPQAEL
                     EKPEIKETQVEGPVVEVEEPQVEESEAVVEALQVKEAQVEVETPQLEEMQVETQTEIE
                     EPESEPEGPKVKEPQVEGPAVEVEQPQVEETQTEIEEPESELEGPEVKEPQVEEPAVE
                     VEAPQVEGPAVEVEEPQVEDPEAVVEVPQVEEPAVEVEETHVETQVEETHTEVEKPQI
                     EDSKEEDVIDEDTKSQKSEIGDDSANKPAVHGTISDLLEPEIPGTTMPEAVEPGSEQD
                     IATEIEVSESKTTEQNFEESNIEPIVAAKDSKIEDEILDLMGTSSNTLNDIITEEKST
                     KPITNSESIINSLLDDTDALLKDLEFVDDSEINDMLLALDNNNTSTTSKSITVVEKET
                     PTTSDASKVIKQSEIRKENMKLPIYIYTSLAGGGFHMIPRTNRLATILTANQVEFTYR
                     DLGTDDEARKVWKRYSKGRMLPGIVRGKDDLIGNYLDIEEANEDYKLLELLYDTI"
     gene            complement(<224456..>225373)
                     /gene="TPHA0O01150"
                     /locus_tag="TPHA_0O01150"
                     /db_xref="GeneID:11530561"
     mRNA            complement(<224456..>225373)
                     /gene="TPHA0O01150"
                     /locus_tag="TPHA_0O01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688470.1"
                     /db_xref="GeneID:11530561"
     CDS             complement(224456..225373)
                     /gene="TPHA0O01150"
                     /locus_tag="TPHA_0O01150"
                     /inference="similar to DNA sequence:INSDC:YLR257W"
                     /note="similar to Saccharomyces cerevisiae YLR257W;
                     ancestral locus Anc_1.378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688518.1"
                     /db_xref="GeneID:11530561"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q6"
                     /translation="MSELNLAGSPSLIGESIRSVEDSNNPDYNTAVDASSQINKITGS
                     TLIKQLNKHSNDGLTTKDTSYTSVEDLNREGALLTDEMDMDRIVNVTSELKIDDKEDD
                     EKRLALLKKKKELRERMYGENSKISNNGSSPYLSMSPSLSNANSLVTSTDPIDDQMNT
                     IINDAKHSNIKKSESESESESEKTIRNSYGEFIKKETNKPHLARGDSYQSSVIQEESN
                     GQESKSPERLGRTFNRYSSTEYLRSLSNSLSRDVKNTRSSFSESSSTSDPRLFSTNNY
                     SISQMDLQNAPHIIKEEELEAGDIQARHL"
     gene            complement(<225978..>226589)
                     /gene="TPHA0O01160"
                     /locus_tag="TPHA_0O01160"
                     /db_xref="GeneID:11530562"
     mRNA            complement(<225978..>226589)
                     /gene="TPHA0O01160"
                     /locus_tag="TPHA_0O01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688471.1"
                     /db_xref="GeneID:11530562"
     CDS             complement(225978..226589)
                     /gene="TPHA0O01160"
                     /locus_tag="TPHA_0O01160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688519.1"
                     /db_xref="GeneID:11530562"
                     /db_xref="GOA:G8C1Q7"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q7"
                     /translation="MNIDQLTNPEPLPTSNLKLDDTTSIEYNKVKLKELELTAVQALV
                     LLDGFKISKAKLRTLAEFPLKQNVCNGILPYPNKNTNTNYARIRINETTSLNVSTAST
                     KVQKSPRVSKKKGIPSKSNKNRNYNGGCVHCGVTETVEWRKGPQGNHTLCNSCGLFYR
                     RLLGFTSYDETIMIFKERYKNNPTDRRIPVHIRRKSKNVRFQN"
     gene            complement(227008..227078)
                     /gene="TPHA0Otrna9G"
                     /locus_tag="TPHA_0Otrna9G"
                     /db_xref="GeneID:11530625"
     tRNA            complement(227008..227078)
                     /gene="TPHA0Otrna9G"
                     /locus_tag="TPHA_0Otrna9G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:11530625"
     gene            <227929..>229365
                     /gene="TPHA0O01170"
                     /locus_tag="TPHA_0O01170"
                     /db_xref="GeneID:11530607"
     mRNA            <227929..>229365
                     /gene="TPHA0O01170"
                     /locus_tag="TPHA_0O01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688472.1"
                     /db_xref="GeneID:11530607"
     CDS             227929..229365
                     /gene="TPHA0O01170"
                     /locus_tag="TPHA_0O01170"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688520.1"
                     /db_xref="GeneID:11530607"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q8"
                     /translation="MMKHDEFLNSIEAGDYLSKITKLEEEEKGLELNIEKLRTKIIDR
                     EGLLNNRTTAHTRTSINNTVTNGSNKEEGNQQTNLMNNGSLMFKTLNGKEVVINKNYL
                     PLNIEFKLINIEDLPLWIKEFVKFLNYYNLDNLNELPESTIIDPVEDQFIKGQLKENI
                     KCEDIYDFIFMENSSIEILNEVKRIFLRKLNFAKRQKLWKQVSITEKSNNLALQLNLL
                     NKLVGIEEFIDTNKMEIFNLIINRINNQVLQRINAVPIDLSKITPTQYLGIIKKHAED
                     AFEFHEQIKQFYSSEREEAKSNSKNPETLRPIVKKVQRNPVQTKISTKKNQLKSAVDT
                     VIDSGSGINFTNKKGLIFNYRKLTTIPEYSGVGSSSNLQIIGQGSLRVRMDNNGKYQY
                     IPVYYCPDEDATVLSAIGLRKTLGFIITEDYKNLKNDSISIKIHNVANTTWIKSNDLL
                     LSSKDNRTSEKLTKASSIRWIKPSTSLI"
     gene            <229525..>230487
                     /gene="TPHA0O01180"
                     /locus_tag="TPHA_0O01180"
                     /db_xref="GeneID:11530626"
     mRNA            <229525..>230487
                     /gene="TPHA0O01180"
                     /locus_tag="TPHA_0O01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688473.1"
                     /db_xref="GeneID:11530626"
     CDS             229525..230487
                     /gene="TPHA0O01180"
                     /locus_tag="TPHA_0O01180"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688521.1"
                     /db_xref="GeneID:11530626"
                     /db_xref="GOA:G8C1Q9"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:G8C1Q9"
                     /translation="MKQHDHIKDSMNKHYEQMQPGQSWSLDIRGPLGKNLAKVDNYLL
                     LMVDNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRIVKELIVDRGSEFTNDSL
                     KTYVSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHNSDLPWALWKYAALAAA
                     RIRNLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTNNKLTNQGIPAITL
                     CKDPNSFGYLFYLPQTRKVISTMSYILANSEVNGDFIDPNKVLSEIVPDNDDTNEVTS
                     EDALEIEAEPSNADDITIIKGLKMTLSIKFRPIFKKTLSMVWIL"
     gene            <230494..>232602
                     /gene="TPHA0O01190"
                     /locus_tag="TPHA_0O01190"
                     /db_xref="GeneID:11530627"
     mRNA            <230494..>232602
                     /gene="TPHA0O01190"
                     /locus_tag="TPHA_0O01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688474.1"
                     /db_xref="GeneID:11530627"
     CDS             230494..232602
                     /gene="TPHA0O01190"
                     /locus_tag="TPHA_0O01190"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688522.1"
                     /db_xref="GeneID:11530627"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8C1R0"
                     /translation="MTTKRFLTTLARRPPMRRSKNLHWNRTPTNTSDNHSVHEAHMST
                     LPKDTATATSHIDILPDSVAESEPVKNVSDQELLLINRFDNKNSDKFPSTEAMKQRRT
                     KLFLKEFASITRRPLKSRKRELTTLDLEEFEAAEEQKKKIKLRSVQAVNKIRTLYFKT
                     AITNNTDVRERKLFSEAFEKELQNLLKMQVFDTSISIPRNQVPANRIIPLQTIFTVKR
                     DGTHKARIVCRGDKQTEATYSNYHTDLLQIDTLKLFLMIANNRKMWIQTLDINHAFLY
                     ADLREEIYVPLPHDRRFVTPLKKALYGLKQSPKEWNEHLKKFLNSIDLDDSRHTPGIF
                     RNHDYSIMIAVYVDDCVIAAKSQELLDEFGSTLRNRFELKIIGKMNQGILRTDVLGMD
                     LDYNIDEGKISLSLQSYIESIENDWLDKISHIKTTSIPHVSSYEHNIKNIDSMDTKTR
                     SKKINELQKINGVINYIRSRCRYDIEFAANKLARSVNFPADNVFYMADKLMNYIFQTK
                     SEKIVFTRETTDNPAITLLSDASLGTEHDMKSRMGIMLWYGENLYKVISRASSAVRNS
                     STEAELDAIYEGSKEAYYLKKILEEMNLQKDPTVISITDSKPSIQYLKNNYNSNRRDR
                     FLDLKLAKLEERIRADDLLIYKIAGTDNIADVLTKPVSCEDFKKLRSSMQNKLTPKDI
                     LTITDPGEFHSPSSSISTIS"
     gap             233181..233380
                     /estimated_length=200
     gene            complement(<234634..>236946)
                     /gene="TPHA0O01200"
                     /locus_tag="TPHA_0O01200"
                     /db_xref="GeneID:11530628"
     mRNA            complement(<234634..>236946)
                     /gene="TPHA0O01200"
                     /locus_tag="TPHA_0O01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688475.1"
                     /db_xref="GeneID:11530628"
     CDS             complement(234634..236946)
                     /gene="TPHA0O01200"
                     /locus_tag="TPHA_0O01200"
                     /inference="similar to DNA sequence:INSDC:YFR022W,YOR018W"
                     /note="similar to Saccharomyces cerevisiae ROG3 (YFR022W)
                     and ROD1 (YOR018W); ancestral locus Anc_1.358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688523.1"
                     /db_xref="GeneID:11530628"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:G8C1R1"
                     /translation="MDIMRNYCRDPVLFDIRLNNLEEDVLVIKGSPDEAPSVLLAGTI
                     VLSLSEPVQIKKLKIKLVGDINMKIFEEPTSKTNDNYSRFKKRIFEHSWDDVDIDSCL
                     GNLQFDNSVADPIIDKRRILRQKAKSSTSLVSAFARNKLQGVNSSTDIFNPIGSSHRT
                     DAATKHITLVKGNYEFPFSAILPGSLTESVESLTNANVIYKLTATLERTKNDPDIITE
                     KHLRVIRTVSPDTAELSETVAVDNTWPEKVEYSISIPTKTVAIGSTIPISISIVPLLK
                     NLKLGQVKVVLIENSQYCGHYGNIHNQEREVCRIKLKDPLNHIAASVNSASDGSDDLD
                     TEYMNFQDIWEVQSALKIPPNLLNCCQDCTVMKNIKVRHKLKFVIYLINPDCHVSQLR
                     ASLPVQIFLSPFIAVTVKSTEPDWITDHKDKLINTYSSSGLDNLYYEKHKKVNDNESA
                     VIFSRATSGVNVADMSGIDDHSVVSNGNLTPRAELMVPPKYERYMYDPVYSPESSGVN
                     TPMTSGMHSPISRSRGASFLSNHTLEHSFSPMHLQNMNFLKTELERPSDNNFYSSAFL
                     QTGKSQINSEGLDELIQGSNNNTKVASPLIKNAESSTDISSNFLPTNPFSSSYSCNFL
                     NNIKNVQPVDINQNIQSSKSLIRPDMVDLDASPPSNWKPQEMNKVPTYDTAMKITSIG
                     MELPPIYPIQDASSSIPIESPKSAKIKSESYTNLMFHRNQRKSPPFSLLRSNSTQLKD
                     VKKSRRPFNIINEQSLYNSDSMVSSNTEIH"
     gene            complement(<238057..>239778)
                     /gene="TPHA0O01210"
                     /locus_tag="TPHA_0O01210"
                     /db_xref="GeneID:11530629"
     mRNA            complement(<238057..>239778)
                     /gene="TPHA0O01210"
                     /locus_tag="TPHA_0O01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688476.1"
                     /db_xref="GeneID:11530629"
     CDS             complement(238057..239778)
                     /gene="TPHA0O01210"
                     /locus_tag="TPHA_0O01210"
                     /inference="similar to DNA sequence:INSDC:YFR021W"
                     /note="similar to Saccharomyces cerevisiae ATG18
                     (YFR021W); ancestral locus Anc_1.359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688524.1"
                     /db_xref="GeneID:11530629"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8C1R2"
                     /translation="MSDAPLINFINFNQNGSCISIATTEGFRIYNCDPFGKFYSQKKL
                     NFNSTSNQDNPNMDLSTVSSPTGCSLAIVEMLYSTSLLAIVGLGDQPALSPRRLTMLN
                     TKTDTVICEVTFPTAILSVKMNKARLIVVLREQIYIYDIKTMRLLHTIENNENDKGLI
                     ALSTSLDNDFLAYPSPPKIINSEIEANLTTNNMVLLSNNSRNNIQSSDNNRRLGKDAN
                     GSNEQQNLDSEPNNNEPDAPLFMSSNNLNNKNTHKIIKNGDVILFNLVTLQPTMVVEA
                     HKGTIAALALNNEGTLLATASEKGTIVRVFSVETGAKLYQFRRGTYPTNVHSIIFSND
                     SKYLSVTCSSKTVHIFKMDNENLTPSNENFTSRSSSPPLSEELDNNSNETDMLSNETN
                     TSPKSPDSSKKEPFVDTTRSTVGRMIRKSTQKFSKNAAKKFGEYFPLDVKSIIESSRH
                     FASFKLPIESKETYSNYIGSNNANLSSHQLNSTSSESLAHVSMRINAGKYISSIGEEI
                     TLDLSNYPKVLANYSNYTTGQTSPKKITAIPIRVLSSDGIYYNYILDPERGGDCILIS
                     KYSLLLD"
     gene            240483..240583
                     /gene="TPHA0Otrna10S"
                     /locus_tag="TPHA_0Otrna10S"
                     /db_xref="GeneID:11530571"
     tRNA            join(240483..240520,240538..240583)
                     /gene="TPHA0Otrna10S"
                     /locus_tag="TPHA_0Otrna10S"
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /db_xref="GeneID:11530571"
     gene            complement(<240793..>241803)
                     /gene="TPHA0O01220"
                     /locus_tag="TPHA_0O01220"
                     /db_xref="GeneID:11530707"
     mRNA            complement(<240793..>241803)
                     /gene="TPHA0O01220"
                     /locus_tag="TPHA_0O01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688477.1"
                     /db_xref="GeneID:11530707"
     CDS             complement(240793..241803)
                     /gene="TPHA0O01220"
                     /locus_tag="TPHA_0O01220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688525.1"
                     /db_xref="GeneID:11530707"
                     /db_xref="GOA:G8C1R3"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C1R3"
                     /translation="MAVLVTGASGFIALHVINLLLSQNYKVIGTVRSQDKVDKIIKQF
                     NNPNLSFELVTDITKLDAFDETLKKHSNEIDYVIHMASPLPDEGNTDFENHYLLLAVN
                     GTKSVLSAIKKFAPKSVKHVVMTSSIVAMLNVNDDSAITTEKDWNPITWEQAKTSSFL
                     CYFGSKTYSEKAAWDFLKENKDEVDFKFTTVNPVMVFGRQMFDEDVKDTLNVSCEYVN
                     KILYLPPTEKLSQDYAMSYVHVDDVALAHVMAMREDRLDGERLLLSAGTYSDQLVANS
                     INKQFPQVKGTIPAAIENCDKPTIRYDSTATQKQLGIEWKSFDVAVYDIAHQALKRLG
                     KL"
     gene            243583..243672
                     /gene="TPHA0Otrna5Y"
                     /locus_tag="TPHA_0Otrna5Y"
                     /db_xref="GeneID:11530597"
     tRNA            join(243583..243622,243636..243672)
                     /gene="TPHA0Otrna5Y"
                     /locus_tag="TPHA_0Otrna5Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:11530597"
     gene            <244313..>245854
                     /gene="TPHA0O01230"
                     /locus_tag="TPHA_0O01230"
                     /db_xref="GeneID:11530694"
     mRNA            <244313..>245854
                     /gene="TPHA0O01230"
                     /locus_tag="TPHA_0O01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688478.1"
                     /db_xref="GeneID:11530694"
     CDS             244313..245854
                     /gene="TPHA0O01230"
                     /locus_tag="TPHA_0O01230"
                     /inference="similar to DNA sequence:INSDC:YFR028C"
                     /note="similar to Saccharomyces cerevisiae CDC14
                     (YFR028C); ancestral locus Anc_1.349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688526.1"
                     /db_xref="GeneID:11530694"
                     /db_xref="GOA:G8C1R4"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:G8C1R4"
                     /translation="MRKNVYLDNTIEFLRGRVYLGAYDYTPDDTDDMVFFTVDGTIFY
                     NSFHLDFGPMNIGHLYRFAVIFHEILNDVENAKKSVIFYSSTSTRARANAACMLCCYM
                     ILVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVIYGVWRAKEKSLIDLQ
                     AFNLETYEKYERVENGDFNVLTPDFIAFASPQESNRIGAIQSSSPNKSHLNQPFRSVL
                     KFFKSSNVQLVVRLNSHLYNKQHFEDIGIQHLDMIFEDGTCPDLSIVKNFVGAAETII
                     NKGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYL
                     NQNTFREWKYTMRLSLEPKEVIGGLYPLIGMEEYRLQKKKVKESKKNTHVKAFENDDS
                     EMRDLVMTPPSAKDKKVGKEEYSNPSFQIAAVPQNSPGQPRKGQNGTNTIEDINKQNA
                     IQNNSEKGTRTPGMGDDTNNSDEDMDRSAEDVLKQLLPKNRRIASGKRTPSAGVRKVS
                     GTTKK"
     gene            complement(<246121..>246954)
                     /gene="TPHA0O01240"
                     /locus_tag="TPHA_0O01240"
                     /db_xref="GeneID:11530598"
     mRNA            complement(<246121..>246954)
                     /gene="TPHA0O01240"
                     /locus_tag="TPHA_0O01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688479.1"
                     /db_xref="GeneID:11530598"
     CDS             complement(246121..246954)
                     /gene="TPHA0O01240"
                     /locus_tag="TPHA_0O01240"
                     /inference="similar to DNA sequence:INSDC:YFR027W"
                     /note="similar to Saccharomyces cerevisiae ECO1 (YFR027W);
                     ancestral locus Anc_1.350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688527.1"
                     /db_xref="GeneID:11530598"
                     /db_xref="GOA:G8C1R5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR028005"
                     /db_xref="InterPro:IPR028009"
                     /db_xref="UniProtKB/TrEMBL:G8C1R5"
                     /translation="MKNLGSSSKSKINPKSVVKNNNKYVQSRLQFNSNKTSRKSNLTK
                     CEKCGMLYSINSIPDIDSHKTYHTMHLSGHKWAKTWGSYIEGPKLIDQKITPPTSSST
                     SNDSTYTSDLQSKNEYVVVVRPQFPKEVKAASELMSVVNDELNAPHNENDFWATVDGK
                     GKLFLYIKDDRAVGAISVEPIDSTRSRWMVYENKSIIDHIRPHFKVGISRIWVCKEHR
                     SQGIAVKLLEAARTNMNPSRTMQRWELAWSQPTESGGKLASKYNGMKHKSGKLLIPCY
                     I"
     gene            <248012..>249433
                     /gene="TPHA0O01250"
                     /locus_tag="TPHA_0O01250"
                     /db_xref="GeneID:11530599"
     mRNA            <248012..>249433
                     /gene="TPHA0O01250"
                     /locus_tag="TPHA_0O01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688480.1"
                     /db_xref="GeneID:11530599"
     CDS             248012..249433
                     /gene="TPHA0O01250"
                     /locus_tag="TPHA_0O01250"
                     /inference="similar to DNA sequence:INSDC:YNL011C"
                     /note="similar to Saccharomyces cerevisiae YNL011C;
                     ancestral locus Anc_1.394"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688528.1"
                     /db_xref="GeneID:11530599"
                     /db_xref="InterPro:IPR002882"
                     /db_xref="UniProtKB/TrEMBL:G8C1R6"
                     /translation="MNVVVFSGGTATNSLTPCFNKICLKGSDSDRELNEGTDSNSEQY
                     GNLTYVLPISDNGGSTSEILRVFGGPALGDIRSRIVRLINDEDLKYVFSYRLSKDEQK
                     AKKEWNSIVEGEHDLWSSISPVLKELVRSFLISIHTEILKRARSSSNSFNFSKASIGN
                     LFLLAARTFIGGSLDSSIELMMRIGYCNTHLNVIPCINTIHTYHISALLDDGQIIIGQ
                     SQISHPSKTPKTLLTPQASLYMSNPKSNHLVKSDSSSTTTYTSANEENTQEDYGNPLY
                     ILPELRNSQLHFDKSQEDDKLDAKISKIFYINPYGEEVRPVGNERVKQKIHDADMVVY
                     SIGSLMTSLMPIIILGNIAETLYQSSSKKIKKVLLINNKYDRETYGLSGYEYIKFIVD
                     SMKEAVMYQNSRKSEQLDLSILSENKSWKCFITDIVYLSEGDIKINPLEFKDHEIKFH
                     EIQSDILDNDSLANILLRVNADR"
     gene            250042..250114
                     /gene="TPHA0Otrna8A"
                     /locus_tag="TPHA_0Otrna8A"
                     /db_xref="GeneID:11530579"
     tRNA            250042..250114
                     /gene="TPHA0Otrna8A"
                     /locus_tag="TPHA_0Otrna8A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11530579"
     gene            <250335..>252413
                     /gene="TPHA0O01260"
                     /locus_tag="TPHA_0O01260"
                     /db_xref="GeneID:11530697"
     mRNA            <250335..>252413
                     /gene="TPHA0O01260"
                     /locus_tag="TPHA_0O01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688481.1"
                     /db_xref="GeneID:11530697"
     CDS             250335..252413
                     /gene="TPHA0O01260"
                     /locus_tag="TPHA_0O01260"
                     /inference="similar to DNA sequence:INSDC:YFR023W,YHR015W"
                     /note="similar to Saccharomyces cerevisiae PES4 (YFR023W)
                     and MIP6 (YHR015W); ancestral locus Anc_1.357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688529.1"
                     /db_xref="GeneID:11530697"
                     /db_xref="GOA:G8C1R7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8C1R7"
                     /translation="MVELTDNGRQVLNLISSNIERKPQCQQLSKLVTKNNVFSKSRTN
                     QMNENDELAVDMISSSSVSNGIIQKSDMFTKPKKKNITKKKVSLFVGNLPEHVTEEML
                     KEKFNDYKSIISIKVCRDSVSKRSLGYCYFNFEDSASAEDFTERYNYKVLFDNKEIKI
                     MPSLRNSFFRKNVGTNVFFCNLPLNDGLKNEEDAEREVKLTTRIFYETFRKYGKILSC
                     KLDYRKNIGFVYYEDDVSAKKAIKSFNNKIYFGKKILCGLHFDKNVRSNPDFEKKKQQ
                     LDSDIFIREELLTDEDAKDKSIVDQISSKSNDDVEDNDNIGYSITQKNKIEDDVSIAA
                     TVNGDSERRNDANNENKLKKVFPNSVFIKNLPIDTTDEEILNHFSSIGPLKSVFSSKV
                     NKFDSVWSIVTYKKIADACFSITHFNKTLFKDRIIQLAKAHSKDIKAGPAVKDYGIHT
                     GPENYNTVVFVNNISSQCDELFLTKLLNESNKTFEEVRFLKAKNDKDSFRMSCTINCH
                     TQAEATRIQEFLNKKVIFGNVVHANIRSKFVNNSYTPQFYQYSRRSHYPSNDIPKKYF
                     HYANPYYYQQYYHKNYYNNMLPYYYNHFYFKNIAIQNMNNNWVDIEQNEILNDLKDAV
                     KFYCRKINENSNLKDSDISCISEYIFNVFGRSDVNKLKETIMINPNGDDNEMLLEKIL
                     EASKCLGYDI"
     gene            complement(<252746..>254110)
                     /gene="TPHA0O01280"
                     /locus_tag="TPHA_0O01280"
                     /db_xref="GeneID:11530580"
     mRNA            complement(<252746..>254110)
                     /gene="TPHA0O01280"
                     /locus_tag="TPHA_0O01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688482.1"
                     /db_xref="GeneID:11530580"
     CDS             complement(252746..254110)
                     /gene="TPHA0O01280"
                     /locus_tag="TPHA_0O01280"
                     /inference="similar to DNA
                     sequence:INSDC:YFR024C-A,YHR016C"
                     /note="similar to Saccharomyces cerevisiae LSB3
                     (YFR024C-A) and YSC84 (YHR016C); ancestral locus
                     Anc_1.356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688530.1"
                     /db_xref="GeneID:11530580"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="UniProtKB/TrEMBL:G8C1R8"
                     /translation="MGINNPIPRSLKSETKKAAKVLSSFVKPNQVFGADQVIPPDVLR
                     RAKGLAIVTVLKAGFLFSGRAGSGVIVARLPDGSWSAPSAIAMAGGGAGGMVGIELTD
                     FVFILNTKQAVKSFSEFGTITLGGNVSVSAGPLGRSAEYAASASTKAVASVFAYSKSK
                     GLFAGVSVEGSAFIERREANRKFYGDKCTTKMILSGRIRPPPHADPLFRVLESRAFNY
                     RQRGYDDDYDERRDRDYDTDSFYNDIPDSFSSNDDYDYDPRGGSRSRAGSRARGGYDD
                     FDNSDSDDYYGSRNSRSNVAGSRYGRNDGYGSDSDDYDRNSTRDYYAENRRTPANRTS
                     SYGRPSSSRTNTRWEDEIYDNENNVDDVSNRFSRARISSNNNSANRERRASRSSYNDG
                     VSHAGPKAVALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANY
                     VELV"
     gene            complement(<254342..>254884)
                     /gene="TPHA0O01290"
                     /locus_tag="TPHA_0O01290"
                     /db_xref="GeneID:11530581"
     mRNA            complement(<254342..>254884)
                     /gene="TPHA0O01290"
                     /locus_tag="TPHA_0O01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688483.1"
                     /db_xref="GeneID:11530581"
     CDS             complement(254342..254884)
                     /gene="TPHA0O01290"
                     /locus_tag="TPHA_0O01290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688531.1"
                     /db_xref="GeneID:11530581"
                     /db_xref="UniProtKB/TrEMBL:G8C1R9"
                     /translation="MRCQQVRVRMKNNFSFFEGLDEFFEKEETEDGVAGDAVRSRWIA
                     CVRWRVARCHGRGHRQRQESRAAVRVALAVKGQEVRVSSPVRQRCSRWVVSGMYVCAC
                     PVDVGCRRCSIRNCLAMPRRCNCVHMRQVLVAGLLVCPLAIKGPHSLHRCYPLSLCLA
                     LPSIESVLSSIGEARHRYLQ"
     gene            <255176..>257257
                     /gene="TPHA0O01300"
                     /locus_tag="TPHA_0O01300"
                     /db_xref="GeneID:11530582"
     mRNA            <255176..>257257
                     /gene="TPHA0O01300"
                     /locus_tag="TPHA_0O01300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688484.1"
                     /db_xref="GeneID:11530582"
     CDS             255176..257257
                     /gene="TPHA0O01300"
                     /locus_tag="TPHA_0O01300"
                     /inference="similar to DNA sequence:INSDC:YHR020W"
                     /note="similar to Saccharomyces cerevisiae YHR020W;
                     ancestral locus Anc_1.352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688532.1"
                     /db_xref="GeneID:11530582"
                     /db_xref="GOA:G8C1S0"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:G8C1S0"
                     /translation="MASIVDSFKQLCISQDTDSPTAEVKSLVFKPKTPKSATPVPILV
                     VALAETKTPANLIASETNSKDPRLARDDVFKSFFNVDNGKLFNLSHLLNLSASSEIQI
                     LIDQELVNRKDSDLVFKLNDEIKITGANLVDGFLLNDSNGFHKFAKIVDFSKEVESPS
                     PQETAEAKKQQQKKKKEAAATAKIEDAKLIGITVDKALDFPGWYQQILTKGEMLDYYD
                     VSGCYILRPASYAIWEKIQEYFDAKIKKIGVKNAYFPMFVSSRVLEKEKDHIEGFAPE
                     VAWVTKAGSSDLEEPIAIRPTSETVMYPYYSKWIKSHRDLPLKLNQWNSVVRWEFKHP
                     QPFLRTREFLWQEGHTVFLTKEEAESEVLQILDFYAGVYEELLAVPVVKGKKTEKEKF
                     AGGEFTTTVEGYIPQTGRGIQGATSHHLGQNFSKMFNITVENPLGTEHPKVFAHQNSW
                     GLSTRVIGVMTMIHSDNKGLVIPPRVSQYQAVVIPLGITSKTSEEQRKAIHESAKKVE
                     ARLLESGIRIFGDYNDNYTPGWKFSQYELKGVPIRIEMGPKDIEQNHVTVVRRNDSKK
                     YTVPLDELEKRIPEILDELHDSLYSKAKESFDEHRVQVSEWKEFVPALNKKNVIVAPW
                     CGVMECEEDIKESSGKQDDGEEIEVDDKSPSMGAKSLCIPFEQPELKPGQKCIKCDRE
                     AVNFTMFGRSY"
     gene            complement(257556..257628)
                     /gene="TPHA0Otrna9A"
                     /locus_tag="TPHA_0Otrna9A"
                     /db_xref="GeneID:11530583"
     tRNA            complement(257556..257628)
                     /gene="TPHA0Otrna9A"
                     /locus_tag="TPHA_0Otrna9A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:11530583"
     gene            complement(<258745..>260061)
                     /gene="TPHA0O01310"
                     /locus_tag="TPHA_0O01310"
                     /db_xref="GeneID:11530699"
     mRNA            complement(<258745..>260061)
                     /gene="TPHA0O01310"
                     /locus_tag="TPHA_0O01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688485.1"
                     /db_xref="GeneID:11530699"
     CDS             complement(258745..260061)
                     /gene="TPHA0O01310"
                     /locus_tag="TPHA_0O01310"
                     /inference="similar to DNA sequence:INSDC:YGR110W"
                     /note="similar to Saccharomyces cerevisiae YGR110W;
                     ancestral locus Anc_3.454"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688533.1"
                     /db_xref="GeneID:11530699"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8C1S1"
                     /translation="MHRYLKELLDNLRTIKLREKVIDFSGSNLNLIEKPSRLTSPSIP
                     NAAAAPTASTAPTALSLFELIKQFPRLFPRSFMKSFQDYKQFHSDVENFQVRLLETLP
                     YFPDPSNGIYSKITNTIVDDEGSSINEFVVYPSNISVPSEKLKHLIFVHGYGAGLGFF
                     LKNLENIKLLNDEWCVHAIDLPGYGFSTRAKFPFQVGKHRHDQVNEWFHSRIRNWMHQ
                     RNLLQHSQNNFLIAHSLGAYLMALYVDKHPNDLQKILMCSPAGIGDSMNLKKKTPAWW
                     FEKLWERNISPFTLVRSSSYIGSKLTSGWTYRRFSSLLSQNNLKQFEALHKYTYSIFN
                     QRGSGEYLLNFALKCGGGPRYPLEKTLFMNNDKGISKSSTEWIWAYGDNDWMDKNGGI
                     RVSEILTKQLKKRSEVYIVPRAGHHLYFDNHQFFNDLILKEMECMK"
     gene            complement(<260525..>261832)
                     /gene="TPHA0O01320"
                     /locus_tag="TPHA_0O01320"
                     /db_xref="GeneID:11530667"
     mRNA            complement(<260525..>261832)
                     /gene="TPHA0O01320"
                     /locus_tag="TPHA_0O01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688486.1"
                     /db_xref="GeneID:11530667"
     CDS             complement(260525..261832)
                     /gene="TPHA0O01320"
                     /locus_tag="TPHA_0O01320"
                     /inference="similar to DNA sequence:INSDC:YJL046W"
                     /note="similar to Saccharomyces cerevisiae YJL046W;
                     ancestral locus Anc_1.347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688534.1"
                     /db_xref="GeneID:11530667"
                     /db_xref="GOA:G8C1S2"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004562"
                     /db_xref="UniProtKB/TrEMBL:G8C1S2"
                     /translation="MCSILSQIIRRTVSSQLISIPPRNIKLRWLHSSKVLCKITPFDI
                     DATADLNDEFNELNSMYTSMFSKSNSNNKDVHKVKTENSLVDDINELNDELNELCSPY
                     DTRCGSQNVPKISGDDLKTLVENSGRFIMISLSNNPYFNLALEDYIYNNSGKASSITK
                     SDNRNSFVNSERLMFYINDKCAVIGKNQTIWKELFMKNLYDNGYQVLRRFSGGGAVIH
                     DLGNVNYSFLTSREDFRREFFNENIVKWLREQNPKLNINLNERGDITLDGYKVSGSAF
                     KIGRGKSYHHGTMLINSRIDKFKGLLKPDELPNVKWNCNSINSVRSEITNLPLTSTKQ
                     FIDICIDGYKTHFQDSNIPVLYCDESDTMNIEIRKVMNKLMSYEWKATTGPPFEVQIN
                     TIDTQLTLTVEKGIIIKSTIPIFIGMPFQEFSRLSKALLQTDV"
     gene            <262193..>263053
                     /gene="TPHA0O01330"
                     /locus_tag="TPHA_0O01330"
                     /db_xref="GeneID:11530668"
     mRNA            <262193..>263053
                     /gene="TPHA0O01330"
                     /locus_tag="TPHA_0O01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688487.1"
                     /db_xref="GeneID:11530668"
     CDS             262193..263053
                     /gene="TPHA0O01330"
                     /locus_tag="TPHA_0O01330"
                     /inference="similar to DNA sequence:INSDC:YBR257W"
                     /note="similar to Saccharomyces cerevisiae POP4 (YBR257W);
                     ancestral locus Anc_1.346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688535.1"
                     /db_xref="GeneID:11530668"
                     /db_xref="GOA:G8C1S3"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:G8C1S3"
                     /translation="MDRAQTFVKECLLSRNFDNPNKPIEEGRLQETLLLLPTDGGITS
                     NLKKNKSKQKLTIENIHTHASKDHGEYKQDNYRTIKKNARVELHDYIKRCRKAVVNAK
                     RSISAYEHDNKKRLEGKEMVKEYLQNNEAHIWEALPKYDTFLPMYEELWLSYIKDLLN
                     INFDMETSEKVNVNGSSALLKLSMADYNGASLKVIRSRNANMIGIEGIIVWDGQQSFI
                     MICKGTEVDELKIIPKKGTAFAFEIPLTKDTALQYTIIGDRLNYRSYDRAGRKFKSRR
                     CDDLLYLINK"
     gene            <263505..>265889
                     /gene="TPHA0O01340"
                     /locus_tag="TPHA_0O01340"
                     /db_xref="GeneID:11530669"
     mRNA            <263505..>265889
                     /gene="TPHA0O01340"
                     /locus_tag="TPHA_0O01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688488.1"
                     /db_xref="GeneID:11530669"
     CDS             263505..265889
                     /gene="TPHA0O01340"
                     /locus_tag="TPHA_0O01340"
                     /inference="similar to DNA sequence:INSDC:YJL047C"
                     /note="similar to Saccharomyces cerevisiae RTT101
                     (YJL047C); ancestral locus Anc_1.343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688536.1"
                     /db_xref="GeneID:11530669"
                     /db_xref="GOA:G8C1S4"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:G8C1S4"
                     /translation="MQSEDILVDLEQIDTSGSSNASNLTPLYGKNHIYENELTKLKNI
                     LRSSEHTMSPNTISSLLYRLCSFKLYEPLVIQIEKEKENEGEDLSESKRLKKLRLVKQ
                     HSVIQTVWTTVVNELKHYSSTITSSLDNMRNTIDDENLDSVYHNIIQIFKMLMDYYEN
                     VKDIIKFFHFNYPTVIQDEFPLQLDELEYYQNIALAPLFLEHGDKVRTGFTKWFLSAN
                     SAANFQYSKLQLEFMKYLYRSNPILQGEPFTECLNTCILSFANEIINDIQNNQDDSTN
                     GLNIIITGLKKLVLICWPLGKDIIPIVTEFYIENTLLKEYTAASIIRRCVENCDIKDS
                     GDQIIYKTILECFLDRDLEDLLKDEISYAFEDSLKYIFESVKNYSSIKYFIMAVKYIN
                     FISNSTIETEKVKFSSFSRIIRESIFNFLGGDIKVVEKYQKLISLRMKGLSTTHFQLA
                     SEDMDTLLCKIPYFLQFDKSFLLDHSNYLFRRIVMSGPRTLNDLSQNSFEHNLLKTYD
                     EIYQHNDDATGFLNFSLDMRGACSMANEYMNLHGEEIDLALVPMVFAKKSVPKIFQNT
                     NIDQDIIIPDRFKESWNTFSSFYKAKDKNEYKTLHQMYSLHHCEVETFYKLPNGENLT
                     FQLTLYQTLILEKFNELDELTVNHIRITLNMTVDTVLIILQSFLNIHLIKASDKDTYI
                     LNNNYSPDLKKVKNSRLRIQLPKTTSSINQKDTHKLKTLKNREGNLSLWKLELIKAAI
                     VRTVKTHPDRLQFDELIDIVNKQVHDYSVGEFKDALYKTVLDGAIRQEEHYYIY"
     gene            complement(<265993..>268545)
                     /gene="TPHA0O01350"
                     /locus_tag="TPHA_0O01350"
                     /db_xref="GeneID:11530670"
     mRNA            complement(<265993..>268545)
                     /gene="TPHA0O01350"
                     /locus_tag="TPHA_0O01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688489.1"
                     /db_xref="GeneID:11530670"
     CDS             complement(265993..268545)
                     /gene="TPHA0O01350"
                     /locus_tag="TPHA_0O01350"
                     /inference="similar to DNA sequence:INSDC:YBR260C"
                     /note="similar to Saccharomyces cerevisiae RGD1 (YBR260C);
                     ancestral locus Anc_1.342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688537.1"
                     /db_xref="GeneID:11530670"
                     /db_xref="GOA:G8C1S5"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8C1S5"
                     /translation="MADLLDTKTNKIASLDFNDDEMFQDNQLKIFLNSDVSVNVLLSF
                     FKNSIINCEFLIKCIRRKINAEKSYLNDLVKEYKHIQSDCNGISTSTNGKSKLTNSIL
                     EFFKFDNYIIRVRENYINELNNVFVELSNLLSVMMKYRKFFKDKIKVLEKNINEAVTV
                     SEKSKRTYVSLCLDYERFKISKSNGHLDNDPLKMKLSIRGSKTPKEHEAELLKKIENA
                     DNDYKEKVKYSTNLRSNLIEIERPDIVNNLISIILEFENVMTATLTKMALLNEKLIVN
                     MGLIISPIDNKKFMSLKTCSENIKPKTNLVNFLYKIIESKIYSNNYVNNDLVPLIYSK
                     HPIMQSYEKKLKKSVSNAKLNPANSRSRSNSASSVKHNNSASLSFVVDPSRNSIPKGL
                     ISTHNESPFALSTQPSMMSLNSNSIFETPAKVPSVPVDVSVPLPKSKNLHKISAKQLP
                     KTPNEVVASNTSNNNSQDFPTLDPGKSRNTTAVRIPSLKTIDSDNVSIYSRVRPSPSI
                     KVATNTNKTDNIIYDNEAKNDTASENTDHNEGINDKESTSDDNKVSDADMEVSPEKSD
                     KSEEANEPENDLPSNKETESLNTDKISSPAHTEKFQEESNVLEETTKNNGDQLIDKED
                     TVSGISSIADTTGNIYNSYKDANSNTLPIFGTSLSDLFNLEQGTVPTIVRQCIHVIEK
                     YGLELEGIYRDFRETDNLELLMAEINTSPDKITSLIPPPNHTDTDIYLIATLLKTFFA
                     KLSEPLITPDAIEGLNVCLSIDNKKTQIDYMHGIIYNFDDAQYWTLRSLLFHLKNVVK
                     NENKNNMNLKAISIIWGPLILPKNETDINDFDYHYKLIKILFDTADQAFETN"
     gene            complement(<269831..>270526)
                     /gene="TPHA0O01360"
                     /locus_tag="TPHA_0O01360"
                     /db_xref="GeneID:11530671"
     mRNA            complement(<269831..>270526)
                     /gene="TPHA0O01360"
                     /locus_tag="TPHA_0O01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688490.1"
                     /db_xref="GeneID:11530671"
     CDS             complement(269831..270526)
                     /gene="TPHA0O01360"
                     /locus_tag="TPHA_0O01360"
                     /inference="similar to DNA sequence:INSDC:YBR261C"
                     /note="similar to Saccharomyces cerevisiae YBR261C;
                     ancestral locus Anc_1.341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688538.1"
                     /db_xref="GeneID:11530671"
                     /db_xref="GOA:G8C1S6"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8C1S6"
                     /translation="MADKEINYDDAIKYWTDTPATVDGVLGGYGEETIVPTMDVLGSN
                     HFLRKLKSRMVVSPGHSRVAIDVGAGIGRITKTLLHKHCDEIDLLEPVKPFVAQMRVE
                     LDEEIASGKVKNIFDIGMQDFTPETGRYWLIWCQWCVGHLPDAELVQFFKRCKEGLQP
                     NGTIIVKENNTNNIEYTDEFDSTDSSVTRSDKKFKEIFEQSGLKLIASDLQRGLPKEL
                     YPVRMYALKPMEE"
     gene            <270983..>272443
                     /gene="TPHA0O01370"
                     /locus_tag="TPHA_0O01370"
                     /db_xref="GeneID:11530584"
     mRNA            <270983..>272443
                     /gene="TPHA0O01370"
                     /locus_tag="TPHA_0O01370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688491.1"
                     /db_xref="GeneID:11530584"
     CDS             270983..272443
                     /gene="TPHA0O01370"
                     /locus_tag="TPHA_0O01370"
                     /inference="similar to DNA sequence:INSDC:YBR263W"
                     /note="similar to Saccharomyces cerevisiae SHM1 (YBR263W);
                     ancestral locus Anc_1.339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688539.1"
                     /db_xref="GeneID:11530584"
                     /db_xref="GOA:G8C1S7"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G8C1S7"
                     /translation="MLKLPARNIRCYATKANNAYQQALLSKHVDQTDPEMYAILQAER
                     KRQKHSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPNERYYGGNQFIDKAESLCQKR
                     ALDLYQLDPEKWGVNVQPLSGAPANLYTYSAIMNIGDRLMGLDLPHGGHLSHGYQLPS
                     GTKISFVSKYFQTMPYHIDPSTGLIDYEELSMTSKLFRPKIIIAGTSAYSRILDYKRF
                     REITNACNAYLVSDMAHISGLVAAGVTDSPFEHSDIVTTTTHKSLRGPRGAMIFYRKN
                     LRKVTKQGKEIHYDLDKKINFSVFPGHQGGPHNHTISALAVALGQAAKPEFKQYQQNV
                     VANAKAFSDELIKRGFNLVSGGTDNHLILINLSNLGIDGARLETILESINIAANKNTI
                     AGDKSALFPSGLRVGTPAMTTRGFDKSDFAKVAEYIYKAVKLAISLKSQESATATTAR
                     ARLIDFKKLCKESTAVKQLADEVYTWVGQYPIPGEL"
     gene            <273056..>277456
                     /gene="TPHA0O01380"
                     /locus_tag="TPHA_0O01380"
                     /db_xref="GeneID:11530585"
     mRNA            <273056..>277456
                     /gene="TPHA0O01380"
                     /locus_tag="TPHA_0O01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688492.1"
                     /db_xref="GeneID:11530585"
     CDS             273056..277456
                     /gene="TPHA0O01380"
                     /locus_tag="TPHA_0O01380"
                     /inference="similar to DNA sequence:INSDC:YBR275C"
                     /note="similar to Saccharomyces cerevisiae RIF1 (YBR275C);
                     ancestral locus Anc_1.337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688540.1"
                     /db_xref="GeneID:11530585"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:G8C1S8"
                     /translation="MIEGSPIANTVTKSKALDLLERQLTDRAKRNSPLQHQRTKSISP
                     IKRFNYGNDDSMAMKSPTAKKRKVNNNNESLVLVDPISNKEDIMQTKLELQKVELMQP
                     VLYKIKPAVDIVESSKNKSVAFSDQIELSPSNFNINSSPKLLGSASKPSKSILRNSQT
                     ENDQTINKLNFTNNTELNFTLYKLSNNPFDLKFWVKGEIHSLRNINDIQEYKDIIDGG
                     IHILKGTDDINKARKFEIYATFNNIIPIVTSKTMNDIIDHKIDYLLKSLSILLDLAIE
                     DIKIVQTSLLSSSDKKNPFITRLYVQMVRFLGNIASNFRIVKWLDENPASLKTLKDFY
                     QLSLAVLTHENSNKLIITAQITFLKDEKFSSYYLDKNEINAVIDAIIHIKEIPSTNLT
                     CEKLLLIKQLISKHPTLMISNSLKWLPQEVIYRILVEKEPYTLKVLSTTISVLLDLLK
                     RCMDNPKGHNEVYECVNVQPVKKCLPKQYFDQLQTVYPTLTDTSTIGELLQEYTLYLI
                     EVEGEFKLAMDLWLSMVALLYNNPTKLPLLLLSEKDSKWLHINKDVIKSTHEGRLHAI
                     KSWRVVTYIAFTNFKKITDVNKPVMLRLLRMPLMHITGSNCNATSETGFLYHLTGIIF
                     TFCSVSKSLSNRDFDLIWTDLIKPIYDSIYSQNFTSSFIEYSSALLQNAFDINKREKI
                     GYRDVHPVKVIASIGVSPNNIAPLSLGHIKASFVEITDLLINITINNPFDYENNLQTL
                     NNILKNIPERFYSQYDMLNKYKSVLKVIIEGNKLKKCTLVIESYLIQLILSFKKLLFL
                     DKPEILIDILSIVTEKFQNSPELVMNITKALFKDRKSSISEYTVAKIILSLNDEISTL
                     YITNWIGSTLIPKNINQIDFVSILQILNKVATKPVISNVLDLCGRMEMPPDLSAVIDF
                     SHWSEDCVEYFIKIYTSKFPENTVTLLMPTILNYIATNEAFFGNLVRHLYDNNSYQLI
                     KDILEKNPSYVVHLENIISADTKNLLTPMNFNYYVINLTNYSSSLSQYLIRCIFDSNA
                     PRQNKAAFVEYILPSSQTKSLDDQKNIAIVTLFNYYCENKNWEKLNDLLLLILERKHI
                     NLLSVTLNSQLKGCMEYLTPMTLVTIAIKCQIMKKEIFEIIKSSFENKEYSFNCDLIF
                     NLLKEKKYQLFTSIIDEFCKFLTVKQLSRSTEEQDAAISLFNSFLDLLLRQGMKKVDA
                     CINSLLIHMDRNKNDHYIKISKSILTNPLFMSRRLRNTKCHKILSAKLEFWFDPTAGT
                     IVESISTISEKIPNIPLVSFKLNTAKNTSSVVNGITDLHNAKLLHSDRFEEESTQREF
                     SPIKLNFDNSKVNNSRTEFVTSTQSISYNEVQVQATQDQRNTIESTQIPVFSSIIENP
                     TSKRISSQIKKSDISNNDIDGDSELPEVDDADISIIETIKFPIFNSKRNIRNPSNMSS
                     DVLLSEDYTERPQKKELQSSEKKNLLIVRY"
     gene            complement(<277678..>279258)
                     /gene="TPHA0O01400"
                     /locus_tag="TPHA_0O01400"
                     /db_xref="GeneID:11530586"
     mRNA            complement(<277678..>279258)
                     /gene="TPHA0O01400"
                     /locus_tag="TPHA_0O01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688493.1"
                     /db_xref="GeneID:11530586"
     CDS             complement(277678..279258)
                     /gene="TPHA0O01400"
                     /locus_tag="TPHA_0O01400"
                     /inference="similar to DNA sequence:INSDC:YBR274W"
                     /note="similar to Saccharomyces cerevisiae CHK1 (YBR274W);
                     ancestral locus Anc_1.336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688541.1"
                     /db_xref="GeneID:11530586"
                     /db_xref="GOA:G8C1S9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:G8C1S9"
                     /translation="MNFSQISTLPKIKDVELNETIGNGAFACVKTAYLKADPSVIFAV
                     KFVHIPTCTQQGLTEKDITKEVVLQSKCSDHPNVLKIIDCNISTDFMWIIMELAEGGD
                     LFDKIEPDVGVDSSVAQFYFQQLVNAVVYLHTECGVSHRDIKPENILLDNNGNLKLAD
                     FGLASQFKRKDGSLRISTDQKGSPPYMAPEVLHSSQYFADKTDIWSIGVLLFVLLTGE
                     IPWEAPLLEDSNFQYFIEHNGNITLGPWSKIDLNQLNLLRKILQPNPDNRISLEMIKK
                     HPWFTTKVPFAGSDGLCNDPSQLAKRLYLNLKVSLSDDDYLRSTQDPGSYGRSNAGFR
                     ATQPVGDDYADIEHDPLATDHNMSTQLAFTQYNHNRITDKYAHNEQNWTQLLSNDLAL
                     LQFSDKSLDGSLSTNLRFDHTKLTKFYSLANMEEIISTLEEALRFSNIKVKPNLYDNF
                     LKLSSSMGAASVFPVTINIKTDDFTGLLLSGVISINKVQEDLKIISINRKSGDPLEWR
                     RLFKKLALLCRNLVFIPN"
     gene            <279713..>281161
                     /gene="TPHA0O01410"
                     /locus_tag="TPHA_0O01410"
                     /db_xref="GeneID:11530587"
     mRNA            <279713..>281161
                     /gene="TPHA0O01410"
                     /locus_tag="TPHA_0O01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688494.1"
                     /db_xref="GeneID:11530587"
     CDS             279713..281161
                     /gene="TPHA0O01410"
                     /locus_tag="TPHA_0O01410"
                     /inference="similar to DNA sequence:INSDC:YBR272C"
                     /note="similar to Saccharomyces cerevisiae HSM3 (YBR272C);
                     ancestral locus Anc_1.333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688542.1"
                     /db_xref="GeneID:11530587"
                     /db_xref="UniProtKB/TrEMBL:G8C1T0"
                     /translation="MTEASETNTVVNIINETYIALETNPLPTNINSLLEKCLTNIRYL
                     SSSPVNLDPLLRSIKALLLDKEEYLFLDDQLMIEVMDHILKIAPFDLVLNVFTMKDIE
                     SALISNNTSLIKSALKVIELSSPKSIFASSPLFDLVLKLYFYEETDLDIINKIENLFR
                     SLSSDELVANKILVNNKPVLLSIKKGAALINYSRMLELLSIFVVHINQATFDEELFII
                     TPEEIASLVDKDILFFIQIINYYSKLLDDLLIDDFTRESKDWIYQYLEPIFNVLGQYY
                     KKRDEYVEIKLFTLSYLFQIFRKVSYWNYENCFNLLDKHYLELNYQNEHIIDFLSFVN
                     PKYLYEYHSEIIKEYADIKPSRLSILRNLVSNEKSFNLIKDNFTAEDILKMPYMEQMV
                     LLERMSQYKYCVKYILHTMPTILGNLVNFNGLHIIETETVELREQTIDNLIHFDVDLL
                     GTWYAPLVDELNKIKYHGIVKEVQPKVESMYL"
     gene            complement(<281318..>284545)
                     /gene="TPHA0O01420"
                     /locus_tag="TPHA_0O01420"
                     /db_xref="GeneID:11530588"
     mRNA            complement(<281318..>284545)
                     /gene="TPHA0O01420"
                     /locus_tag="TPHA_0O01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688495.1"
                     /db_xref="GeneID:11530588"
     CDS             complement(281318..284545)
                     /gene="TPHA0O01420"
                     /locus_tag="TPHA_0O01420"
                     /inference="similar to DNA sequence:INSDC:YJL050W"
                     /note="similar to Saccharomyces cerevisiae MTR4 (YJL050W);
                     ancestral locus Anc_1.332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688543.1"
                     /db_xref="GeneID:11530588"
                     /db_xref="GOA:G8C1T1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011254"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1T1"
                     /translation="MSNLFDVFDEDGNDIADIQIEELEEVDNNAVEDVETATQKRGLD
                     SEEESEGSKDDDEDNSGKKLKHGDKLINEKKNTVVIPVVTDTFEQEESREVDVSTGLT
                     NAATTQVEDDGKVKLKHQVRHQVALPPNYDYKPIGQHKRVNQARTYPFTLDPFQDTAI
                     SCIDRGESVLVSAHTSAGKTVVAEYAIAQSLRDKQRVIYTSPIKALSNQKYRELSAEF
                     GDVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVVFDEVHYMRDKERGV
                     VWEETIILLPDKVRYVFLSATIPNSMEFAEWICKIHSQPCHIVYTDFRPTPLQHYLFP
                     AHGDGIYLVVDEKSTFREENFQKAMASISNGAGDDPNSAVAKGKKGQSFKGGASKGDA
                     KGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSEDEKDALSKIFNNAI
                     ALLPENDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFS
                     IGLNMPAKTVVFTSVRKWDGKQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKME
                     PQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFYQFQNVISVPIME
                     KTYLELEKKADEIYIEDEENIREYYDIRKTLDGYNEDLRHVITHPANLLSFLQPGRLI
                     NVNIGGEQDYGWAVVIDFVKRVNKRDTSVVYSDHESYIVNVVVNTMYSNAPVNIIKPF
                     NPVLPEGIRPIVKGEQPICAIIPITLESIKSVGNLRLFMPKDIKASGQKETVAKSLNE
                     VKRRFPDGVPLIDPVKNMKIEDEDFKTLLKKIVVLEEKLYSNPLANSVRLSELYDKFS
                     IKFALHEDMKKLKKKINESQAVIQLDDLRRRKRVLRRLGFSTPSDIIELKGRVACEIS
                     SGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREVA
                     SKIAKVMKDSKIEVIEKEYVESFRHELMEVVYEWCKGATFTQICKMTDVYEGSLIRMF
                     KRLEELVNELVNVARTIGNSALEEKMETIVKLIHRDIVSAGSLYL"
     gene            complement(<285029..>287737)
                     /gene="TPHA0O01430"
                     /locus_tag="TPHA_0O01430"
                     /db_xref="GeneID:11530700"
     mRNA            complement(<285029..>287737)
                     /gene="TPHA0O01430"
                     /locus_tag="TPHA_0O01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688496.1"
                     /db_xref="GeneID:11530700"
     CDS             complement(285029..287737)
                     /gene="TPHA0O01430"
                     /locus_tag="TPHA_0O01430"
                     /inference="similar to DNA sequence:INSDC:YJL051W"
                     /note="similar to Saccharomyces cerevisiae YJL051W;
                     ancestral locus Anc_1.331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688544.1"
                     /db_xref="GeneID:11530700"
                     /db_xref="UniProtKB/TrEMBL:G8C1T2"
                     /translation="MHQRTIAAVVSILSSLLSIALGAVAVSLAKKYDPNRCVLIIIAC
                     SSIIYGITNIFDILSTIQRSKRINKYFSFNRELFLLLQLLILGSAVEFFNNSLKNLIT
                     NDSSYLTNSLEQRLYIGFSELLIFSLFINGINIGSLNAVKSFCTRKEGEDKGVITPDY
                     EKIYNHDQQAYKPSIPLKISSQTLTPDMDLANFGENNNIGSNYDVKNLRNGKQINLDA
                     NYNIIPAQSGINTRESSGNLSFPSVLRTKLSSSHLKPQKNLNEPSKIEEASEVSRKDK
                     TKNFCSSFFISTSKILKGSKNYDATQAQKTSMIHSNLVQNKISKSNKNFKYFSKLSAI
                     SDMQRDMLSKYTSTDSVNKNAETNEKSDTNSYLTEKKRMSSLILESNVNMNRADKFLD
                     ECNPVALEKEAKIEVERQALKRINSALLPPILSPCEAPVLQQQGFIPGLIPELLESAS
                     NKLQTVDEINSPENFVHDHHYDNFSFDDKILEDNDLQSISQIPMFPEEPVPTQKDYKQ
                     FNLSVENLPGNVTLDMWNSDKSKFMKRAETLQDNLLLPAFNFSKQELIELDDDNSNSS
                     ILDNSHFHFPKTALGHKMNLTQIDLPYENYDTISQLDEYLTDLNDKDNNDESQLLENG
                     LNQNLSSSNITEICSKDLSRINTRHSPTKSIISIISSGTGIHHRQKSHAGSGMGSISH
                     NRGNSQMSNYLNSQNNFSTMLSPPTSPTRNKTFKRLGKKLSISNLSDSLSPIHSTEMT
                     FTESMKTSNNDSNFGKLMFSGHKKRGKSLDFSYLHSLQNNGSPTKSPFNGVSQKGSIT
                     ENRRNSAFAEKNLRTVSSLFYHQENSNTSPYLSDKRKQLTINTDLRAFDDQPLFTLRS
                     TSYYSDEQKSTTSNTEYPQTLTSQYDQEKWNSSHNLMTKSDINVAL"
     gene            <289051..>291387
                     /gene="TPHA0O01440"
                     /locus_tag="TPHA_0O01440"
                     /db_xref="GeneID:11530701"
     mRNA            <289051..>291387
                     /gene="TPHA0O01440"
                     /locus_tag="TPHA_0O01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688497.1"
                     /db_xref="GeneID:11530701"
     CDS             289051..291387
                     /gene="TPHA0O01440"
                     /locus_tag="TPHA_0O01440"
                     /inference="similar to DNA sequence:INSDC:YJL056C"
                     /note="similar to Saccharomyces cerevisiae ZAP1 (YJL056C);
                     ancestral locus Anc_1.326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688545.1"
                     /db_xref="GeneID:11530701"
                     /db_xref="GOA:G8C1T3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8C1T3"
                     /translation="MKDLVMAGNGVLHGHIHKLNNLTYIHGHIHHTKENDVKAESDYY
                     SNDNNTETTGIERSSSDIEGANTRVDTINSFLEEDNGVCGLNKNFIDCKHFEFINYDT
                     EYSKLNNINNSTVNSNWASQLFNDQLVMPPNKRRKFEEIKEEEDTSMKMCNDCNPKVL
                     EVCCEFEHNKTENLRDNSLNPTDFIESRNHDSVNGKSIKREKSMGSNNLDLDIYTESL
                     NLLNKDKLDPFFDTRSINDFNADNHLIKQKTMENISIPDLSCNLTCETACTFQNKNDA
                     YNNNVYLDTTKVRENYEELYPNITKPLGSTDLHKKDCHDHIVNSEADLKILQDLCDIS
                     SIYSLPFTKHSMHDSENDHHQYEHTKEELENHYHSSHHEHHHHFVNFHSHSLLKEGRN
                     DLIENNNGIRSQYNNFRQINQFLPGKPQNKDHLSYERLKSWPNAVNPSTFHHHVQNYN
                     LQPNDDSESDIINSDTIKTASELSTIDFNWNFNTPSESKYYSIQCKWNNCGETFASLV
                     DLQKHLIYEHVSKEDYQNISLDKDEVICNWKDCEFEGEDICSLLSHINRKHGINFDMK
                     FINLYDTEDKKKNKGNSNSPNSLNIPTPTSTSIEYSSPNGKNDSLCKWDKCGKLFENE
                     EMLNNHVEKTHLLSRQSEYYCKWENCDRRFTQKQKLVRHLRVHTHYKPFTCKTCGKNF
                     SNQEILIQHQRVHSGEKPYKCDMCGNSFSSASSLKVHKRTHTGEKPLSCNVCGKRFNS
                     SSNLSKHVKTHKKQYKCPKCLKSYDSEVKLISHAKRCK"
     gene            complement(<291591..>292922)
                     /gene="TPHA0O01450"
                     /locus_tag="TPHA_0O01450"
                     /db_xref="GeneID:11530702"
     mRNA            complement(<291591..>292922)
                     /gene="TPHA0O01450"
                     /locus_tag="TPHA_0O01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688498.1"
                     /db_xref="GeneID:11530702"
     CDS             complement(291591..292922)
                     /gene="TPHA0O01450"
                     /locus_tag="TPHA_0O01450"
                     /inference="similar to DNA sequence:INSDC:YJL060W"
                     /note="similar to Saccharomyces cerevisiae BNA3 (YJL060W);
                     ancestral locus Anc_1.321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688546.1"
                     /db_xref="GeneID:11530702"
                     /db_xref="GOA:G8C1T4"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8C1T4"
                     /translation="MSLRFARSLKTMTTSKLNFTPNNYFTQNNFKDVWSLTNETAALA
                     STNSKNKDRGLVNLGQGFFSYSPPKFAIEALQKAVEEPLVNQYSPTRGRPTLIKSLTD
                     LYSPLYKLTLKPENVLVTTGANEGILACLMGILNQNDEVIVFEPFFDQYIPNIELCGG
                     KVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITNKTKAIIINTPHNPIGKVFTREE
                     LKRIGDICVKHNVIIISDEVYDNLYFVDEFTRIATLSPEIGQLTLSVGSAGKTFAATG
                     WRIGWVVSLNPELLNFASKAHTRICFASPSPIQEACAESINIALRNGYFENMRNEYVK
                     KYKIFTSVFDELGLPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINKGKDFRISNWLI
                     NELGVVAIPPTEFYIKEHEKAAENLLRFAVCKDDEYLERAVERLRLLKAYI"
     gene            complement(<293395..>295560)
                     /gene="TPHA0O01460"
                     /locus_tag="TPHA_0O01460"
                     /db_xref="GeneID:11530703"
     mRNA            complement(<293395..>295560)
                     /gene="TPHA0O01460"
                     /locus_tag="TPHA_0O01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688499.1"
                     /db_xref="GeneID:11530703"
     CDS             complement(293395..295560)
                     /gene="TPHA0O01460"
                     /locus_tag="TPHA_0O01460"
                     /inference="similar to DNA sequence:INSDC:YJL061W"
                     /note="similar to Saccharomyces cerevisiae NUP82
                     (YJL061W); ancestral locus Anc_1.319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688547.1"
                     /db_xref="GeneID:11530703"
                     /db_xref="UniProtKB/TrEMBL:G8C1T5"
                     /translation="MVSPQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYG
                     FVNDADGNFKSITLEKEMIGDVSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSS
                     FQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEE
                     IPSTCITTFHTKGVMGLSSCIDDIIDISFSSDKLSLYALTETDIYLFYPFLIPTISVT
                     KNEIDQLFQKSIILFENLENDSSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETK
                     IYNIDINTEYRSVNAQGSFSIAPFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVL
                     ILYRDLESSMSWDSNDYTFNNSFILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVN
                     LIDTSCWSDILSQCIKDNDIRNLAGLSIESHKQTINTLEEPNSCILWNEHNKKELLFI
                     TETKLISSDILESNNESAEKLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSC
                     KVPYSKVIPANIRQKPFANDENEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQ
                     DVFAEQLMHTNKELLHNKTIKQTYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQS
                     QQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSH
                     DAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSASGLI"
     gene            complement(<295860..>296162)
                     /gene="TPHA0O01470"
                     /locus_tag="TPHA_0O01470"
                     /db_xref="GeneID:11530704"
     mRNA            complement(<295860..>296162)
                     /gene="TPHA0O01470"
                     /locus_tag="TPHA_0O01470"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_003688500.1"
                     /db_xref="GeneID:11530704"
     CDS             complement(295860..296162)
                     /gene="TPHA0O01470"
                     /locus_tag="TPHA_0O01470"
                     /inference="similar to DNA sequence:INSDC:YBR268W"
                     /note="similar to Saccharomyces cerevisiae MRPL37
                     (YBR268W); ancestral locus Anc_1.318"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_003688548.1"
                     /db_xref="GeneID:11530704"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:G8C1T6"
                     /translation="MISVFAKRFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGK
                     DPIALEDSEYPPWLWTVLDKGAQAARLENDPLKLRRKELRRKNRANIKQNNFLKQI"
     gene            complement(<296533..>299007)
                     /gene="TPHA0O01480"
                     /locus_tag="TPHA_0O01480"
                     /db_xref="GeneID:11530589"
     mRNA            complement(<296533..>299007)
                     /gene="TPHA0O01480"
                     /locus_tag="TPHA_0O01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688501.1"
                     /db_xref="GeneID:11530589"
     CDS             complement(296533..299007)
                     /gene="TPHA0O01480"
                     /locus_tag="TPHA_0O01480"
                     /inference="similar to DNA sequence:INSDC:YJL062W"
                     /note="similar to Saccharomyces cerevisiae LAS21
                     (YJL062W); ancestral locus Anc_1.317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688549.1"
                     /db_xref="GeneID:11530589"
                     /db_xref="GOA:G8C1T7"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:G8C1T7"
                     /translation="MLSLKLLLFQLIAITIFCVGFFPSKNVLQGSGEFNFEKELQLTT
                     KPVFTKLVFVVIDALRSDFLYEEQNSHFHFVHRVLNSGEAWGFTAFSNPPTVTLPRLK
                     GITTGSTPNFLDAILNVAEDDVSSSLKDQDSWLMQFYKHNKNIRFFGDDTWLKLFPLN
                     IFSEYEGTNSFFVSDFEQVDLNVTRHLEKQFKEKEQWDVLILHYLGLDHIGHKGGSQS
                     KFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMGDHGMNNGGNHGGSSSGETSAGLTMI
                     SKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKFLSFVQQVDFVPTLSALFNLPMPI
                     NSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSLTTRNIYNAIDFQNDTIEDIIS
                     QMQSVQSELMKSATNYNMNAIYIAIILLSIVTLIIIHKAFSNYKFNILPVAVSLIIGL
                     SSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNFIVFLCLRLIRGWNNSGQKYY
                     YPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNFPSFMSSFLLANLCLMYKVSWA
                     IVNQEHVPDTIKHYVLVLCTHLMSARNVAPLQLFESTLIPLARLFFCCVVILLSLTLV
                     IGKLSPTRLGNPVSNIKKIIIFLLIFQTSPENIGLYLLFGILETNLTDIIDKHYSGNT
                     QLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNIYFVGWMMSISNYAPAI
                     YWSMFPWIIDDNKQKWKKFIERKNIILLFNCISGLFLLITCTILRYHLFIWSVFSPKL
                     CYYMMWNIFMNVIIGWILETLVTYVM"
     gene            complement(<299517..>300743)
                     /gene="TPHA0O01490"
                     /locus_tag="TPHA_0O01490"
                     /db_xref="GeneID:11530590"
     mRNA            complement(<299517..>300743)
                     /gene="TPHA0O01490"
                     /locus_tag="TPHA_0O01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688502.1"
                     /db_xref="GeneID:11530590"
     CDS             complement(299517..300743)
                     /gene="TPHA0O01490"
                     /locus_tag="TPHA_0O01490"
                     /inference="similar to DNA sequence:INSDC:YBR267W"
                     /note="similar to Saccharomyces cerevisiae REI1 (YBR267W);
                     ancestral locus Anc_1.316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688550.1"
                     /db_xref="GeneID:11530590"
                     /db_xref="GOA:G8C1T8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:G8C1T8"
                     /translation="MSGVYTCNSCNLQFPTGNDQRDHMKSDWHRYNLKRRVANLPPIS
                     EDVFNSKLNESAKTNENAKQLSKKEQRRKEKEILLEKKRKLLEIARARMLEQQALEEQ
                     NGHIDGTVNVAELTEEVKKVETSEQDNVEATVGKNEEEPESELTEEQLAEILMAEKIK
                     NKVDIPLEQCLFCTNNKTFKTFELNLLHMYQNHGFFIPEQKYLVNQEGLVKYMAEKIG
                     LGNVCIVCNYQGSSLNAVRSHMLSKRHCKVPYESNNEKLEISEFYNFESSYANVEAAQ
                     GNEEDWEDVEDGDAENTEGDEELEQDEEGTTEFLYHDGVELHLPSGIKVGNRSLMRYY
                     RQNLRPEMILSEGQGTVIAAETRMNFITDGLPDREMVKTQQRAWKTEIKDKKTHDKRA
                     AKFVNNQPHYRDQLLQ"
     gene            complement(<301189..>302142)
                     /gene="TPHA0O01500"
                     /locus_tag="TPHA_0O01500"
                     /db_xref="GeneID:11530591"
     mRNA            complement(<301189..>302142)
                     /gene="TPHA0O01500"
                     /locus_tag="TPHA_0O01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688503.1"
                     /db_xref="GeneID:11530591"
     CDS             complement(301189..302142)
                     /gene="TPHA0O01500"
                     /locus_tag="TPHA_0O01500"
                     /inference="similar to DNA sequence:INSDC:YBR265W"
                     /note="similar to Saccharomyces cerevisiae TSC10
                     (YBR265W); ancestral locus Anc_1.315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688551.1"
                     /db_xref="GeneID:11530591"
                     /db_xref="GOA:G8C1T9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C1T9"
                     /translation="MSYSLDNQVVLITGGSQGLGKQFARKYYSDGKNSSIVIVSRSEK
                     KLICAIEEIVGDSKIHGERFLLSKENCGSDNVSPNGNHIYYYPCNLSNYDNVGTLFEL
                     MNKKGLKPTQALSCAGGSVPKLFKDLSPAELQNGITMNYSTVLNLSHNIIKNYSDCHL
                     ILFSSVTAFFPFIGYSQYQPLKESIKALAAILRQENSKQRISVVYPGNFQSEGYEQEN
                     LTKPEVTKVIEGPSDAITCEECCNKIIWWLQKGYDDITTDFIGWFLMALDMGLNKHDN
                     KSPFWFVQLIMGAILNLLIVPIYMVIVRYQISSYYKSQKSE"
     gene            <302813..>303898
                     /gene="TPHA0O01510"
                     /locus_tag="TPHA_0O01510"
                     /db_xref="GeneID:11530592"
     mRNA            <302813..>303898
                     /gene="TPHA0O01510"
                     /locus_tag="TPHA_0O01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688504.1"
                     /db_xref="GeneID:11530592"
     CDS             302813..303898
                     /gene="TPHA0O01510"
                     /locus_tag="TPHA_0O01510"
                     /inference="similar to DNA sequence:INSDC:YNL141W"
                     /note="similar to Saccharomyces cerevisiae AAH1 (YNL141W);
                     ancestral locus Anc_2.104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688552.1"
                     /db_xref="GeneID:11530592"
                     /db_xref="GOA:G8C1U0"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="InterPro:IPR028892"
                     /db_xref="UniProtKB/TrEMBL:G8C1U0"
                     /translation="MGVPDQFLRELPKCEHHVHIEGTLEAEQLFQFANRNNISLPEGF
                     PATIEDLKAKYNFANLQEFLDLYYIGASVIVTEEDFYELAFAYFKKAASQGVVHAEIF
                     FDPQSHTSRDVSIVTVVSGLTRACKEAEKKFSITTKLIMCLLRHTAPSECSKTIESAK
                     KYIKDGTIAGLGLDSSEKGFPPSLFVECYEVAKKYNADLRLTAHAGEEGPASYVIEAL
                     DLLKVERIDHGIRVADDDKLLERLAEEKIMLTICPLSNVKLQVVDKTADLPLQKLLDY
                     GVPFSINSDDPAYFGGYILDNFYQLSKEYPQWGFFTWGQIVKNSINGSWCDAKRKEDL
                     VDEVDKIITKYVNRTVDEVNRIEGKKF"
     gene            <304547..>306058
                     /gene="TPHA0O01520"
                     /locus_tag="TPHA_0O01520"
                     /db_xref="GeneID:11530733"
     mRNA            <304547..>306058
                     /gene="TPHA0O01520"
                     /locus_tag="TPHA_0O01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688505.1"
                     /db_xref="GeneID:11530733"
     CDS             304547..306058
                     /gene="TPHA0O01520"
                     /locus_tag="TPHA_0O01520"
                     /inference="similar to DNA sequence:INSDC:YHR137W"
                     /note="similar to Saccharomyces cerevisiae ARO9 (YHR137W);
                     ancestral locus Anc_2.102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688553.1"
                     /db_xref="GeneID:11530733"
                     /db_xref="GOA:G8C1U1"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8C1U1"
                     /translation="MTNHISNEELEQKFSSKLSRRAALRKLIPFWDDLEENPEDLIEL
                     AGGMPNPKLFPVNSIDFNIVNKPQFGDVKTEKASIGLYEPKTFPMARSFQYMESKGPP
                     AVINFAKSIIERINKPKYDNWDLTLASGSSDGMFKIFETLLDENSSILMEEFTFTPAA
                     FVAIATGASCIPLKMKLSENAAEQGIDIDYMANLLDNWETSQFKDKPKPKMLYTIATG
                     QNPTGMTLSMEKRRKIYEICQKHDIIILEDDPYGYLLFPKYDPSNPYKNSYVDDKELT
                     VATYLDEYLVKSFLTLDTDGRVLRLETFSKVFAPGLRLSFIVGNSFLIEKFVDFADVS
                     SRSPSGTSQAILLATVNKFTEPYLEQFDGDYTKASLEGWFKWVMSLASMYTHRRNVLV
                     TSLRATEAFKKGYMTILEPSAGMFIDIKLQCENIEKLKGKDVITIMDELNSKLLANRI
                     KIVLGYKMALMKEFSKDHCDFLRVTIAYAEDDEQLAKAAQRIGDGIVEYLETK"
     gene            complement(<306597..>307655)
                     /gene="TPHA0O01530"
                     /locus_tag="TPHA_0O01530"
                     /db_xref="GeneID:11530734"
     mRNA            complement(<306597..>307655)
                     /gene="TPHA0O01530"
                     /locus_tag="TPHA_0O01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688506.1"
                     /db_xref="GeneID:11530734"
     CDS             complement(306597..307655)
                     /gene="TPHA0O01530"
                     /locus_tag="TPHA_0O01530"
                     /inference="similar to DNA sequence:INSDC:YHR139C,YNL160W"
                     /note="similar to Saccharomyces cerevisiae SPS100
                     (YHR139C) and YGP1 (YNL160W); ancestral locus Anc_2.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688554.1"
                     /db_xref="GeneID:11530734"
                     /db_xref="GOA:G8C1U2"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="UniProtKB/TrEMBL:G8C1U2"
                     /translation="MKLQLSALLAASTLAAAQPANWSKFLKNNHNTEVNSLATNATGF
                     NSTATNSSGWGNWTVSNSTQDAHKDIFKVIITGGDFKLDNSSHLEYEYCYNQTNALNL
                     TQLYEVAEIVNTTISDDRYKAVVIVSGGDSMESLGFLNSILIDSEKPVVISQSDAYGI
                     AVANKTASKGTLVVTNDDYVYPGVFSPYSTRYSSFGGVPVAACGDDLSVNYFFESYET
                     KFLSGNSTIRKNFTDFTNYNATKDLDTLPVVPIIAESELSATVLESLAASVDAIVVVA
                     TEDDRDTIKTVDDYSNVGVPVVFAKSINTYPFLSDAAVPTGTCSAGYLSPTKAQLLLS
                     IALINGVTNVEDIVTLFP"
     gene            <309432..>310280
                     /gene="TPHA0O01540"
                     /locus_tag="TPHA_0O01540"
                     /db_xref="GeneID:11530735"
     mRNA            <309432..>310280
                     /gene="TPHA0O01540"
                     /locus_tag="TPHA_0O01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688507.1"
                     /db_xref="GeneID:11530735"
     CDS             309432..310280
                     /gene="TPHA0O01540"
                     /locus_tag="TPHA_0O01540"
                     /inference="similar to DNA sequence:INSDC:YNL167C"
                     /note="similar to Saccharomyces cerevisiae SKO1 (YNL167C);
                     ancestral locus Anc_2.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688555.1"
                     /db_xref="GeneID:11530735"
                     /db_xref="GOA:G8C1U3"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:G8C1U3"
                     /translation="MLAQTQTAFTNTLNNTNKSASVSSGVRTTPNFYINSGLTPNESS
                     LRTGLTPLSQTVPTMLPVLGNNGAALNSAAAPFTPGLTTLLGYSSAQPLPTSMGMMGN
                     GSGFTPGGIRPSPPLNINNGTKVLDNVTKVVVGGGSNSGSAGDSVASGPLNSSGDPTA
                     EKTKAKRVQKPKANGRKAGTTKKKKGAKAKANSESKEVVQKRMEFLERNRLAASKFRQ
                     RKKEYIKKIEDELDFYKSEYRELTQIVDKIIGHDDNKSILEGLENLMAANDPIKALEL
                     VNSIKI"
     gene            <310978..>312330
                     /gene="TPHA0O01550"
                     /locus_tag="TPHA_0O01550"
                     /db_xref="GeneID:11530736"
     mRNA            <310978..>312330
                     /gene="TPHA0O01550"
                     /locus_tag="TPHA_0O01550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688508.1"
                     /db_xref="GeneID:11530736"
     CDS             310978..312330
                     /gene="TPHA0O01550"
                     /locus_tag="TPHA_0O01550"
                     /inference="similar to DNA sequence:INSDC:YNL169C"
                     /note="similar to Saccharomyces cerevisiae PSD1 (YNL169C);
                     ancestral locus Anc_2.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688556.1"
                     /db_xref="GeneID:11530736"
                     /db_xref="GOA:G8C1U4"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:G8C1U4"
                     /translation="MLGSSYVQRVAIDSEDIGLRAGYMDKNNHVWLKIFVVFTLSFFI
                     KRVYSKSKQKTVSLRDKSSTHVTTHKRYKRKIKIVKDNWFLFLYRTLPLNFISRLWGN
                     FNDLTLPMWFRPYGYRFYCYLYTVDVSEILDKNFYHYPNLGSFFYRNIDPKARPIVPG
                     DNVITSPSDGTILNFGTIDPETGEIEQVKGLTYSIREFLGTHEHPLMTKSESHLDLLK
                     QKWKQSQENSTHSFSNLLINEGDKSALVYETNNSKIQKLLSELTAMDTPSVYNHNNIQ
                     INHKNQLYFTVIYLGPGDYHHFHSPINWVCKIRRHFPGKLFSVAPYFQRHFKSLFVLN
                     ERVPLLGYWKYGFFSMTAVGATNVGSIKLNFDKDLRTNVKQPKSKECKHNKNSCYEAV
                     YVNTNEKLKGVPLLKGEEMGGFKFGSTVVLCFEAPFDFKYNIKCGQKIKLGEKIGTVP
                     "
     gene            <312823..>313755
                     /gene="TPHA0O01560"
                     /locus_tag="TPHA_0O01560"
                     /db_xref="GeneID:11530737"
     mRNA            <312823..>313755
                     /gene="TPHA0O01560"
                     /locus_tag="TPHA_0O01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688509.1"
                     /db_xref="GeneID:11530737"
     CDS             312823..313755
                     /gene="TPHA0O01560"
                     /locus_tag="TPHA_0O01560"
                     /inference="similar to DNA sequence:INSDC:YHR146W,YNL173C"
                     /note="similar to Saccharomyces cerevisiae CRP1 (YHR146W)
                     and MDG1 (YNL173C); ancestral locus Anc_2.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688557.1"
                     /db_xref="GeneID:11530737"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:G8C1U5"
                     /translation="MTESVFTFEWPSGPKSVSIVGQFNSWGEPIALQLKSNERDVEEF
                     QLELPVSIENGSDKLHFKFIVDDNWVVSDEYKKDTDANGNENNYIEKSDLNVKQPKSR
                     RVKIKKKLRRNKKTGEVFLVSEEFIPLDDEGNELEPTKITVYEAKATPEKPEITPESE
                     SNGEENVQENTFESGEVPVGEPVGEPVEHPVEEQIEVPVKENSSNPVAEHTESSISNS
                     GDSSSNSEALESSSIDDSDENDENLEVTLPKEINQEMAAVVNTTKAQEIPKTVKKLSK
                     KKTVVKPKPLAKKTDNETKTKKTVMGKLKKFLSK"
     gene            <314248..>315192
                     /gene="TPHA0O01570"
                     /locus_tag="TPHA_0O01570"
                     /db_xref="GeneID:11530639"
     mRNA            <314248..>315192
                     /gene="TPHA0O01570"
                     /locus_tag="TPHA_0O01570"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="XM_003688510.1"
                     /db_xref="GeneID:11530639"
     CDS             314248..315192
                     /gene="TPHA0O01570"
                     /locus_tag="TPHA_0O01570"
                     /inference="similar to DNA sequence:INSDC:YNL177C"
                     /note="similar to Saccharomyces cerevisiae MRPL22
                     (YNL177C); ancestral locus Anc_2.78"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="XP_003688558.1"
                     /db_xref="GeneID:11530639"
                     /db_xref="GOA:G8C1U6"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:G8C1U6"
                     /translation="MLHRGLIGRIGAISHNHILFNAVNKRMISQSSVLRAEEESANTS
                     IFGSLTKNVDMAKPAQDRLSDRMIASADNNNTGEDAAVEEQKFRDSITVETDVLLQKH
                     IQKLDEPEKPAVNLYLSPLKRRIYEQNCKDNGGFFKKNAIVRLPSTKEEYRLTLNQQE
                     LDALEPSVYLQSYRLKSSMKKTTQVLRMINGIDLKKAITQCHFSKRHVAKEIEELLKR
                     GIEDAQKLKLDPNDLYISQIWCGSDGSWRKNMEFKGRGRVGIISHPWVHVRCILKTKS
                     VTKKRLEFEKDLKELKKKPWIQLPDKPVRGVTNNVYKW"
     gene            complement(<315534..>316163)
                     /gene="TPHA0O01580"
                     /locus_tag="TPHA_0O01580"
                     /db_xref="GeneID:11530640"
     mRNA            complement(<315534..>316163)
                     /gene="TPHA0O01580"
                     /locus_tag="TPHA_0O01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688511.1"
                     /db_xref="GeneID:11530640"
     CDS             complement(315534..316163)
                     /gene="TPHA0O01580"
                     /locus_tag="TPHA_0O01580"
                     /inference="similar to DNA sequence:INSDC:YDL212W"
                     /note="similar to Saccharomyces cerevisiae SHR3 (YDL212W);
                     ancestral locus Anc_2.77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688559.1"
                     /db_xref="GeneID:11530640"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:G8C1U7"
                     /translation="MAFLGLSYEEFCTIGTGLILVSSSFLMGVIFGNQPYDYNVLFKT
                     NSTTEDFAASLNHYQQIYNTNPKVFYVLMGVATLGFIGSMIRIYKPNPELQLFEYTSL
                     GLFVFAICIFITNIKTGVECTISHQWGEVTENQGLAVLASSNIIFLFFLGGTVVLQAG
                     LWYTNWEYQKRLKAFFAEEAAERAAAVEKEATAGQGKGKKAQKENKKQK"
     gene            complement(<316482..>317198)
                     /gene="TPHA0O01590"
                     /locus_tag="TPHA_0O01590"
                     /db_xref="GeneID:11530641"
     mRNA            complement(<316482..>317198)
                     /gene="TPHA0O01590"
                     /locus_tag="TPHA_0O01590"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_003688512.1"
                     /db_xref="GeneID:11530641"
     CDS             complement(316482..317198)
                     /gene="TPHA0O01590"
                     /locus_tag="TPHA_0O01590"
                     /inference="similar to DNA sequence:INSDC:YNL178W"
                     /note="similar to Saccharomyces cerevisiae RPS3 (YNL178W);
                     ancestral locus Anc_2.76"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_003688560.1"
                     /db_xref="GeneID:11530641"
                     /db_xref="GOA:G8C1U8"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="UniProtKB/TrEMBL:G8C1U8"
                     /translation="MVAYISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPT
                     KTEIIIRATRTQEVLGENGRRINELTLLVQKRFKFKAGTVVLYAERVQDRGLSAVAQA
                     ESMKFKLLNGLAIRRAAYGVIRYVMESGAKGCEVVISGKLRAARAKAMKYADGFLIHS
                     GQPVNDFIDVATRHVLMRQGVLGIRIKIMRDPSKSKVGPRALPDAVNIVEPKEEEKIL
                     VASVNDYRPAEEQEEVAASA"
     gene            complement(<317977..>319164)
                     /gene="TPHA0O01600"
                     /locus_tag="TPHA_0O01600"
                     /db_xref="GeneID:11530642"
     mRNA            complement(<317977..>319164)
                     /gene="TPHA0O01600"
                     /locus_tag="TPHA_0O01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688513.1"
                     /db_xref="GeneID:11530642"
     CDS             complement(317977..319164)
                     /gene="TPHA0O01600"
                     /locus_tag="TPHA_0O01600"
                     /inference="similar to DNA sequence:INSDC:YNL181W"
                     /note="similar to Saccharomyces cerevisiae YNL181W;
                     ancestral locus Anc_2.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688561.1"
                     /db_xref="GeneID:11530642"
                     /db_xref="GOA:G8C1U9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C1U9"
                     /translation="MPLNIIGTALIEGTDSVPYLNEFIKVSPFLAAGSLVKYWSRGVS
                     NIWERNLHGKVFIVTGATSQSMGTAVVRKMAELGAQLIILTRNVDEWVTDWCEDLRNE
                     AGNQLVYVEQCDISDLLQVRKFVTGWLDNSPPRRLDGVVIMSGDMEACGIPGFSNKTR
                     KSSVDGLELQMSTNFAGIFHMLDLMQPSFKAQPPDRDVRIIFTTCFLQSLGDVNVEDP
                     LWQNVPYNKNSLKFFASSKLQMSLCLLELQRRIFGDVRNRKGPDGVQRTGKNISFTVV
                     QPGLMRSATLRRIISNGSVFSLIFLYCIILYPILWLFVKSGARGAETILCTLMTPELE
                     EVNADETNSVRYYTECKTVKFVRKEFEDLELQKQLYDNTKKQIEEIEKQSAKKRNLSK
                     KKR"
     gene            <319614..>321224
                     /gene="TPHA0O01610"
                     /locus_tag="TPHA_0O01610"
                     /db_xref="GeneID:11530643"
     mRNA            <319614..>321224
                     /gene="TPHA0O01610"
                     /locus_tag="TPHA_0O01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688514.1"
                     /db_xref="GeneID:11530643"
     CDS             319614..321224
                     /gene="TPHA0O01610"
                     /locus_tag="TPHA_0O01610"
                     /inference="similar to DNA sequence:INSDC:YNL182C"
                     /note="similar to Saccharomyces cerevisiae IPI3 (YNL182C);
                     ancestral locus Anc_2.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688562.1"
                     /db_xref="GeneID:11530643"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:G8C1V0"
                     /translation="MNEQIIYTTNATGAIASIHSFEQSNLRQCNVDSLNSAVQVGDKY
                     LFVAQAKKALINVYDISGLQKRESVEQRLPLPEIVSCLEVVPNSTDIGTNDNIPYLLL
                     ASTPSGKVYVWEVSSGILLSVKPMAHYQAITKIKSILGGKYIVTAGKDSRLMIWQTTD
                     FVSSEEPRPVAILHDHTLAVTDFVVSTTYGDYLSSSGTKLYTASQDATVRCYELNTLA
                     TQMPIGKKLDSNDANLLQPKLLVTFTLPYAVATLSLDQADRALYIGTSKGCFNLPLFY
                     QLPGNRIVNLTQSISEKLTSKGKVFSLTELLPGQDEHQKPQDLFAIGQILMNKISDLD
                     VKCSQLSLDGSQLVIGDATGKISIIEIFSKQILRTISPATTQQDSVGSVTNLLISTQY
                     KESSHIELFNGSKSDSGKTQKLPALQRAIFDNKKEGTLHDIWNQFKSPAFETVAPLED
                     FETYLDNMKNQESVFLTESNRDSNSINTVTANTENNTNASENSSKDKEIQELKNNVQS
                     LTDAYKELREMHEKLLTENETQLQKDST"
     gene            <321912..>324359
                     /gene="TPHA0O01620"
                     /locus_tag="TPHA_0O01620"
                     /db_xref="GeneID:11530738"
     mRNA            <321912..>324359
                     /gene="TPHA0O01620"
                     /locus_tag="TPHA_0O01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688515.1"
                     /db_xref="GeneID:11530738"
     CDS             321912..324359
                     /gene="TPHA0O01620"
                     /locus_tag="TPHA_0O01620"
                     /inference="similar to DNA sequence:INSDC:YDL214C,YNL183C"
                     /note="similar to Saccharomyces cerevisiae PRR2 (YDL214C)
                     and NPR1 (YNL183C); ancestral locus Anc_2.71"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688563.1"
                     /db_xref="GeneID:11530738"
                     /db_xref="GOA:G8C1V1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C1V1"
                     /translation="MSSLTRLLQEKKDNAQLKQGSPVPSIAEDVASTTSNTSSSSSLP
                     PRPIIYGTGMPRASVASVTTVTQLDSEDDDTDSAQSASAIVNTRPGDESMYFKAGPND
                     AASSRLRNPINSPLDSKSGLSSSFLDSNSAHTATMHGTTVNTRVGSNSVISNENVFSS
                     TAYGSSYGDTIQRRRSGRAYSSSNQMRQIPSLSSSIPYSVPNSNKERAGTSSSGSSVT
                     NSWIEAYGGSMPSNISAIDSNVISSPIVDSVEPRFIISKQKLQKSSMENSTSQAGSVS
                     RSNSLSSQLGNLFFSKSSKDIYGSSSYSTTHTTVNGSLNTTYTTSTAATAIPKPGRAR
                     QSSIYQSSRQPSSFSDATISSTPSLNEHVSIQSAPKGSYSSVSNLKNIFKKNSGTSIS
                     GSSNAAPLAVPSKITTNGSISIPDRMSTQLNTQSLTPNFYGSSANANDTLYSNSDDTK
                     LPFSRRYERSGEDLGAGAGGSVKLMRRITDAKVFAVKEFRQKLENESKRDYIKKITSE
                     YCIGTTLRNPNIIETIEISYESNRIYQVMEYCEYDLFAIVMSNKMSYEEICCCFKQIL
                     TGVQYLHGIGLSHRDLKLDNCVINNQGIVKLIDFGAAVVFSYPFSKTLVEASGIVGSD
                     PYLAPEVCIFSKYDPRPVDIWSAAIIFVCMVLKKFPWKIPKLRDNSFKLFCSGRDCDS
                     LSSLVTKTPEPPSYDNATTTGNNDKNSNNPSDPKNTNIGPQRLYHSLPEESQSIISRM
                     VDLAPACRANIDEVMSDPWMESIDMCYVIENGDQSTVVNSKCHTHTKVDQSEAHIAGL
                     EKKKKKQQAADNHHNAS"
     gene            <325078..>325527
                     /gene="TPHA0O01630"
                     /locus_tag="TPHA_0O01630"
                     /db_xref="GeneID:11530739"
     mRNA            <325078..>325527
                     /gene="TPHA0O01630"
                     /locus_tag="TPHA_0O01630"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_003688516.1"
                     /db_xref="GeneID:11530739"
     CDS             325078..325527
                     /gene="TPHA0O01630"
                     /locus_tag="TPHA_0O01630"
                     /inference="similar to DNA sequence:INSDC:YNL185C"
                     /note="similar to Saccharomyces cerevisiae MRPL19
                     (YNL185C); ancestral locus Anc_2.70"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_003688564.1"
                     /db_xref="GeneID:11530739"
                     /db_xref="GOA:G8C1V2"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:G8C1V2"
                     /translation="MSQATKNLLVKLIVGAGQAAPTPPVGPALGSKGIKAIDFCKEFN
                     AKTASFKPGVPIPVLITIKPDRSFSFELKSPPTGYLLLKALGMEKGHGTPDTNNPDRI
                     VGTLSLKHIYEIAKIKKTDDRHKILEMEGIVKSIIGVAKSMGIKVEP"
     gene            complement(<325844..>328084)
                     /gene="TPHA0O01640"
                     /locus_tag="TPHA_0O01640"
                     /db_xref="GeneID:11530740"
     mRNA            complement(<325844..>328084)
                     /gene="TPHA0O01640"
                     /locus_tag="TPHA_0O01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688517.1"
                     /db_xref="GeneID:11530740"
     CDS             complement(325844..328084)
                     /gene="TPHA0O01640"
                     /locus_tag="TPHA_0O01640"
                     /inference="similar to DNA sequence:INSDC:YNL186W"
                     /note="similar to Saccharomyces cerevisiae UBP10
                     (YNL186W); ancestral locus Anc_2.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688565.1"
                     /db_xref="GeneID:11530740"
                     /db_xref="GOA:G8C1V3"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8C1V3"
                     /translation="MTMSDALNPLVDSIISNPIKFKTSTKLTDSIKSDDTSSYIVIGA
                     SKKMELRSKRVAGAESRGDDSSTNDKMHKKQKKKKKKLPTSMSEALAMYTTKDQKSED
                     LSDTDYNTLESEEGNMELEVKKDDNTQQHNGYDHEDSEEDPDFKEEKSQTGETTSVSS
                     NGSSSENEVFHEAKEYADNEDIGEDIGEDIGEGIYQKIDNNKDHKRQRSQLEESEVSE
                     NDTTKDDDEVDEKAELQKEKMEFETEKLKKMEANEKKNAKVVEPINSEILSNFYQFNE
                     DVDDIGTNKDSRIIKNWGPILSGLKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDI
                     LRNNKDYITDIIKPNSVSYILSQTSKKMWWKDSKKTSKTSANYIDPKKLIAALEQINC
                     MMSEWQQEDSHEYFMSLMSRLQEDSVPKGKKMTESIIYDIFGGLLKQEVTCKSCGEIS
                     KTEQPFYDLSLHLKGKHNRHQTNSTDSATTNYPAGNSNKIEESSTKEGAADSVNNANN
                     QLNPENGIQDASTSRFSIEKSIGDFFNPELIKMDKEKKGYVCEKCKKTTNAVKRNTIL
                     RAPETLLVHLKKFRFNGQSSSKMKQAVSYPMFLDLTSYCDKTKSKLLVMYQLISVVVH
                     EGRSLSSGHYIAHCKQPDGTWATYDDEYTNIISERNVLKEPNAYYLVYTRLTPREIKF
                     SKHITNKEVSIPMQTQQQNSNQRPNSSSSNNSAFSSPSQYKRTGGNNNNRKQFKKNKK
                     RRLNKY"
     gene            <329035..>329643
                     /gene="TPHA0O01650"
                     /locus_tag="TPHA_0O01650"
                     /db_xref="GeneID:11530741"
     mRNA            <329035..>329643
                     /gene="TPHA0O01650"
                     /locus_tag="TPHA_0O01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688518.1"
                     /db_xref="GeneID:11530741"
     CDS             329035..329643
                     /gene="TPHA0O01650"
                     /locus_tag="TPHA_0O01650"
                     /inference="similar to DNA sequence:INSDC:YDL217C"
                     /note="similar to Saccharomyces cerevisiae TIM22
                     (YDL217C); ancestral locus Anc_2.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688566.1"
                     /db_xref="GeneID:11530741"
                     /db_xref="GOA:G8C1V4"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:G8C1V4"
                     /translation="MGYNGFGLELCQPPPPKKSFGEMTPEEQGDKGAEMMINFMSSCP
                     GKFLISGVTGFALGGVFGLFMASMAYDTPLHTPMPSDVTGKGKGLLPTNVKNIADLPF
                     KQQIKLQFADMGKRSYSSAKNFGYMGMIYSGAECVVESLRAKNDIYNGVAAGCITGGG
                     LAFKSGPQAALIGCAGFAAFSTAIDLYMRSEDGRPPKNDFDE"
     gene            complement(<329809..>330630)
                     /gene="TPHA0O01660"
                     /locus_tag="TPHA_0O01660"
                     /db_xref="GeneID:11530742"
     mRNA            complement(<329809..>330630)
                     /gene="TPHA0O01660"
                     /locus_tag="TPHA_0O01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688519.1"
                     /db_xref="GeneID:11530742"
     CDS             complement(329809..330630)
                     /gene="TPHA0O01660"
                     /locus_tag="TPHA_0O01660"
                     /inference="similar to DNA sequence:INSDC:YNL188W"
                     /note="similar to Saccharomyces cerevisiae KAR1 (YNL188W);
                     ancestral locus Anc_2.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688567.1"
                     /db_xref="GeneID:11530742"
                     /db_xref="UniProtKB/TrEMBL:G8C1V5"
                     /translation="MNQNKPNQQHILQSQSRINRINELYKNKTASKTQDSKVNASKQS
                     AVKNPFVSTPVSNDEPYESSESDMDELQYTPKLKSRYNVRTNNASPSPTEKDSLLFKV
                     KATSKPRVRKTSSTKVILGDPLPLPYDTHRITNNKGDVTTVDGKRKLMESKWRNLMVN
                     SKENVRSKFNEQRSFSEGGKKPKENQRISSVRFMPVANEHTTLLELKNKLIANGHKLD
                     SIIQALNSQEKKQHLEHTKNIKPSKYDYKEIVNSLLWAICIIILTICNLYVYKYL"
     gene            complement(<331520..>332095)
                     /gene="TPHA0O01670"
                     /locus_tag="TPHA_0O01670"
                     /db_xref="GeneID:11530677"
     mRNA            complement(<331520..>332095)
                     /gene="TPHA0O01670"
                     /locus_tag="TPHA_0O01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688520.1"
                     /db_xref="GeneID:11530677"
     CDS             complement(331520..332095)
                     /gene="TPHA0O01670"
                     /locus_tag="TPHA_0O01670"
                     /inference="similar to DNA sequence:INSDC:YNL190W"
                     /note="similar to Saccharomyces cerevisiae YNL190W;
                     ancestral locus Anc_2.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688568.1"
                     /db_xref="GeneID:11530677"
                     /db_xref="UniProtKB/TrEMBL:G8C1V6"
                     /translation="MKFSAVAIASVAAMSAMVFADDATTTDVTTTTTSKSTHKYGKFN
                     KTSKSHAPKNTGTHKYGKFNKTSKSHAPKNTGTHKYGKFNKTSKSHAPKNTGTHKYGK
                     FNKTSKSHAPKNTGTQKYGKFNKTPKSHAPKNTGTHKYGKFNKTKHQKSTSSPQAKAV
                     SANGAPSNFGAAGAFGLTAGGAFIAGALMLL"
     gene            complement(<333098..>336058)
                     /gene="TPHA0O01680"
                     /locus_tag="TPHA_0O01680"
                     /db_xref="GeneID:11530678"
     mRNA            complement(<333098..>336058)
                     /gene="TPHA0O01680"
                     /locus_tag="TPHA_0O01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688521.1"
                     /db_xref="GeneID:11530678"
     CDS             complement(333098..336058)
                     /gene="TPHA0O01680"
                     /locus_tag="TPHA_0O01680"
                     /inference="similar to DNA sequence:INSDC:YNL192W"
                     /note="similar to Saccharomyces cerevisiae CHS1 (YNL192W);
                     ancestral locus Anc_2.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688569.1"
                     /db_xref="GeneID:11530678"
                     /db_xref="GOA:G8C1V7"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C1V7"
                     /translation="MSYNYNTYYSNENDLNYQPSNYHNYIHVNNNTRNSTPQQEYNAP
                     QQNYNPEAYNDIPHQNNPEGYNNNRRRQYIPSNPYRTSIDFQNEIQQNNPSDQNENYP
                     YIRHDNYDEENDLSNSVINTYLRNDDSFEFENSDDDDLDNQSLATADKLKIKSQIHNL
                     SSYTLSSNASSVETMVSQRDVTHHSYNTLSNAPIRRDTVTRKFQLQNGNFVFDSPISP
                     SLLIRYNDAAAKRQYALTNEFKFMRYQAITCEPNELLQENFSVRQLQYMVPRETELLI
                     TVTMYNEDHILLARTLRGVMKNIKHMIKRTNSSVWGPEAWKKIVVCVVSDGRSKINEK
                     ALSLLSSLGCYQDGFAKKTINNKNVNTHVYEHTTLMNITDINEQTGMINIECDENTVP
                     IQLLFCLKEKNQKKINSHRWVFEGFSELLQPHIITLLDCGTMPGNESIYNLWKEFKNP
                     QVGGACGEIKTDIGKYGKNLLNPLVASQNFEYKMSNILDKTTESNFGFISVLPGAFSA
                     YRFEALRGEPLTKYFLGEYMEADQSAFHFFSSNMYLAEDRILCFEIVMKKNANWILKY
                     CKNSFATTDVPTSVSEFIMQRRRWLNGSFFASIYSLSHFGRIWTSGHSLFRKFFLQIE
                     FIYILINTVLSWFALSSFFLVFRILCLSVALSYSTVFNVLSVVFFWLYGICVASTFIL
                     SLGNKPKSSRLFYMVTIIFFAVVMLYMIAISCFLTVKSVEVFIASEQEHDYSTLSEKI
                     EEFFVDDNFRNLVISIGSTYALYIISSLLYMQPMHMLTSFAQYVLLSPSYINVLNIYA
                     FCNLHDISWGTKSSGDEKENNNVADLVNGVIKSGSNGEFELEVLIKPTEIQENYDKRL
                     SNLYAVAEKDDGTTSEAPVTLSYEERKLGYNSSVRSLLIILWLISNFVVVTIVLESGG
                     IIDYILTQGYKDSSSDVNVAHVVLPTQTKYYFNVLLWLVAFNAVIRFFGCVYYLVCLP
                     LKKLNYEKRERALV"
     gene            <337788..>340256
                     /gene="TPHA0O01690"
                     /locus_tag="TPHA_0O01690"
                     /db_xref="GeneID:11530679"
     mRNA            <337788..>340256
                     /gene="TPHA0O01690"
                     /locus_tag="TPHA_0O01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688522.1"
                     /db_xref="GeneID:11530679"
     CDS             337788..340256
                     /gene="TPHA0O01690"
                     /locus_tag="TPHA_0O01690"
                     /inference="similar to DNA sequence:INSDC:YDL220C"
                     /note="similar to Saccharomyces cerevisiae CDC13
                     (YDL220C); ancestral locus Anc_2.56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688570.1"
                     /db_xref="GeneID:11530679"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:G8C1V8"
                     /translation="MDERFQYITSSSELEVLLGLDEKRKQGRFYVEFISVLTSIKYLK
                     SSKCILKFQSFNNNLVYESPYEVIYECTSDEIIKKFDLDIAEPKGNGFIVNDCHLQRL
                     CFVICRGACVFNGIYPVVVAEDLIPLDLSQVIEMLDTFKSDNYDKNNYLTKDSIVENK
                     NLTVSKIFDNLIFMNAKKTEPFKFVKLEDYDMRFKEVIQHRQLLLNDRIIKNNPVYNP
                     GSRNMNSTEDEGSDAGNYNRFDSDGDDEIEDESQDENSKIFDNSKYLKTNDGERINNN
                     ISINKIISTTGTQSSTEMLSSAIITQTNDKQAIRASGEYINSSPSKNNQEHSIDKIVQ
                     SESSDVKIMKLYNIGEKLEYSGQFIELYPSRFSDFSFLSKTSLRVYFQPFECVSEKED
                     IYGIIPNIDCIEILLTSAEEIKELFGTLVHNSKSLKQLLFHHKMVVELENTKFCLNKK
                     SRIYTTALKIKNTKNWEKFIPKSRNSKTSIIHEYKPPIVDRSKYTDNLIKFEDLLFAG
                     KKILFSRLLGLLVSCSFSHRAFVTLLFTDFTKNNINQKFIFSNYLIEKEDKLNEKYYY
                     RVNVFHNDFEKFDLKVYNIYGSHIKDMLKDGDNVSHIGILCDITVKCDMYNDTLGMIA
                     RNIIPITVKTERTKDENRKIKVIYENLLEAINTKSIMENYDSYSIAFPIKKGSLKDKV
                     FLKRQERLTQRFIKNLKFDYLNGITAINTATEFMVRAKILNVEYSSNHISIVTSDYLF
                     DKSISSLSNKDGDIIIPKSRIIFIDVNGKKDIKNFLGMTKKDDILNLIEMKDFNLRIQ
                     RIMDNSLVVKWRQTTGTLHELLLQ"
     gene            <341361..>342236
                     /gene="TPHA0O01700"
                     /locus_tag="TPHA_0O01700"
                     /db_xref="GeneID:11530680"
     mRNA            <341361..>342236
                     /gene="TPHA0O01700"
                     /locus_tag="TPHA_0O01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688523.1"
                     /db_xref="GeneID:11530680"
     CDS             341361..342236
                     /gene="TPHA0O01700"
                     /locus_tag="TPHA_0O01700"
                     /inference="similar to DNA sequence:INSDC:YDL222C,YNL194C"
                     /note="similar to Saccharomyces cerevisiae FMP45 (YDL222C)
                     and YNL194C; ancestral locus Anc_2.55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688571.1"
                     /db_xref="GeneID:11530680"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:G8C1V9"
                     /translation="MLFKRFVNFLTLLFLLGAGLLTFFIILSGSHNSGTLKSFYWFEA
                     NTFGFNDASIITRWYDYEFCGYLNDNLVNCSSRAPAKPFSPKDNFGASDNMPSSFLNN
                     RDTYYYLSRVAWAMLLIGLVFICLSIIPIFINIFKLVPGIVIWSTVATWLAFFFIILS
                     ACLYTGCYVKARKNFHHDGRHAKLGAKNFAFIWTSVFLLLISIVWTTLLSTLFTRDDH
                     YRKSNYNVASTTVDAEESGIPYNPGAPQPQARDIPTHKKRFFTTLKTRKIHESDIPED
                     LENVSPANNINPVVS"
     gene            <342489..>343556
                     /gene="TPHA0O01710"
                     /locus_tag="TPHA_0O01710"
                     /db_xref="GeneID:11530681"
     mRNA            <342489..>343556
                     /gene="TPHA0O01710"
                     /locus_tag="TPHA_0O01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688524.1"
                     /db_xref="GeneID:11530681"
     CDS             342489..343556
                     /gene="TPHA0O01710"
                     /locus_tag="TPHA_0O01710"
                     /inference="similar to DNA sequence:INSDC:YNL195C,YDL223C"
                     /note="similar to Saccharomyces cerevisiae YNL195C and
                     HBT1 (YDL223C); ancestral locus Anc_2.54"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688572.1"
                     /db_xref="GeneID:11530681"
                     /db_xref="UniProtKB/TrEMBL:G8C1W0"
                     /translation="MPGNFDQEHTTKAFSTTIPIESELPPRNNFSDNGAPSESEHLDS
                     NPFVKGIKESDKNDIIKETDNAGSRSENLQATGTEMKNSMQRDQNKVSIDSNSQFPSV
                     LKSSSHKSEPILSQTVNSSNKNGIWNDEYMNREETDSSMKKSTTIGTTANAERNSSTE
                     TKTKNMEDQGLQRTRTGSRSGSRSRGSRKGSMSRSSVSRPGTTQFENEIMEAQRRKQR
                     QRSIGSEDIGSYATIIGNSPSMIDPAVNTYGYKSIPTHKTMSTKSGAAGYMLDRNVSK
                     GSSNALRGTSSESSESSESSESSEDVGNYTVENTKGMKHNYKKSTPRSELRKKTSNVE
                     ETVIEQTRFGKFKKTFMRPTL"
     gene            <344833..>346692
                     /gene="TPHA0O01720"
                     /locus_tag="TPHA_0O01720"
                     /db_xref="GeneID:11530682"
     mRNA            <344833..>346692
                     /gene="TPHA0O01720"
                     /locus_tag="TPHA_0O01720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688525.1"
                     /db_xref="GeneID:11530682"
     CDS             344833..346692
                     /gene="TPHA0O01720"
                     /locus_tag="TPHA_0O01720"
                     /inference="similar to DNA sequence:INSDC:YDL224C,YNL197C"
                     /note="similar to Saccharomyces cerevisiae WHI4 (YDL224C)
                     and WHI3 (YNL197C); ancestral locus Anc_2.52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688573.1"
                     /db_xref="GeneID:11530682"
                     /db_xref="GOA:G8C1W1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8C1W1"
                     /translation="MPLIHETETLNDTSMMFQNENRGEYQTTNTSIPALGDLSPKHKQ
                     ALGLHTVNGSNFKGQQSPLQLTSMLNSLTLSQDNQAVANMRNYNGPFVLILRNLPNEI
                     SLRECHAVFALAHNILSMELVKSENSEKDEPFLKVQIDSLVNAASYAMILSSKSDIFG
                     PDCPMKSYVELFDQPTNQQVPYNELSQLNQSYRLGSDLNNLHNFKNIIPLAANSNIPS
                     VFDGSTLPKKSRFSFSDNFSNESNLVNNTTENQHVSTGNSLNPQGSQSIPGHPQSFQE
                     LSATSSMQQGNVGKSILMMESDDINDAIWGSNGITFNNATTGSNSTVPMFEWNSGGSR
                     KQNNLFGFSQQTNNMPNQSVQGSTAQLSNISSDGYLPANNNISSFGIPPSVNSSTQQM
                     LSPLDSTLPANQHHPNISSQSSTFNINDKLSTDSQAAKNQSQTPHRMQPMRNTRNSQE
                     SIGLQKNSSTPSLSYSNLANTGAISQADLSLLAKVPPPANPADQNPPCNTLYVGNLPS
                     DATEQELRQLFSVQQGFRRLSFRNKNNNGNGHGPICFVEFDDVSFATRALAELYGSQL
                     PSATVSNKGGIRLSFSKNPLGVRGPNNRRNTSTPTLNGSSNSNNYSYIGNYGK"
     gene            complement(<347210..>348895)
                     /gene="TPHA0O01730"
                     /locus_tag="TPHA_0O01730"
                     /db_xref="GeneID:11530683"
     mRNA            complement(<347210..>348895)
                     /gene="TPHA0O01730"
                     /locus_tag="TPHA_0O01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688526.1"
                     /db_xref="GeneID:11530683"
     CDS             complement(347210..348895)
                     /gene="TPHA0O01730"
                     /locus_tag="TPHA_0O01730"
                     /inference="similar to DNA sequence:INSDC:YDL225W"
                     /note="similar to Saccharomyces cerevisiae SHS1 (YDL225W);
                     ancestral locus Anc_2.51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688574.1"
                     /db_xref="GeneID:11530683"
                     /db_xref="GOA:G8C1W2"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1W2"
                     /translation="MSEFDSAKLARRKKENKRGIAYSVLLCGRDGLGKTTFANNLLES
                     NIFTHKYNTSAESDLGSSVGPENERIKIIKPTKVVSYNSKNGIPTFMSDLDAKRANFE
                     PGVTITSTTVDINTSSDAGNAVDDDEDTIILNIVNTHGLGENLDDTLCFDELTNYLEQ
                     QFDIVLAEETRIRRNPRFEDTRVHVIVYFIEPTGHGLQELDIELMKRLSNYANVLPVI
                     AKGDSFTKEEMKTFKKNILKDIDYFNIPVYQFKVDEDEDDLETIEENQILASLQPFSI
                     ICSDVRDSDGNYIRSYPWGTVIIDSYKNKDKGNNSELEVVKNVLFGSHLQEFKDTTQN
                     LLYENYRAEKLSSVASPQINASKPSTFAANSGNPIDRNSTVPSLSNFTSFVNTGKFAS
                     QQTLALVEQDSTPENDKSNASKFVGESIEESPIKQMSQTLKHHNEEIIKNIKKEAPNM
                     TSPDMNEKSKLRNMSETVPYVLRHERIIARQQKLEELEAQSAKELQKRIQDLEKKAQT
                     LKLKEKLLRQEHLERAQGKESSQSSLGSAFAGTGQLKKEETLTDLASIVSGQK"
     gene            <350747..>351313
                     /gene="TPHA0O01740"
                     /locus_tag="TPHA_0O01740"
                     /db_xref="GeneID:11530684"
     mRNA            <350747..>351313
                     /gene="TPHA0O01740"
                     /locus_tag="TPHA_0O01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688527.1"
                     /db_xref="GeneID:11530684"
     CDS             350747..351313
                     /gene="TPHA0O01740"
                     /locus_tag="TPHA_0O01740"
                     /inference="similar to DNA sequence:INSDC:YNL199C"
                     /note="similar to Saccharomyces cerevisiae GCR2 (YNL199C);
                     ancestral locus Anc_2.50"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688575.1"
                     /db_xref="GeneID:11530684"
                     /db_xref="UniProtKB/TrEMBL:G8C1W3"
                     /translation="MESIFDIGKQNTDYADLFILDNINTNTDIEIKGRKRRFTYSDAD
                     ADVLYTDLINFKDSEGLGNTSKRLHKSSKNDRRNRKSRTKSSSHYDMDYSKGSNSTIE
                     SELEIQPIPTPVSISSLSTNSYHQQDQDELAIITENYSKIIEEKNQRILNLEKSIDEI
                     LHEKKFLKQLLLENFGYLRRTLNESRDP"
     gene            complement(<351478..>352425)
                     /gene="TPHA0O01750"
                     /locus_tag="TPHA_0O01750"
                     /db_xref="GeneID:11530685"
     mRNA            complement(<351478..>352425)
                     /gene="TPHA0O01750"
                     /locus_tag="TPHA_0O01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688528.1"
                     /db_xref="GeneID:11530685"
     CDS             complement(351478..352425)
                     /gene="TPHA0O01750"
                     /locus_tag="TPHA_0O01750"
                     /inference="similar to DNA sequence:INSDC:YNL202W"
                     /note="similar to Saccharomyces cerevisiae SPS19
                     (YNL202W); ancestral locus Anc_2.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688576.1"
                     /db_xref="GeneID:11530685"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C1W4"
                     /translation="MVNTLNPSFVTGSSWKPDLFKGKVAFITGGAGTICRVQAEALIL
                     LGCKVAIVGRDAQKTAEVCDELNQLDPEKGAAGSKALSLCNIDVRNYDQMVSAVKQTV
                     SVYGRIDFVICGAAGNFICDLTNLSANAFKTVIDIDLIGSYNTIKATFDELYKSRGSI
                     IFVSATFHYYGVPFQSHVGAAKAGIDALSQAIAVEWGPLGIRSNCIAPGAISGTEGFK
                     RLTLKEHRENLENNKSNGGKATNPLVGKIPLGRLGTTKDIAEATVFLFSPSASYITGT
                     VTVVDGGMWHLGTIFGDKMYPDMLKEKMKLPTRDLDHKL"
     gene            <354708..>356486
                     /gene="TPHA0O01760"
                     /locus_tag="TPHA_0O01760"
                     /db_xref="GeneID:11530656"
     mRNA            <354708..>356486
                     /gene="TPHA0O01760"
                     /locus_tag="TPHA_0O01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688529.1"
                     /db_xref="GeneID:11530656"
     CDS             354708..356486
                     /gene="TPHA0O01760"
                     /locus_tag="TPHA_0O01760"
                     /inference="similar to DNA sequence:INSDC:YDL227C"
                     /note="similar to Saccharomyces cerevisiae HO (YDL227C);
                     ancestral locus Anc_2.42"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688577.1"
                     /db_xref="GeneID:11530656"
                     /db_xref="GOA:G8C1W5"
                     /db_xref="InterPro:IPR004042"
                     /db_xref="InterPro:IPR006142"
                     /db_xref="InterPro:IPR007868"
                     /db_xref="InterPro:IPR007869"
                     /db_xref="InterPro:IPR027434"
                     /db_xref="InterPro:IPR028992"
                     /db_xref="UniProtKB/TrEMBL:G8C1W5"
                     /translation="MFEDGTRVMMADGRSKDISELRANDYLMAEDGAPVKVTGVIKDS
                     QSTYEIVHKTKHRAFEGEAATNDPLRKIIYQRLSFNCTLTHDLVLRTPAKPMIENDFT
                     KNIYRVRYRTLDKVNTDDGRIINIPKQHKKYFKMTPEGKTDAENFRDEMERQCGEFLN
                     YNLQVRDLDLMMPLLRITTYLRFSPLTSGNGVLSQFLTGTKHLNTKAVLQMAWMLGLW
                     IGDGTTNEPQITVDSFDTSLIDALNENSKPWGIYPTYKDEAFASRCKHVSLHYGQEAG
                     ENRVYRNLRKNNPFWNVVTSLKFKRDGDGGKQIPTFMWSEDEEVREAFMAGLIDADGY
                     VCKWTEKTGNLKVSIQTIYPSIMNGIVHISRSLGITATVTTRSSKTITIRGRQVQCQF
                     TFDCNMYGSERLQNILSYCHSGHKTRPVPSTISRDPVYFTFLDIKKGINDVYGLTLEE
                     DKNVLLENKTVVTMCTSQCKNEHFKIKPSKYLQHCIACPHKGIKYFYKNWSGTAKLCG
                     RCWQRYKFSGYRCLNCNFVPEAREVKIAKAKGEGVGLTPEGVPVKGYFCRRCNGILKY
                     DGVRGPKRTKEETSRKAKVTSVGNIQ"
     gene            complement(<356732..>358573)
                     /gene="TPHA0O01770"
                     /locus_tag="TPHA_0O01770"
                     /db_xref="GeneID:11530657"
     mRNA            complement(<356732..>358573)
                     /gene="TPHA0O01770"
                     /locus_tag="TPHA_0O01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688530.1"
                     /db_xref="GeneID:11530657"
     CDS             complement(356732..358573)
                     /gene="TPHA0O01770"
                     /locus_tag="TPHA_0O01770"
                     /inference="similar to DNA sequence:INSDC:YDL229W,YNL209W"
                     /note="similar to Saccharomyces cerevisiae SSB1 (YDL229W)
                     and SSB2 (YNL209W); ancestral locus Anc_2.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688578.1"
                     /db_xref="GeneID:11530657"
                     /db_xref="GOA:G8C1W6"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8C1W6"
                     /translation="MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEEAVQEDMKTWPFKVIDVQGA
                     PMIEVEYLGENKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQAT
                     KDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGG
                     VFTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGSDISNDARALRRLRTAAERAKRT
                     LSSVTQTTVEVDSLFDGEDFEASLTRARFEDLNAALFKSTLTPVEQVLKDAKIAKSQI
                     DEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDET
                     KDLLLLDVAPLSLGVGMQGDIFGIVVPRNTTVPTIKRRTFTTAGDNQTTVQFPVYQGE
                     RVNCKENTLLGEFDLKGVPPMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSSNITIS
                     NAVGRLSTEDIEKMVNQAEEFKAADEAFAKRHEARQRLESYVASIEQTVTDPALSAKL
                     KRGSKVKIENALSEAMAALAIEDSSTDDLRKAEVGLKRVVTKAMSTR"
     gene            complement(<359214..>360260)
                     /gene="TPHA0O01780"
                     /locus_tag="TPHA_0O01780"
                     /db_xref="GeneID:11530658"
     mRNA            complement(<359214..>360260)
                     /gene="TPHA0O01780"
                     /locus_tag="TPHA_0O01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688531.1"
                     /db_xref="GeneID:11530658"
     CDS             complement(359214..360260)
                     /gene="TPHA0O01780"
                     /locus_tag="TPHA_0O01780"
                     /inference="similar to DNA sequence:INSDC:YDL230W"
                     /note="similar to Saccharomyces cerevisiae PTP1 (YDL230W);
                     ancestral locus Anc_2.39"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688579.1"
                     /db_xref="GeneID:11530658"
                     /db_xref="GOA:G8C1W7"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:G8C1W7"
                     /translation="MVSLPKYLKQSDRELENKFRFIQHQEDARIRDATMDPSNSKWTF
                     GVSIDDSNRYRNRYVNIMPYEKNRVKLNVYNGNDYMNASYVKVNVSGQTMKPGFYIAT
                     QGPTERTWDQFWQMCYQNYSENDSNDSVVIVMVTPLVEYNREKCYQYWPRGGSSDSIR
                     IAEKVQDPGEDDVSEFEHALKIEYANSRRYDDCYTLTTMRLVPVDESGEELGPAKTVH
                     HFYFDQWRDMSKPEEVIPIMKLCQHSHSLNKAGNPIIVHCSAGVGRSGTFIALDHMLH
                     DTEDFKIDAEQKMSSGGQMVGSPLHPDKGYDHDLIEQIVLQLRAQRLKMVQMSDQYKF
                     IYHAAKYMYQHPPH"
     gene            complement(<360715..>360843)
                     /gene="TPHA0O01790"
                     /locus_tag="TPHA_0O01790"
                     /db_xref="GeneID:11530659"
     mRNA            complement(<360715..>360843)
                     /gene="TPHA0O01790"
                     /locus_tag="TPHA_0O01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688532.1"
                     /db_xref="GeneID:11530659"
     CDS             complement(360715..360843)
                     /gene="TPHA0O01790"
                     /locus_tag="TPHA_0O01790"
                     /inference="similar to DNA sequence:INSDC:YDL232W"
                     /note="similar to Saccharomyces cerevisiae OST4 (YDL232W);
                     ancestral locus Anc_2.37"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688580.1"
                     /db_xref="GeneID:11530659"
                     /db_xref="InterPro:IPR018943"
                     /db_xref="UniProtKB/TrEMBL:G8C1W8"
                     /translation="MITDEQLNRLVLIFGAIMMFLIIVYHTISSSTDQEPEETKEE"
     gene            <361654..>362301
                     /gene="TPHA0O01800"
                     /locus_tag="TPHA_0O01800"
                     /db_xref="GeneID:11530660"
     mRNA            <361654..>362301
                     /gene="TPHA0O01800"
                     /locus_tag="TPHA_0O01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688533.1"
                     /db_xref="GeneID:11530660"
     CDS             361654..362301
                     /gene="TPHA0O01800"
                     /locus_tag="TPHA_0O01800"
                     /inference="similar to DNA sequence:INSDC:YNL213C"
                     /note="similar to Saccharomyces cerevisiae YNL213C;
                     ancestral locus Anc_2.34"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688581.1"
                     /db_xref="GeneID:11530660"
                     /db_xref="InterPro:IPR010487"
                     /db_xref="UniProtKB/TrEMBL:G8C1W9"
                     /translation="MHIQFFKRYFHLQLFSGSLLNRKTVNGAIKHINNSSLTKKEINL
                     GLSKEAYDTLPEWKKQNIALKKKFNGERWNPLKKLSRLEMNNVKLLKSNFPDMTATQL
                     ANQFKVSPETIRRILKSKWTPNEDEIVKLEERWKRRGEKINEMYKENLKVGQGPRPDL
                     IASNKIIIGLSRNVDTYRVTRSQKQYNKFPNPKTKQNNKQSHNKNKLFLLQGKNE"
     gene            complement(<362495..>363094)
                     /gene="TPHA0O01810"
                     /locus_tag="TPHA_0O01810"
                     /db_xref="GeneID:11530725"
     mRNA            complement(<362495..>363094)
                     /gene="TPHA0O01810"
                     /locus_tag="TPHA_0O01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688534.1"
                     /db_xref="GeneID:11530725"
     CDS             complement(362495..363094)
                     /gene="TPHA0O01810"
                     /locus_tag="TPHA_0O01810"
                     /inference="similar to DNA sequence:INSDC:YNL214W"
                     /note="similar to Saccharomyces cerevisiae PEX17
                     (YNL214W); ancestral locus Anc_2.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688582.1"
                     /db_xref="GeneID:11530725"
                     /db_xref="UniProtKB/TrEMBL:G8C1X0"
                     /translation="MAIKQNKFPTIDQVNIRTFKGKSSNIVDSLRSLGNNAALFISIA
                     YLTLEYIIRPLLNEQFRQRIQLSGTTLITLRKLVADLKGKLDEYRLISAIGFNETNKT
                     VDRCTQTSKDFISRGAYSVPTVEQINIKLEDFTLTLDMENGSDGIQLRSNEETLQEIK
                     ESWKDIDDVLESEKKLTSKTKVLECIRDIKGWYVNGRIP"
     gene            complement(<363412..>364047)
                     /gene="TPHA0O01820"
                     /locus_tag="TPHA_0O01820"
                     /db_xref="GeneID:11530726"
     mRNA            complement(<363412..>364047)
                     /gene="TPHA0O01820"
                     /locus_tag="TPHA_0O01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688535.1"
                     /db_xref="GeneID:11530726"
     CDS             complement(363412..364047)
                     /gene="TPHA0O01820"
                     /locus_tag="TPHA_0O01820"
                     /inference="similar to DNA sequence:INSDC:YNL215W"
                     /note="similar to Saccharomyces cerevisiae IES2 (YNL215W);
                     ancestral locus Anc_2.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688583.1"
                     /db_xref="GeneID:11530726"
                     /db_xref="GOA:G8C1X1"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="InterPro:IPR029523"
                     /db_xref="UniProtKB/TrEMBL:G8C1X1"
                     /translation="MEEEEEEEEETTKNRLSSTSRNQSIKVVDDDEEDEGDSEDFEQQ
                     EEQEEEEQDEEQDEEEQDEEQEQEEGKDGQTEVETPSGLENDTDGSRETTLETVRKTG
                     GSKMLLNLLSDGSSRKKLTEEEIQLRRAENARKRKNLSEKRSEEEKREVLDKLLKRRA
                     AKSRSHLPNDDENSKDGTDESLSYIKPRRPYSSPGMIRTLRKAETDLYCTY"
     gene            complement(<364958..>366985)
                     /gene="TPHA0O01830"
                     /locus_tag="TPHA_0O01830"
                     /db_xref="GeneID:11530727"
     mRNA            complement(<364958..>366985)
                     /gene="TPHA0O01830"
                     /locus_tag="TPHA_0O01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688536.1"
                     /db_xref="GeneID:11530727"
     CDS             complement(364958..366985)
                     /gene="TPHA0O01830"
                     /locus_tag="TPHA_0O01830"
                     /inference="similar to DNA sequence:INSDC:YNL216W"
                     /note="similar to Saccharomyces cerevisiae RAP1 (YNL216W);
                     ancestral locus Anc_2.29"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688584.1"
                     /db_xref="GeneID:11530727"
                     /db_xref="GOA:G8C1X2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="UniProtKB/TrEMBL:G8C1X2"
                     /translation="MSSVNDFDTAPDEYVDAKESSHNDKRHQKAELSEDQLNSKAPNE
                     NHSLFKGYSFFINTKPDAYGKKSDINSLTRLALSHEGTILDELPDSTSMTGEQRSKFY
                     VVSPYNSTNLNTVTATYIKACCQNNTLLEAHDYLVPYDDFKKGEQNTNANEAEAKNDK
                     NDKTDSIDSELVGNIQLQSMTAENTTPLQLNNSKEKNKKNRRSQKNKSPTVSYNKASF
                     TEEEDEFILDVVKKNPTRRTTHTLFDEISNYLPNHTGNSVRHRYRVYLSKRLEFVYQV
                     DSNGRLVRDENGDLIKTKVLPPSLKKKFTAQEDYTLAIAIKKQFYKDLYQVDPDSGSS
                     LIMADDSPVMVAKRKVTMAPNHVPGTEPSFDSFKVLDRTGPLAREFFKSFSEKNTSHT
                     ENAWRDRFRKFILPYGIDAYIEYYDSEKAKGKEPEPMRNFTNRAVRVGPPTPGNYNSV
                     NKRAKLNINEVRNAAAAAAAAASAHVGYTIPENELLDETTMKFISTIKNDIESQQNQQ
                     NFEYPQDIAEAIRQDFANEENQYDNLEIDVMEFPPAIASVDLFLPEFFRMGSVKVFVD
                     KIQEIISRDYEPSQAEKLVQDLCDEVGVRKTFSTSVLTALSGDLMIFPRYFLHMFKEN
                     ANPPTNVPGIWTPEDDIMLKNNKPQEIDILIQKHGKGRIEMRKRFVERDLI"
     gene            complement(<367808..>368464)
                     /gene="TPHA0O01840"
                     /locus_tag="TPHA_0O01840"
                     /db_xref="GeneID:11530728"
     mRNA            complement(<367808..>368464)
                     /gene="TPHA0O01840"
                     /locus_tag="TPHA_0O01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688537.1"
                     /db_xref="GeneID:11530728"
     CDS             complement(367808..368464)
                     /gene="TPHA0O01840"
                     /locus_tag="TPHA_0O01840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688585.1"
                     /db_xref="GeneID:11530728"
                     /db_xref="UniProtKB/TrEMBL:G8C1X3"
                     /translation="MQRHPHTHNSKSRVGKVPSPCACLSPSVVGRSHTRTRWMFLAED
                     LIAAERQQVEAESGKKVCCNNKVVGGTVRLLCPVVVWRHKTKCTVRCCSVRSLSMEAL
                     LLFVLSCILHTGFSFSVALPKNTILWRYFTVHFISPVPFSSFEVVVIFVFCAFCAWGG
                     KRVSRFWVVVCYDSMSRILTIALIHGNSKNNNIYIYIYIWEWRLTVLFQRIMHITVLV
                     "
     gene            <369221..>369637
                     /gene="TPHA0O01850"
                     /locus_tag="TPHA_0O01850"
                     /db_xref="GeneID:11530729"
     mRNA            <369221..>369637
                     /gene="TPHA0O01850"
                     /locus_tag="TPHA_0O01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688538.1"
                     /db_xref="GeneID:11530729"
     CDS             369221..369637
                     /gene="TPHA0O01850"
                     /locus_tag="TPHA_0O01850"
                     /inference="similar to DNA sequence:INSDC:YDL235C"
                     /note="similar to Saccharomyces cerevisiae YPD1 (YDL235C);
                     ancestral locus Anc_2.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688586.1"
                     /db_xref="GeneID:11530729"
                     /db_xref="GOA:G8C1X4"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="UniProtKB/TrEMBL:G8C1X4"
                     /translation="MISNIPTEVIDWSILNEIISMDEDDPEFSKMLIRQYIEQVTTTF
                     NDIGNELDTTKDLNKLNSLGHFLKGSSATLGLQRIAWVCERIQNLGKKRSAGLDEGTV
                     KDDQYYLDLIREALKEAKVEFILAKKELHDYYKTDF"
     gene            complement(<369931..>370857)
                     /gene="TPHA0O01860"
                     /locus_tag="TPHA_0O01860"
                     /db_xref="GeneID:11530617"
     mRNA            complement(<369931..>370857)
                     /gene="TPHA0O01860"
                     /locus_tag="TPHA_0O01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688539.1"
                     /db_xref="GeneID:11530617"
     CDS             complement(369931..370857)
                     /gene="TPHA0O01860"
                     /locus_tag="TPHA_0O01860"
                     /inference="similar to DNA sequence:INSDC:YDL236W"
                     /note="similar to Saccharomyces cerevisiae PHO13
                     (YDL236W); ancestral locus Anc_2.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688587.1"
                     /db_xref="GeneID:11530617"
                     /db_xref="GOA:G8C1X5"
                     /db_xref="InterPro:IPR006349"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023215"
                     /db_xref="UniProtKB/TrEMBL:G8C1X5"
                     /translation="MSTYVAPIKITNGELSEEFIDKFDTFLFDCDGVLWLGTHLLPSI
                     TETLSLLESKGKQLIFVTNNSTKSRKAYTHKFADFGITVKEEQIFTSGYASAIYVRDF
                     LKLQPGKDKVWIFGQSGIREELGLMGYETLGCDDPRLNEKFDAKTSPFLKDGLDNDVK
                     CVVAGLDNDINYHRLAITLQYLQQDGVAFVGTNVDSTFPQKGLILPGAGSMIESAAFA
                     ANKRPAYCGKPNMNMLNTIISAFNLNKQKCCMVGDRLNTDIRFGVEGGLGGTLLVLTG
                     IETEERAVTKTDEYPNPKYYINKLGDLYEFTH"
     gene            complement(<371225..>372526)
                     /gene="TPHA0O01870"
                     /locus_tag="TPHA_0O01870"
                     /db_xref="GeneID:11530618"
     mRNA            complement(<371225..>372526)
                     /gene="TPHA0O01870"
                     /locus_tag="TPHA_0O01870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688540.1"
                     /db_xref="GeneID:11530618"
     CDS             complement(371225..372526)
                     /gene="TPHA0O01870"
                     /locus_tag="TPHA_0O01870"
                     /inference="similar to DNA sequence:INSDC:YNL220W"
                     /note="similar to Saccharomyces cerevisiae ADE12
                     (YNL220W); ancestral locus Anc_2.23"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688588.1"
                     /db_xref="GeneID:11530618"
                     /db_xref="GOA:G8C1X6"
                     /db_xref="InterPro:IPR001114"
                     /db_xref="InterPro:IPR018220"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C1X6"
                     /translation="MVNVVLGSQWGDEGKGKLVDLLVHDYDIVARCAGGNNAGHTIVV
                     NGVKYDFHMLPSGLVNPNCQNVLGNGVVLHIPSFFKELETIESKGLTDASKRLFISSR
                     AHLVFDFHQRVDKLRELELSGASKDGKNIGTTGKGIGPTYSTKASRSGIRVHHLINDQ
                     PGAWEEFVTRYMRLLKTRKERYGNFDYDYEEELNRYKNIYRQKLRPFVTDTVHFIYDA
                     LKSNKKILVEGANALMLDIDFGTYPYVTSSSTGIGGVITGLGIPPRYIETTYGVVKAY
                     TTRVGEGPFPTEQLNEEGEKLQSIGVEVGVTTGRKRRCGWLDLVLLKYSTIINGYTSL
                     NITKLDVLDTFKEIPVGISYSINGKKLDSFPEDLLVLGNVEVEYETLPGWNEDITKIS
                     KYEDLPENAKKYLKYIEDFVNVPVEWIGTGPGRESMIHRDI"
     gene            <373651..>376281
                     /gene="TPHA0O01880"
                     /locus_tag="TPHA_0O01880"
                     /db_xref="GeneID:11530619"
     mRNA            <373651..>376281
                     /gene="TPHA0O01880"
                     /locus_tag="TPHA_0O01880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688541.1"
                     /db_xref="GeneID:11530619"
     CDS             373651..376281
                     /gene="TPHA0O01880"
                     /locus_tag="TPHA_0O01880"
                     /inference="similar to DNA sequence:INSDC:YNL221C"
                     /note="similar to Saccharomyces cerevisiae POP1 (YNL221C);
                     ancestral locus Anc_2.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688589.1"
                     /db_xref="GeneID:11530619"
                     /db_xref="GOA:G8C1X7"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:G8C1X7"
                     /translation="MSSASGSGGRKVLNKNQKFKRDKLRNARNIRTQAVSYDKNNHDL
                     SKEGGSLLNVNNFVNTRAFEIKQLYSSMHQSRRSNATRVFQSLPRKLRRRTASHNIAR
                     IPKRMRNRAKREMNKNNNNNEKVNNISGGLTIAAKKRSKKSLNAKQFYRAKMSIKLLR
                     LFTKTKNLKMLSGPKELTLRNITTRQKIKHFKDILKNKLPSSSTAIACNNQMGSYDNT
                     AVDSLATKTYSRIKYLKRQKHFKWLSTHIWHAKRSHLIKRWGYQIPYSPTQKCYKLTH
                     RIGSSVASSDGNLLQDTSFIGNMIIQNESSTDELSDLIASLTNKKGNKKVYRVHQCYF
                     EGLLYNIDNENSISNAILGPADLLWINENKVLLRLHPSFYEVVFKAILKKVKLNKNFK
                     VYDCRYSIGSINLCGAKTLSSLSSILRTVKNEGKESSSYQTFTKLSKLTDYSILPKQT
                     LFAFRALDPRFVITPKAVTPNNGEINIADICKLNEINKDEVKAILEMLSDPETRKESY
                     KNQATLKQLHKRKEAQSSGEASTNQNIIMFKRDYDPLIPVVIAKRPKTGDWVLLLPWN
                     WVLPFWYQLHKVSKSYHIGLRQNQLLHFESQSLYFPDDYPFTKIGFKENYFYKRDAAM
                     KKWESKPSSHRLNYDKIKEIHDLDLPAIQGEVGDYFSCDWLFLQILINSITYLSKDGN
                     DLISINSSKTMSMNEHCGLRELRSVNDIMEFYNDIKVKPIEEDTPILSLHNIKNKSKN
                     KLNPILFDKLSPQLSIIKTPLPVTPISCILNEKGHPTDNARIYQIPSEHLEHWKSVAK
                     GVYRSNGRRNHELNHPKPNVKDLIGFVTSGTFSLSQGKGVGNGFVHSNYIYNSTHDYV
                     LIRNVGTNVYRVSQWKLINI"
     gene            complement(<377451..>378713)
                     /gene="TPHA0O01890"
                     /locus_tag="TPHA_0O01890"
                     /db_xref="GeneID:11530620"
     mRNA            complement(<377451..>378713)
                     /gene="TPHA0O01890"
                     /locus_tag="TPHA_0O01890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688542.1"
                     /db_xref="GeneID:11530620"
     CDS             complement(377451..378713)
                     /gene="TPHA0O01890"
                     /locus_tag="TPHA_0O01890"
                     /inference="similar to DNA sequence:INSDC:YDL237W"
                     /note="similar to Saccharomyces cerevisiae YDL237W;
                     ancestral locus Anc_2.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688590.1"
                     /db_xref="GeneID:11530620"
                     /db_xref="GOA:G8C1X8"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:G8C1X8"
                     /translation="MIYEKQTDATIPPKLGSNEQTTINQRNNLFLWSKEQQTSLYGTG
                     VKYVENFRKTITRIMPNSLLGQDFYYRLTTSLFLGQTSSQIQSLPKRLLTKDVVPKAI
                     HSHNDYWRELPLFDALTHGATSVEADVWYVKNSYSKYVLAVGHNKAYLDTENTTLYNL
                     YTGPLLALLKPPSALLKKNPELKETGVFYNEPHRTLYLYIDFKTEADVETYELLLKYL
                     APLVDCNLVSYYDLMKEVTVSRPITVIATGNYPEYLATAGGQLSNNLQGSFKRYVFKD
                     LTMLPVIDNETDLDTFGKELEKVVKRYSEDFNALTASISFKNFIKDFTSFTKHDPNDY
                     LRRYIEICHKYNLKVRIWDTPEWPLANAVYVWQKLINYYKVDLLCVDNLDLACSLQEL
                     HTFDEPDIEKSQHKLPSYEIDDNVVNII"
     gene            <379309..>380868
                     /gene="TPHA0O01900"
                     /locus_tag="TPHA_0O01900"
                     /db_xref="GeneID:11530621"
     mRNA            <379309..>380868
                     /gene="TPHA0O01900"
                     /locus_tag="TPHA_0O01900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688543.1"
                     /db_xref="GeneID:11530621"
     CDS             379309..380868
                     /gene="TPHA0O01900"
                     /locus_tag="TPHA_0O01900"
                     /inference="similar to DNA sequence:INSDC:YDL238C"
                     /note="similar to Saccharomyces cerevisiae GUD1 (YDL238C);
                     ancestral locus Anc_2.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688591.1"
                     /db_xref="GeneID:11530621"
                     /db_xref="GOA:G8C1X9"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="UniProtKB/TrEMBL:G8C1X9"
                     /translation="MGCIQKYSSFKVIIFLIQDLNIIFKGNLHMVQPLFTESAKNTYS
                     NDDNLREEKFRVFYGTFVDTPVLGEFRIRYQTSVGVESRSGTILFINENSSDPMGDVS
                     RFDPTIEESNVEVIELKSHFTSFFFPGFIDTHIHASQYPNTGIFGKSTLLDWLIKYTF
                     PLEQSLENDDISKDVYTKIVKRTLSHGTTTACYYTTIHASSAKIMAQICSKLGQRAMI
                     GKVCMDLNSPDFYTEKNVNDSLKSTLDVVDYIFNEIKKPIILPVLTPRFAPSCSRELM
                     LGLSKIASSYPDGLHIQTHLSENIKEINWAKELFPECKSYTEIYNKYGMLSNKTILAH
                     CIHLDDDEIKLIKENKSGISHCPISNSSLTSGECKVRELLNENIKIGLGTDVSAGYST
                     SILDNARQAHLVSRHLAMKYDNREKRDSVKLSVEDVLYLATLGGAKVLELDDKIGTFD
                     IGKHFDTQLIDLNVKGSPVDVFDWQIPDINNGNENDIFTLKELLYKWFFNSDDRNVAK
                     VWVDGLEVISK"
     gene            complement(<381058..>381666)
                     /gene="TPHA0O01910"
                     /locus_tag="TPHA_0O01910"
                     /db_xref="GeneID:11530563"
     mRNA            complement(<381058..>381666)
                     /gene="TPHA0O01910"
                     /locus_tag="TPHA_0O01910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688544.1"
                     /db_xref="GeneID:11530563"
     CDS             complement(381058..381666)
                     /gene="TPHA0O01910"
                     /locus_tag="TPHA_0O01910"
                     /inference="similar to DNA sequence:INSDC:YNL222W"
                     /note="similar to Saccharomyces cerevisiae SSU72
                     (YNL222W); ancestral locus Anc_2.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688592.1"
                     /db_xref="GeneID:11530563"
                     /db_xref="GOA:G8C1Y0"
                     /db_xref="InterPro:IPR006811"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y0"
                     /translation="MKDTSLKLCTVCASNNNRSMESHKVLQEAGYNVNSYGTGSAVRL
                     PGLSIDKPNVYAFGTPYNDIYNDLLSQSSERYKANGLLSMLNRNRKLKKFPEKWQENF
                     KVFDIIFTCEERCFDSVIEDLMSRGGKKNKLVHVINVDIKDDNENAKIGAKSILKLTD
                     LINERYKTQNDENLLEDNIISILTEWQAQYPTLPCLYSPAYY"
     gene            <382854..>386099
                     /gene="TPHA0O01930"
                     /locus_tag="TPHA_0O01930"
                     /db_xref="GeneID:11530564"
     mRNA            <382854..>386099
                     /gene="TPHA0O01930"
                     /locus_tag="TPHA_0O01930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688545.1"
                     /db_xref="GeneID:11530564"
     CDS             382854..386099
                     /gene="TPHA0O01930"
                     /locus_tag="TPHA_0O01930"
                     /inference="similar to DNA sequence:INSDC:YDL239C,YNL225C"
                     /note="similar to Saccharomyces cerevisiae ADY3 (YDL239C)
                     and CNM67 (YNL225C); ancestral locus Anc_2.16"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688593.1"
                     /db_xref="GeneID:11530564"
                     /db_xref="InterPro:IPR021750"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y1"
                     /translation="MEALDVHETLENRSYNKSDNEERKFDYYYNSGVKTSGNLMGFVF
                     PGSPKAMQSLIFRNKNNVDNTDSNDKFRNALEKAKQFDQQNGITYSDVDDSLYDENLL
                     PYNNSIDEDTDKELSDKREGEEVQNREDSSISQPVLSPKSPTQKLHDNSELEQSTPIN
                     SPTNHSRNTNMKSPINSHANSSSLGMESFKQSIKNVKEENNELKKLLEEKVIENNRLN
                     SDILNSRNSNLVLQNKLVDGSDEITNLQDEVNILKDKLSYFEADNKILKNDIYSLESN
                     YDELHRELNEWETKVKTLNKDIQYLQGTNAQLSATNATLSEEKEALTKEKEILLNNND
                     SVTKSNNNLIAEKELLVSERELLISEKEALTKEIEVLLKNNDNITKLNNSLILEKETL
                     LHENEEITKAYNNLISERDDLLIKERELHHNNSTLSSEVGELIKKQTDLETELQEKCT
                     TIKNMTSQVKYFLSEFNHFKKSSEVQETSNIESTDLNDIEVNDDDMTVLEMQSLFKRT
                     LEFIKNHQTEYRYQISTLSTTIAQNMEKKDLEQKILNEKLIDKDNTLEEFKSRLSNYM
                     SKLAELEARLDEINKKESITTNKLIDELNIKNDLNIKIKELEKYVTEKQDQIDSLSKD
                     AKELNEKIVEKVARIKALEANLDTSTNNYENMQQRVNELEDEEKYNIELSSKVAHLSS
                     ELEGLRNQLNEEKITATKLKSEKETQNEKFTELLSFITGFEIFNLTIGALIMKAYKDK
                     EKKLSDAKFNEYISNDENHSYIIGFKNREDEHTMHELQNNLTESEKEVSRLRDTIDTE
                     LKTKINDLTSKSRDLEIETKELKTEIEKKNNRIDEGICEIRDLKTQTTQLMNERKLLT
                     QKNIDLSTELTTVKGNIIDNHEIKLQELAESLNKISTRSDSLQNQLSTKDEEIVELKK
                     NITAIELINNEQKDKFESQTTVLNNLKSKIRKLEGNKYEKVMFDSISKTHPGITKKKY
                     DDLHVDNVDSIDMVQLQNIVKNIILLFEIPLSKLTKKLPLIAIYIKYERTFLLNFANQ
                     LHYQIYNETIDIKRFINIVYTQYIDGISLENLDHPLESCLEDLYIKIKTRL"
     gene            <386610..>388406
                     /gene="TPHA0O01940"
                     /locus_tag="TPHA_0O01940"
                     /db_xref="GeneID:11530565"
     mRNA            <386610..>388406
                     /gene="TPHA0O01940"
                     /locus_tag="TPHA_0O01940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688546.1"
                     /db_xref="GeneID:11530565"
     CDS             386610..388406
                     /gene="TPHA0O01940"
                     /locus_tag="TPHA_0O01940"
                     /inference="similar to DNA sequence:INSDC:YNL227C"
                     /note="similar to Saccharomyces cerevisiae JJJ1 (YNL227C);
                     ancestral locus Anc_2.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688594.1"
                     /db_xref="GeneID:11530565"
                     /db_xref="GOA:G8C1Y2"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y2"
                     /translation="MKTCYYELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEAT
                     DIFANIRTAYEILSDPQERVWYDSHKNQILNDEPIMEDGSYEVDSRVTGVTTEELMMF
                     FNSSLYTRFDDSPAGVFQIAGKIFSRLAKDEIVNGRKLGLPKFDKYVDDHFEEDINTL
                     GYKSACDKYIKEENDTQLFPVFGYSTTEYEHLKSFYKKWNSFNTLKTFSWKDEYMYSQ
                     TYDRRTKREISKINEKARKEARTEYNRTVIRFVGFMKKLDKRMKEGAKEATKKKVEMD
                     KLKRQQQREQYLKEKKSQKTEFTEQTWQEVNDDYWKELEKNFDEFEESDVFTKEEDNT
                     NQTEKDDKQDEVVVYECIICQKLFKSEKQLNNHTQTNLHKKNMKEIRRELKNDSLELG
                     LDEVSDIDDFSSANEDPAETGISASMDMDKINEELEAIQKQLEDLDAITDDEFGDNDE
                     TNGNFDIEVSDVEIDNDSLNDDRKSTVEEFLEKEEDIKDIDEDIMRDEQLNKLLASLQ
                     SSKNNPDDSDSDANWGSSKGKKNNKKNKNNKINRVNVPRLSANNKKSNTIVFTDVCST
                     CGEAFESRNLLFKHVKTSNHALAPNKVKKKNK"
     gene            <388894..>390051
                     /gene="TPHA0O01950"
                     /locus_tag="TPHA_0O01950"
                     /db_xref="GeneID:11530566"
     mRNA            <388894..>390051
                     /gene="TPHA0O01950"
                     /locus_tag="TPHA_0O01950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688547.1"
                     /db_xref="GeneID:11530566"
     CDS             388894..390051
                     /gene="TPHA0O01950"
                     /locus_tag="TPHA_0O01950"
                     /inference="similar to DNA sequence:INSDC:YNL229C"
                     /note="similar to Saccharomyces cerevisiae URE2 (YNL229C);
                     ancestral locus Anc_2.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688595.1"
                     /db_xref="GeneID:11530566"
                     /db_xref="GOA:G8C1Y3"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017298"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y3"
                     /translation="MQNTNIGNVSQLSSALRHVNINNNESAGNMNKNGSNEILFGGND
                     MINNNGDNDKNNIMQQQLNQQQSNQQNGTEQQQDQQLQQGHHTNAHQQVHLEDMLHPF
                     TIQQQQQQQQAQQQAQNILGSEYNPAQHSRITQYFQNLPVEGYTLFSHRSAPNGYKVA
                     CALSELGLQYNTFFLDFATGEHRAPEFVSLNPNARVPALIDHSLENLGIWESGSIMLH
                     LVNKYYKETGDPLLWSDNLAEQSQINSWIFFQTSGHAPMIGQALHFKYFHSQKIPSAI
                     ERYTDEVRRVYGVLEVALAERREALVMELDTENVASYSAGTTPISQSKFFDYPVWLVG
                     ENITIADLSFLPWNNVIDRIGINIRVEFPEVYKWTKHMMRRPAIIQALRGE"
     gene            <390761..>391945
                     /gene="TPHA0O01960"
                     /locus_tag="TPHA_0O01960"
                     /db_xref="GeneID:11530672"
     mRNA            <390761..>391945
                     /gene="TPHA0O01960"
                     /locus_tag="TPHA_0O01960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688548.1"
                     /db_xref="GeneID:11530672"
     CDS             390761..391945
                     /gene="TPHA0O01960"
                     /locus_tag="TPHA_0O01960"
                     /inference="similar to DNA sequence:INSDC:YNL230C"
                     /note="similar to Saccharomyces cerevisiae ELA1 (YNL230C);
                     ancestral locus Anc_2.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688596.1"
                     /db_xref="GeneID:11530672"
                     /db_xref="GOA:G8C1Y4"
                     /db_xref="InterPro:IPR010684"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y4"
                     /translation="MITSLQEVAELHLVRNHKLVEDTGNMPYRLLKRVLKQMKKDQLI
                     RVEQKNVILIFDDNELWLNFLKQDFPTSIHDSFTTKKNNIINYYLDFIKKNDLKFYNN
                     NSSYIEGILKMKVVKDLSSNKYLIPYRMLYLKYEIDEIRKAEESTERLRIQMREIQKK
                     REEKQTIQVDHSFYINNKSSRKSNKNRYVNSARSHVFKTVLNGRTTIMNNFKNTDGSI
                     PRNKNHRIAFGGQVGGTFNKPEYENDISEEHQSPIDKNESVPVSNKSDNLKRSFDSMS
                     SPVKRRPGITNIFLNKTRTSDMSRSQVRKKFDLSSKEQTIHSKVTETKITSENSGSDP
                     IMEMKFFSKRSPKYVSNNRPTLGTKKKSRIFSSNQQDFSSGPSADSSKVYIHVKPSTK
                     HR"
     gene            complement(<392083..>393171)
                     /gene="TPHA0O01970"
                     /locus_tag="TPHA_0O01970"
                     /db_xref="GeneID:11530673"
     mRNA            complement(<392083..>393171)
                     /gene="TPHA0O01970"
                     /locus_tag="TPHA_0O01970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688549.1"
                     /db_xref="GeneID:11530673"
     CDS             complement(392083..393171)
                     /gene="TPHA0O01970"
                     /locus_tag="TPHA_0O01970"
                     /inference="similar to DNA sequence:INSDC:YNL234W"
                     /note="similar to Saccharomyces cerevisiae YNL234W;
                     ancestral locus Anc_2.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688597.1"
                     /db_xref="GeneID:11530673"
                     /db_xref="GOA:G8C1Y5"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y5"
                     /translation="MNTVYKDLNSGTIGLTIDEDNSSSDELEHLYNNTDSPKSVSIDD
                     EPFGSYVTEKEFDGVKNIGNIIGNESNQNEFEQYKLTINLCLTNNEKQLLRLSWDLIN
                     HYSGDLNAFPYDTLDIRELHNHISKATPEELMDKYGFERKPSEYFYDQFYNNLIEMNP
                     RLEIEFPTLRHQAKGFSFVLEKALDNFDDLDAIDIYMEKLGKRHARILGINRVSFELM
                     GEVFSKTINERLGEYHTLEIQKAWSKLYIYLANRIIASGIDPIINSIRQDELVLETPV
                     FYKENEECFRASLDESSEYNLTNILSSIHNNPNSNKTLKLKDNVKSGLSETKLQQSSD
                     QSRYNTYNQNGALKYPTNTPQKKRCAIM"
     gene            complement(<393699..>396842)
                     /gene="TPHA0O01980"
                     /locus_tag="TPHA_0O01980"
                     /db_xref="GeneID:11530674"
     mRNA            complement(<393699..>396842)
                     /gene="TPHA0O01980"
                     /locus_tag="TPHA_0O01980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688550.1"
                     /db_xref="GeneID:11530674"
     CDS             complement(393699..396842)
                     /gene="TPHA0O01980"
                     /locus_tag="TPHA_0O01980"
                     /inference="similar to DNA sequence:INSDC:YDL240W"
                     /note="similar to Saccharomyces cerevisiae LRG1 (YDL240W);
                     ancestral locus Anc_2.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688598.1"
                     /db_xref="GeneID:11530674"
                     /db_xref="GOA:G8C1Y6"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y6"
                     /translation="MQNFSTSSQLVNNHDHACVNILSQKDTNPISNNNNNNNNNHVHN
                     KTSVDNRKFCERCKKPIIQGDKKGKSTLKALGKYYHDECFNCEDCNTPLKRKYFPFTL
                     KNENTTILLCQYDYFKRNELLCAVCDQPLRGLYYTAFGKKYDEKHFSCVICSEPCGIK
                     KCFIDNEKLYCKYHFLKFHSKLCNGCEYPISDQYIEFLKGDEVNCWHPECYGIHKYWH
                     VTLSSEKLALPEIKKILSSELDNNTDDDIDSLKRDLDAKMNIFNNLLSKVWSTLYKFE
                     EQTAACISDMFQHLASIDQIKGLESCALLVLKTECLFKALGTLDNEIPTDENEDNTTI
                     EEYQDKNFSLRKISKNLTTKIMIYLQILRKINLDPATIKSQMPTFMSIITGLAHFLKL
                     IMRYGLFVVLEKNKITNSNTPLMKYLKALRKYEEYSSQPFNYIKLSIKVTDNCYQCNK
                     YIQEGCIKYHDKRWHAKCFNCFKCNNHIGLDELSDATFNQQQNTILCGNCSIEDPIST
                     SGFQYVTRLIQLIFLLKIGLVKSKAVTEMQLKYNKNSNKSTVNEAVMMQQTYIRTLND
                     ISKLKSKRESVSVSHKQNARLSMLLTTTDENTEEPTITLEDKLISSGNEENNTKVSFL
                     PENVFSNGRSLTLDDISRIVAVEQARELRPNAFTHFKKLKETDEESVRVVAKESGSFY
                     SELSNSDSLILQAIALSLLQNEKSMEKLMVPSTLIPSIPKGDKSNSSNKFWNIIKIKR
                     NKETKKKKIKKTFGVPLDYLCESWGIQSDLGVGPSKIQIPIVVDELIFSLRQMDLSVE
                     GIFRINGNIRKLNELTLEIDNNPGKTPDFSKETAIQLSALLKKFIRSLPEPLMSRELY
                     DMWINAARIESETEKRKFMSLLYSILPVYNRNVLEVLLSFLFWTSSFSHIENQMGSKM
                     DIHNLSTVIAPNILYNGSGDNNIPLKSASTNMDTKHNTYRDAFAQNEGENYFLAIEVV
                     DYVITNNIELAMVPRFLIRLLEEVKQLNYTDYESIKRFVLEKINSGAIEFDIDQQPLR
                     SETVKTVHSSTIIHVKE"
     gene            complement(<397743..>402548)
                     /gene="TPHA0O01990"
                     /locus_tag="TPHA_0O01990"
                     /db_xref="GeneID:11530675"
     mRNA            complement(<397743..>402548)
                     /gene="TPHA0O01990"
                     /locus_tag="TPHA_0O01990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688551.1"
                     /db_xref="GeneID:11530675"
     CDS             complement(397743..402548)
                     /gene="TPHA0O01990"
                     /locus_tag="TPHA_0O01990"
                     /inference="similar to DNA sequence:INSDC:YNL242W"
                     /note="similar to Saccharomyces cerevisiae ATG2 (YNL242W);
                     ancestral locus Anc_2.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688599.1"
                     /db_xref="GeneID:11530675"
                     /db_xref="GOA:G8C1Y7"
                     /db_xref="InterPro:IPR015412"
                     /db_xref="InterPro:IPR026849"
                     /db_xref="InterPro:IPR026885"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y7"
                     /translation="MPFGFTGSIQKKILAYILNKISILSNVDLSDVDISLGPNSKFTF
                     HKVKLNTDDIKVTNFIVQEGSLDELDIQLTISAVLNIVARNMTVIIKSEKDLLHSVTA
                     NQDDGQLLFSLSKSLNDLTTSMMLQLPTSLDLNALEEFNEFEDDTVRSNDATDTELAQ
                     TLKRTLSTTTNDNSGHSNIDGGNANSKGTQSTLQMMKKKVLSSFLSKFKLNIIDVKII
                     FQLDDANENYLEIKVDDILLTNDEMGTRELTLQTLKIYNARKNSSKYSGSPLAQTSMV
                     DSMSMYMSAMETFESTTSLKNNRISSSSIIEAAEQTINILEILSIEGLSLKLTGFNAV
                     DDFKFLNSSLTVKKVSLYYYNLLNLEPALFTLLLRNIFACTEKENDSKVQSPEKFSNY
                     RRFQQEQNISISVNKFTLLLLDFELMISEHLSLKFENFHLSSSEFDEYEINIQSLEPV
                     KVDSKIQKKNNDCNSVMDVLKIKYSSNNAIIDVTKDLEYYLDKTAILDILSAYIKTNA
                     LVERYRKVNCYTALSSKAPLNIELKTKTVNIYLLLDNEKLKFELAPIQFTSSDTKFQL
                     NNIEVYRCLINNDTDHILTIKNIEGRNRYPPIQILSQNTSFKKSSIFTNLLLSIDGFY
                     IKESYPKLHRTIKEFMSMAFEYESTIPQRNDNVNHKSCKRSVRVLNCSNIKLRETKNA
                     NLVLKIKTVQLDLHQFLNSKFGSLNLSLKENEVIVNEDGELNLCSIKVTASRHFDNSS
                     YSLVKSIAIDSNTLPAIIVNKLSTNKIQIIMKNMEFVFCASFMELLENHKVAHEHEKP
                     NHSVNEKLIIEARMTYCSLILKPFRIKPALLIFFNDIHLNYNTANSYLKCNSTESGIF
                     LIDDISQLKNKKNTSNSCLSDYYYNEGFINIGKFNLLSAQLKFKDNGSLIKISSELLQ
                     LSLCSDSFHTLLFLLIDFKIPLTFPDNLKYKNDFAKNINTMKDVDQSFFDPSKIRLHT
                     DVDNIQIDNDGVIINEFLDQSYPSSEVYESGIDALPEWESTTSSLFTLSNSLECEENY
                     MDNISSVHSSRSTQPENLNIDFNINRISIKFFDGYDWKYTRKQINKTINIVGNKVMES
                     EQVDDTQIQLQTTVFDSILIATTKSDVDKLKTTVNNDIQSEKNPIQPINKANLKPSKI
                     HKIAIEADSISIKAVVFSSITQESNNHNPIILNSFDISVDKFTVLDNVLGSTWNKFLS
                     MLRYEKWPSSKSMLNIKYSSIKPIGSLEAVETIIDVEAAPLRLHVDQGTLDFLLRFLE
                     FKDPRFELVDDYPELTFIQKFSSNSVKIVIDYKPKKYNYSGLRSGRSEELVNFFILEG
                     ATVTLKAINLYGVNGFERLGFALKENWVPDILSNQLSGIIGGVSSLKPAVTLGSNFKS
                     AITVPVREYRQEGNASRSIKKGVNIFFKTTGGDFIRIGAKMVSGTQTILENTEEFFGG
                     KGSAGRIYSIPETVVNFDSILKEDQLIGGSNPKVRNRDPSALVIDSTKTEDGYPRVIS
                     LYADQPLNVHQGLEEAYHALEKNLYIAYDTIKDKTKVSNGENDFSITNDYGPKLTALS
                     AAKAAPIAIIRPLIGATEAISKTLLGISNQLDKQQHLNYEDKYKPQIRK"
     gene            complement(<404570..>406432)
                     /gene="TPHA0O02000"
                     /locus_tag="TPHA_0O02000"
                     /db_xref="GeneID:11530676"
     mRNA            complement(<404570..>406432)
                     /gene="TPHA0O02000"
                     /locus_tag="TPHA_0O02000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688552.1"
                     /db_xref="GeneID:11530676"
     CDS             complement(404570..406432)
                     /gene="TPHA0O02000"
                     /locus_tag="TPHA_0O02000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688600.1"
                     /db_xref="GeneID:11530676"
                     /db_xref="GOA:G8C1Y8"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018456"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y8"
                     /translation="MSSEKEFSDVTVHASHPSEYKYDAIYSGEKELDSSHDVTFNIDD
                     KVENDTNEEELDEFAVDDEADPYNDEWGYVEPTEEEMATLKHVAGHIPYRCWLIAVVE
                     LSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLSYFFQFWCYITPIFGGYM
                     ADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGFVTAIILIGIGTGMIK
                     ANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLMINIGALSVLATTE
                     LESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFKVTFIVCKNKFN
                     FDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMINNFITQAGTM
                     ELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMCGSCAMVW
                     AAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASVTGLEF
                     AYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAGCLF
                     WICFHHYNDIDADMKAIDFVEDDMINASGDVEKTASSGFSTVEPIISMRSAKSL"
     gene            complement(<410334..>412022)
                     /gene="TPHA0O02010"
                     /locus_tag="TPHA_0O02010"
                     /db_xref="GeneID:11530705"
     mRNA            complement(<410334..>412022)
                     /gene="TPHA0O02010"
                     /locus_tag="TPHA_0O02010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688553.1"
                     /db_xref="GeneID:11530705"
     CDS             complement(410334..412022)
                     /gene="TPHA0O02010"
                     /locus_tag="TPHA_0O02010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688601.1"
                     /db_xref="GeneID:11530705"
                     /db_xref="GOA:G8C1Y9"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8C1Y9"
                     /translation="MYVESFKNTFAVDVLEYFNLVTIEEEIPDINAVEQRVNPSDCSV
                     ETKKENDVQESFQVSSDFESLNNAEKPIVDIEAGSADQESQKQKTVEERNPFLLEWDD
                     PSDPDFPVNWSKKKRGAILLQIMLLTSVTYMGSSIYTPGQLQIQSEFGVGHVVATLNL
                     SLYVLGYGLGPLIFSPLSEFSLLGRQHLYTVTLFIFTILQIGCATVHNFGGLVVLRFL
                     SGVFCSPSLSTGGASISDILAPEVVPLFLGLWAVGAISAPVLAPLLGAAMVVAEDWRW
                     IFWFLLWLCAFTLVLLMLFMPETHHGNILYRRARRLRKQTGDDRWSTASAEKEKKLEL
                     GAFLLTAVYKPIKIIMREPIIAAIDAYIALIYGIFYLFFEAFPLVFGGIYNFTLIESG
                     LAFLGFQVGCVIIYPFYIIFLAKYIAPKMQNQTFVPEDFLVMTMIVAFFLPAALFIFG
                     WTAGIHWILPIFAEVLFVINSFGLFQSTFAYMALSFPDHVASVFAGNGLARAGFACAF
                     PLFGQAMYNNLGSEKYPVGWGSSLLGFISIVMSVIPFLLYKYGATLRSKSKFTD"
CONTIG      join(HE612870.1:1..413379)
//
DBGET integrated database retrieval system