GenomeNet

Database: RefSeq
Entry: NC_016535
LinkDB: NC_016535
Original site: NC_016535 
LOCUS       NC_016535             394523 bp    DNA     linear   CON 02-JUN-2017
DEFINITION  Tetrapisispora phaffii CBS 4417 chromosome 16, complete genome.
ACCESSION   NC_016535
VERSION     NC_016535.1
DBLINK      BioProject: PRJNA79335
            BioSample: SAMEA2272094
            Assembly: GCF_000236905.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Tetrapisispora phaffii CBS 4417
  ORGANISM  Tetrapisispora phaffii CBS 4417
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Tetrapisispora.
REFERENCE   1
  AUTHORS   Gordon,J.L., Armisen,D., Proux-Wera,E., OhEigeartaigh,S.S.,
            Byrne,K.P. and Wolfe,K.H.
  TITLE     Evolutionary erosion of yeast sex chromosomes by mating-type
            switching accidents
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 108 (50), 20024-20029 (2011)
   PUBMED   22123960
REFERENCE   2  (bases 1 to 394523)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 394523)
  AUTHORS   Byrne,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-NOV-2011) Smurfit Institute of Genetics, Trinity
            College Dublin, College Green, Dublin 2, IRELAND
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to HE612871.
            Accession numbers for all the chromosomes/scaffold in this genome
            project: HE612856-HE612872.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..394523
                     /organism="Tetrapisispora phaffii CBS 4417"
                     /mol_type="genomic DNA"
                     /strain="type strain:CBS 4417"
                     /db_xref="taxon:1071381"
                     /chromosome="16"
     gap             1331..1642
                     /estimated_length=312
     gene            complement(<3777..>7208)
                     /gene="TPHA0P00100"
                     /locus_tag="TPHA_0P00100"
                     /db_xref="GeneID:11530876"
     mRNA            complement(<3777..>7208)
                     /gene="TPHA0P00100"
                     /locus_tag="TPHA_0P00100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688554.1"
                     /db_xref="GeneID:11530876"
     CDS             complement(3777..7208)
                     /gene="TPHA0P00100"
                     /locus_tag="TPHA_0P00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688602.1"
                     /db_xref="GeneID:11530876"
                     /db_xref="GOA:G8C1Z0"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z0"
                     /translation="MKISHLLILYPILNIALAALSATKNNNEITSTSSNSTTTIDSAE
                     PSTYMPSSYVFSGWSSSATSTYSTGTKTNTDYNGDEVLTNIFYVYTPYFLYSTTVTYT
                     GDVTETSTANWWTNYYVNDGMTTAIITYMIYVPSHTATTMSSSSSTTSITKPSTYMPS
                     SFVYTGWSSSATSTYSTGTKTNTDYNGDEVLTNIFYVYTPYFLYSTTVTYTGDVTETS
                     TANWWTNYYVNDGMTTAIITYMIYVPSHTATAMSISSSLQHSSYIFRSNRDISIPTII
                     TGKLRTTAAISLQSGEETSHHSSNQFNSSIGAEESTESLTDISSSYIIESLSENTFVP
                     SLGSGETVSSASSLSVTRTFSIKESVVSSQYTEISVGSNYIPSSLVASSDRSDCVSFI
                     SSTSIFRGGEVAAKSRTRTKPTSGKSEQSSSGYDEQSSSGYGEQSSSGYDEQSSSGYG
                     EQPSEASAAHSSEDANGSSLEAATETSSTYGEQSSSGYGEQPSSGDVSVYISSSVSES
                     ASDVTGSINLESDPGESLEYSVISVESSYTPSSLVASSDRSDCVSFISSTSIFRGGEV
                     AAKSRTRTKPTSGKSEQSSSGYDEQSSSGYDEQSSSGYGEQPSEASAAHSSEDANGSS
                     LEAATETSSTYGEQSSSGYGEQSSSGYDEQSSSGYDEQSSSGYGEQPSEASAAHSSED
                     ANGSSLEAATETSSTYGEQSSSGYGEQPSSGDVSVYISSSVSESASDVTGSINLESDP
                     GESLEYSVISVESSYTPSSLVASSDRSDCVSFISSTSIFRGGEVAAKSRTRTKPTSGK
                     SEQSVTATEAMPTAELRTSGASNCKAFSKEIFHCMGSARVDAISRTRSTSSFKYSEES
                     ATGVGSELFTSIASENTATLINFTTTIVNARLTVISDVFESSESSISVLEREKSTIPS
                     TDSSFTTINSTHSVENNYTTYFATHKNVHFSDVPYSTEITTTSNGSSASEFISYFLTV
                     YSYDMPTAASSTAASSTVASSTVASSTVASSTAASSTVASSTVASSTVASSTVASSTT
                     DESSSAEVVPYYLTTDSNGKDPVTSTTYPAVSNVDVNTNTIITSRYIDISLYTTALSS
                     RTLSTLPYTNGNSISSENLTTSDASVSYEAAGSNIMVHRSSMISFIGFIFMIVIA"
     gene            complement(<18228..>21170)
                     /gene="TPHA0P00110"
                     /locus_tag="TPHA_0P00110"
                     /db_xref="GeneID:11530749"
     mRNA            complement(<18228..>21170)
                     /gene="TPHA0P00110"
                     /locus_tag="TPHA_0P00110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688555.1"
                     /db_xref="GeneID:11530749"
     CDS             complement(18228..21170)
                     /gene="TPHA0P00110"
                     /locus_tag="TPHA_0P00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688603.1"
                     /db_xref="GeneID:11530749"
                     /db_xref="GOA:G8C1Z1"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z1"
                     /translation="MQWSNTLLGQLLVPFLFLINYTKAYEYHCDIPALSSGTAGFRAR
                     FFPYYYPEYSNLYSPLDYLFDVYDEINNEIATTSGVTDINFSYTDHSAGTIAWGEVYG
                     VPITISNFTLELTGYFVPPVSGNYAFEFFDTDDSALLLFANPSAFTCCNADESAADYD
                     DISLNAVNQWATNERRYIEGYLEAGYAYPLKIVYFNIGYIGILNLQYTDPEGEIHTDW
                     KEAVTFYDNLETDCPATPQATSTTTSYWTGSVTTTFNMITTTYVGTDDLTTTETIYTV
                     LTPTKADTDYTYTHGTNSFVTTVSTTVKTKTGMDGEETTETTYFIETPSDESIASTAT
                     KWTGTYVTTYSTLISTSTGEDGFGTTETTYFVNTPTAETTFYSTTAGSGSTIRTYSTI
                     ISTYTGIDEIETTETTYFVETPTYDTTTTHFTEWTGKTTKTYWTITSITTGDDGYEST
                     TTIYLVETPVIHESHVSYTEWTGTFISTYSLTTDVHLGTDGILTSDTIYYIETPFFEE
                     FTTTYTEWTGTFVSTYSTTVNYYTDSDGIVTSETTYFVETPYYEIQTTITTGWTGTYV
                     NTYSTVTSFFTGSEGFPSTETTYYVQTPYERTTTTTYTHGTVTEDATVSTILSTTVGT
                     DGETTIETTFIVETPSNEEITTTYTQSDVTQTSTISTIVTTVTGSDDKPTTETTFVVV
                     TPIDKTTTTEYTHGTVTADTTVSTILSTTVGTDGETTIETTFIVETPSNEDITTTYTQ
                     SDVTQTSTISTIVTTVTGSDDKPTTETTFVVVTPYTSNYYSYVNSTNSISTEESSNIS
                     DVETTKFDITSRDSTKSQTTEIANSTYSTLTKTKSSTFTSYTTVSCETITDSSGSIIL
                     TATHTITCTETECIYQSSSGNIVEDKTTGITDVTTTADNIANDQTNKLSSTVQTDGST
                     AAATTSFNSKKSSTTSASTPLLQYEGSTSSSSAHTIEVSSYLGLANNNVSHSLISMVL
                     MFSFSLFL"
     gene            complement(<23525..>25201)
                     /gene="TPHA0P00120"
                     /locus_tag="TPHA_0P00120"
                     /db_xref="GeneID:11530750"
     mRNA            complement(<23525..>25201)
                     /gene="TPHA0P00120"
                     /locus_tag="TPHA_0P00120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688556.1"
                     /db_xref="GeneID:11530750"
     CDS             complement(23525..25201)
                     /gene="TPHA0P00120"
                     /locus_tag="TPHA_0P00120"
                     /inference="similar to DNA sequence:INSDC:YFL040W"
                     /note="similar to Saccharomyces cerevisiae YFL040W;
                     ancestral locus Anc_8.22"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688604.1"
                     /db_xref="GeneID:11530750"
                     /db_xref="GOA:G8C1Z2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z2"
                     /translation="MSENIHDEELERSSQNSHLSTPSVKEDYEDIKAQTPDDLNMEDP
                     APKSSKSKYLSASLLCLCVAFGGFIFGWDTGTISGFVNQTDFLDRFGSKHSDGTPYFS
                     NARTGLIVAIFNIGCAIGGIILSKGGDLYGRRIGLFIVVTIYIIGIIIQIASIDKWYQ
                     YFIGRIISGLGVGGIAVLCPMLISEIAPKQVRGSLVSCYQLMITAGIFLGYCTNYGTK
                     NYSNSVQWRVPLGLCFAWALFMLFALTLVPESPRYLVEVGRLEEAKRSLAKSNRCTIE
                     DPIVIEEYDLISAGVEAEKAAGDASWKELFSTRSKIVQRLTMGCMIQCLQQLTGNNYF
                     FYYGTSIFKSIGLEDSFQTSIIIGIVNFASTFVALYTVEKLGRRRCLLWGAASMMACM
                     VIYASVGVTSLYPNGDDQPSSKGAGNCMIVFTCFYIFCYATTWAPVAWVITAESFPLR
                     VKSKCMSIASAANWTWGFLIAFFTPFITSAINFYYGYVFMGCLVFMFFYVFLIVPETK
                     GLTLEEINELWEEGVLPWKSAQWVPASRRAVDYDNELLTHDDKPWYKSMI"
     gene            complement(<26744..>28012)
                     /gene="TPHA0P00130"
                     /locus_tag="TPHA_0P00130"
                     /db_xref="GeneID:11530751"
     mRNA            complement(<26744..>28012)
                     /gene="TPHA0P00130"
                     /locus_tag="TPHA_0P00130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688557.1"
                     /db_xref="GeneID:11530751"
     CDS             complement(26744..28012)
                     /gene="TPHA0P00130"
                     /locus_tag="TPHA_0P00130"
                     /inference="similar to DNA sequence:INSDC:YFL048C,YLR080W"
                     /note="similar to Saccharomyces cerevisiae EMP47 (YFL048C)
                     and EMP46 (YLR080W); ancestral locus Anc_8.2"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688605.1"
                     /db_xref="GeneID:11530751"
                     /db_xref="GOA:G8C1Z3"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z3"
                     /translation="MKFLLYFLTIVCLAVGHSIDKAKSSMNENHSLSYLLGVKKIPPT
                     WVSGDGTVLEEGRIVLTPKKSSKGSLWSRSVYQLKDSFTMEWTFRSVNYFGDSKGGIS
                     FWFISDSVPHADKSLYNGPQKYEGFQMLVDNKSKFKSTLHVLLNDGSETFKEDDIHLR
                     AIGKCLLSYQDQSVPSTIRLSYSSQDNLFKVQVNNKVCLQTSKVKLPKGNYFIGVTAA
                     NYNNDESFEILQMKMHDVLTEESLIPNVNQMPQPQLLTKIVDKATGNEKLVTKAKFDS
                     KSKQFSSNEIYKKLDKIEGKILGNDISNLEEMLTELMKTQELLASSIGKLAEQFGSHT
                     VQKAQNPNDGSIDPEKYKDIFALNEKLEKMIADQQKLRDSASHNNNTSHLDSIVNKLT
                     LFLIPLIIFMCVMTYYTIKIKQELLKTKLL"
     gene            complement(<28437..>28847)
                     /gene="TPHA0P00140"
                     /locus_tag="TPHA_0P00140"
                     /db_xref="GeneID:11530781"
     mRNA            complement(<28437..>28847)
                     /gene="TPHA0P00140"
                     /locus_tag="TPHA_0P00140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688558.1"
                     /db_xref="GeneID:11530781"
     CDS             complement(28437..28847)
                     /gene="TPHA0P00140"
                     /locus_tag="TPHA_0P00140"
                     /note="ancestral locus Anc_8.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688606.1"
                     /db_xref="GeneID:11530781"
                     /db_xref="GOA:G8C1Z4"
                     /db_xref="InterPro:IPR011893"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z4"
                     /translation="MSFPKIDVLFCTKCKWNLRAAWYAQELLQTFDDKLGQVALVPAE
                     TGEFKILAYETKQDYIDDKAVTLWDRKVDGGFPDSKFLKQRAKQLVFRDSVKVGAHIE
                     RVTATQGLVSEDSTARNGQYSSDNSKQCTECQDN"
     gene            complement(<29084..>29710)
                     /gene="TPHA0P00150"
                     /locus_tag="TPHA_0P00150"
                     /db_xref="GeneID:11530782"
     mRNA            complement(<29084..>29710)
                     /gene="TPHA0P00150"
                     /locus_tag="TPHA_0P00150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688559.1"
                     /db_xref="GeneID:11530782"
     CDS             complement(29084..29710)
                     /gene="TPHA0P00150"
                     /locus_tag="TPHA_0P00150"
                     /inference="similar to DNA sequence:INSDC:YLR079W"
                     /note="similar to Saccharomyces cerevisiae SIC1 (YLR079W);
                     ancestral locus Anc_8.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688607.1"
                     /db_xref="GeneID:11530782"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z5"
                     /translation="MMEPSTPPRSSAAQFETPREHRANGPVTPAEGRRPLQFNLKASL
                     LPPPVQQQQLKSPEYTPRRGSIKRRLGHEESVQMGAGSNLFGKLAEATLDQKLHKTCP
                     GTPSHKIIADHNIEDYVQAPRPDDADDDDFEDVVQAPLANPFANESTLTKEDYRRRHE
                     QLLTDHPELQSTITYCNKDGDVVKQKTLTQEEQDRFKPKKLFADQLDK"
     gene            <30233..>30892
                     /gene="TPHA0P00160"
                     /locus_tag="TPHA_0P00160"
                     /db_xref="GeneID:11530783"
     mRNA            <30233..>30892
                     /gene="TPHA0P00160"
                     /locus_tag="TPHA_0P00160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688560.1"
                     /db_xref="GeneID:11530783"
     CDS             30233..30892
                     /gene="TPHA0P00160"
                     /locus_tag="TPHA_0P00160"
                     /inference="similar to DNA sequence:INSDC:YLR073C"
                     /note="similar to Saccharomyces cerevisiae YLR073C;
                     ancestral locus Anc_8.13"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688608.1"
                     /db_xref="GeneID:11530783"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z6"
                     /translation="MAVVGSPKHPLSGPGSMRTAALRTDATNYKFNPQMPLRVYLKIC
                     VDMLNRAQDEFQAGNVNAAYMYYFRYVDLVTNKLARHPHCMAGASQVGHETYIHRQEY
                     LQLVKLELPCVMRIVEDLQRKIDVAHEKSQLSLAKNIAKTKQHAQAQGTFKLPSNFNE
                     NKFNQSLSFLNNSAIETITPKQEAKVGSNSASNSKTASATADDKALIYPELPQLNTAS
                     Y"
     gene            complement(<31006..>33000)
                     /gene="TPHA0P00170"
                     /locus_tag="TPHA_0P00170"
                     /db_xref="GeneID:11530784"
     mRNA            complement(<31006..>33000)
                     /gene="TPHA0P00170"
                     /locus_tag="TPHA_0P00170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688561.1"
                     /db_xref="GeneID:11530784"
     CDS             complement(31006..33000)
                     /gene="TPHA0P00170"
                     /locus_tag="TPHA_0P00170"
                     /inference="similar to DNA sequence:INSDC:YFL042C,YLR072W"
                     /note="similar to Saccharomyces cerevisiae YFL042C and
                     YLR072W; ancestral locus Anc_8.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688609.1"
                     /db_xref="GeneID:11530784"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z7"
                     /translation="MSEGLKSDREGELVDVNAVVDETQTTNDVVDNDSQNDEGAASVS
                     GDVEVKEPQSPSVSSPSFIQMFSPFSYGKSADSLGNIKEENVDGKYGNLDGGSGSKPT
                     SPVIISHRRQPSGNVRKNSKRTNSIDSAMQAADSTSVTVSRKTSNVSVKDIATAVETP
                     LSINTDVAESKKVDDNDQESLEPLKSSTSKQHTYSDDKYKDTDFKYASESRNIEFHEV
                     FKTTPLKDRLLDEYHCTLSREFLYQGKLYISENYLCFNSSILGWVSKLVIPFKDIIFV
                     EKTSAAGLFPNAISIETTMGKTQFNGFSSRDETFALLKEVWARVLIEDGEINSNSSRE
                     LRLKNDSKESFSESNALIIDRAINSIDEKTPDSDISRLQESDVTININKFKKNSGYTY
                     KGPYVGETKTKSFETEGNEHALVDIPIDVAPGLAFKALFDDNITNFWTDFAAYSGDSF
                     EYSEIPRFDKTDKEGHQYREYEYMKKLNYSVGPSSTKCYAKTTIIHLDYEDYIEVVNC
                     VSTPDVPSGGSFNTMTRFIFVWDGQASTTSRFKVSFWVDWIGSSWIKSLVESSCQSGL
                     SANFEKMKGFIVDYIHNIVSPQLMSLEMACGGTESDAASSVVNSESKTVFDMEYMGNI
                     ELQVNQLRDTCSRMQKDIRMLTRLIFALLVFIVAEVLLRK"
     gene            <33456..>36449
                     /gene="TPHA0P00180"
                     /locus_tag="TPHA_0P00180"
                     /db_xref="GeneID:11530790"
     mRNA            <33456..>36449
                     /gene="TPHA0P00180"
                     /locus_tag="TPHA_0P00180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688562.1"
                     /db_xref="GeneID:11530790"
     CDS             33456..36449
                     /gene="TPHA0P00180"
                     /locus_tag="TPHA_0P00180"
                     /inference="similar to DNA sequence:INSDC:YLR071C"
                     /note="similar to Saccharomyces cerevisiae RGR1 (YLR071C);
                     ancestral locus Anc_8.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688610.1"
                     /db_xref="GeneID:11530790"
                     /db_xref="GOA:G8C1Z8"
                     /db_xref="InterPro:IPR013947"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z8"
                     /translation="MPDVVEHTAPPLPHVEINQAPLSMVIRNLTVFTIKELSQFIKTN
                     VHVNTNSQEPSSARKINFLQLVIFLRNQFLKLYVLIKWCRTIKGNNFHVLIDLLNWFR
                     TANMTVNNCIWALKNNLITMTNAKLPNADLTTALEVLSLGRPNLPTHNFKMSGEDSST
                     VLENGALKIPPKLILRRLYDLNLNISIKLSMMDIPPQMKNYRIKDGRVFITVLDEFEI
                     QLATIDSQHPLFFVDLTLLLNNQYLHLNKPRFEKVINDLLHKTEEPLYELYIFLHKYV
                     VTLKLYLIHIELTSLESNGKFFGGNLVHRYDAKKSVITVRYWLNARMGNKGKITIGID
                     KESNNLVLRWNNEIARGINALPVVYTNILSNIENILDEVMFNHSHLIRAELLSNGIFQ
                     EDEENSDVLLFQIPTTCISVAPVQLKIDLISGIFYFKNSTTLLQSYAQQINKSDSIKE
                     LTLVLQRLRLDKITYILQNMFEKTGWVCSKVVELEKPIKSHVNTNRSKDNSFNLLQKD
                     IFISLPNWPTHWYLIITVVSSKTSCIIEKRISKILAVKGKWELKYLEDSSVTANLETI
                     TYQKIMNLQRTILHKIINHMLIDSLNQLKIKNKICSSSAISSQLPKYVVDDQSIKEGS
                     IFQSTSQKQNSLGYISVIALELTSFLDNSDTAGQIFESSLLLKIDYGKSQIKLFGKFV
                     IDTMMTKFEPENLNINFIKDDPKAFYLDATFMNMNNIVQYLSKFKNNLMQLVSLTDVV
                     ERLRKNFESEHFKILNLQPNEVAFKYFEKSTNEPDCTIKIISNDEVIENLQVQLSPSS
                     PQYIIQKFLDDSHMHFHFIFNYLQFTSSLFTSLDLIQNEKKSGLYQNFTKVTVGLHNL
                     NEYQLMYHNPEAGTKISITIELKIVSHNGQKKIQYYVHFSEDNISTKSLAYPLVHKIR
                     QQVFILDKESKDTTLHKNTVRLVNGIACDATSIEAVLLEIHGILKKDSNISDSGTNIT
                     AANLDLGATENADTLKIQNQNTITV"
     gene            <36892..>38742
                     /gene="TPHA0P00190"
                     /locus_tag="TPHA_0P00190"
                     /db_xref="GeneID:11530791"
     mRNA            <36892..>38742
                     /gene="TPHA0P00190"
                     /locus_tag="TPHA_0P00190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688563.1"
                     /db_xref="GeneID:11530791"
     CDS             36892..38742
                     /gene="TPHA0P00190"
                     /locus_tag="TPHA_0P00190"
                     /inference="similar to DNA sequence:INSDC:YFL041W"
                     /note="similar to Saccharomyces cerevisiae FET5 (YFL041W);
                     ancestral locus Anc_8.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688611.1"
                     /db_xref="GeneID:11530791"
                     /db_xref="GOA:G8C1Z9"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:G8C1Z9"
                     /translation="MNLLWLILAVKLEFSLAKTHQFNFTAGWVNANPDGVTERQMIGF
                     NGVWPIPDIHVNKGDRVELYLTNKLGEGIGTSLHFHGLFMNSSYGNANQADGPEMVTQ
                     CPIMNGDMYLYNFTVPNQAGTYWYHAHSGSQYGDGMRAAFIIHDEDEPFEYDDEMVIS
                     LADLYVDHSYDLTRKFLSRFNPTGAEPIPSNILFNNTMNATLNFEPEKTYLLRFINMG
                     LFVSQFIAIEDHEMTIVEIDGVFIKPNSTDLLSIASGQRISVLVKAKKEDPGRNFAIM
                     QMMDVNMLDVVPEDLVLNRTNYISYNEDYSKPKAFTVPDFKSATNDFYLRPIDEIELL
                     DKYDVQIQFDVRMDNLGDGVNYAFFNNISYTSPKIPTLTTLLTSGELGSNPLIYGDNI
                     NAHVLKGGEIIEVVLNNYDPGRHPFHLHGHNFQIVQKSGAYREDKDYPPEEQDSITIP
                     YNESFPLMPMPDYPMIRDTVVLEPNGHVVIRFRADNPGVWLFHCHVNWHVEQGLAAVF
                     IEDPLVLQEREQLSDNYRQICSHGGFINEGNAAGHSDDWFNMDDLPRQKNSLPDGFQL
                     KGYIAFFISTVIGLFGLYTITQYGLQDSIPNDQEVYSRLKSILEENNLNE"
     gene            complement(<38940..>39398)
                     /gene="TPHA0P00200"
                     /locus_tag="TPHA_0P00200"
                     /db_xref="GeneID:11530792"
     mRNA            complement(<38940..>39398)
                     /gene="TPHA0P00200"
                     /locus_tag="TPHA_0P00200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688564.1"
                     /db_xref="GeneID:11530792"
     CDS             complement(38940..39398)
                     /gene="TPHA0P00200"
                     /locus_tag="TPHA_0P00200"
                     /inference="similar to DNA sequence:INSDC:YLR068W"
                     /note="similar to Saccharomyces cerevisiae FYV7 (YLR068W);
                     ancestral locus Anc_8.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688612.1"
                     /db_xref="GeneID:11530792"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="UniProtKB/TrEMBL:G8C200"
                     /translation="MVTSKQQYNKKKFTREYKVKEIQKNLTKKARLKKEYLKALKEEG
                     YAVPEKAPSEGNEKYDYKKRKEEREQENRRRALERKAMKQEKKWKEKQRTLQRQQTQE
                     ERTKTIQLKLKDRERRRERLTQMTRSGQPKMGPKIEDLLNKIKTDDTYTG"
     gene            <39780..>42677
                     /gene="TPHA0P00210"
                     /locus_tag="TPHA_0P00210"
                     /db_xref="GeneID:11530796"
     mRNA            <39780..>42677
                     /gene="TPHA0P00210"
                     /locus_tag="TPHA_0P00210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688565.1"
                     /db_xref="GeneID:11530796"
     CDS             39780..42677
                     /gene="TPHA0P00210"
                     /locus_tag="TPHA_0P00210"
                     /inference="similar to DNA sequence:INSDC:YLR067C"
                     /note="similar to Saccharomyces cerevisiae PET309
                     (YLR067C); ancestral locus Anc_8.20"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688613.1"
                     /db_xref="GeneID:11530796"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:G8C201"
                     /translation="MLKCTSSLLHSATKIKWPPGRPSRIKEALERSGSDYSARDSGLV
                     AKYYLSHRNEELFVDERRLLLNWLHALKDHKNVFLIGKKFLFDAGTEGPTLHQNVDYK
                     KRVQCGRLRDDATLREIRTFMNSMVHEKKGILLDAFMEEIIAQQSIKNKIKVIKIINS
                     VLDRMVTIGLPTSEVVIKWAKWMTLLNGDCEFYTYIDNKVFLKKLLYLIKTDANFKDP
                     SSSVCIDLLQFMMDRQGSTVAAQLGTTLMTLLSREAKYQIAEGVWKFKIVNNLPIVKS
                     DLTNIMKAYCYTNNYEKAKLVHEEHEEAHDENQQFDYLLLAHSKLRHWDALQKEFDGL
                     FGIGELPNINQYGIIMNALAQVGEVESVEKLYSQLLRRNMLPSLKVLQALLIANFESG
                     NFSACLTQFEYFKKYGIKPTSLTYKTMLKVYRNLANIDNALKMLKQMSKENPECVNET
                     HISIVISMCSKTTNPLIAQELFDIMINHYSISPTGRSVSSLMKVYRSSSLLGKSLQLF
                     KKYAVKEPVSENIILIYNEALRAYTDLGDSENYDRLFKEILDKNIKVEEGFYRSVLHF
                     MATLSQDLEGAKETLMKLCVDPSVKALPSHFEILMKAYMKRSNYKEVINLYAKMNEYK
                     IPVSSKVLFYLIKANFEIQLNSDSNLDSSINFVNNILTNTANKTLNMTVPNLHPAIIA
                     YPMRVLAKFDNPSKSLQLLENYSNLFPNTNNRASINDSFSVMRSLLILCAEVNEWDDF
                     SLVFEKYIDKIEHHRNLPSATTPNLYLSKLMLGLLKYKVEECKQKNSIDQLPKLLERI
                     KKLGLEVDNHSINVIVTALCKDTRTIMQSINIVNNQLIHGYNLIRKTRLLQHISKENH
                     IYKEKSWLLQQKENNPGSFIPKIYLKPDTLNVLSESLDSYLNDSDDIIKAVRDMINKN
                     KYFMKTYLMHPRNNIERWDSIKDEFKEYLEYIQTNKRSISIDELNKLKDQN"
     gene            complement(<42938..>43936)
                     /gene="TPHA0P00220"
                     /locus_tag="TPHA_0P00220"
                     /db_xref="GeneID:11530797"
     mRNA            complement(<42938..>43936)
                     /gene="TPHA0P00220"
                     /locus_tag="TPHA_0P00220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688566.1"
                     /db_xref="GeneID:11530797"
     CDS             complement(42938..43936)
                     /gene="TPHA0P00220"
                     /locus_tag="TPHA_0P00220"
                     /inference="similar to DNA sequence:INSDC:YLR063W"
                     /note="similar to Saccharomyces cerevisiae YLR063W;
                     ancestral locus Anc_8.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688614.1"
                     /db_xref="GeneID:11530797"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:G8C202"
                     /translation="MVKTAQLPVYDKKSLPPQETVDLFKTAFFNELYGSETIDELLSQ
                     IQTVKTDLYNRDYLSAFENNVKRTAYCCRWSPSRATAYSSLFAHLTEVTDVLTCKDGE
                     DQDVLCIGGGAGGELVAIASLFAPSRSFDSKYRTKRIESEDGDLHGTPTKTTLNLHLV
                     DVANWENVLKRLSDTIEDRWLYQGEMKYFNTTFTNKNILEMSNDEMHISNLNLITLLF
                     TTNEIFTEHKTESVKLFQKFNKSCKKGCYLLIVESAGSYSNITIGSKVFPIHFLVDTI
                     LVGKRSAKKDFSGGLGEGSWSLIKENDNIWYRGDTQLDYPMKLENMRIFYRLYRKN"
     gene            <44507..>46801
                     /gene="TPHA0P00230"
                     /locus_tag="TPHA_0P00230"
                     /db_xref="GeneID:11530798"
     mRNA            <44507..>46801
                     /gene="TPHA0P00230"
                     /locus_tag="TPHA_0P00230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688567.1"
                     /db_xref="GeneID:11530798"
     CDS             44507..46801
                     /gene="TPHA0P00230"
                     /locus_tag="TPHA_0P00230"
                     /inference="similar to DNA sequence:INSDC:YFL034W"
                     /note="similar to Saccharomyces cerevisiae YFL034W;
                     ancestral locus Anc_8.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688615.1"
                     /db_xref="GeneID:11530798"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8C203"
                     /translation="MEEHKDNEIHGEDMLAGEVYSNAEAVTEAHELHVDGLVLNAIDK
                     NAPNDDNESGDEKDWQPIDKIPSEDDTLRCADSSGSNKGYGMMDNDEEVAEDFIYSNV
                     SSEEQIIRSNKNNSKTDFLFNNPNVYVTQDKKESVDAEDNRETKDGNHSSISINYYKQ
                     LAYTRSLFSDNQKFGYVGSLSVLTGHFCLRLAKLATIKNLKTNQKLTRLLSTLQKDLA
                     DWRSKILNMLYEELELSSPEIKMIEQLDMIDVQLSDLCRNLQTTQKNEPEEGDDKNTS
                     KENTIDIAWVIICHLFLLLTSEESYDSRDRTLLVELAKVLGISYNELNDFERRAYDAI
                     VYNQDSSDDQSGTEIDHLKKRRHKNKKKKMAYVGLAMVGGSVVLGLSGGLLAPFIGAG
                     LASGFSTLGLGGAAGFLSSAAGTASVAITSTAVGANIGAKSMSKRMGSVETFEIKPIH
                     DNSRVNVLLTVPGWMINEEDEISAPFSTIDCIEGDIFSLNWEPSILTEIGTRMKVATS
                     EVVTDSIQQMLGNVILVSIVSAIQLPLILSRLSFFLDNPWAVASDRAWSAGLILADTL
                     MNKNLGNRPVTLIGYSLGARVIYSCLLELSAHKKVGLVENVFLFGAPVIISQDELIRA
                     RSMVSGRFVSGYSLNDWILKYIYRTTTSRGYKEVLGISQVDEPLTVENIDLTEIIKGH
                     SEYRENMPKLLKLVGLEVTSETFHDPANKEDAESHQISTVSTQSQDPDSTDKIIKEID
                     NIESFLKPLTETPPTTHEEENPTQ"
     gene            <47300..>48709
                     /gene="TPHA0P00240"
                     /locus_tag="TPHA_0P00240"
                     /db_xref="GeneID:11530746"
     mRNA            <47300..>48709
                     /gene="TPHA0P00240"
                     /locus_tag="TPHA_0P00240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688568.1"
                     /db_xref="GeneID:11530746"
     CDS             47300..48709
                     /gene="TPHA0P00240"
                     /locus_tag="TPHA_0P00240"
                     /inference="similar to DNA sequence:INSDC:YLR058C"
                     /note="similar to Saccharomyces cerevisiae SHM2 (YLR058C);
                     ancestral locus Anc_8.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688616.1"
                     /db_xref="GeneID:11530746"
                     /db_xref="GOA:G8C204"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:G8C204"
                     /translation="MSYALSDAHKHMIQAHLTETDPELESIITDEIDRQKHFIDLIAS
                     ENFTSTSVFDALGTPLCNKYSEGYPGARYYGGNQHIDRIELLCQQRALEAFGVTPKEW
                     GVNVQTLSGSPANLEVYQALMKPHERLMGLYLPDGGHLSHGYATEHRSISAVSTYFES
                     FPYRVDPETGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMKEIADKCGAYLMV
                     DMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRNINPKTGKEVI
                     YDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKEYQLQVLKNAKVLEESFK
                     AAGYRLVANGTDSHMVLVSLREQNIDGARVEYVCERVNIALNKNSIPGDKSALVPGGI
                     RIGAPAMSTRGMGEADFKRIVEYIDKVVKFSRDVQQSLPKEANKLRDFKAKIDEGSPE
                     LAQWQHEISAWTADYPLPV"
     gene            complement(<49123..>50220)
                     /gene="TPHA0P00250"
                     /locus_tag="TPHA_0P00250"
                     /db_xref="GeneID:11530747"
     mRNA            complement(<49123..>50220)
                     /gene="TPHA0P00250"
                     /locus_tag="TPHA_0P00250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688569.1"
                     /db_xref="GeneID:11530747"
     CDS             complement(49123..50220)
                     /gene="TPHA0P00250"
                     /locus_tag="TPHA_0P00250"
                     /inference="similar to DNA sequence:INSDC:YLR056W"
                     /note="similar to Saccharomyces cerevisiae ERG3 (YLR056W);
                     ancestral locus Anc_8.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688617.1"
                     /db_xref="GeneID:11530747"
                     /db_xref="GOA:G8C205"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:G8C205"
                     /translation="MDLVLEVCDTYVFDWVYERLLPTSLYGTVPESWAKQMDLNSGVQ
                     NITALLKSINTGNEHRTSPERYGHVPYLTDMTAATFGSLLRRSNYAREMISLTIVVTV
                     FGWLLYLLFATGSYFLVFDKNIFNHPKFLKNQMALEIKLAMFAIPVMSFLTSICFMFE
                     LNGFSKLYATVDINNGGIRKLLFEFPLFILFTDCGIYLAHRWLHWPTVYKVLHKPHHK
                     WLVCTPFASHAFHPVDGFIQSLPYHIYPMIMPLNKYLYLFLFTFVNFWTIMIHDGNHM
                     SQNPYVNGTAFHTVHHLYFNYNYGQFTTLWDRLGGSYRKPEDSLFNPELNKDAKALDE
                     QLRRIDEIQRVVEEDEDDRIYSNISKKKNSR"
     gene            <51352..>52488
                     /gene="TPHA0P00260"
                     /locus_tag="TPHA_0P00260"
                     /db_xref="GeneID:11530748"
     mRNA            <51352..>52488
                     /gene="TPHA0P00260"
                     /locus_tag="TPHA_0P00260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688570.1"
                     /db_xref="GeneID:11530748"
     CDS             51352..52488
                     /gene="TPHA0P00260"
                     /locus_tag="TPHA_0P00260"
                     /inference="similar to DNA sequence:INSDC:YFL026W"
                     /note="similar to Saccharomyces cerevisiae STE2 (YFL026W);
                     ancestral locus Anc_8.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688618.1"
                     /db_xref="GeneID:11530748"
                     /db_xref="GOA:G8C206"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:G8C206"
                     /translation="MSQIPELSSYFYDSTYNPGESLVSYTSIYGNDTEVSFNELQSIV
                     NKRVNESIMFGVRCGAACLMFIVMWMISKNKKTPLFIINQCSLVFMIIHSGLYFKYLL
                     SDYASVTYSLTYFPQLINRSDVHLYGAASMFQAFLVGSIELSLVFQIKVLFQSDTYNK
                     RLGQVVLGIGAALGLTTFAMYLVTAIKGMVALYADTSDMEQYFFNVSTILFASSLNFL
                     TCLLVLKLALVVRTRRYLGLRQFDSFHVLLIMAFQTLLIPSILFIIAYSINASNDVDE
                     LIIIGGLLVVLSLPLSSMWASSINNSVRPTSLNTSLSPQTTWSSDEKSIYSDQMEPDI
                     KTKITNKVGGFLPFEKTGMVSTPTESTISMQTDIEKASTIDYSK"
     gene            complement(<52588..>55575)
                     /gene="TPHA0P00270"
                     /locus_tag="TPHA_0P00270"
                     /db_xref="GeneID:11530865"
     mRNA            complement(<52588..>55575)
                     /gene="TPHA0P00270"
                     /locus_tag="TPHA_0P00270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688571.1"
                     /db_xref="GeneID:11530865"
     CDS             complement(52588..55575)
                     /gene="TPHA0P00270"
                     /locus_tag="TPHA_0P00270"
                     /inference="similar to DNA sequence:INSDC:YFL025C"
                     /note="similar to Saccharomyces cerevisiae BST1 (YFL025C);
                     ancestral locus Anc_8.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688619.1"
                     /db_xref="GeneID:11530865"
                     /db_xref="GOA:G8C207"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:G8C207"
                     /translation="MIDRERQSIELAAMSSGGLLDSDVREKQDLPNFRGTKKPLRLMT
                     IWGLFLIIAVAAVTKFTTFKGADSPQCQSIYMYPAYALIDGFDERYTSLAKKYHLYLY
                     REQGQDKVPLNDNGDEIVLNGIPVLFIPGNAGSFKQVRSIAAGCSNIYFNDFGSLDNK
                     DTQNLDFFAADFNEDFTAFHGRTMMDQAEYLNDAIRYILSLYEQTADSSSPKPESVII
                     VGHSMGGMVARIIPGLQNYVYGSINTIITLSTPHGAAPVTFDGDILKIYQTTNEYWIQ
                     QYKDENSFFSKNMSLFSITGGILDDVLPADYVFVKDFLPEENGFSTFTTTIQKVWTPI
                     DHLAVVWCNQLRNVVAKLLLEIVDKNIPNKTKPLDYRVSKARELLLSGFEENRPLLNA
                     NSKSIDIPSNKYADYKTIHPSNEGLVLTGNQLNDFSKGMIIDIAEMSNSDEFSFLTNI
                     DKVTMYLCDEKFKTFNDNKVGFMECKDVTSYINLAPMKVTNPSSDESIKSYKIVNITK
                     QMSLGKSKLIMDFPNHNNIANDIFINFKITSIENSRPININHTPYYLTFFSNSVKIDN
                     QKWIYYENIWDSLISYKLKTKLLSGKKEELEFQPFIRQWIGNRYETKWHNNILDSEVD
                     ITMHNTAPFIPISDKKYGLNLMVYAPENASIQVSLKINWSMTLKQLFIRFRLVIGTFP
                     VFIVSSAFAYQLYLYNKTSVFIDFKVALSYLLVKYGVIVVVSMLLLSPLIDTKLGQYF
                     IYRLDPIRINTPMVEGIKNMTVNNYLLGLRSVYVSWIGPLFMSMSFGLVSFLVEVILG
                     IETIIRKIKGPPNTNPPKSKDFINKVVFDRRRTLASLSLLALIVLYIPYQIAFSVVLA
                     VQLATSFKICLTVPESHPGYLNLRNYNFSVLLLFIFVFIINAPVMIVFLHNVAIRWET
                     PFRSHHNVLAVAPIIFLTSANSTLNMPSFGSNKFLHGGLLVVIMSYLGFFSLIYGIRN
                     MYWIHHIVNIFCGWLLLGFMKGD"
     gap             55905..55920
                     /estimated_length=16
     gene            <56338..>58731
                     /gene="TPHA0P00280"
                     /locus_tag="TPHA_0P00280"
                     /db_xref="GeneID:11530866"
     mRNA            <56338..>58731
                     /gene="TPHA0P00280"
                     /locus_tag="TPHA_0P00280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688572.1"
                     /db_xref="GeneID:11530866"
     CDS             56338..58731
                     /gene="TPHA0P00280"
                     /locus_tag="TPHA_0P00280"
                     /inference="similar to DNA sequence:INSDC:YFL023W"
                     /note="similar to Saccharomyces cerevisiae BUD27
                     (YFL023W); ancestral locus Anc_8.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688620.1"
                     /db_xref="GeneID:11530866"
                     /db_xref="GOA:G8C208"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:G8C208"
                     /translation="MEAESLLKTLSQTISNLVNKRQFLEEQQELYGKIRGHVLSRSGM
                     SLDESGLVFGDVVISKNKIFLNIGYEYYVEKSEDEIIEYLNEKLMLMKDAITEFDSKI
                     KDAKKTQSDLKNFTEMIEKDPKSETIENVMDYEIDNGQFVNDEGLQSMEIREELDEDG
                     NVLSSSVKPTKPNGVDIDQSQDSVRNNTEFEDNLKGKLAKSSESTVPKIEELSDISDN
                     KELESKFNEIADDKMYSFADLIEQLDEQDELEDGEIDDRDIAYDYDRFDTHYIASEED
                     EDIEDDDGTSYSFIPGYAAQSSFLDQINKLRGTNVIEEVEPEGMENHEEKTDVKAVKS
                     ATKKTVKSILKKVSDDDVTAVKKKTKNVGFASSLDVHEVENLKEETRMNTQRFPNYSN
                     FAYEDIYTEDSELPKEEFDGDLLAKLLGVQGPEELHTKYQGLLEDEYAKEQEEADLKR
                     NKRVSRFKLARNDGVSSDVIEREVPVSDILEREVPVSDILEREVPVSDILEREVPVSD
                     VLEREVPVTNIKPKAINTVTHGTESHSVPGGASNPVSSNQNISSSLFNKTFNSLKPKQ
                     KHTHNHKMQLSKEMLEYLEGSSSEEEPDEAQKKDEAQKKDNDGSFPEEVNQLIKQQEA
                     KSVKIPTIDFAALGSDMDSMAKAYALGIYDNDMEEDVGTVIERIDDFKKYNREAIRLE
                     NEIKQFKLENPYGRETEGTSMDRDEPLSNDGKMVSEIIERDVPVDYDDTEEDDYGFHS
                     DKLTESIAMEYHKLRGAIASHELTSIIEQEPNGIEPIDENGEPIKTSRFRSQRLGYK"
     gene            complement(<58802..>59533)
                     /gene="TPHA0P00290"
                     /locus_tag="TPHA_0P00290"
                     /db_xref="GeneID:11530867"
     mRNA            complement(<58802..>59533)
                     /gene="TPHA0P00290"
                     /locus_tag="TPHA_0P00290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688573.1"
                     /db_xref="GeneID:11530867"
     CDS             complement(58802..59533)
                     /gene="TPHA0P00290"
                     /locus_tag="TPHA_0P00290"
                     /inference="similar to DNA sequence:INSDC:YLR052W"
                     /note="similar to Saccharomyces cerevisiae IES3 (YLR052W);
                     ancestral locus Anc_8.53"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688621.1"
                     /db_xref="GeneID:11530867"
                     /db_xref="UniProtKB/TrEMBL:G8C209"
                     /translation="MGAFEQLVQSDKQLQFARRAVAKYQRQLDHGPDDSEAPLDSEGL
                     GAAAAQLNKRHIMNVDDISKINYEVVKSVPGNLLTPLYAGTHKLEGRQLDDERLENEV
                     VQAKTKLYKNHLYTMNDEFLAALRAPAASTKAKRAREVADEESDEDLADVPLQVQIQW
                     LQEIQHDLMGTYKDLVNKEKKWFTLKEVILDANAELDLFSTKDVERAPPNVNLGDPNA
                     PTNPYSTVNTMLFHSKKKRNKKILP"
     gene            complement(<59839..>60357)
                     /gene="TPHA0P00300"
                     /locus_tag="TPHA_0P00300"
                     /db_xref="GeneID:11530813"
     mRNA            complement(<59839..>60357)
                     /gene="TPHA0P00300"
                     /locus_tag="TPHA_0P00300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688574.1"
                     /db_xref="GeneID:11530813"
     CDS             complement(59839..60357)
                     /gene="TPHA0P00300"
                     /locus_tag="TPHA_0P00300"
                     /inference="similar to DNA sequence:INSDC:YLR050C"
                     /note="similar to Saccharomyces cerevisiae YLR050C;
                     ancestral locus Anc_8.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688622.1"
                     /db_xref="GeneID:11530813"
                     /db_xref="InterPro:IPR016964"
                     /db_xref="UniProtKB/TrEMBL:G8C210"
                     /translation="MLTPLELSFYTYYSLLHIPITLCIDSTVVLPWRWFPRWVQAAVR
                     WHVAQNHDYLLDDPPWWLVLFVAVELLVQLPLFCYFAWQLPRLRRPASVAAGDDKLLK
                     GARRRQHRRVLALLRGYGANASLTTLVCIVHICRWGHVVGGAGALSPAQKLQLVAVYL
                     PTFVIPLRLCFV"
     gene            <60690..>61019
                     /gene="TPHA0P00310"
                     /locus_tag="TPHA_0P00310"
                     /db_xref="GeneID:11530814"
     mRNA            <60690..>61019
                     /gene="TPHA0P00310"
                     /locus_tag="TPHA_0P00310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688575.1"
                     /db_xref="GeneID:11530814"
     CDS             60690..61019
                     /gene="TPHA0P00310"
                     /locus_tag="TPHA_0P00310"
                     /inference="similar to DNA sequence:INSDC:YFL014W"
                     /note="similar to Saccharomyces cerevisiae HSP12
                     (YFL014W); ancestral locus Anc_8.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688623.1"
                     /db_xref="GeneID:11530814"
                     /db_xref="GOA:G8C211"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:G8C211"
                     /translation="MSDQGRKNFSEQIHEEFKPDSQKSYAEQGKEYISGTADKLQGKM
                     TPNEDKGLAQGAHDSYQQGKSEAQAKETSHDLKQEVNDYYMTAKEKLNEAAKYVSKSM
                     HGDEGSK"
     gene            complement(<61109..>62869)
                     /gene="TPHA0P00320"
                     /locus_tag="TPHA_0P00320"
                     /db_xref="GeneID:11530815"
     mRNA            complement(<61109..>62869)
                     /gene="TPHA0P00320"
                     /locus_tag="TPHA_0P00320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688576.1"
                     /db_xref="GeneID:11530815"
     CDS             complement(61109..62869)
                     /gene="TPHA0P00320"
                     /locus_tag="TPHA_0P00320"
                     /inference="similar to DNA sequence:INSDC:YFL013C"
                     /note="similar to Saccharomyces cerevisiae IES1 (YFL013C);
                     ancestral locus Anc_8.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688624.1"
                     /db_xref="GeneID:11530815"
                     /db_xref="UniProtKB/TrEMBL:G8C212"
                     /translation="MVEMGNRVYDPIHDVFQTQPSEGHDKEGAGAGRTGSMLSKLKAE
                     GELVPSLISSKHKLKESSKYNRHLKKPDGAYFNRSDVQFRFLYLLLSDKRLLFTNIYK
                     SFFRSTVVPIQTDEPKVVNVTDEGFDARCFIFNDTLTFSQAYILALATSSKCSKILKD
                     KLLRDKEVAFSSCALGILVNVGRMNTTINFFHEMTSQLRTFHSVPCLQMNNTDPKALQ
                     DTPRLKSILKSAAVGNDPIDLMKVYDHEEQIQGKSNLINLIFALCDNVSLLNIILLKK
                     YVDVDPGFSSLYSLLDSSKYDPVDRCNVLLWLLYIHSETDMTDVSVRESLTLFRGAFP
                     EEEKLMLRLSEEDYDVDTPEEVEYGLQQMQKRKEFLKSHKSGAEPKDGEGNKENSEGS
                     EKATTSPPSSPSRQPSVTAATVKKQDPESNGPAKKRPRVKKEASAEPAAKLKSPSKDK
                     EVVQRRNLARSWIEADNAKMITKGLDVAKEISQHQFLKDLAGAQEYARLKRKEVGLMK
                     AFSEFEDISLANLLGVRGRKRKKFKDNLLGFETDYIKYFGLLKKKILANERLDATAAA
                     VASASPDSDDEPGSPVFKLR"
     gene            <63488..>65419
                     /gene="TPHA0P00330"
                     /locus_tag="TPHA_0P00330"
                     /db_xref="GeneID:11530816"
     mRNA            <63488..>65419
                     /gene="TPHA0P00330"
                     /locus_tag="TPHA_0P00330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688577.1"
                     /db_xref="GeneID:11530816"
     CDS             63488..65419
                     /gene="TPHA0P00330"
                     /locus_tag="TPHA_0P00330"
                     /inference="similar to DNA sequence:INSDC:YFL009W"
                     /note="similar to Saccharomyces cerevisiae CDC4 (YFL009W);
                     ancestral locus Anc_8.67"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688625.1"
                     /db_xref="GeneID:11530816"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8C213"
                     /translation="MTITAEFPLSGVPVPCRYRVSEITTVSDGGGASGATSSRALDEV
                     VNAADSKQDDGNNDDTASESRCVKRARLGDDGEDLEDETLPPSPIASPGCDEKGAGSL
                     RAKPFVASDLAAHLHTSIPGSCYKNMVFRALAKLNRRDLADFATLITDNLKRDFISSL
                     PAEIAVKILLKLPYRDITSCLQVSRKWNEVATSSPALWKSLLISENFVSASCFDLYSS
                     KLLKKYPGAMSEEDCYYSDFLKNRNYLNNWYNKHFTPRRYTLDGHATSVVTCLQFEDD
                     YIISGADDKVIRVYSSKDKKLLKSLTGHEGGVWALKYVDDGIIVSGSTDRTVRIWDIE
                     LGCCTHVFKGHTSTVRCLEVVEYKGIKYIVTGSRDNTLHVWKLPKVDVHARIRKQENQ
                     GALDNEGDLPYLHSSPDENPYFVGVLRGHLASVRTLSGHGNIVISGSYDCSLMVWDIA
                     QMKCLYVLAAHSDRVYSTIYDHKRNRCISASMDATIRVWDLKDIWKNGTCVRVMNAMT
                     PCTNILGSMLILHGHTALVGLLKLSDRFLVSAAADGSLRGWNANSYGRKFIYSHANMS
                     AITTFDLNDNLLVSGSESQFNIYNLRTGGIIHPNLLSDADQIWSVKIKENILVVAVER
                     DNRSFIEIFDFNERYHTNI"
     gene            <65711..>69370
                     /gene="TPHA0P00340"
                     /locus_tag="TPHA_0P00340"
                     /db_xref="GeneID:11530817"
     mRNA            <65711..>69370
                     /gene="TPHA0P00340"
                     /locus_tag="TPHA_0P00340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688578.1"
                     /db_xref="GeneID:11530817"
     CDS             65711..69370
                     /gene="TPHA0P00340"
                     /locus_tag="TPHA_0P00340"
                     /inference="similar to DNA sequence:INSDC:YFL008W"
                     /note="similar to Saccharomyces cerevisiae SMC1 (YFL008W);
                     ancestral locus Anc_8.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688626.1"
                     /db_xref="GeneID:11530817"
                     /db_xref="GOA:G8C214"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:G8C214"
                     /translation="MGRLVGLELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMD
                     AISFVLGFQSSNLRSSTLKDLVYRDIASADENEFGEDGERSAYVKAFYEKDGTVVELM
                     RAITAGRDSVYKIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPRQLT
                     KLFEEVSGSIKYKKEYEELKEKIEKLSESAAESAKNRRRIQGEMKIYEDGISKDEKYK
                     KQLEVRDKLQVHLALWQLFHLEQEEKLSTKKLKEVKNKVMKLTDQVNEEETNVKKAKN
                     EVIKETSLQMKQQNRLDYKEKEKDNLLSELTPIQLSQRSAEKRLANIEKRIESIARDM
                     ERQKTYVSRYEKQLKVVKKTKDTFEEELKQSNSNPDKYRLNDEDMKLYERLNEQYLTE
                     GGFELDTKLSLLNNEKKDIDDELELLQKRIDMSKNRITDEFAVKGENFELQAVELSSE
                     LNEKNSLHLNLANKLKKIQSDIESTSNKEYELNHKLRDTLVKLDDASANQRETLKEKK
                     LRENVSMLKRFFPGVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECIT
                     YLKKQRAGIISFIPLDTIDAFVPTLPTTNIQGITLVLNAIDYDQEYDKAMQYVCSDSI
                     MCDTLSIAKSLKWKHNVTSKLVTLEGTLIHRAGLMTGGVSKEQGNRWDKEEYQGLVTL
                     KDKLLIQIEQLSNNSKTFAIEARDLESNISQLNSSISDLRTQISQINRSIEENKAEVQ
                     YHEDMLKKEYEPKQNQLNTKLESIEKSKSEIIGQKELLQNTVFKEFHNKLGFTIQEYE
                     HHSGEALRQSNKELQQLEKQVLNIESKLQFEVERYESTEKRHKKAQIDLENNNSTIES
                     LQENEAEVVAKIKDIENGMLEIKKVLEDFSKEIDRKKKKLAIAEDSLSEKSELLTTST
                     NEKISIKEEIEKKDLEKLGILTNCKISNIQVPVASKIDLNNLPIGKIDNDAILISNEI
                     SLDYKTLPAKYKESSSSKIRSALEHEIEVVEDLLQDLQPNARAVDRFDEAKERFDSAS
                     DETETLKKQERKLLTQFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSG
                     GNASLTLEDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSP
                     FFILDEVDAALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQE
                     NSSRVVTLDLSQYAD"
     gene            <69773..>76015
                     /gene="TPHA0P00350"
                     /locus_tag="TPHA_0P00350"
                     /db_xref="GeneID:11530818"
     mRNA            <69773..>76015
                     /gene="TPHA0P00350"
                     /locus_tag="TPHA_0P00350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688579.1"
                     /db_xref="GeneID:11530818"
     CDS             69773..76015
                     /gene="TPHA0P00350"
                     /locus_tag="TPHA_0P00350"
                     /inference="similar to DNA sequence:INSDC:YFL007W"
                     /note="similar to Saccharomyces cerevisiae BLM10
                     (YFL007W); ancestral locus Anc_8.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688627.1"
                     /db_xref="GeneID:11530818"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:G8C215"
                     /translation="MVNEDARRRSRASEEIHGEVKRGKLADNKHRNGLDPETVLAERM
                     RHYGLDYVEDAEEHSKNVFDKSSKWFSRDVKPKFPIDECLPYKIESHLEQAKYVCHIL
                     INLYVAINSKDIQGLISISTQDFAELKQDIQSYGVENGVVDTDMLNSDIADFDEGEYM
                     EEQIDENEYIDLAGPDFNAIGKITSASATIVNVNYWTNELKNCMHIDFPLALRKKLAS
                     VYYYLSLVQGQKIYRQMHVEMFEQLVSKDDDGTNFTDLLIKDGLVLDYSLLFDYLSEF
                     LPYPDSDYVRHDINSKDDLQLFRLLLKLAHQAKPFFNEKDTKLMTRVMDSFMSSLAPS
                     TMSTVLPMITSFVPYHYHKDAKILDYFPLFFSLWSSVSANIAIDTHMYDFVGNISEDV
                     HSKLLKNDDRINDVEFTKFGVFTASQLTFLFNRVQGHLRTDGQIHSYSRTVRPFVYCI
                     NGSSHSEYFAKLSSLVNSIETFVHPSNSGYWTKTIAKFIHGFIKMYHKRYTFEKYISS
                     KSSNDFRLTDECHAKIVDTFVDILITGSQSKGSEIANYYISSFAYLLDLNPTNKQKIF
                     DKILGDLYEALGGEYVHSRHRIISSLKQFTRIVRYMATDTLYRVHVTNILSMLVSKMD
                     INDTNLTSNLINGIVSTASFIPFANMIKDDEYLTFESHTLPFIEQHYYYIKSEENNGQ
                     FQYDPEILHNAFRASTTIFENIAREYIDKLFQFISVDLEDGFISKINNTTMLMQESMD
                     DKIFAYYSKKLLTSFWENDLIVESNPNYELLTIPLAALVKRDPTLCQSIFKNLAFNIR
                     NQIEKGAGSIRSTSEIQQRDYRLVLYLTAMNDVIRQSYSTVLSFHKELFDFMTYIYDN
                     ITNPPIDIITSILSHSVLATLTTTEVVNSPLFAKDCKVSLEDRWGGMQFDDSKFNKDN
                     LKFDWHVSTQEEVAVAIEFLENIFKYCKENTLKTLESGETGSFFVDKIQKYVLIMTHT
                     LSGASLLFDPDFNQQLIKLNHDLKTKDMSSYKEIFSSMMSLNFNQSYLDEFEKESSST
                     PSTLNSEDAVEMKASSTDELVTEGEIDELAVQSFENTPIPGATSSSGEETAVFREIDI
                     FACNYFFGVTTEEKFNNPRYLHVHHIRNEIGLFFHKLFTYLSKNFEDNTMIFQILLHG
                     LKVWFTDVGQEVIFNEDQTAKLDLEFLENIQTLSHLVEPFTRTALSVKADNYHQSRVY
                     LHSTIRKPSLLERRLLNDIVVLAASVYPDVSKPAQGTLVHCMKQLFGSYLYVIELIIR
                     KLNECIKSNSYMEIEVVLSILMIKKIHRRLMSDYNNQEQIIILLIQCCGIHEMDIALY
                     AEKILNDIVTGLKIPSSVCVIDENAKKNISPSDNLIDTQVSLIEKAKNNKRKLYLSRL
                     SKIKDKLYTELKKDPEGNWKVSMFIVRFISKLEASLEFQSDVKSLEIIFEQIQTKHPM
                     LIQLGIKCLLGIFNKILSLSDYKYDITRAYVSNFDPASVNKIDTSQTSFNKTFQTEMN
                     KFENPSYFIDSRPFVGWLCWGSPMKVLQTRQVDLVLQNYEQDMLIKFSNSVTKEFLKE
                     LVSNFVKDNETKSIFSSGNVSFYMLVVYACSQEHCEYDIDFLFELCEETYDKYDKASM
                     IMSVEIFSGLICGIKYLDERRVGEVDKFVDRFLEKCLFNELNQDGFEIWGTICWWLPT
                     VVDCRRCPAMYKRFSDISSIIEMSNEDVSNQVSRINMFRNLLMGIEYKSPNTSPVLEL
                     LKFDNQHEPIREVSAKLLSTIIQNRSAPNYVSSEEVIKAQSENSSGLGIPIKRMPPKI
                     GEYIAAQFAMIKEESLKVTEMTPQEILKSRYYFMASSMYFLLSELGRGPNKILLVPYI
                     VEYVMPFLMDLTTHKDMCKISGLDPAKLYVSIAYMPIPRAYISDIINLICDDSVVASS
                     FQKQLQMSLIQHFLSSQLLQLTETEKSMILEEIITNLYNSQYIEVRMRAAEVLSDIVH
                     NFGDEQRLTMLIARFSKELCGFSWEPARACRRPTSKSTAVWSGWGPIVSAFPYVFPLP
                     KWIPEQLSVLASWARTHGMAGIAAKNTISEFKKVRTDTWQFDRQVFSGEQLEDMEGAL
                     WRSYYA"
     gene            <76379..>77023
                     /gene="TPHA0P00360"
                     /locus_tag="TPHA_0P00360"
                     /db_xref="GeneID:11530848"
     mRNA            <76379..>77023
                     /gene="TPHA0P00360"
                     /locus_tag="TPHA_0P00360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688580.1"
                     /db_xref="GeneID:11530848"
     CDS             76379..77023
                     /gene="TPHA0P00360"
                     /locus_tag="TPHA_0P00360"
                     /inference="similar to DNA sequence:INSDC:YFL005W"
                     /note="similar to Saccharomyces cerevisiae SEC4 (YFL005W);
                     ancestral locus Anc_8.70"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688628.1"
                     /db_xref="GeneID:11530848"
                     /db_xref="GOA:G8C216"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C216"
                     /translation="MSGLRSVSGSTNGKNYDSIMKILLIGDSGVGKSCLLVRFVDDKF
                     NPSFITTIGIDFKIKTVEINGRKIKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVT
                     DEKTFANIRQWFKTVTEHANDDAQLLLVGNKSDMETRTVTHEQGDELSRELGIPFVEA
                     SAKNDDNVNEIFFTLAKLIQEKIDSNQIATGGNAKDSNININSSGGSGSKSNCC"
     gene            <77473..>79224
                     /gene="TPHA0P00370"
                     /locus_tag="TPHA_0P00370"
                     /db_xref="GeneID:11530849"
     mRNA            <77473..>79224
                     /gene="TPHA0P00370"
                     /locus_tag="TPHA_0P00370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688581.1"
                     /db_xref="GeneID:11530849"
     CDS             77473..79224
                     /gene="TPHA0P00370"
                     /locus_tag="TPHA_0P00370"
                     /inference="similar to DNA sequence:INSDC:YPL020C"
                     /note="similar to Saccharomyces cerevisiae ULP1 (YPL020C);
                     ancestral locus Anc_8.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688629.1"
                     /db_xref="GeneID:11530849"
                     /db_xref="GOA:G8C217"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:G8C217"
                     /translation="MNHSTIERASSVSSYYNPSFSKIFLINSQDVRNHQRSRISRYSR
                     YSARQRPQSSSYEYNTASEIAEDLKVSFKAAGKYFWRKLHARYGSNTRQQQQQQTQKR
                     ECLAEDLDAADSTFGGSKRPMSVSHVYYISSKRRKLDSPNVQDNIGAHSLPTYLSIDV
                     VDSSRKDSSAGIGSKDPFKWATWSVCSNQDKNCNTKHNYATSNYGSAFISNKHSSEPN
                     QAVNPEDPIEKKEFADCLKTIYEGKNLVRSFDSAKEDIMKDLSLSNIGNHLNSTTSFK
                     LRIAGLTKQLKDIIVQNQDKEPIDDLIVVKERKISPLEKKRNEFYRHVGDVNKALLDY
                     KKYTKSYADLLKKQREARKAYLSKKSQQDLIPSISASDLNEIQQAFNANDNKLLSKGN
                     NLEVYVRDLITLRPGAWLNDTIIEFFMQTIEANDEACVAFNSFFYTTLSDRGYPGVRR
                     WLKRKKKNIDNLDKIFVPVNLNRSHWALCMIDLKNKRIIYVDSLSNGPNATSFAILSD
                     LQHFVWEASEHKYGKDFELVNADCPQQPNGFDCGVFVCMNAFYLENHSELTYKPSDAS
                     RMRLHIANLILHSVDKK"
     gene            complement(<79297..>80316)
                     /gene="TPHA0P00380"
                     /locus_tag="TPHA_0P00380"
                     /db_xref="GeneID:11530850"
     mRNA            complement(<79297..>80316)
                     /gene="TPHA0P00380"
                     /locus_tag="TPHA_0P00380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688582.1"
                     /db_xref="GeneID:11530850"
     CDS             complement(79297..80316)
                     /gene="TPHA0P00380"
                     /locus_tag="TPHA_0P00380"
                     /inference="similar to DNA sequence:INSDC:YPL015C"
                     /note="similar to Saccharomyces cerevisiae HST2 (YPL015C);
                     ancestral locus Anc_8.74"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688630.1"
                     /db_xref="GeneID:11530850"
                     /db_xref="GOA:G8C218"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:G8C218"
                     /translation="MKIGNTVESLASYFKEFPKSKVIFLVGAGISTSCGIPDFRSPET
                     GLYHNLSKLKLPFAEAVFDIDFYEENPEPFYTLAKELYPGNFKPSKFHYMMKLFQDKK
                     RLERIYTQNIDTLERLAGIRSELIVEAHGSFADNHCISCGEEYPQEVFKSRLEECSKI
                     DGKFDYAACVKCQSFIKPKIVFFGEDLPKRFFDTWAQDLETMQQSSKNGSEVVVIVAG
                     TSLAVYPFASLPTEVPNTVVRGLMNKNTVGDFSKHPRKSDFLLTGDLDELATELMEHL
                     GWSKEFNDLIVTEDKIDELINEIENLDIRKTKEEVMVTKELQKETNIKEIEIKVQELG
                     KQKAK"
     gene            complement(80553..80626)
                     /gene="TPHA0Ptrna6N"
                     /locus_tag="TPHA_0Ptrna6N"
                     /db_xref="GeneID:11530743"
     tRNA            complement(80553..80626)
                     /gene="TPHA0Ptrna6N"
                     /locus_tag="TPHA_0Ptrna6N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11530743"
     gene            <80952..>83429
                     /gene="TPHA0P00390"
                     /locus_tag="TPHA_0P00390"
                     /db_xref="GeneID:11530913"
     mRNA            <80952..>83429
                     /gene="TPHA0P00390"
                     /locus_tag="TPHA_0P00390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688583.1"
                     /db_xref="GeneID:11530913"
     CDS             80952..83429
                     /gene="TPHA0P00390"
                     /locus_tag="TPHA_0P00390"
                     /inference="similar to DNA sequence:INSDC:YPL008W"
                     /note="similar to Saccharomyces cerevisiae CHL1 (YPL008W);
                     ancestral locus Anc_8.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688631.1"
                     /db_xref="GeneID:11530913"
                     /db_xref="GOA:G8C219"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C219"
                     /translation="MSSGANFGHPYQPYDIQIQLMQCIYDTLTQNKKLAILESPTGTG
                     KTLSLICSIVSWLRDNKTTLIADNESSNRIKADSDFSDSDSEDELDWVKENYQKSIVK
                     DRLLDLNDYELYLDSVENRSSAVEIKSKHDKRVKATEPKKKRKIEHVDVEMAEADFLP
                     ADYNSDSEDSNSTVSKASALSSEIHLLLQKLDNNNENKKETNSSDLLKECNPVKIYFA
                     SRTHSQLNQFASQLKLPDFKPSFDPEIVPKERIKYTPMGSRLQLCVNPDIRKKWKTLE
                     SINNACKELVGSEKGCPYHKRKISKIDFRDQMFTKVHDIEDIVDIGETLNMCPYYGTR
                     EYLMDSEIITLPYQYLLSESTRISMGIDLKNSIVVIDEAHNLIDTVNSIHSAQISLQE
                     LIMSQKGLTLYLKKFQKRLNGGNRVNILKLIKLFSILNEFIKKTYKKAGQKINVNDIF
                     SGSNADTINIHKLNKFIQVSKIAYKIDTYIDSISPEKDEKVEPSSTPLLYKVATFLNC
                     LTNQSNEGQFFFEKDNTIRYMLLEPSESFKSIINDARCVILAGGTMEPVSDFFDVLFP
                     SVDKIDTVTFSCNHVIPDENLSTYIIDEPQFEFTFEKRQDKNLVNGALFNFLNDLSNS
                     VPPSGGIVTFFPSYQYLQYIIDTWKESGMFDKLNNSRKILFESKAGKDPFPEYMNNIS
                     EGISSNLFAVVGGKLSEGINFQDNLCRAIVMVGLPYPNIFSGELQIKRSHLEDKIIKN
                     GGSKSDAMKKTRTYYDVLCMKSVNQSIGRAIRHINDYANIYLLDKRYKLPNIEDKLSL
                     WVRNRIQQESKVSGILTKTKNYFENRA"
     gene            complement(<83549..>85306)
                     /gene="TPHA0P00400"
                     /locus_tag="TPHA_0P00400"
                     /db_xref="GeneID:11530744"
     mRNA            complement(<83549..>85306)
                     /gene="TPHA0P00400"
                     /locus_tag="TPHA_0P00400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688584.1"
                     /db_xref="GeneID:11530744"
     CDS             complement(83549..85306)
                     /gene="TPHA0P00400"
                     /locus_tag="TPHA_0P00400"
                     /inference="similar to DNA sequence:INSDC:YPL007C"
                     /note="similar to Saccharomyces cerevisiae TFC8 (YPL007C);
                     ancestral locus Anc_8.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688632.1"
                     /db_xref="GeneID:11530744"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:G8C220"
                     /translation="MKYLKDLIISRKDFQDWCHNLHWGKDGSMFLTTVPELTLIEPIY
                     NTEVAGQCKNLFHVREYPLVIENKFEYETSQHNSLLDGQPESFVRGWIPSPDSISDNL
                     FSVLTNNCNVIVYKHNKKVINLDEPDKPLSHRTYHCMNWCNNGQYLFVGNEESEVVVF
                     ERQKPNSDEVMFHYKTTIKLGANRLWITKLYSRDNQIIVTTDNNAIYHISFAKGFNNV
                     KTNQVLNAGRFKVVDLKISENYAFITTYNKFYCINLNNNIQSEVTLPQSEGYSIVPLT
                     PRKSEILLLSLSGNLTVQLNDFSNLVLMQDNIVTPPIEKKYKKWKTLSQEEFGKCMTN
                     IRIFGSCISQDENSIAVLYNFERVAPKYSITSESQYRLMLLPLYDSWTISDRSAGLSL
                     FQTYNIYDKKLPILKDCNNTEEAKNNTNIDFKEYIKNILSLKEMNKTMFQNFINPVPS
                     CEFFRECIINYVNDHIDEIQNPLDKACALSLAASTNQTIKLNKETLHFKSEFISENFV
                     FDNTQDSNIITSIEGHTWKRCLITLLPLLTVNVKVCPVSNERMIDIKKDDLNEYGWLT
                     RTLLEVFHDQSVYTGATMK"
     gene            <85770..>89321
                     /gene="TPHA0P00410"
                     /locus_tag="TPHA_0P00410"
                     /db_xref="GeneID:11530745"
     mRNA            <85770..>89321
                     /gene="TPHA0P00410"
                     /locus_tag="TPHA_0P00410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688585.1"
                     /db_xref="GeneID:11530745"
     CDS             85770..89321
                     /gene="TPHA0P00410"
                     /locus_tag="TPHA_0P00410"
                     /inference="similar to DNA sequence:INSDC:YPL006W"
                     /note="similar to Saccharomyces cerevisiae NCR1 (YPL006W);
                     ancestral locus Anc_8.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688633.1"
                     /db_xref="GeneID:11530745"
                     /db_xref="GOA:G8C221"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/TrEMBL:G8C221"
                     /translation="MRGFAAFIVALFLLTIRVNAAQCAIYGNCGKKSLFGSELPCPVD
                     SRFQPPKPDENVIDLLVNVCGEEWRDIEDLCCSEDQLKNLKSNLKKAQSIISSCPACV
                     KNFNNLFCHFTCSPNQREFVNVTKTQITKTGKEAVAELDVFMNSTWASLFYNSCKDVK
                     FSATNGYAMDLIGGGAKNYSSFLKFLGDEKPLLGGSPFQINYVYELQDDNDEETCDFK
                     KFNNTIYSCSNGEYKCACTDCEASCPKLEPLQDLICRKGGMPCFSFDVLVLYGIIFIA
                     VGLFHIYIFRKRKLQSVNLDRITTDEIMDGADEINPEYEAPTDFNSNKINDSISKVLG
                     NLAEFSTKNPYLVLGISNLVILFCLALLIKFYELETNPVNLWVSKDSSKFKQKQYFDE
                     NFGPFYNTEQIFVVNETGPVLTYETMKWWFDVENYITKELLSDQKIGYEDLCFRPVEN
                     SSCVIESFTQYFDGKLPSEDSWKSQLKGCTDSPVNCLPKFQQPLKKNMFFNNDNIFES
                     NAFFITFLLDNHTDAATLWETTLEDYLLNLEVPKGLRFSFSTEVSLEKELNKNNDYII
                     VIISYLLMFLYATLALGRNHSSTRMTLGCTGIAIVMASVFCAAGVLSAFGVKLTLIIA
                     EVIPFLILAIGIDNIFLITNEYDRICITNPSLDIKQRIVFAVGRISPSILLSYICQVS
                     CFLIASFVTMPAVRNFALYSALAITFNAILQLTSYVAVLSIYENRYSNVLFEYTSENS
                     FLIKETYFNIIKKKRKILGIFISWCSISLAVIPTIQLGLDQTMAVPEQSFLASYFRDV
                     YQYLQMGPPVYFVVNDLDITKRENQRKICGKFTTCDSNSMANILEQERTRSTITEPLA
                     NWYDDFMSFLNPELEQCCMVKLDSDLEMCPPDYPTFKCKSCYNPGEWSYNMHGFPEDQ
                     EFMEFFKIWMATGSDPCPLGGKAPYSHSILFNDSKIISSTFRTSHRPLHSQRDYIDAY
                     LDSERIASSFEDLDVFAYSPFYIFFVQYDGIVSLTLKLLGTAIVLIFFTTFILLRSLR
                     TSLVLSVTVLMVIIDIGSLMSWLGITLNAVSLVNLIICVGLAVEFCIHIARAFTVVPT
                     NIAEDKDNRVNYAMSTVGGSVFTGITMTKFIGISILAFAKSKIFQVFYFRMWFSLIIV
                     AGLHSLIFLPVVLSMVGGECYYDDTKEIESSLEAEST"
     gene            <89727..>91562
                     /gene="TPHA0P00420"
                     /locus_tag="TPHA_0P00420"
                     /db_xref="GeneID:11530793"
     mRNA            <89727..>91562
                     /gene="TPHA0P00420"
                     /locus_tag="TPHA_0P00420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688586.1"
                     /db_xref="GeneID:11530793"
     CDS             89727..91562
                     /gene="TPHA0P00420"
                     /locus_tag="TPHA_0P00420"
                     /inference="similar to DNA sequence:INSDC:YPL005W"
                     /note="similar to Saccharomyces cerevisiae AEP3 (YPL005W);
                     ancestral locus Anc_8.84"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688634.1"
                     /db_xref="GeneID:11530793"
                     /db_xref="UniProtKB/TrEMBL:G8C222"
                     /translation="MNVLSRLSVEVAKNGVKGKVPVVRYVLPKEFELVNKKEFIDKSN
                     NTNDEKSKSSKNSYGYVREHMTLVGRGSNYQKKQVQEYLSPLRPYKLRRQEINKDYDQ
                     EKSIEYTKFTLHKKKEERLGFGLSEDFLGELLAALIKNLPKRYEGQDEVDKADNLNDD
                     DIPSCKYAYPKFSKEEIPKIPDFEKHPEKFPEYVGLLTHCDFYYRNSSKSNGIIPKIL
                     RNLFHPSNVKTLHLRSVDSFNDLIYYFSNKFDFASCREFLAQMKVENIKPNTKTYNLL
                     IMNVLKNSHIRKGKSIRPELKFLFHDMQKNQVTVDEITWNICFNFLNNGLSKDIYIEQ
                     MVKHGVAITPEFVYTVFRNDKTYSSSDILNYLTENKISMTYKIFKLCIEKLLKQQKSK
                     VVWEMIQFAMDNNSHEPGQMKVTYEVVDKLLAEFARRGRIDLTLMTLNKFLLDYKLTP
                     SVNTFDMCFKSLSNSGYSKNFEAVYRYIVKLKSDSGLPPYKSYWAVKCQSTIKFNCRQ
                     LHDKEAEIIRGMELLNSLRFPKDKYVDFTWYIRDSNIRKTLRYLGCTLHKIHDKQINP
                     VNKDKSNYRQRIRFIAIQKSMVNKIDYSMDYYKTLKRELRDRSII"
     gene            complement(<91648..>92607)
                     /gene="TPHA0P00430"
                     /locus_tag="TPHA_0P00430"
                     /db_xref="GeneID:11530794"
     mRNA            complement(<91648..>92607)
                     /gene="TPHA0P00430"
                     /locus_tag="TPHA_0P00430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688587.1"
                     /db_xref="GeneID:11530794"
     CDS             complement(91648..92607)
                     /gene="TPHA0P00430"
                     /locus_tag="TPHA_0P00430"
                     /inference="similar to DNA sequence:INSDC:YPL004C"
                     /note="similar to Saccharomyces cerevisiae LSP1 (YPL004C);
                     ancestral locus Anc_8.85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688635.1"
                     /db_xref="GeneID:11530794"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:G8C223"
                     /translation="MNRTYSLRNSRAPSAAQLQNPPPPPSSTKSKFFGKASISSSFRK
                     NTAGSFGPELSRKLSQLIKTEKNLMRSMELVVSERKHAATQLSEWGYGNDEDVSDVTD
                     KLGVLLFELGELQDQFIDKYDQYRITIKSIRDIESSVQPSRDRKEKLAGQIAALKYKD
                     PTSAKLPVLEQELVRAEAESLVAEAQLSNITREKLKASFNYQFDSIRELSEKFALIAG
                     YGKALLELLDDSPVTPGETRPSYDGYEASRQIIADAENSLEAWTLDVAAIIPTLSFHQ
                     TSHDVYGEGELEEEEEEEEAGEWVHDPKDHEEEEEEEEEEEEE"
     gene            <93076..>93297
                     /gene="TPHA0P00440"
                     /locus_tag="TPHA_0P00440"
                     /db_xref="GeneID:11530795"
     mRNA            <93076..>93297
                     /gene="TPHA0P00440"
                     /locus_tag="TPHA_0P00440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688588.1"
                     /db_xref="GeneID:11530795"
     CDS             93076..93297
                     /gene="TPHA0P00440"
                     /locus_tag="TPHA_0P00440"
                     /inference="similar to DNA sequence:INSDC:YDR525W-A"
                     /note="similar to Saccharomyces cerevisiae SNA2
                     (YDR525W-A); ancestral locus Anc_1.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688636.1"
                     /db_xref="GeneID:11530795"
                     /db_xref="GOA:G8C224"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:G8C224"
                     /translation="MHARDWFLVFVAVFLPPVAVWFKKGFFSKELLVNVLLLCLGFFP
                     GLVHALWVISKNPYSEPLASDDAGYGSIA"
     gene            93755..93844
                     /gene="TPHA0Ptrna9F"
                     /locus_tag="TPHA_0Ptrna9F"
                     /db_xref="GeneID:11530780"
     tRNA            join(93755..93792,93808..93844)
                     /gene="TPHA0Ptrna9F"
                     /locus_tag="TPHA_0Ptrna9F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:11530780"
     gene            complement(<93963..>95576)
                     /gene="TPHA0P00450"
                     /locus_tag="TPHA_0P00450"
                     /db_xref="GeneID:11530915"
     mRNA            complement(<93963..>95576)
                     /gene="TPHA0P00450"
                     /locus_tag="TPHA_0P00450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688589.1"
                     /db_xref="GeneID:11530915"
     CDS             complement(93963..95576)
                     /gene="TPHA0P00450"
                     /locus_tag="TPHA_0P00450"
                     /inference="similar to DNA sequence:INSDC:YFR006W"
                     /note="similar to Saccharomyces cerevisiae YFR006W;
                     ancestral locus Anc_8.98"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688637.1"
                     /db_xref="GeneID:11530915"
                     /db_xref="GOA:G8C225"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:G8C225"
                     /translation="MGLVFLSSWIVSILVTYQIFKKKNKYQFGRSNSLPYTEEKMSYP
                     VEKQFKNFEDLADPNYVPEKLRGKKYLAKEHCLRVKKLLLSKVKSLNASKTGIFIAGE
                     EMKGVKYCDAFKDFRQNQYFYYLSGVYDIPGCSLFFDFHDDSLTLFLPNVDTEDIMWS
                     GEPLYPEEALKKYDADAVKYYSDLESEIINNTKYSDYLIFTTDLDNVHIDALAKKLTP
                     KDKDFFFAMDETRVIKDWYEIEIIRRACEISDKSHLAVMSALPIELNELHIQAEFKYH
                     ATRQGGRTLGYDPICCSGPACGTLHYIKNDEDVHGKVSTLIDCGAEWRGYTSDVTRCF
                     PLSGKFTKEHRDIYETVLDMQSQAMELIKPGAEWDDLHFLTHRVLIQHFLKLGIFKKE
                     FSEEELIKRRVSAAFYPHGLGHMLGIDVHDVAGNANYEDPDPYFCYLRIRRRLEENMV
                     VTNEPGCYFNEHLIKNFLKSHSERLETVNMDVVAKYMHVGGVRIEDDILVTAKGYENL
                     NKVTSDPDEIEKIVSAGLAKGRSSFHVLA"
     gene            <95994..>97442
                     /gene="TPHA0P00460"
                     /locus_tag="TPHA_0P00460"
                     /db_xref="GeneID:11530883"
     mRNA            <95994..>97442
                     /gene="TPHA0P00460"
                     /locus_tag="TPHA_0P00460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688590.1"
                     /db_xref="GeneID:11530883"
     CDS             95994..97442
                     /gene="TPHA0P00460"
                     /locus_tag="TPHA_0P00460"
                     /inference="similar to DNA sequence:INSDC:YFR005C"
                     /note="similar to Saccharomyces cerevisiae SAD1 (YFR005C);
                     ancestral locus Anc_8.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688638.1"
                     /db_xref="GeneID:11530883"
                     /db_xref="GOA:G8C226"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8C226"
                     /translation="MSSLKRMLDYESESGSESEDEPAFNHKKRYLNEDSPIEDKYSIS
                     PLLRSINKKKLDFDAERICSITATNVNVYCCLVCGKYFKGRNEGSPAFLHSIGENHNI
                     FINMTNLKLFNLPANIPLEDAVTLNLTEQKIIDDIKYAINPQFTLESIKDFPIICKDV
                     DNEEYLNGFVGISYNANASNDSIASIVMMLTHMDDIRDYFLLDKNLTNDTPFETKLRL
                     LMKRIWSPKLFKSHVAMNELLSFILIDPSFSNRNINDPRLLLLSLINSNINISKPLKD
                     IIDTNIRGQVLVTSEKSVANSKESKIKKTIMPFSLLSLDLPDVPVFKDGMDTNALPQI
                     KLSEMLMKFNGITEHIQSKELKKKFKLESLPRYLILHFNRFDSKTNTPVKDRNQTLVE
                     FPTLMELKKTKYRLISNLVHEASQSITSNSSSHSHFLTVSDKDHVSKWKMILLNSKDN
                     IWYEVDRTDIPKKERELLFLNEIYMQVWEKLD"
     gene            complement(<97579..>98499)
                     /gene="TPHA0P00470"
                     /locus_tag="TPHA_0P00470"
                     /db_xref="GeneID:11530884"
     mRNA            complement(<97579..>98499)
                     /gene="TPHA0P00470"
                     /locus_tag="TPHA_0P00470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688591.1"
                     /db_xref="GeneID:11530884"
     CDS             complement(97579..98499)
                     /gene="TPHA0P00470"
                     /locus_tag="TPHA_0P00470"
                     /inference="similar to DNA sequence:INSDC:YFR004W"
                     /note="similar to Saccharomyces cerevisiae RPN11
                     (YFR004W); ancestral locus Anc_8.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688639.1"
                     /db_xref="GeneID:11530884"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:G8C227"
                     /translation="MERLQRLMMNSKAGAPDANRDDTQETVYISSIALLKMLKHGRAG
                     VPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQ
                     MVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGNVVIDAFRLID
                     TGVLLNNQEPRQTTSNAGLLNKANIQALIHGLNRHYYSLNIDYHKTSSETSMLMNLHK
                     KQWQTGLKMNDYEEKENSNLEVTKKMVNIAREYSKRIEEEKELTEEDLKTRYVGKQDP
                     KKHLTEASDKLLEENIVSVLTSSVNAASIK"
     gene            complement(<99165..>101735)
                     /gene="TPHA0P00480"
                     /locus_tag="TPHA_0P00480"
                     /db_xref="GeneID:11530862"
     mRNA            complement(<99165..>101735)
                     /gene="TPHA0P00480"
                     /locus_tag="TPHA_0P00480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688592.1"
                     /db_xref="GeneID:11530862"
     CDS             complement(99165..101735)
                     /gene="TPHA0P00480"
                     /locus_tag="TPHA_0P00480"
                     /inference="similar to DNA sequence:INSDC:YFR002W"
                     /note="similar to Saccharomyces cerevisiae NIC96
                     (YFR002W); ancestral locus Anc_8.94"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688640.1"
                     /db_xref="GeneID:11530862"
                     /db_xref="GOA:G8C228"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:G8C228"
                     /translation="MSVNEVPVDQRLENDHVQNNNGTSKLFDELVASSKNLPSSSSDL
                     GLIQLSYDELILRAKKLRNEAHNGSATKNYTKAHYLLAGSGISMEEFDSLYDTLRTDM
                     SQETQNKNLKIHPISDVSSVASKELNKAQEQSEFRQNNILYSIEKLLSTTEKEFDYSI
                     NQVLNLDWDQRKEEVELNFKKMLKSKNIYNSNRKVNNEVNHFSSPNSQSNFDVNENQL
                     TRMKFERYASIIYVFNNNRQNKQPFSLIDEYNNFLPSLDNENDKNMLKCCKILKSKLN
                     NNNVVEDSKIYLENEFKQYLNTISIQFSRPEFNFSSNPILQANIERAIVFLNMKLKNK
                     KGNWTINNLTVIDNVPVWALVFYLMRAGLLEEALEVLNKSKPHLKKIEQPFLAYFKAY
                     TFSKDRKLPLEFVAKLNSEFNQHIKNSFDGDLFRLAVYKIIGKCDLSRKSIPSVLLTV
                     EDWVWFHFILITDPTESSYSVYESFSLEEFQNITMSHGPNKLGNNYLEVLILCGLYSE
                     AVQYLSEFDEINSVHLYISLIDKKLIDHQNKSGVNGINFASIINSYIRSFKFSDPRIA
                     AEYITLITLCNDNEQLELCKEAFLHLVLDTKEFTILLGKVNRDGVKLPGVLSQRLELL
                     KLDNPEKFINEVIQRAIVQADEEERVSDSLLLCQLSKQYDMVIKIINEQLSELLSESE
                     LDSNLVQIVDNIETNAILFAENLVLQYSKDAEIIAKIDNKSFNTTKLLIKISKARALF
                     TKENWRECLSEIEALNIIPLRNELEASKGAHSLPTLDKYLIKNIPNILLMVMTCAKRI
                     YENTNRIIKQHTQATNDIEELKKITRNCMIYAGTIQYKMPRDTYRALTVLDLNREYIY
                     "
     gene            complement(<102167..>103696)
                     /gene="TPHA0P00490"
                     /locus_tag="TPHA_0P00490"
                     /db_xref="GeneID:11530863"
     mRNA            complement(<102167..>103696)
                     /gene="TPHA0P00490"
                     /locus_tag="TPHA_0P00490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688593.1"
                     /db_xref="GeneID:11530863"
     CDS             complement(102167..103696)
                     /gene="TPHA0P00490"
                     /locus_tag="TPHA_0P00490"
                     /inference="similar to DNA sequence:INSDC:YPR002W"
                     /note="similar to Saccharomyces cerevisiae PDH1 (YPR002W);
                     ancestral locus Anc_8.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688641.1"
                     /db_xref="GeneID:11530863"
                     /db_xref="GOA:G8C229"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="InterPro:IPR012705"
                     /db_xref="UniProtKB/TrEMBL:G8C229"
                     /translation="MFRKAKIMTEIKRRSSFQVPSANLNVRPKSDEVIDKISDYVVNK
                     KITSTLAMDTARLCFLDTIGCGLAALQHEQARKIIQPIVPGTVVPNGTKVLGTNLVMD
                     PVDGAFAVGSLIRWLDFNDCWLAAEWGHPSDNLGGILPVADYLTRLSRATGGKEGKIF
                     TVKDILENMVKAHEIQGILALDNSFNKVGLDHVVLVKVATTAVVSRLLGLSKEQINTA
                     VSHAFVDGQSLRTYRHAPNTGSRKSWAAGYAVARAVHLSYLTKNAHIGEIPSVLTAKR
                     WGFYDVLFNGKPFSFKQRSEFDSYVMENILFKISFPAEFHAQTAVEAAIEANKVLKNM
                     NKSYKDIKSVIIKTQKAALEIIDKKGDLYNYADRDHCIQYMIAFPLIYGRLTATDYSD
                     ENASNTEINVLRNKMTCEEETTFTTDYYDPKKRSIGNSLVIELEDGTVLDEIRVEYPI
                     GHKFRREEGIPLIWEKFQRHVKEHYGENNEQVEQILSVTKTSDFVDLEIDKFVDMLAQ
                     K"
     gene            complement(<103909..>105342)
                     /gene="TPHA0P00500"
                     /locus_tag="TPHA_0P00500"
                     /db_xref="GeneID:11530864"
     mRNA            complement(<103909..>105342)
                     /gene="TPHA0P00500"
                     /locus_tag="TPHA_0P00500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688594.1"
                     /db_xref="GeneID:11530864"
     CDS             complement(103909..105342)
                     /gene="TPHA0P00500"
                     /locus_tag="TPHA_0P00500"
                     /inference="similar to DNA sequence:INSDC:YPR001W"
                     /note="similar to Saccharomyces cerevisiae CIT3 (YPR001W);
                     ancestral locus Anc_8.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688642.1"
                     /db_xref="GeneID:11530864"
                     /db_xref="GOA:G8C230"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:G8C230"
                     /translation="MLRSTRRLYSHSSSYRGVKNLKTRLTELIPEKKEELLNIKSKFN
                     NVKVGDITIGSIIGGMRNNSSMFWQSTTLDPETGIRFHGRTIEDCQKLLPKVKDGSKS
                     NSFLPESMLWLLMTSEIPTQDEANSLSKELALRAKSLPQETIKLLSDLPQDLHPMTQL
                     VIGLASLNKYSSFSNKYASGQLGKENYWDSTYEDAMNLIAYLPEITGRIYSKITGNGG
                     ELLGVLNEDKDWSYNICSMLGMVNSTDSSNRCNLTKSQSDDFIDLMRLYTGIHVDHEG
                     GNVSAHATHLVGSALNDPFLSYSSGILGLAGPLHGLAAQEVVRFLIQMNSEITSIDDD
                     QQIKDRLKNLLDSRKVIPGYGHAILRKPDPRFNVMLDFVEKRKFTEFKDDDNIKLMQK
                     LSTFAPQVLLEHGKTKNPYPNVDSASGIIFYHYGLKELLFFTVIFGCSRSMGPLTQLV
                     WDRIYGLPIERPKSVDIAQLKALCKVN"
     gene            complement(<105767..>106378)
                     /gene="TPHA0P00510"
                     /locus_tag="TPHA_0P00510"
                     /db_xref="GeneID:11530845"
     mRNA            complement(<105767..>106378)
                     /gene="TPHA0P00510"
                     /locus_tag="TPHA_0P00510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688595.1"
                     /db_xref="GeneID:11530845"
     CDS             complement(105767..106378)
                     /gene="TPHA0P00510"
                     /locus_tag="TPHA_0P00510"
                     /inference="similar to DNA sequence:INSDC:YFR001W"
                     /note="similar to Saccharomyces cerevisiae LOC1 (YFR001W);
                     ancestral locus Anc_8.91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688643.1"
                     /db_xref="GeneID:11530845"
                     /db_xref="UniProtKB/TrEMBL:G8C231"
                     /translation="MVVKKSSKKQSTMREVRPEVFQDSQARNQMANVPKLTERSKKRK
                     PNKYENSKEQARARLYGVKKQPRKYSDKELDIPTLNKAIVPGVKLRHGKKGKKFMGDH
                     DLLALNRLINTIGDKYDDVTESKLEKARRLEEIREIKRQELEVKEAAKQDKLEETKDQ
                     IKHKSSVARTLRRKNKRELEKAQKEEEDAMKESKKSKKRVSFA"
     gene            <107051..>107764
                     /gene="TPHA0P00520"
                     /locus_tag="TPHA_0P00520"
                     /db_xref="GeneID:11530846"
     mRNA            <107051..>107764
                     /gene="TPHA0P00520"
                     /locus_tag="TPHA_0P00520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688596.1"
                     /db_xref="GeneID:11530846"
     CDS             107051..107764
                     /gene="TPHA0P00520"
                     /locus_tag="TPHA_0P00520"
                     /inference="similar to DNA sequence:INSDC:YPL002C"
                     /note="similar to Saccharomyces cerevisiae SNF8 (YPL002C);
                     ancestral locus Anc_8.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688644.1"
                     /db_xref="GeneID:11530846"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016689"
                     /db_xref="UniProtKB/TrEMBL:G8C232"
                     /translation="MKRFGLAALGDQQDQRYSDVSNDILKRQSVELDEQLSIFRDRLI
                     KFAKKHNKEIKENSEFRSKFMRMCSSIGIDPLSLFDKDRHIFNAEDFYYEICVKIIEI
                     CRQTRDMNGGITSLDELENGYFANLKLDRTDLEKSIEMLKSLDGGIETFQIKGRKFLR
                     SIPNELTSDQTKILEVCSVLGYASISLLKANLDWKRVRSKAVLDEMVSNGLLWVDNQN
                     NGKEVLFWDPSWIMNLQGK"
     gene            complement(<107875..>109143)
                     /gene="TPHA0P00530"
                     /locus_tag="TPHA_0P00530"
                     /db_xref="GeneID:11530847"
     mRNA            complement(<107875..>109143)
                     /gene="TPHA0P00530"
                     /locus_tag="TPHA_0P00530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688597.1"
                     /db_xref="GeneID:11530847"
     CDS             complement(107875..109143)
                     /gene="TPHA0P00530"
                     /locus_tag="TPHA_0P00530"
                     /inference="similar to DNA sequence:INSDC:YFL001W"
                     /note="similar to Saccharomyces cerevisiae DEG1 (YFL001W);
                     ancestral locus Anc_8.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688645.1"
                     /db_xref="GeneID:11530847"
                     /db_xref="GOA:G8C233"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:G8C233"
                     /translation="MEEKSYGTWSKEDLIRRLEILEDNVSKHNKKTNDKIENTESITQ
                     NKNKKFNEKKKFDFSKYNTRFIALKFAYLGWNYNGLAIQKEPTALPTVEGVIVDAMNK
                     CKLIPSINPSDFKFSRCGRTDKGVSAMNQVISLNVRSNLTPEQQMNSEFDSKEIQYIN
                     ILNQLLPDDIRISAVCLRPPTGFDARFSCQYRHYKYLFKKDGLNISAMETAASYFKGE
                     HDFRNFCKLDGSKQITNFKRTMMSSQILQVNEEFYCFDLIGSAFLWHQVRCMTAILFL
                     VGQNLEVPEIVSQLVDVASNPQKPIYDMASDIPLILYDCKFPEMDWIMNNVNDYNSIK
                     YSKIVEGLTLGYQLKSTVATIFQDILPSADQDFQNKTRINLGDGKGKIVGTYEKLFKR
                     KVMESYEIVNKKYKQRKKIPKNKLGLCNHL"
     gene            <109933..>110217
                     /gene="TPHA0P00540"
                     /locus_tag="TPHA_0P00540"
                     /db_xref="GeneID:11530762"
     mRNA            <109933..>110217
                     /gene="TPHA0P00540"
                     /locus_tag="TPHA_0P00540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688598.1"
                     /db_xref="GeneID:11530762"
     CDS             109933..110217
                     /gene="TPHA0P00540"
                     /locus_tag="TPHA_0P00540"
                     /inference="similar to DNA sequence:INSDC:YBL001C"
                     /note="similar to Saccharomyces cerevisiae ECM15
                     (YBL001C); ancestral locus Anc_3.206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688646.1"
                     /db_xref="GeneID:11530762"
                     /db_xref="InterPro:IPR002767"
                     /db_xref="InterPro:IPR029756"
                     /db_xref="UniProtKB/TrEMBL:G8C234"
                     /translation="MPSFNCVVDLCLYPVGTESVSGSDFVARVEKRIHESGLKSSLHS
                     AGTTIEGPWDQVMSLVGKLHEHCHKENFKRIHSHIRVCSVIEDECSAYYR"
     gap             110232..110300
                     /estimated_length=69
     gene            complement(<110346..>111686)
                     /gene="TPHA0P00550"
                     /locus_tag="TPHA_0P00550"
                     /db_xref="GeneID:11530763"
     mRNA            complement(<110346..>111686)
                     /gene="TPHA0P00550"
                     /locus_tag="TPHA_0P00550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688599.1"
                     /db_xref="GeneID:11530763"
     CDS             complement(110346..111686)
                     /gene="TPHA0P00550"
                     /locus_tag="TPHA_0P00550"
                     /inference="similar to DNA sequence:INSDC:YDL001W"
                     /note="similar to Saccharomyces cerevisiae RMD1 (YDL001W);
                     ancestral locus Anc_3.209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688647.1"
                     /db_xref="GeneID:11530763"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:G8C235"
                     /translation="MQSKDSQEQTPLIGNKENNIQTGSSTNAIVNTGHNLSTSKASTK
                     YVPKGMKEPEYFVSNDVADSLNLPIDAEINKNKHVRSGAQRTSRTTQKLKLLPEEPYD
                     LDHNNFPDLPENEVYSQVNRIKDKSARRDAEKLGKAHRHLLPRVTAFCTASSYNMRGL
                     IRWLKDSKHQFRSHPKLFDECLYTPFIYTDSRGDKRYEREDFIRFDDEGGEINVSDKQ
                     PDVFIFEYGVVVLWGFTEREEKEFLNDIEKYEKEKLAEEDIQIEEFNYYVTESYQPRI
                     YNDFITLRDGSNYMTKLSISHALSQSVKISLFEELLDNTIEDTQDIPQEIASSGKVSM
                     SKEDIMKSIGELFILRININLHGSILDSPEIMWSEPQLEPIYQATRGYLEINQRVALL
                     NQRLEVVSDLLQMLKEQLGHTQEEYLEFIVIVLVGVEVLLSVINISVDLFAYSN"
     gene            <112332..>113096
                     /gene="TPHA0P00560"
                     /locus_tag="TPHA_0P00560"
                     /db_xref="GeneID:11530764"
     mRNA            <112332..>113096
                     /gene="TPHA0P00560"
                     /locus_tag="TPHA_0P00560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688600.1"
                     /db_xref="GeneID:11530764"
     CDS             112332..113096
                     /gene="TPHA0P00560"
                     /locus_tag="TPHA_0P00560"
                     /inference="similar to DNA sequence:INSDC:YDL002C"
                     /note="similar to Saccharomyces cerevisiae NHP10
                     (YDL002C); ancestral locus Anc_3.210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688648.1"
                     /db_xref="GeneID:11530764"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:G8C236"
                     /translation="MSDSELKRKFDELKEENDTLALGIQRTRMSIKRLKLEYSVLLER
                     LEARLEVDPELNYENPLPTLESFKKELLAKPIKKGKSKTQKAKDRDPNLPKRPTNAYL
                     LFCEVTKEKIREAGTQDVTKGLAEAWKKLNEEDRKPFYKMYNDDRERYKKEMDEYMKK
                     HSNHTGEEATLIKDEPDTDGETSSTNVKIASKENIELDLDDDEDEEIGEEEEEEEEEE
                     EEEEEEEDDDGVDIEEDDNSNDNELEEDKKKTDKSR"
     gene            <113762..>116020
                     /gene="TPHA0P00570"
                     /locus_tag="TPHA_0P00570"
                     /db_xref="GeneID:11530873"
     mRNA            <113762..>116020
                     /gene="TPHA0P00570"
                     /locus_tag="TPHA_0P00570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688601.1"
                     /db_xref="GeneID:11530873"
     CDS             113762..116020
                     /gene="TPHA0P00570"
                     /locus_tag="TPHA_0P00570"
                     /inference="similar to DNA sequence:INSDC:YAR035W"
                     /note="similar to Saccharomyces cerevisiae YAT1 (YAR035W);
                     ancestral locus Anc_3.176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688649.1"
                     /db_xref="GeneID:11530873"
                     /db_xref="GOA:G8C237"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:G8C237"
                     /translation="MSQINDVDNNNDLLQRLPIPNLNDTLNRYYKRIEPLQDDKQNKL
                     SFKKIFSNENIDILNDLNNILISYDQKLSITKPKSSYIEKFWYDAYLLYDESVVLNLN
                     PFFQLADDPTLNSYYKNYDYFYGKDKELNPDIKIKTNEKSESESESFYKYGEFTLQIK
                     RTTKLILSILKFIKEIRNNKLKPDLIKNKAKLSMDQYEKLFGSSRIPSSNTNTKEKKY
                     SCNLQTDKTSHHIIIMYRSQFYWFDVLNINNDLIFEKSDDLEYNLFSIIKDYEKNETF
                     YKKNISPIGIFTTENRKVWSNVRDYIKNDQKKNTNYKNLKLIDSALFIVCLDDISIED
                     DNELSKSMLCGTSNINLSNNINNYKNPNELILGLQNGTCLNRWYDKLQLIVTKNGKAG
                     INFEHTGVDGHTVLRLASDIYTDSILSFATTITNNVPTIFESNNEKMVKKSNKLTKNI
                     LNSNLITIPRKLEWKLDSFLTSSLHFAETRLSDLISQYDLETLEFSGYGSTLIKKIFK
                     CSPDAFTQQIFQLAYYALYGRFETVYEPAMTKTFQNGRTEAIRSVTNESKLFVKSIFD
                     ASSNDLDRIAKLQKACSEHSRITKECSMGLGQDRHLYALYSIYNEYFKDTKPTPPIFQ
                     DKSWYLLNTTILSTSNCGNPCLKSFGFGPTSPNGFGIGYIIRENSISIVVSSRHRQTK
                     RFSSLIEKSFLEIKHIFHNQFNPVDKSTDLNGNSVKLASMNAKNSLTTKKSEDLRYLL
                     SGYDYFDVNVVG"
     gene            <117136..>120909
                     /gene="TPHA0P00580"
                     /locus_tag="TPHA_0P00580"
                     /db_xref="GeneID:11530874"
     mRNA            <117136..>120909
                     /gene="TPHA0P00580"
                     /locus_tag="TPHA_0P00580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688602.1"
                     /db_xref="GeneID:11530874"
     CDS             117136..120909
                     /gene="TPHA0P00580"
                     /locus_tag="TPHA_0P00580"
                     /inference="similar to DNA sequence:INSDC:YDL019C,YAR042W"
                     /note="similar to Saccharomyces cerevisiae OSH2 (YDL019C)
                     and SWH1 (YAR042W); ancestral locus Anc_3.175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688650.1"
                     /db_xref="GeneID:11530874"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:G8C238"
                     /translation="MSQHNSDKHVATKAMLELKLLEVLGQSDISQLKVLFERDFNSED
                     SRNNKYIQDIKKSLLHYCVQVGSLELIKDVVNEFYQSDNSNELGVKLDINQQDENGNT
                     PLHLASAQGRADVVEYLMNLPHINDCIRNKKKLQPVEVCKDLNVAQMMQLKRANYIEN
                     VIEQCKDASKKKDLSKLEQLFKNPRNKELININDVDPTTGENILHLHILHGDIPIVKW
                     LLDHGADPFIKNQEGKTAHEVLQTLKPHEKLSLDKLNKLKSLFERKAKEKNVLEMTSP
                     LNKCPTFKGYLKKFTNFAQGYKLRWFVLTADGKLSYYKDSSDTNNSSRGSLNLANCIL
                     HVNSTEKLKFEIVGGGAGTIKWNLKGVHPIETNKWIFVIQAAIRYQRDKKNGVIASPV
                     SINRASTIEILGTSAGPLNQNIHNKDIDISKHELSSYKNPTSTSLATSDIKLNDNLTP
                     QGKSYINKVIETRLEQPTDIHSFHSSIMSGESNQMKSNIIGPTDINLDDYAEGETIQD
                     DDDDAIGLKTDPIDEDINVQYGSYGQQIAILEKSIILELNSVNKILSGGQSSVEAWTL
                     IRKSLTSITECFTKLTETFGQRENSLVNLLDKERNVNNVWVQSVKDLEKELQQKEFRL
                     DSLNKERKTLKKVVQQKLSKGSDSASVDVNTLDKLEDSTDPTTLEHIAKFISATRDKG
                     EDSDADEFFDAEESVTEDEDAGSYASGARNVASHQIHEGDIIELHSATSDTHTNLADG
                     AKVSDFKIQNFNEPSAKIEEINREATPDSKIIKEATNIPKLTDVTSTEINVDAGNTVK
                     SKSNETSKQKESKLSGKVVKENLPEVTKIAITASQKEAESKILDELSFAGYEDGIRKR
                     LKLDEDNRPKISLWGVLKSMVGKDMTRMTLPVSFNEPTSLLQRVTEDLEYSQLADMAA
                     TYEDSTLRMLYVAAFAGSSFASTTLRVAKPFNPLLGETYEYARPDKHYRFFTEQVSHH
                     PPISATWTETPKWDFWGESYVDTKFTGRTFNVEHLGLWYLKLRPDCNDPTELYTWKKP
                     KNTVIGILVGNPQVDNSGDVEITNHTTGDRAVLHFKARGWRSSGAYELRGEVFNKKGK
                     KVWVFGGHWNDSYHAKKVTESKHSEITLSRAKTNNSMSNVEPLSDGSTFLLWKANKRP
                     DAPFHLTPFAITLNAPQKHLVPWLAPTDTRLRPDQRAMEDGDYDLAADEKHRLEEKQR
                     AARKSREESNTEYIPRWFKSEIHPITKKKYWNFNGEYWKLRKEHQLKDAGDIF"
     gene            <121758..>123419
                     /gene="TPHA0P00590"
                     /locus_tag="TPHA_0P00590"
                     /db_xref="GeneID:11530875"
     mRNA            <121758..>123419
                     /gene="TPHA0P00590"
                     /locus_tag="TPHA_0P00590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688603.1"
                     /db_xref="GeneID:11530875"
     CDS             121758..123419
                     /gene="TPHA0P00590"
                     /locus_tag="TPHA_0P00590"
                     /inference="similar to DNA sequence:INSDC:YOL055C"
                     /note="similar to Saccharomyces cerevisiae THI20
                     (YOL055C); ancestral locus Anc_3.174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688651.1"
                     /db_xref="GeneID:11530875"
                     /db_xref="GOA:G8C239"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:G8C239"
                     /translation="MDQTSLYINTAPPYLKLNQNESLPVVMTIAGSDSSGGAGVEADI
                     KTITSHKCYAMTCITALTIQTPTSVYGIQVTPKHVVSKILDVNLRDMRCNVIKTGMLT
                     TDAIEAIETKLKEYDNGDIKSSRPILVIDPVMVATSGSFLASGDLKDLLIEKITPWAD
                     LLTPNIPECFKLIDREMDLKNTQDIFKLAKEVSIVTNCSNILVKGGHLPWNEEKKHII
                     DILYIGKENKFIVYEGHYTETKNTHGTGCTLASSIASNLALGYSLTHAVYGAIEYVQN
                     AVSIGCYVTSEIVKENGPINHVYAIEVPLEKMMKDECFSAQELIPKPTSSTFSASEDF
                     FTYLINHPKVKPHWESYINHDFVKQIAQGTVDSKKFKFFLEQDYSYLVDYARIHCIAG
                     SKAPTLEDIEKALSIVGSVKQEMENHEKKLKEAFGVTGEKYLEGIKKGPALKAYSRYF
                     YDVSKRGSWEELVTSLNPCLMGYGYALIQQEKYIVKNEGSIYYDWCQTYSSKWYREHV
                     EEGRSLLNKIGSKCPPSDIDKLVNIYADVCELETKFWDAALNYEE"
     gene            complement(<123739..>124581)
                     /gene="TPHA0P00600"
                     /locus_tag="TPHA_0P00600"
                     /db_xref="GeneID:11530916"
     mRNA            complement(<123739..>124581)
                     /gene="TPHA0P00600"
                     /locus_tag="TPHA_0P00600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688604.1"
                     /db_xref="GeneID:11530916"
     CDS             complement(123739..124581)
                     /gene="TPHA0P00600"
                     /locus_tag="TPHA_0P00600"
                     /inference="similar to DNA sequence:INSDC:YDL021W,YOL056W"
                     /note="similar to Saccharomyces cerevisiae GPM2 (YDL021W)
                     and GPM3 (YOL056W); ancestral locus Anc_3.172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688652.1"
                     /db_xref="GeneID:11530916"
                     /db_xref="GOA:G8C240"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:G8C240"
                     /translation="MSSSTYKIFILRHGQSELNHENIFCGWIDANLTEKGKDQARNSA
                     DLIKKYCEDNKLPLPQIGYTSRLVRTQQTIEEIINQWGLKEETYIVTGEKFEVSDKEV
                     FSEKDTIPVFQSWRLNERHYGSWQGQRKPQVLEEYGETEYMNIRRGYRGRPPVADLKR
                     EMIQEFDDQGSKTGYEFKEPNRHLKYNPEELAGEVLPNSESLELVVARLEPLLDDMIL
                     KLAKQTHHESCMIVAHGSSVRSLLKLIENIADADIKNIDIPNGIPLVIELDKKHFNLL
                     ANVT"
     gene            complement(<125174..>127348)
                     /gene="TPHA0P00610"
                     /locus_tag="TPHA_0P00610"
                     /db_xref="GeneID:11530917"
     mRNA            complement(<125174..>127348)
                     /gene="TPHA0P00610"
                     /locus_tag="TPHA_0P00610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688605.1"
                     /db_xref="GeneID:11530917"
     CDS             complement(125174..127348)
                     /gene="TPHA0P00610"
                     /locus_tag="TPHA_0P00610"
                     /inference="similar to DNA sequence:INSDC:YOL057W"
                     /note="similar to Saccharomyces cerevisiae YOL057W;
                     ancestral locus Anc_3.171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688653.1"
                     /db_xref="GeneID:11530917"
                     /db_xref="GOA:G8C241"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:G8C241"
                     /translation="MSLPIADDEPPISMLLSAKGDNKDYFKLLDVKEKKYAHYMSKAS
                     QFGTRITLRQVSIESELIFDLLLFVQKNLDSNLINDQYKIEYKDYLNYASQFLSNLGN
                     YKSFGDTKFIPNCSKEFLVDSILKNVKLDVHDSKVWEQFTNEYYNSNYDYKSHFKTLN
                     DLIDQGIYGVNSNNLNLAQLGYPSLGFKSSYYSGNSVSSDDMILLKKEIFTKFNILPE
                     NTRIEKINDKTFIIHVASFNMLHPSNPSNEYPSGSVTVADDTVVSFKFGDHSREMQGI
                     IKNLKLAKMYVANEVQSQMLDKYIEHFETGSGNAHKESQKLWVTDISPTIETNIGFIE
                     TYREPSGIIGEYEALVAIQNKERTAKFGEMVENAKEFILLLPWGAEYEKPDFNPPDFT
                     SLEVLTFTGSGIPAGINIPNYDDVRLTIGFKNVSLGNILNASAKSSSKFPPSFIQEKD
                     LEVFKKYQSESFEVQVGIHELLGHGTGKLLSEIDDNKYNFDFANLPIGLNGKAVTTYY
                     KKGETWGSKFGSLAGAFEECRAELVAMYLITNRKLLEIFGFKTKEEQNNIIFAGFLQM
                     ARAGILALEYCSPETGKWGQPHMQARFSIMKTFLKHSSSKQFLKIVLDNETNPTDFHL
                     EMDASLIETVGHECVKDYLLHLHIYKCSGDAENGTKYFIERSTVPEDLARLRDIVIKK
                     RLPRRQFIQPNTVFNEETNDIIVKEYDETATGMIQSFIERET"
     gene            complement(<127635..>128816)
                     /gene="TPHA0P00620"
                     /locus_tag="TPHA_0P00620"
                     /db_xref="GeneID:11530918"
     mRNA            complement(<127635..>128816)
                     /gene="TPHA0P00620"
                     /locus_tag="TPHA_0P00620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688606.1"
                     /db_xref="GeneID:11530918"
     CDS             complement(127635..128816)
                     /gene="TPHA0P00620"
                     /locus_tag="TPHA_0P00620"
                     /inference="similar to DNA sequence:INSDC:YDL022W,YOL059W"
                     /note="similar to Saccharomyces cerevisiae GPD1 (YDL022W)
                     and GPD2 (YOL059W); ancestral locus Anc_3.169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688654.1"
                     /db_xref="GeneID:11530918"
                     /db_xref="GOA:G8C242"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:G8C242"
                     /translation="MSQAPASMKQMSQMDSVATMVALDKPFKVAVIGSGNWGTTIAKV
                     VAENCSKYKNLFKSRVDMWVFEEQIDGRNLTEIINQDHENVKYLPKIKLPQNLVANPD
                     LVATAKDADILVFNIPHQFLRRICAQLKGHINPNARAISCLKGFELTEKGVRLLSDYI
                     EDELNITCGALSGANIAMEVAKKKWSETTVAYHMPEDYRGDGYDVNHDVLKALFHRPY
                     FHVSVIEDVAGISIAGALKNVVALAVGFVEGLGWGNNAAAAIQRVGLGEIIKFGQTFF
                     PESKVETYYKESAGVADLITTCSGGRNVKVARLMATSGKSAEECEKELLNGQSAQGII
                     TAKEVHDWLKQCNKVDEFPLLNAVYEIVYNNVPMSSIPEMIEELGSLGPHILSMIEEE
                     K"
     gene            <129779..>131560
                     /gene="TPHA0P00630"
                     /locus_tag="TPHA_0P00630"
                     /db_xref="GeneID:11530919"
     mRNA            <129779..>131560
                     /gene="TPHA0P00630"
                     /locus_tag="TPHA_0P00630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688607.1"
                     /db_xref="GeneID:11530919"
     CDS             129779..131560
                     /gene="TPHA0P00630"
                     /locus_tag="TPHA_0P00630"
                     /inference="similar to DNA sequence:INSDC:YOL060C"
                     /note="similar to Saccharomyces cerevisiae MAM3 (YOL060C);
                     ancestral locus Anc_3.168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688655.1"
                     /db_xref="GeneID:11530919"
                     /db_xref="GOA:G8C243"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:G8C243"
                     /translation="MYLYKLRCFVVVSCHLLLPKVALALPLVKDLSASAVVTETSPQL
                     YLVISIGLVLLGGIFAGLTLALMGQDEIYLKVIQTSGSPRERQLASSVLDLLAMGKHQ
                     ILVTLLLSNVITNETLPIVLDRFIGKNGGGWQAVLFSTVLIVIFGEIIPQSICVKYGL
                     QIGSVLSPYVRLLIYLLYPISYPIAKLLDHILGEDHGTMYKKSGLKTLVNLHQTNGIE
                     RLTRDEVTIISAVLDLKDKKVSEIMTPIDKVFTLSSATVLDEDTVNVILNSGFSRIPI
                     YLPNDPNNFIGMLLVKILISYDPEDSLRLSEFPLATLPETLPNTSSLNILNYFQQGKS
                     HMCLVSEKPGESSGALGILTLEDVIEELIGEEIVDESDVYAEQELRNENNFISLNSPL
                     LKSKFRTNTTSYSSLPKFTDRTAAANEVAQRQGLLLKKTSSSKTPVQDGVINHAAHNK
                     LPSNMASNPLKDEPSFVKIKRNIPFGMINGIQSNENINKKSNSLASIHSTKTANTGND
                     SNISPIMINQSSSNSKFSNKNTIENNNGIVESVITVKGVPKTIIQSTDMDSSQDMEGI
                     GGLLLVHDKSLLQNQNRKQHSSSENEN"
     gene            <132185..>133963
                     /gene="TPHA0P00640"
                     /locus_tag="TPHA_0P00640"
                     /db_xref="GeneID:11530920"
     mRNA            <132185..>133963
                     /gene="TPHA0P00640"
                     /locus_tag="TPHA_0P00640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688608.1"
                     /db_xref="GeneID:11530920"
     CDS             132185..133963
                     /gene="TPHA0P00640"
                     /locus_tag="TPHA_0P00640"
                     /inference="similar to DNA sequence:INSDC:YDL025C"
                     /note="similar to Saccharomyces cerevisiae YDL025C;
                     ancestral locus Anc_3.167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688656.1"
                     /db_xref="GeneID:11530920"
                     /db_xref="GOA:G8C244"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C244"
                     /translation="MSANTKDDEGSSNSNGNLSFKHLSEYLLHPTQNFFHNSSRYVTN
                     SNNHNQVVAKTLSITSNTDDTGVNELLLNNNKYNMTVHPAQHLQNTIKMQKHFSNLHG
                     NGNTPSYRISLTSSGSTVAKVYMKNIDSNGKKKYSKGKETLHLKRFIKNHSKNETFLE
                     NLNRNLSNVSHTSNSSFNSLYSDNNQTEKQINSKVITRISSVLSNTSIATTNSDNKQH
                     HSLNRNDNYYGIFAFTDELTNNFEFKMLTSEDTIDTLLRFYGQPIKKVGEGASGTVNV
                     LKNYERQKLYAVKILNSNDIPVPQQNNSEGEPANYPNRTVSKREYAEKVTAEYSIGST
                     LHHLNLIKILGMIQMESIGMYYLIMEFAQHDFFDVIMSDNLQVDSINCYFKQICNGVQ
                     YLHSMGISHRDLKLDNCVVNHEGTLKIIDFGCAVIFNDDLNSDKCVKAFGITGSDPYL
                     APELLNTINRRASNGYYDPRAVDVWSLAIIYYCMVVKKFPWKSPKLMYNSFRLFCSIP
                     QYPNDSLMGPYRLLKYLPEESRPLLREMIKIDPLDRIPMNEIVKERWFQSIVCCTENP
                     ASLHYRSAPYRIHSHDLRLDIDYTFS"
     gene            complement(<134232..>135554)
                     /gene="TPHA0P00650"
                     /locus_tag="TPHA_0P00650"
                     /db_xref="GeneID:11530765"
     mRNA            complement(<134232..>135554)
                     /gene="TPHA0P00650"
                     /locus_tag="TPHA_0P00650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688609.1"
                     /db_xref="GeneID:11530765"
     CDS             complement(134232..135554)
                     /gene="TPHA0P00650"
                     /locus_tag="TPHA_0P00650"
                     /inference="similar to DNA sequence:INSDC:YOL061W"
                     /note="similar to Saccharomyces cerevisiae PRS5 (YOL061W);
                     ancestral locus Anc_3.166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688657.1"
                     /db_xref="GeneID:11530765"
                     /db_xref="GOA:G8C245"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G8C245"
                     /translation="MSNDIVIFGGNSNPELVNLICENINVSPSEVTLSKFSNGETSVQ
                     VGVSVREKDVYVIQSGFGHVNDIFMELLILVNACKTSSASRITVVMPYFCYSRQPDIP
                     YTAKGAPLITKPNNTNPSKTSLSTQKPGPDNSKSLEKAIRSSMVKTQSSSRIPMISGK
                     KDQAHSSEAGELFKAQNAGYKLWVVQSGTLIANLLTTAGADHVITMDLHDPQFPGFFN
                     IPVDNLYCRPLFQNYIQHHIPNYQDSVIVSPDAGGAKRAAAIADALKLSFALVHKERR
                     SQLLKGPPGATLTSGGVGGALSISTKPLLKQEELRDVKRVASTPTIVQTTMLVGDVRN
                     KVCILVDDLVDTSYTIARAAKLLKDQGASKVYALVTHGIFSGDALNRIKQSSIDKLVV
                     SNTVPQNKALEVLGEEFVDILDVSRVFGESIRRIHNGESISMLFEHGW"
     gene            <136114..>137535
                     /gene="TPHA0P00660"
                     /locus_tag="TPHA_0P00660"
                     /db_xref="GeneID:11530766"
     mRNA            <136114..>137535
                     /gene="TPHA0P00660"
                     /locus_tag="TPHA_0P00660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688610.1"
                     /db_xref="GeneID:11530766"
     CDS             136114..137535
                     /gene="TPHA0P00660"
                     /locus_tag="TPHA_0P00660"
                     /inference="similar to DNA sequence:INSDC:YOL062C"
                     /note="similar to Saccharomyces cerevisiae APM4 (YOL062C);
                     ancestral locus Anc_3.165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688658.1"
                     /db_xref="GeneID:11530766"
                     /db_xref="GOA:G8C246"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:G8C246"
                     /translation="MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKS
                     PILTLGSTTFHHIRSSSESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKL
                     MEKFMVYYEMIDVMLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIP
                     KFLTRNSRSMSQEFSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAY
                     VDGSIDLVSHLSGTPICQFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSS
                     VKIEDCTFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSS
                     RCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKF
                     NKYKGLTENELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMER
                     VQKYRPVKWIKYVSKSGSYEIRY"
     gene            <137985..>139127
                     /gene="TPHA0P00670"
                     /locus_tag="TPHA_0P00670"
                     /db_xref="GeneID:11530767"
     mRNA            <137985..>139127
                     /gene="TPHA0P00670"
                     /locus_tag="TPHA_0P00670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688611.1"
                     /db_xref="GeneID:11530767"
     CDS             137985..139127
                     /gene="TPHA0P00670"
                     /locus_tag="TPHA_0P00670"
                     /inference="similar to DNA sequence:INSDC:YDL027C"
                     /note="similar to Saccharomyces cerevisiae YDL027C;
                     ancestral locus Anc_3.164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688659.1"
                     /db_xref="GeneID:11530767"
                     /db_xref="UniProtKB/TrEMBL:G8C247"
                     /translation="MNMLCMFRGKPVIRGLHTCTPILRASPRYVNKVVVLSNKASISK
                     IRFSSGSIYTTMGHSPLYGNTMASLTTKFAHNGLQHGTFTTKRHFHQSHYKLYSMGKR
                     PFFEGRTPVTIFRLTPMKIFLFALTFYVMIFLLVPFILSILLPAAILGYAFFQYRKWR
                     LNCALKLWVNSLMKTQMHTKFSTFNGLRYSIINSVEKDARSQVFGFTNTPNGPIFRAM
                     NDMTRDLSTEASDKFKKFIEARVLEAFVSDEDGVRSALASDHTWKQAIKTSRPLGIEF
                     GRMVERSFVARDKKYMTYAFPLSINSPSGSQSHLGRVSIVACHPLSAGFNPPDKTNLK
                     LILCIESNSKLSPDLFIIDTNGMTGEFFSKYDVQKFKDHTEYTVKK"
     gene            <139640..>141823
                     /gene="TPHA0P00680"
                     /locus_tag="TPHA_0P00680"
                     /db_xref="GeneID:11530768"
     mRNA            <139640..>141823
                     /gene="TPHA0P00680"
                     /locus_tag="TPHA_0P00680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688612.1"
                     /db_xref="GeneID:11530768"
     CDS             139640..141823
                     /gene="TPHA0P00680"
                     /locus_tag="TPHA_0P00680"
                     /inference="similar to DNA sequence:INSDC:YBL067C,YER098W"
                     /note="similar to Saccharomyces cerevisiae UBP13 (YBL067C)
                     and UBP9 (YER098W); ancestral locus Anc_7.390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688660.1"
                     /db_xref="GeneID:11530768"
                     /db_xref="GOA:G8C248"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:G8C248"
                     /translation="MLKRLLRRTHGPEETESRSEECSNDSRSIFNDSPSEYDLVSGVE
                     DGDEMDKCNDTPRIIPSLIDCDLVLNAQEPVPVEVDPESAVEGVRREIEGILSNYDVG
                     ERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIGPASIGEFQLKNISMRKNTELDTNA
                     NIPANENAKINATAATEEEVEEDGKNLHHNKVGPLSDNYTYKLSPSTTLQSMETNESG
                     DETEPLNASIQEQNGIINDNTATKKNNNDKVIILGRQINEINDTLFEVKVKPVLEVSC
                     SQTVVKESSSYLQKIFKLNREDKKYKKVENKVTVMSKSSISPTISDLKNDAISDTNEQ
                     NETKDSPPNNSLPSFQNNIVKSLEERKQIALRTGPVQVLQSDKNNTNHTLFSCLRDIF
                     IELSCSKSLTGLVSPTGFIDILKRDNVLFNTYCHQDAHEFFNFLINDLCDYLDNSSLA
                     NEEIVGNIVSETFKGIIKYQTRCSMCDSITEREEQFLDFPIEFNGSEKVEIQELLGNY
                     CAREILRASNKFYCEICNEYQEAERLIGIKELPKHLVVHLKRFKYCEEKNCNIKLFNK
                     VNYPFTLNISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHKSYGWLIYDDETV
                     QAVSDELVSRILNNEQRSATAYLLFYEEVDSKITQIYDIDLYAKNIEALLRDDELLRK
                     NTAGLIVIFKGRCIEKLHKPYPKLLKLIPNQYLASQRENNLRNKR"
     gene            complement(<141986..>142942)
                     /gene="TPHA0P00690"
                     /locus_tag="TPHA_0P00690"
                     /db_xref="GeneID:11530769"
     mRNA            complement(<141986..>142942)
                     /gene="TPHA0P00690"
                     /locus_tag="TPHA_0P00690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688613.1"
                     /db_xref="GeneID:11530769"
     CDS             complement(141986..142942)
                     /gene="TPHA0P00690"
                     /locus_tag="TPHA_0P00690"
                     /inference="similar to DNA sequence:INSDC:YBL068W,YER099C"
                     /note="similar to Saccharomyces cerevisiae PRS4 (YBL068W)
                     and PRS2 (YER099C); ancestral locus Anc_7.391"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688661.1"
                     /db_xref="GeneID:11530769"
                     /db_xref="GOA:G8C249"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:G8C249"
                     /translation="MSSNSIKLISGNSHPELAELISKRLSIPLSKVGVYQYSNKETSV
                     TIGESIRDEDVYIIQTGTGEDEVNDFLMELLILIHACKTASVRRITAVIPNFPYARQD
                     KKDKSRAPITAKLIANLLQTAGCDHVITMDLHASQIQGFFHIPVDNLYAEPSVLNYIK
                     TKTDLSNAILVSPDAGGAKRVASLADKLDLNFALIHKERQKANEVSRMVLVGDVKGKA
                     CLLIDDMADTCGTLVKACDTLLDHGAKEVVAIVTHGIFSGSAREKLSNSRLSKIVCTN
                     TLPIDLDLDIVEQVDISPTLAESIRRLHNGESVSYLFTHAPI"
     gene            <144086..>145058
                     /gene="TPHA0P00700"
                     /locus_tag="TPHA_0P00700"
                     /db_xref="GeneID:11530819"
     mRNA            join(<144086..144088,144654..>145058)
                     /gene="TPHA0P00700"
                     /locus_tag="TPHA_0P00700"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_003688614.1"
                     /db_xref="GeneID:11530819"
     CDS             join(144086..144088,144654..145058)
                     /gene="TPHA0P00700"
                     /locus_tag="TPHA_0P00700"
                     /inference="similar to DNA sequence:INSDC:YER074W,YIL069C"
                     /note="similar to Saccharomyces cerevisiae RPS24A
                     (YER074W) and RPS24B (YIL069C); ancestral locus Anc_7.262"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_003688662.1"
                     /db_xref="GeneID:11530819"
                     /db_xref="GOA:G8C250"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:G8C250"
                     /translation="MSDAITIRTRKVITNPLLSRKQFVIDVLHPNRANVSKDELREKL
                     AEIYKADKDAVSVFGFRTQFGGAKSTGFGLVYNSVADAKKFEPTYRLVRYGLAEKVEK
                     ASRQQRKQKKNRDKKIFGTGKRLAKKMARRNAE"
     gene            <145704..>145961
                     /gene="TPHA0P00710"
                     /locus_tag="TPHA_0P00710"
                     /db_xref="GeneID:11530820"
     mRNA            <145704..>145961
                     /gene="TPHA0P00710"
                     /locus_tag="TPHA_0P00710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688615.1"
                     /db_xref="GeneID:11530820"
     CDS             145704..145961
                     /gene="TPHA0P00710"
                     /locus_tag="TPHA_0P00710"
                     /inference="similar to DNA sequence:INSDC:YER074W-A"
                     /note="similar to Saccharomyces cerevisiae YOS1
                     (YER074W-A); ancestral locus Anc_7.263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688663.1"
                     /db_xref="GeneID:11530820"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:G8C251"
                     /translation="MVLFGLGKLFYVILLLINAVAILSEERFLSRIGLGRSTNAGPSF
                     GQDENTTKSKVIQLIGAVQTLLRIPLIGINIIVIIYELLLG"
     gene            complement(<146273..>147778)
                     /gene="TPHA0P00720"
                     /locus_tag="TPHA_0P00720"
                     /db_xref="GeneID:11530821"
     mRNA            complement(<146273..>147778)
                     /gene="TPHA0P00720"
                     /locus_tag="TPHA_0P00720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688616.1"
                     /db_xref="GeneID:11530821"
     CDS             complement(146273..147778)
                     /gene="TPHA0P00720"
                     /locus_tag="TPHA_0P00720"
                     /inference="similar to DNA sequence:INSDC:YER078C"
                     /note="similar to Saccharomyces cerevisiae YER078C;
                     ancestral locus Anc_7.268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688664.1"
                     /db_xref="GeneID:11530821"
                     /db_xref="GOA:G8C252"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:G8C252"
                     /translation="MFKSNSFLIFRNFSINNIRNYASLQAGQPLHETRPNLLKSGELT
                     PGITALEYFDRRVKFAKLLPAKSCAIIAGNQVKYASGAVFYDFQQNNNLFYLSGWNEP
                     DSVLILEKQTENLIDLVFHMLVRPKDEYSEKWEGFRTGIEGVRDIFNADESDDISNLS
                     DYVKKIVKRCDNIFYDKDTENQSRGDSAKFGNFFSVPSNSSQEKDLNAILQIHGTNKK
                     ISGLDKILAPMRRIKSPSELKVMRRAGQISAYAYNQALPKKFRNERTLQAYLEFKFIS
                     GGCDKSAYIPVVASGKNALCIHYTRNNDTIDDGKMVLVDAAGSIGGYRSDISRTWPIN
                     GKFTEAQKALYSAVLNVEKRSIELCTADHGLSLHEVHQKSTEYMLEELKNVGFNGIDY
                     SEVDKLYPHYIGHNLGLDVHDVPNASRHNKLEAGQVITIEPGIYIPDEPSYPSYFRNI
                     GIRIEDDIAVGEKSYVNLTAEAVKEIADIENAIQNNNPTKFDDDVIRPLDT"
     gene            complement(<148081..>149907)
                     /gene="TPHA0P00730"
                     /locus_tag="TPHA_0P00730"
                     /db_xref="GeneID:11530822"
     mRNA            complement(<148081..>149907)
                     /gene="TPHA0P00730"
                     /locus_tag="TPHA_0P00730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688617.1"
                     /db_xref="GeneID:11530822"
     CDS             complement(148081..149907)
                     /gene="TPHA0P00730"
                     /locus_tag="TPHA_0P00730"
                     /inference="similar to DNA sequence:INSDC:YIL072W"
                     /note="similar to Saccharomyces cerevisiae HOP1 (YIL072W);
                     ancestral locus Anc_7.269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688665.1"
                     /db_xref="GeneID:11530822"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:G8C253"
                     /translation="MSTKQQVLTKVDTKTEITTEQSQKLIQTLLSMSFGCLAFLRGLF
                     PDDNFIDQRFVPEKVIKNYDKNKIVQANSIKIKTLLRGRSQEADVFLDWLENGVFQTL
                     RLKYLKALSLGIFSDEKEPNDLIENYVFSFEYQNNNEISFKMESDKKGTLTSSLLDSR
                     KAVQQLMRRFIILTQSLEPLPDKKYLSMRLMFNDTTPKNFQPSLFKDATYEKPPTIKL
                     KSGINLADTSVGSLNTGHNKIKLSLFSLYDSSLIQEEIVNETRDIVSINKQSFSESYQ
                     YIDPLSFAEENFNILPTVGNKINSQSQVSNLLSDILKSSQPNTQPTQFNGSKINRQVE
                     CECGLQSPTNSGTIRECKECNKLVHGVCYGNVNSKKLESCFSCLYEKIFLEFGEECKD
                     LMMIRKCFRTLSRIRSFPSSIHEFIAIMISKEDITDTVTESVKFALAVLFNDGILNIN
                     DNIENKENVNARVNGTNVKIDVSGIKIDKVGELEYGKIMNIIFTYRSQGSHSFYVNQI
                     PHNLAEMEQWVNQVKLLKTKYNNNLSSQIDIQSLVINDTFTQDPIVIGKKRKNIQIAD
                     SEIVEDSNPYSNIEINNGIEETKTPLKIRKISVSKKTLKSNW"
     gene            <150710..>151318
                     /gene="TPHA0P00740"
                     /locus_tag="TPHA_0P00740"
                     /db_xref="GeneID:11530823"
     mRNA            <150710..>151318
                     /gene="TPHA0P00740"
                     /locus_tag="TPHA_0P00740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688618.1"
                     /db_xref="GeneID:11530823"
     CDS             150710..151318
                     /gene="TPHA0P00740"
                     /locus_tag="TPHA_0P00740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688666.1"
                     /db_xref="GeneID:11530823"
                     /db_xref="UniProtKB/TrEMBL:G8C254"
                     /translation="MSNTDDETSTLFRDSILNYFTSKRNVIKLLSDKLDGLELLETDE
                     SVEKYLEGCEYPCNCNFTNVNAEFDLKPIRLNTQHVKNQDSISNVSSLFERTSEDYKM
                     KIQEEFENVSICTDYGNEPLQEFQDAVMACVTYPIWYINNEDDVGDYIADLVEYYEPL
                     VGDLELMEEILKVFMVFGQEYHILNSEWFYSFELDTFFKIVV"
     gene            <151647..>154562
                     /gene="TPHA0P00750"
                     /locus_tag="TPHA_0P00750"
                     /db_xref="GeneID:11530803"
     mRNA            <151647..>154562
                     /gene="TPHA0P00750"
                     /locus_tag="TPHA_0P00750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688619.1"
                     /db_xref="GeneID:11530803"
     CDS             151647..154562
                     /gene="TPHA0P00750"
                     /locus_tag="TPHA_0P00750"
                     /inference="similar to DNA sequence:INSDC:YIL073C"
                     /note="similar to Saccharomyces cerevisiae SPO22
                     (YIL073C); ancestral locus Anc_7.272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688667.1"
                     /db_xref="GeneID:11530803"
                     /db_xref="InterPro:IPR013940"
                     /db_xref="UniProtKB/TrEMBL:G8C255"
                     /translation="MSEMNSVVKATLEEFCDSSVWLVQQFSSNLENTFSSVENRLDGL
                     QPMAEKYERLFRTSPIIIDEELCLKLENNSTSLWNQITMIEKSKNNKENQKILFRCKV
                     YATILLSIYESLSPTVVNKLMVLKCYITVLKGLEGEFYDQQILRNIQEQCDKLLIVTQ
                     DEINDNKIKNHLETEQKEKDFNNLRIEYLIINFQLALAENDYELASIYFSKVDINENT
                     SSMNPKVLLELCRLIYNAILQQYQNFNEEIPNIDILNSMCHYLRNTSELFTLNKNMLK
                     TEVNYSSMHFSIFTLHAELLMLQPSTDINWEFINSIIEQLQTEYPKKIESHLLSYKVR
                     NKTMHPENLNEELKELIMKMIINIDIKENFEAITNCISDFAQKSITLANVCLDYIFGN
                     KLDPQRDQTIFEKLICIRVYLTTQSSQLNTSEMISSLKDYCTKIEHTIVHEVGLTTVS
                     TIITLFWNTGKTLQKRDQFLESNEFYNLALMNIFCQNYADRSKIQRALIQNFIQLDDM
                     GRAKEIYQTMDYANKKLPLSQLLLLKILYKENDIKGCEECFSQLKINEGDSSVECLIL
                     GVEECKDNIELSLKAMQMLFEKLEEAHFAKDDKGKVSFPIFSLTRYIIQLITKVTEKN
                     GNESFLLYYSVITNLLSKSLEYFKVLQDRTVVARKLNANVTTEIISIDEIEWFSSTCY
                     NIASKCFRENIQVDIDRIVTLAIEYFSLIPIEDVDFSIKCHFKYWYFRTKLLALAVSS
                     SKLSGDTNDQKRLMIEKKVENLNNEIIELINSKDMKDKGNDDEKTKINSCLIELLRLT
                     FEDIMSTKNKEKILAFIKKSYNQNEKQIEILFFSMTVNNPNLSQSIAVYIMEMLIDRN
                     TSSNLLGVEVLLRWLKIYMNFILDLDMTCKFLLVEQLSKQLQQENIPKLIEKQEVRDD
                     LEIISTLCWNQGINLIMEEDKVNANVYCKQALYFAELANPKLCEQLKQMWNALEESK"
     gene            complement(<154707..>155579)
                     /gene="TPHA0P00760"
                     /locus_tag="TPHA_0P00760"
                     /db_xref="GeneID:11530804"
     mRNA            complement(<154707..>155579)
                     /gene="TPHA0P00760"
                     /locus_tag="TPHA_0P00760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688620.1"
                     /db_xref="GeneID:11530804"
     CDS             complement(154707..155579)
                     /gene="TPHA0P00760"
                     /locus_tag="TPHA_0P00760"
                     /inference="similar to DNA sequence:INSDC:YER083C"
                     /note="similar to Saccharomyces cerevisiae GET2 (YER083C);
                     ancestral locus Anc_7.277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688668.1"
                     /db_xref="GeneID:11530804"
                     /db_xref="GOA:G8C256"
                     /db_xref="InterPro:IPR014802"
                     /db_xref="InterPro:IPR028143"
                     /db_xref="UniProtKB/TrEMBL:G8C256"
                     /translation="MSELSEAEKRQLLRERRQRKFKNGGASSRLNQITGQNKDSQLST
                     ESPLDVQTAATKNTIEMDDLFANVKKASVENKAKQAAIKKKTEKEQIQNPVNPELEMY
                     KHLAEKTQDDGSSTPEFFSMLQSMQQSFGEGTATPSSQVFPVDQANLDYYNYKLNNMK
                     AVFILIKWLVFLLPYIYFVTRPKLQQFNHQFSLSALTDSRNFFMVFLSFEIVAMSAYL
                     QKLKGLQKGHKIDPIQNAGKFANLIGLIPEGILPINNLKGKAVLCLQHLDLLSLFLTD
                     LAFVIIMIGIVSVF"
     gene            complement(<156131..>157012)
                     /gene="TPHA0P00770"
                     /locus_tag="TPHA_0P00770"
                     /db_xref="GeneID:11530805"
     mRNA            complement(<156131..>157012)
                     /gene="TPHA0P00770"
                     /locus_tag="TPHA_0P00770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688621.1"
                     /db_xref="GeneID:11530805"
     CDS             complement(156131..157012)
                     /gene="TPHA0P00770"
                     /locus_tag="TPHA_0P00770"
                     /inference="similar to DNA sequence:INSDC:YIL076W"
                     /note="similar to Saccharomyces cerevisiae SEC28
                     (YIL076W); ancestral locus Anc_7.278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688669.1"
                     /db_xref="GeneID:11530805"
                     /db_xref="GOA:G8C257"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="UniProtKB/TrEMBL:G8C257"
                     /translation="MDYFTVKQNYYTGNYSQVLKEIDVLGADDTTLFYKARSQIALGS
                     YESNASAGQLGASFDSYNAFLKSKKIEDVSIKEDSASNYELVLLASANAIVGDYETAS
                     QLCNKGIDSDEEVGKLELLLLAVEISLLNEKPTIAKALYDNFVNQKTAQGEFSSEDEL
                     IVNLAESYIKFFTNVDTTSSNFYYYSEISQSFSTWSAQLRLLNSHLQQGHLTEAQDIV
                     KVLESEYYSVQQKEQADLFKPELLVQKITLSAMQDDGNIESLRTELKSLAPEHAYLKN
                     NEKINNKFDELVVKYSS"
     gene            complement(<157503..>159683)
                     /gene="TPHA0P00780"
                     /locus_tag="TPHA_0P00780"
                     /db_xref="GeneID:11530806"
     mRNA            complement(<157503..>159683)
                     /gene="TPHA0P00780"
                     /locus_tag="TPHA_0P00780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688622.1"
                     /db_xref="GeneID:11530806"
     CDS             complement(157503..159683)
                     /gene="TPHA0P00780"
                     /locus_tag="TPHA_0P00780"
                     /inference="similar to DNA sequence:INSDC:YIL078W"
                     /note="similar to Saccharomyces cerevisiae THS1 (YIL078W);
                     ancestral locus Anc_7.280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688670.1"
                     /db_xref="GeneID:11530806"
                     /db_xref="GOA:G8C258"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:G8C258"
                     /translation="MSEVTEQVKNLSVDDKPKKENKKNKQQSLFLDPEPAFIQERDDM
                     FTKLLAEYNEKVKAKAHVPIKIVLKDGSKKDAVSWETTPMDIAKDISKSLADRLCIAR
                     VNGSLWDLDRPFESESENEEFSLQLLDFDSEDGKKVFWHSSAHVLGESCECHMGAHIC
                     LGPPTDDGFFYEFATRDSLKEKTEDEAERTVSQADFPNLESVAKSVIKQKQKFERLVM
                     SKEDLLKMFHYSKYKTYLVQTKIPDGGETTVYKCGKLIDLCTGPHIPHTGRIKAFKLL
                     KNSSCYFLGESDNDSLQRIYGVSFPDKKLMDAHLKFLKEAADRDHRKIGKEQELFLFH
                     EMSPGSCFWLPHGTRIYNTLVDMMRTEYRKRGYEEVITPNMYNSKLWETSGHWANYKD
                     NMFSFEVEKETFGLKPMNCPGHCLMFKSRERSYRELPWRVADFGVIHRNEFSGALSGL
                     TRVRRFQQDDAHIFCTQDQIEGEIENIFDFLKYTYGVFGFEFKMELSTRPDKYVGEIE
                     TWNSAESKLQSCLEKWGGDWEINPGDGAFYGPKIDIMISDALRRWHQCATIQLDFQLP
                     NRFELEFKAKDGSDSENYERPVMIHRAILGSVERMTAILTEHFAGKWPFWLSPRQVYV
                     VPVGVKYQEYAQQIRDKCHEAGFYTDVDLTGNTLQKKVRNGQLLKYNFIFIVGEQEMN
                     ERSVNIRNRDIMEQQGKNATVNIDTVIEQLKKLKEERRSDNALE"
     gene            <160182..>161201
                     /gene="TPHA0P00790"
                     /locus_tag="TPHA_0P00790"
                     /db_xref="GeneID:11530807"
     mRNA            <160182..>161201
                     /gene="TPHA0P00790"
                     /locus_tag="TPHA_0P00790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688623.1"
                     /db_xref="GeneID:11530807"
     CDS             160182..161201
                     /gene="TPHA0P00790"
                     /locus_tag="TPHA_0P00790"
                     /inference="similar to DNA sequence:INSDC:YIL079C,YDL175C"
                     /note="similar to Saccharomyces cerevisiae AIR1 (YIL079C)
                     and AIR2 (YDL175C); ancestral locus Anc_7.281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688671.1"
                     /db_xref="GeneID:11530807"
                     /db_xref="GOA:G8C259"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:G8C259"
                     /translation="MTEENNEGLRELRGEGRYFGILDGDQIISGSEIVCRQCRQEGHM
                     QRDCPHTVCSYCGVLDEHASKDCKLTIFCKKCGETGHYFNHCPLRFDDNIYCTVCNSN
                     RHVEKMCSSVWRSYALRDDNTDADLGQQLDMEKFYCYNCGSSGHLGDDCKEYRSSRVP
                     NDDGSAFSGENLSTPLKKMYYQKLNEEYDYYDYGYRKNQSSYNDLNWRQANDQHYMQK
                     PLPKPTSTMQSLPTLNYPQIPEHSYPVRQQGVYYNTQNQYNGQGSYINNYNNQYDNQY
                     GSYDNYQNNNQYNNYNNFNNYQNNRNDGGRLNYNTVYRNNNESKSYQPTKSGTIDEDF
                     KNIDY"
     gene            complement(161355..161428)
                     /gene="TPHA0Ptrna11I"
                     /locus_tag="TPHA_0Ptrna11I"
                     /db_xref="GeneID:11530851"
     tRNA            complement(161355..161428)
                     /gene="TPHA0Ptrna11I"
                     /locus_tag="TPHA_0Ptrna11I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11530851"
     gene            complement(<162667..>164892)
                     /gene="TPHA0P00800"
                     /locus_tag="TPHA_0P00800"
                     /db_xref="GeneID:11530857"
     mRNA            complement(<162667..>164892)
                     /gene="TPHA0P00800"
                     /locus_tag="TPHA_0P00800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688624.1"
                     /db_xref="GeneID:11530857"
     CDS             complement(162667..164892)
                     /gene="TPHA0P00800"
                     /locus_tag="TPHA_0P00800"
                     /inference="similar to DNA sequence:INSDC:YDL176W"
                     /note="similar to Saccharomyces cerevisiae YDL176W;
                     ancestral locus Anc_7.283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688672.1"
                     /db_xref="GeneID:11530857"
                     /db_xref="UniProtKB/TrEMBL:G8C260"
                     /translation="MSDADEISFIVSTASKDENHNSINLVYFEYKDKKLHWHPGKYIL
                     GDTLNAHDRLGEIQKFCYVKPGSHISGETRNDGNLGDDISDYLFIAKKNGVIEVIKDF
                     KKKVTESKDLIADFKMTCNLLPYFRDAEKPNAFDIISLEYFNGILYCSTRVGKVYSFF
                     LNLPNYYRQVNNFFNSKAQDDGIYSIFKESYTPDNFENPNIFEKLTMYVTNEGWQDIC
                     YFLKPTIDTLKDGCGYTKDALYFRASFCVDIKRNIESCHVNPLDRYSLLISSNNINMS
                     IEKFNIPQYFYYWLFSFLSKKTNTQNKLKSYQDGKQSESKINSKCVLKPPSTRIDRLK
                     KMSDYLTESYERGDDGHFNQYNRNAELVEPSDYTSPQFNPITHEEQLFEPEVLAAFNN
                     RRMLDHDLVLSNNNVAIIPSYICWEFKNGKEKTFNTVSFLERRSLRRRNREMFNEILN
                     HGGNWVPNIDDSISTHSNSLSNTSTTSLDKRHSSKNPFLLLDFYACYNSNSATNNISE
                     IDFLTPNYSKLKLISISRNNSIEVFKPKYQNIPSLKIDSFKYVEDEKETLETFNMKCF
                     KDKMTISSLTSFQKLFKINENLSLIIDEAGLLIIDTENITNIDNLSDNNDKILKIALF
                     NFGKIKDVIIYINQFNECMYEYPLKHNFEDEHDYCNDFSISLTAIVTTDADHILGLNG
                     VFICHSKLGKLELTDSIITKNNHKTVELLQFLDFSTVQNTKKHYLKIQSDSDLAYKKQ
                     R"
     gene            complement(<165632..>166375)
                     /gene="TPHA0P00810"
                     /locus_tag="TPHA_0P00810"
                     /db_xref="GeneID:11530852"
     mRNA            complement(<165632..>166375)
                     /gene="TPHA0P00810"
                     /locus_tag="TPHA_0P00810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688625.1"
                     /db_xref="GeneID:11530852"
     CDS             complement(165632..166375)
                     /gene="TPHA0P00810"
                     /locus_tag="TPHA_0P00810"
                     /inference="similar to DNA sequence:INSDC:YDL179W,YDL127W"
                     /note="similar to Saccharomyces cerevisiae PCL9 (YDL179W)
                     and PCL2 (YDL127W); ancestral locus Anc_7.289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688673.1"
                     /db_xref="GeneID:11530852"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:G8C261"
                     /translation="MSGYSALLYLSKQPVSRDMVKFLVSSTEAIIPNIQQSGSLAIPS
                     LTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKT
                     LNDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNVRISTEDLIDSLSPLLQPIQ
                     EMLTLHDQHPDSQIKKSKLLSNVTISQQKLQKVKPSSTYLSSNYSIPSLSSSVTFSSA
                     GSSEAAVAEVKKLQTETSNSKVTNKQKQK"
     gene            complement(<167245..>168486)
                     /gene="TPHA0P00820"
                     /locus_tag="TPHA_0P00820"
                     /db_xref="GeneID:11530853"
     mRNA            complement(<167245..>168486)
                     /gene="TPHA0P00820"
                     /locus_tag="TPHA_0P00820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688626.1"
                     /db_xref="GeneID:11530853"
     CDS             complement(167245..168486)
                     /gene="TPHA0P00820"
                     /locus_tag="TPHA_0P00820"
                     /inference="similar to DNA sequence:INSDC:YDL128W"
                     /note="similar to Saccharomyces cerevisiae VCX1 (YDL128W);
                     ancestral locus Anc_7.290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688674.1"
                     /db_xref="GeneID:11530853"
                     /db_xref="GOA:G8C262"
                     /db_xref="InterPro:IPR004713"
                     /db_xref="InterPro:IPR004798"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G8C262"
                     /translation="MDASAPLLSNSNHGINQRHTMSKFETAKLDMEFVFTSSPINVLL
                     VFVPLGLAFGFFQLSHTWTFVFNFLSIIPLASILAYATEELANKAGSTIGGLLNATFG
                     NAVELIVSIIALREGQIRIVQASMLGSLLSNLLLVLGFCFILGGWNRIQQTFNQTAAQ
                     TMSSLLAISCASLLLPAAFRATLPHGKDDAWIDEKILAYSRGTSMVLLIVYVLFLVFQ
                     LGSHKDMFEEQIEETGEILSQRSMKPHHSLSIKSSLIFLLTTTVFVSVCADYLVGTID
                     NVVASTGLSKTFIGLIIIPIVGNAAEHVTSVYVAMKNKMDLALSVAIGSSLQISLFVT
                     PFMVLFGWWIDVPMTLNFNAFETTTLFISVLLSNYLILDGESNWLEGCMSLAMYILIA
                     MAFYYYPDEEIVEFVKSVASN"
     gene            complement(<169011..>169660)
                     /gene="TPHA0P00830"
                     /locus_tag="TPHA_0P00830"
                     /db_xref="GeneID:11530854"
     mRNA            complement(join(<169011..169217,169547..>169660))
                     /gene="TPHA0P00830"
                     /locus_tag="TPHA_0P00830"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_003688627.1"
                     /db_xref="GeneID:11530854"
     CDS             complement(join(169011..169217,169547..169660))
                     /gene="TPHA0P00830"
                     /locus_tag="TPHA_0P00830"
                     /inference="similar to DNA sequence:INSDC:YDL130W"
                     /note="similar to Saccharomyces cerevisiae RPP1B
                     (YDL130W); ancestral locus Anc_7.293"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_003688675.1"
                     /db_xref="GeneID:11530854"
                     /db_xref="GOA:G8C263"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:G8C263"
                     /translation="MSDAVISYAAFILADAGLDVSAENLLTLTKAAGADVQNVWADVY
                     AEALQGKDLKEILAGFHNAGPAAAGSGAAASSGSAAAAEAAEEAAEEEAEESDDEMGF
                     GLFD"
     gene            complement(<170348..>171694)
                     /gene="TPHA0P00840"
                     /locus_tag="TPHA_0P00840"
                     /db_xref="GeneID:11530855"
     mRNA            complement(<170348..>171694)
                     /gene="TPHA0P00840"
                     /locus_tag="TPHA_0P00840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688628.1"
                     /db_xref="GeneID:11530855"
     CDS             complement(170348..171694)
                     /gene="TPHA0P00840"
                     /locus_tag="TPHA_0P00840"
                     /inference="similar to DNA sequence:INSDC:YDL182W,YDL131W"
                     /note="similar to Saccharomyces cerevisiae LYS20 (YDL182W)
                     and LYS21 (YDL131W); ancestral locus Anc_7.295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688676.1"
                     /db_xref="GeneID:11530855"
                     /db_xref="GOA:G8C264"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8C264"
                     /translation="MTDNNNKFQAVTESAAAAANFQQNPYGPNPADFLSNVNNFQLID
                     STLREGEQFANSFFSTEKKIEIAKALDDFGVDYIELTSPVASEQSRKDCEAICKLGLK
                     AKILTHIRCHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFV
                     KSKGIEIRFSSEDSFRSDLVDLLNIYKTVSKIGVNRVGIADTVGCANPRQVYELVRTL
                     KSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVCVLGIGERNGITPLGGLMARMI
                     VASPQYVKSKYKLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANP
                     STYEILDPHDFGMKRYIHFANRLTGWNAIKSRVDQLNLNLTDSQVKEVTAKIKKMGDI
                     RPLNIDDVDSIIKDFHSGITTPALKPAKENEPIEDSVDILLDPQGPAFKKAKTVAK"
     gene            complement(<172533..>175004)
                     /gene="TPHA0P00850"
                     /locus_tag="TPHA_0P00850"
                     /db_xref="GeneID:11530808"
     mRNA            complement(<172533..>175004)
                     /gene="TPHA0P00850"
                     /locus_tag="TPHA_0P00850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688629.1"
                     /db_xref="GeneID:11530808"
     CDS             complement(172533..175004)
                     /gene="TPHA0P00850"
                     /locus_tag="TPHA_0P00850"
                     /inference="similar to DNA sequence:INSDC:YDL132W"
                     /note="similar to Saccharomyces cerevisiae CDC53
                     (YDL132W); ancestral locus Anc_7.296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688677.1"
                     /db_xref="GeneID:11530808"
                     /db_xref="GOA:G8C265"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:G8C265"
                     /translation="MTDILPRSDDLEATWNFIEPAINQILGQNDQELVNKRVNKILSP
                     TMYMEVYTAIYNYCVNKSRSTGQFSSDRVHSNGQSSILIGSEIYEKLKHFLKRYITNF
                     TKKENETFLEFYVRRWKRFTIGSIFLNHAFDYMNRYWVQKERSDGKRDIFDVNTLCLI
                     TWKQVMFDSNSELLANEILQQITMERNEQSVHQSNLITAIKSFVALGIDPQDLKKLNL
                     NVYLQNFEKPFLTSTEEYYTKFSNEFLENHSVTDYISKARNIIYQEEESMSIYWDEHT
                     RKPLSETLNAVLITKHVKKLEDEFVTLLDARDEINISALYILMQRDFTLMPQLANVFE
                     QYIKKTGEDEVLKLLKMFPSANGSQKTPALIIPPKEYIKKLIEVYKIFLNITQKCFNN
                     DPLFTKALDNACRSYVNVNAYAIPPGNTNVSVNLLTSKTPEMLAKYSDQLLKKSTKPE
                     ISNDMNVDDIMMIFKFLTDKDAFETHYRRLFAKRLIHGTSTRDSDEESIIQRLQSENS
                     MEYTGKIAKMFQDVRLSKIVEEEFNSSVKELPDYSPLKYPELEPFILAETMWPFQYQE
                     SEYTVPPDLKPSFTKLEDMYITKHSGRILKWLYPLCRGELQANIAKTHNAPFNFTVTL
                     YQMSILLLYNGSENNQLTLEQIQEGTNLKINNIAASMIPFIKYKLIQQVPPGLNNLIQ
                     NDTIFKLNTPYKALKPKINFASGVKNDIMNLINANTNSNNTSNGGATNAGPDMGSNTN
                     LSENEKIAKELNIERQIYLEACIVRIMKTNRTMPHTTLINDVIQQAHQRFNPKIAMIK
                     KAIDNLIQKEYLVRGEDGESYRYLA"
     gene            complement(<175558..>176973)
                     /gene="TPHA0P00860"
                     /locus_tag="TPHA_0P00860"
                     /db_xref="GeneID:11530809"
     mRNA            complement(<175558..>176973)
                     /gene="TPHA0P00860"
                     /locus_tag="TPHA_0P00860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688630.1"
                     /db_xref="GeneID:11530809"
     CDS             complement(175558..176973)
                     /gene="TPHA0P00860"
                     /locus_tag="TPHA_0P00860"
                     /inference="similar to DNA sequence:INSDC:YDL133W"
                     /note="similar to Saccharomyces cerevisiae YDL133W;
                     ancestral locus Anc_7.297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688678.1"
                     /db_xref="GeneID:11530809"
                     /db_xref="UniProtKB/TrEMBL:G8C266"
                     /translation="MQAAHGEAVGHKSVGAMSLLEKSTETPSGSSSSDLPVGEHTANT
                     NDTSMSANSERHGMKSRDASETVGNLNYYALNPTTVPPFVLDEDFKRLKTRNSNLLNT
                     DTIFEDKSGIDYGKNVVTRDPFLNSDVEKWGQLVTNVGNHVTYISDQQTKTRMRSSQD
                     MASASMVSAGGSSSMMDRVFDDEVQLNDLSSEWGGEERLNGVYNQPLFQNYHEVKNTM
                     NNREWYEYISKIKDFYYQDGYNKHKQEAGRDGYADRAGQSDWLDEFSKEKERWRRFRK
                     SKYQKWRPLVTELILNSHYVPLAFRLMIVILCAISLGIASRIFINSDDNSIASIDGRI
                     TQQASTVMAICVNSFAIVYSVYIAHDEFTGRPLGLRDPLRKLGLILLDLLFVIFSSAN
                     LALAFNTLFDPKWVCIDDTSTGTAGTGSNSKSFPKVAYICRKQRALSAFLFILMFTWV
                     VTYAITIFRVVQRVRSQSPRF"
     gene            <177150..>177917
                     /gene="TPHA0P00870"
                     /locus_tag="TPHA_0P00870"
                     /db_xref="GeneID:11530810"
     mRNA            <177150..>177917
                     /gene="TPHA0P00870"
                     /locus_tag="TPHA_0P00870"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688631.1"
                     /db_xref="GeneID:11530810"
     CDS             177150..177917
                     /gene="TPHA0P00870"
                     /locus_tag="TPHA_0P00870"
                     /inference="similar to DNA sequence:INSDC:YDL183C"
                     /note="similar to Saccharomyces cerevisiae YDL183C;
                     ancestral locus Anc_7.298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688679.1"
                     /db_xref="GeneID:11530810"
                     /db_xref="InterPro:IPR018786"
                     /db_xref="UniProtKB/TrEMBL:G8C267"
                     /translation="MFGIIRRHISIGRSGFFARDHRLLLVPLSEQDVFFHYEYPHRLV
                     NMDRRVVKLDRWMTRKAHGVWDRFGKSENRVNRYLYGQVSKFVENVPWEEESLRRFPI
                     ETHLHGVETVAMYGPYQVGDEMQEVTATLNKKLAVLEPQYKRQIALCVAAMPLTIPIM
                     LIPLVPNIPSFILCYRVYCHYRSLHGLKMFKSILNDKARHTYMQLTDFPAMPCRGAGR
                     GADGMRRYSKRVAEYAGLPSLATALLKADQQRHVTDT"
     gene            <178418..>179485
                     /gene="TPHA0P00880"
                     /locus_tag="TPHA_0P00880"
                     /db_xref="GeneID:11530811"
     mRNA            <178418..>179485
                     /gene="TPHA0P00880"
                     /locus_tag="TPHA_0P00880"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688632.1"
                     /db_xref="GeneID:11530811"
     CDS             178418..179485
                     /gene="TPHA0P00880"
                     /locus_tag="TPHA_0P00880"
                     /inference="similar to DNA sequence:INSDC:YDL188C,YDL134C"
                     /note="similar to Saccharomyces cerevisiae PPH22 (YDL188C)
                     and PPH21 (YDL134C); ancestral locus Anc_7.302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688680.1"
                     /db_xref="GeneID:11530811"
                     /db_xref="GOA:G8C268"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:G8C268"
                     /translation="MSTEVDVDVPMQDAEQSDLDLELELEDELMKPGSSGIADHKSAE
                     PVKLTTTSIGQLDAWIEKLVKCEVLSEDEVARLCKMAVDVLQFEENVQPVNVPVTICG
                     DVHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPSRITIL
                     RGNHESRQITQVYGFYDECLRKYGSASVWKMFTDLFDYFPITALVDNQIFCLHGGLSP
                     MIETVDQVRDLNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNH
                     TNNLSLIARAHQLVMEGFSWSHQQNVITIFSAPNYCYRCGNQAAIMEVDENHNRQLLQ
                     YDPSIRPGEPTVTRKTPDYFL"
     gene            <180014..>180616
                     /gene="TPHA0P00890"
                     /locus_tag="TPHA_0P00890"
                     /db_xref="GeneID:11530812"
     mRNA            <180014..>180616
                     /gene="TPHA0P00890"
                     /locus_tag="TPHA_0P00890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688633.1"
                     /db_xref="GeneID:11530812"
     CDS             180014..180616
                     /gene="TPHA0P00890"
                     /locus_tag="TPHA_0P00890"
                     /inference="similar to DNA sequence:INSDC:YDL135C"
                     /note="similar to Saccharomyces cerevisiae RDI1 (YDL135C);
                     ancestral locus Anc_7.303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688681.1"
                     /db_xref="GeneID:11530812"
                     /db_xref="GOA:G8C269"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="UniProtKB/TrEMBL:G8C269"
                     /translation="MSEPVNDNEFEDGNIDNYKVSAKKTVDEYKNLDAEDESLAKWKA
                     SLGLSSDVLPLEFPGDKRKVVVLKIQLLVDTEPKPIEFDLTSEETIKELSSKRYKVKE
                     KSTYKLKIIFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTSAKPFYEVELP
                     ESEAPSGMLARGKYSAVSKFIDDDKMNHLTLNWGVEIVKK"
     gene            complement(<180898..>181443)
                     /gene="TPHA0P00900"
                     /locus_tag="TPHA_0P00900"
                     /db_xref="GeneID:11530840"
     mRNA            complement(<180898..>181443)
                     /gene="TPHA0P00900"
                     /locus_tag="TPHA_0P00900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688634.1"
                     /db_xref="GeneID:11530840"
     CDS             complement(180898..181443)
                     /gene="TPHA0P00900"
                     /locus_tag="TPHA_0P00900"
                     /inference="similar to DNA sequence:INSDC:YDL137W,YDL192W"
                     /note="similar to Saccharomyces cerevisiae ARF2 (YDL137W)
                     and ARF1 (YDL192W); ancestral locus Anc_7.307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688682.1"
                     /db_xref="GeneID:11530840"
                     /db_xref="GOA:G8C270"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C270"
                     /translation="MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVIT
                     TIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGE
                     AREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCA
                     TSGEGLYEGLEWLSNNLKNQT"
     gene            complement(<182229..>183281)
                     /gene="TPHA0P00910"
                     /locus_tag="TPHA_0P00910"
                     /db_xref="GeneID:11530841"
     mRNA            complement(<182229..>183281)
                     /gene="TPHA0P00910"
                     /locus_tag="TPHA_0P00910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688635.1"
                     /db_xref="GeneID:11530841"
     CDS             complement(182229..183281)
                     /gene="TPHA0P00910"
                     /locus_tag="TPHA_0P00910"
                     /inference="similar to DNA sequence:INSDC:YDL193W"
                     /note="similar to Saccharomyces cerevisiae NUS1 (YDL193W);
                     ancestral locus Anc_7.308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688683.1"
                     /db_xref="GeneID:11530841"
                     /db_xref="GOA:G8C271"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:G8C271"
                     /translation="MSKIVDKVLDQHHREEERKVYSSREGPPESNVMKRKKKYDSKLE
                     VVKAITDIMLSGDVVGDSEHAKEETSKQRLLSSYFAFLFYKVVLLNMYLMFGLFRYFQ
                     YQYNKMKLRILSLIYNPTSTPQLIRQDVLKLNKIPKRIAAILEMKSVGDIGGGLEGLL
                     NDASEVICWTVSAGIKHLMLYDFDGVLKDNVDNLILEINEHMKLYYGPANVPNYSVHI
                     PHLNKTYYSSEEIKNDEDAKKSIVISVSLLSNRDGRETIVDLTRTMSELCASKEMKLS
                     DITMKLIDTELTHLVGHEPDLLLYFGPSLDLQGFPPWHIRLTEFYWETDNDQVSYLVF
                     IRGLQKYSNCKINVGK"
     gene            complement(<185904..>186470)
                     /gene="TPHA0P00920"
                     /locus_tag="TPHA_0P00920"
                     /db_xref="GeneID:11530842"
     mRNA            complement(<185904..>186470)
                     /gene="TPHA0P00920"
                     /locus_tag="TPHA_0P00920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688636.1"
                     /db_xref="GeneID:11530842"
     CDS             complement(185904..186470)
                     /gene="TPHA0P00920"
                     /locus_tag="TPHA_0P00920"
                     /inference="similar to DNA sequence:INSDC:YNL090W"
                     /note="similar to Saccharomyces cerevisiae RHO2 (YNL090W);
                     ancestral locus Anc_2.200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688684.1"
                     /db_xref="GeneID:11530842"
                     /db_xref="GOA:G8C272"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C272"
                     /translation="MAEQVKRKLVIIGDGACGKTSLLYKFTLGKFPEQYHPTVFENYV
                     TDCFVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAVDDVESLHNARTKWTE
                     EVLRYCPDTKIILVGLKSDLRKTAQDYEEGFVKREDAEQVARQIGAKKYLECSALTGQ
                     GVDTVFELATRTSLLVHKEPGIQCCTII"
     gene            complement(<187009..>190944)
                     /gene="TPHA0P00930"
                     /locus_tag="TPHA_0P00930"
                     /db_xref="GeneID:11530843"
     mRNA            complement(<187009..>190944)
                     /gene="TPHA0P00930"
                     /locus_tag="TPHA_0P00930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688637.1"
                     /db_xref="GeneID:11530843"
     CDS             complement(187009..190944)
                     /gene="TPHA0P00930"
                     /locus_tag="TPHA_0P00930"
                     /inference="similar to DNA sequence:INSDC:YNL091W"
                     /note="similar to Saccharomyces cerevisiae NST1 (YNL091W);
                     ancestral locus Anc_2.199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688685.1"
                     /db_xref="GeneID:11530843"
                     /db_xref="GOA:G8C273"
                     /db_xref="InterPro:IPR025279"
                     /db_xref="UniProtKB/TrEMBL:G8C273"
                     /translation="MPPSKNKKKKSKAKQIKKTNSDNHAGVSMSAELYNDEEQYPTSR
                     IIKRAANGDIVVESLSQGATSQSDDNNNGKDDYLSLALDSHWEWLSADEKKEILRIDR
                     DEVFEIMRKYNHNYGHNNKHSHVGNSNGMTANNANATNANCNCSICGRRHLAMDQEME
                     RIYNTLYELQEKRYDDMNPVKFHLNIIRDLQNSNMHIPTPSSSPVQFQNESPNIEASN
                     TVAVDTDKIPITKPTELKNNNYEYTKNGTLDQFLSTDSVNSLKEEVINFKQNKQKQLQ
                     DQLEIIQARDQKIEIEEEITTEPVYNVHPPAEVDDETKSKYLSFAKTFVSSHPSIAQE
                     YVNRILSCPEMQELTDDLMNNSGKGFLKVIESFASINGNNDAFDTENEETTNLNVTEL
                     NNNTDDIANEIDQAKEFTTMLHNGNPLTPEEYANLQRHIAERVTSSYDTEKREFVGIS
                     QLEKELFTRFMYGGDKKQFGNLILKSFKEKYNNDEFSDQKIGDTISAAASVVCEGFEF
                     ALANEKDNEDTEEDLDYEDENLDNNGDADEDEDEDDEFQYSDYYDEDDDSDHIHRHLD
                     DDEQFHCVHLDHIHDDNGIVTDNEFQLQQRNAANFSRYKHLDEQTSDVHEEEELIDDE
                     EYESGIDENERLEEGRKLLQIVLTKILQGRIMKSFHEKQAEKNRMKLLEELEVEESKK
                     KEKKEKKQKKREKEKEKKKLLQQAKEEEKRKKEEEEVRLKKEAEERELKRREAQRKQV
                     EEAKRKKDEERKIKLEEIRRREEEQDRQRKLKEEQKRKREEERREKEEQKKQQQLQQQ
                     KLKEEKLKEQMRLEEDRKKREEESQLKKERELQLKLKNEKSRAAIQAKAIQSSYGSML
                     NPDIDMSSTNSLNNEIFGMVNAATTSKSISESPSHLHPLLAQNNFKTFSQSIGKNTNQ
                     INFPDEAIFDSNKFNTVPNGSFGSLNGIPTVLSKPPIEQSNAYDRWSWNSFQSPLNQQ
                     NQLKQQNNLMNLSSPQSRLGSMSLNSDPSRQNFNKDLHSITDMLSTTSLHSKSQNFNT
                     FGGSSSLWGSQSPVTVAAQGNIQNNMISQNLQSNQSIAPVNIGNHHMSIWDSGNNNIA
                     DTSIPDSLEDNLMPPAPASTSNSSSSFAVNNNIWAQSVPSSSAQALLDPSLGYSQGEI
                     NTMTSNGVPDAQLTSNLLSNSQNSIITRNLIVNELKTLAVQNVNAEQYIPIDVLYQKV
                     SIHGIDSQTYVNELINLGNTNVCSLLTKENGLISDVKLNKPNSNGMVSQIMPPNGYKN
                     MTTLQRTPTSTILSSNQNPMSQTLSDTLNSQLFGIGQANKPTVLSNLWT"
     gene            complement(<191618..>192841)
                     /gene="TPHA0P00940"
                     /locus_tag="TPHA_0P00940"
                     /db_xref="GeneID:11530844"
     mRNA            complement(<191618..>192841)
                     /gene="TPHA0P00940"
                     /locus_tag="TPHA_0P00940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688638.1"
                     /db_xref="GeneID:11530844"
     CDS             complement(191618..192841)
                     /gene="TPHA0P00940"
                     /locus_tag="TPHA_0P00940"
                     /inference="similar to DNA sequence:INSDC:YNL092W"
                     /note="similar to Saccharomyces cerevisiae YNL092W;
                     ancestral locus Anc_2.197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688686.1"
                     /db_xref="GeneID:11530844"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8C274"
                     /translation="MELNNEISNEQEELKAFRKTLLSFWQYEEFAIREHYQPRYDKWM
                     SLSDHQKALLPNDYLYNLDQIKSKIHSNAEFYKDAVLSTAETLGFDLNYLNDWEMPST
                     SDMNKTCSILVQVYREFSAACQEERNILLSRIQALLNDIGQTDDKLTILVPGVGIGRL
                     IVDLCILAGSTATVISNEYSLHMLTLSMFLLNGNLDVNQYTIYPFIHSFSHWDMKSNQ
                     LKGYSIPDIDISSQNQSRGGLNMEMRMGSFADCFGPNVGIQESSQYTVTPDMRLKRAE
                     VESSIDIVITNFFIDTGFNILDYMETITHALKPGGHWVNFGPLLYHFENDANQETVYE
                     TNPYTNNREIAKPNTPLKGLELATMEILDIATTKLNYKIKLLEQGIPSGYGKSESLIH
                     IPGYLCNYWVIQLQE"
     gene            complement(<193256..>193897)
                     /gene="TPHA0P00950"
                     /locus_tag="TPHA_0P00950"
                     /db_xref="GeneID:11530835"
     mRNA            complement(<193256..>193897)
                     /gene="TPHA0P00950"
                     /locus_tag="TPHA_0P00950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688639.1"
                     /db_xref="GeneID:11530835"
     CDS             complement(193256..193897)
                     /gene="TPHA0P00950"
                     /locus_tag="TPHA_0P00950"
                     /inference="similar to DNA sequence:INSDC:YNL093W,YOR089C"
                     /note="similar to Saccharomyces cerevisiae YPT53 (YNL093W)
                     and VPS21 (YOR089C); ancestral locus Anc_2.196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688687.1"
                     /db_xref="GeneID:11530835"
                     /db_xref="GOA:G8C275"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C275"
                     /translation="MNSNVASVKLVLLGEAAVGKSSIVVRFVSNDFSENKEPTIGAAF
                     LTQRVNIDDHTIKFEIWDTAGQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWV
                     KELHEQASGDIVIALAGNKVDLIEENGENERKVATEEGQKLADEENLLFFETSAKTGY
                     NVNEIFLAVGDKIPLKRPNDNANENGSGNNQNSSRVQLTDANANAANAGNCSC"
     gene            complement(<194351..>196105)
                     /gene="TPHA0P00960"
                     /locus_tag="TPHA_0P00960"
                     /db_xref="GeneID:11530836"
     mRNA            complement(<194351..>196105)
                     /gene="TPHA0P00960"
                     /locus_tag="TPHA_0P00960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688640.1"
                     /db_xref="GeneID:11530836"
     CDS             complement(194351..196105)
                     /gene="TPHA0P00960"
                     /locus_tag="TPHA_0P00960"
                     /inference="similar to DNA sequence:INSDC:YOR090C"
                     /note="similar to Saccharomyces cerevisiae PTC5 (YOR090C);
                     ancestral locus Anc_2.195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688688.1"
                     /db_xref="GeneID:11530836"
                     /db_xref="GOA:G8C276"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:G8C276"
                     /translation="MHNMPSIVQVSLKKTLSRCLSKKNYNKLLYRTYFTHFSKSKNQN
                     GYGRENTDPRLPNRINTNIAILTSGSLLLAYHYFSTNNVLALDSIKGLRQYSSGMNDN
                     ENSSTENNKNSVMLLTDEEVNKKLHDLEESLFVNQGKGIVRYDISQLPSNNPIEDNHI
                     EQILTVPRYDIVEGNVSNLEASVDAAQSNLYFFGIFDGHSGPFTSAKLTKDLVRYVAT
                     QLNELFSVTENTDTEQYSAQFDDAIEKGFLQLDSDIVYESLKRLLDKPTKENMISSLP
                     AISGSCALLSVYDSKNSIMKVAVTGDSRALICEQLPSGEYTVKALSTDQTGDNLAEVE
                     RIKNEHPDEPHCIKNGRVLGSLQPSRAFGDYRYKVKDIDGKSLNELPDHVKLYFRKEP
                     RNFLTPPYVTARPEITTTKIDLQKAKFMVMGSDGLFELLTNEEIAGLVIRWMERQPVA
                     NDITKKSKLLNKKINFKLPLVNDLSTDKDAQRPAFRYKNGNNTKGKNTPEYILEDLNV
                     STHLIRNALSAGGSKEYVSTLVSIPSPISRKYRDDLTVTVVFFGNSEDSTVNTSQIKN
                     DGQIVTNIDATTPPKPRL"
     gene            complement(<196550..>198898)
                     /gene="TPHA0P00970"
                     /locus_tag="TPHA_0P00970"
                     /db_xref="GeneID:11530837"
     mRNA            complement(<196550..>198898)
                     /gene="TPHA0P00970"
                     /locus_tag="TPHA_0P00970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688641.1"
                     /db_xref="GeneID:11530837"
     CDS             complement(196550..198898)
                     /gene="TPHA0P00970"
                     /locus_tag="TPHA_0P00970"
                     /inference="similar to DNA sequence:INSDC:YOR098C"
                     /note="similar to Saccharomyces cerevisiae NUP1 (YOR098C);
                     ancestral locus Anc_2.186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688689.1"
                     /db_xref="GeneID:11530837"
                     /db_xref="UniProtKB/TrEMBL:G8C277"
                     /translation="MAEVKVARRAVEDSRTTSKRSISSTILDFIKMPINRAVGGRQGS
                     SGDTQEHGRGPEQTKKRRVESGGGAEASVVLYEQDGNHGSMARPPVLPLLPLQRLMLL
                     RERQLQRYSQVRALSVDRRSAKGSQNVAEVQLKSTRKKNKPGRQNGVWSADFEYDLED
                     VPVAIQTHPAKPSSPVTVDVKKFKPAIALASAPTAQLSKGQKDLLVNGIASAAAPLVD
                     SAQGIKINVPSATMPSVKPKVTPTVGFDFITSAEESETNDKLPSPNALQTGNFTSETT
                     KHPALEQKSDTKPAFSFGLPKSDSHKEPEEKKVTFEGKPSTLIFNPEKSLTSKLADDA
                     DTEDEPTRKKRFPFAASSESSTEQKPTKQFSFGSSSNEPNAEPLAKKPFTFGSAISKP
                     TEPIVKKEEEDTLKKPAFLLSSTPNDTKPSFSFGAKPETDKEESGKPSFSFGLGKKDT
                     GVKSTPPSLSFGLKNDAKPTEATKAPSFSFGTTNSTEKTATTAPSFQFGGTEPKVKEE
                     TNAATGVDKPNSVFSFNLSNALANSTANKSTKPSFSFDKPKSTPTPTPTPTVTPTELS
                     TDTKTNLFSFNTGSGPANPVINPLLTKPANPLLSGGSNITTNAANSGSTFSFMKKDTQ
                     PAPAFANQPNAANNNNTPSQGFKFGGSTTPSTAGPTAFSSAMSGMNTFGSNATMNTNS
                     GPYMFGMNSYNAPNGLQPPPPAFNPSSSINLNFANSAVSNPATIFGASTPSPTPSNPG
                     FGFNGMSTSAISTNDQSSVRMGSMSQGHPMQRRLARMRAPRR"
     gene            <199450..>200700
                     /gene="TPHA0P00980"
                     /locus_tag="TPHA_0P00980"
                     /db_xref="GeneID:11530838"
     mRNA            <199450..>200700
                     /gene="TPHA0P00980"
                     /locus_tag="TPHA_0P00980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688642.1"
                     /db_xref="GeneID:11530838"
     CDS             199450..200700
                     /gene="TPHA0P00980"
                     /locus_tag="TPHA_0P00980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688690.1"
                     /db_xref="GeneID:11530838"
                     /db_xref="GOA:G8C278"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C278"
                     /translation="MDYKRMLYPAGNSREGTYKFFCGVGVMMLLIYVLIDNLPALVRR
                     DDAGVGHYSHYFGKSFYSSHDDDDEPEYVYPGRVKYNYYDGPKEDACLVMVTKNEELY
                     DVLLTVKNVEDRFNLKYNYDWVFVNNIPFSEDFKFVIGEMVTGKVYFSTIPNKHWDVP
                     AAVDKKKALDARVQQVSAQVSRAGQLKLRQLWRYMSGYFHWDPVFDQYKYYWIIEPDM
                     KLTCDVNYDVFKFMKDNNKQYGFFHSRKTQTAAVKSLWPAVTEFMSANPEMLAQDNML
                     RFISDDEGKSYNMCGFESSIEIGSFEFFRSKEYQVLFQNLDARNGWFYERWTASDFRA
                     VAASLLLNKDQLHHFGDFGYNHKLSKYTMEAVCPLDKQMRLENKCACNAYNAMSWTSN
                     SCLPKFYDIQERIKPDRWKGMQAI"
     gene            <201279..>202499
                     /gene="TPHA0P00990"
                     /locus_tag="TPHA_0P00990"
                     /db_xref="GeneID:11530839"
     mRNA            <201279..>202499
                     /gene="TPHA0P00990"
                     /locus_tag="TPHA_0P00990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688643.1"
                     /db_xref="GeneID:11530839"
     CDS             201279..202499
                     /gene="TPHA0P00990"
                     /locus_tag="TPHA_0P00990"
                     /inference="similar to DNA sequence:INSDC:YOR099W"
                     /note="similar to Saccharomyces cerevisiae KTR1 (YOR099W);
                     ancestral locus Anc_2.185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688691.1"
                     /db_xref="GeneID:11530839"
                     /db_xref="GOA:G8C279"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:G8C279"
                     /translation="MLPKEKSKYKKNGNDLAFLFFRHSRVIGAVMVVLFTLFMVFEKK
                     DDFTSASYVLPSFEGKSYMDRGDYIYSSRVGSTSGKTSRVKAAMVVLVRDKDLYSLVD
                     AIKQVEDRFNKNFNYDWVFLSEALFSDDFKEVTTALVSGKTKYGLIPESQWSYPEWID
                     QKRAAAVREEMRKAEIIFGDMESYRHMCRYESGFFYRHPELEEYDYYWRIEPDIKLHC
                     DINYDIFRFMKDNGKKYGFTISIHEYVSTIMTLWNTTKEFMAEHPEHIHENNMLDFIS
                     DDGGESYNNCHFWSNFEIGDLNFWRGEAYSAYFDHLDKAGGFFYERWGDAPVHSIAAA
                     LLLDRNEIHHFNDLGYFHNPFHQCPIDDVVRFENRCGCDPALDFTWKDFSCGVQFYTV
                     NELKKPDGWVGHVG"
     gene            <202928..>203857
                     /gene="TPHA0P01000"
                     /locus_tag="TPHA_0P01000"
                     /db_xref="GeneID:11530877"
     mRNA            <202928..>203857
                     /gene="TPHA0P01000"
                     /locus_tag="TPHA_0P01000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688644.1"
                     /db_xref="GeneID:11530877"
     CDS             202928..203857
                     /gene="TPHA0P01000"
                     /locus_tag="TPHA_0P01000"
                     /inference="similar to DNA sequence:INSDC:YNL097C"
                     /note="similar to Saccharomyces cerevisiae PHO23
                     (YNL097C); ancestral locus Anc_2.183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688692.1"
                     /db_xref="GeneID:11530877"
                     /db_xref="GOA:G8C280"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:G8C280"
                     /translation="MSTPANLFPGLSDISDVLEEYPIETSRYLTLLHEIDAKCIHALP
                     FLNEQIQEFVKFTGKNSKIPPKESSHPENKLENLININRLFEELIPSLEEKMYVSSIM
                     LKSMEELTTRLELGYEVALKNEEIPEKLRIGVNNHPAMHLHHELMKKIETAKTGTSHK
                     SAQSSKSELRREAMAASKKQHETKDKSSKNEKTAATSTIPAAGVTDSATATSGRKNGN
                     HNNTGHESKKRKTNKDKNNSTHPGVVAPKPKVNEYGEPLYCYCNRIAFGEMVGCDGAN
                     CELEWFHLPCIGLTTLPRGKWYCNDCKKTKKNN"
     gene            <204308..>205600
                     /gene="TPHA0P01010"
                     /locus_tag="TPHA_0P01010"
                     /db_xref="GeneID:11530878"
     mRNA            <204308..>205600
                     /gene="TPHA0P01010"
                     /locus_tag="TPHA_0P01010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688645.1"
                     /db_xref="GeneID:11530878"
     CDS             204308..205600
                     /gene="TPHA0P01010"
                     /locus_tag="TPHA_0P01010"
                     /inference="similar to DNA sequence:INSDC:YOL097C"
                     /note="similar to Saccharomyces cerevisiae WRS1 (YOL097C);
                     ancestral locus Anc_3.97"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688693.1"
                     /db_xref="GeneID:11530878"
                     /db_xref="GOA:G8C281"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:G8C281"
                     /translation="MSAQDVEQVAQDVSKLNATEAKKEQVVTPWDVEGAVDEQGNAQE
                     IDYEKLVKQFGTKAINQETLDRFERVTGQKPHHFMRKGLFFSERDFSQILDLYEQGKP
                     FFLYTGRGPSSDSVHMGHMIPFLFTKWLQEVFDVPLVIELTDDEKFLFKQKLTIKDVK
                     GFARENAKDIIAVGFNPENTFIFSDLSYMGGGFYETVVRVSRQITGSTAKAVFGFNDS
                     DCIGKFHFASIQIASAFPSSFPEVLGLPDKTQCLIPCAIDQDPYFRVCRDVAQKLKFT
                     KPALLHAKFFPALQGSSTKMSASDENSAIFLTDTAKQIQKKINKHAFSGGQGTMELHR
                     ELGGNPDVDVAFQYLSFFKDDDEFLKKTADSYRSGELLSGEMKKLCIETLQEFVKNYQ
                     ERRSQVTDEVLEKFMRPHKLVWGQKERLVPIKPKEPKK"
     gene            complement(<205783..>206409)
                     /gene="TPHA0P01020"
                     /locus_tag="TPHA_0P01020"
                     /db_xref="GeneID:11530879"
     mRNA            complement(<205783..>206409)
                     /gene="TPHA0P01020"
                     /locus_tag="TPHA_0P01020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688646.1"
                     /db_xref="GeneID:11530879"
     CDS             complement(205783..206409)
                     /gene="TPHA0P01020"
                     /locus_tag="TPHA_0P01020"
                     /inference="similar to DNA sequence:INSDC:YDR487C"
                     /note="similar to Saccharomyces cerevisiae RIB3 (YDR487C);
                     ancestral locus Anc_3.96"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688694.1"
                     /db_xref="GeneID:11530879"
                     /db_xref="GOA:G8C282"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:G8C282"
                     /translation="MSAFTPIEDVIEHFKQNKFVIVMDDENRENEGDLICAAENITYK
                     DMGFLVRHSSGYVCAPMSNKIADNLDLPLLRNMKYESFDDDRHGTAYTITVDYEEGTT
                     TGISSHDRALTCRKLADPSSTPKSFLKPGHICPLRAVDGGVLKRRGHTEAAVDLCRLS
                     GLQEVGVICELVKDEDGSMMRLDDCIEFSKKFNVPIITIDALVEYLQK"
     gene            <207281..>208462
                     /gene="TPHA0P01030"
                     /locus_tag="TPHA_0P01030"
                     /db_xref="GeneID:11530880"
     mRNA            <207281..>208462
                     /gene="TPHA0P01030"
                     /locus_tag="TPHA_0P01030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688647.1"
                     /db_xref="GeneID:11530880"
     CDS             207281..208462
                     /gene="TPHA0P01030"
                     /locus_tag="TPHA_0P01030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688695.1"
                     /db_xref="GeneID:11530880"
                     /db_xref="GOA:G8C283"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:G8C283"
                     /translation="MSFVKNNSNAFLKESNLFKPITVGDITLGQRISMSPLTRMRADP
                     SNHVPKEIVTTYYKQRAERKGTLIISEATFISEAATGYDHAPGIYSKEQIEAWKKIIK
                     AVHDEGSFFFSQLWSLGWQASPESIAKHGLQYLAPSESPFMDETQEKACKDNNVKQHA
                     MTKEEIKSMVADYVQAAKNAIEAGADGVEIHAANGYLPNQFLDPLSNRRTDEYGGSIE
                     NRCRFVLEIVDGVIEAVGASKVGIRLSPYGTYGSMTGSADPTLLATYAFVVGELEKRA
                     KSGKRMAYIHAIEPEKSDIEAGKSLNFIFSIWEGVVIRAANMIQNFEKTKEFVDNNDR
                     TIISYGSFFIANPDLIDRLEKGLPFNKPDVSLFFTREKEGYIDYPVYADAVKLGYKLE
                     E"
     gene            <208875..>211991
                     /gene="TPHA0P01040"
                     /locus_tag="TPHA_0P01040"
                     /db_xref="GeneID:11530881"
     mRNA            <208875..>211991
                     /gene="TPHA0P01040"
                     /locus_tag="TPHA_0P01040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688648.1"
                     /db_xref="GeneID:11530881"
     CDS             208875..211991
                     /gene="TPHA0P01040"
                     /locus_tag="TPHA_0P01040"
                     /inference="similar to DNA sequence:INSDC:YOL098C"
                     /note="similar to Saccharomyces cerevisiae YOL098C;
                     ancestral locus Anc_3.93"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688696.1"
                     /db_xref="GeneID:11530881"
                     /db_xref="GOA:G8C284"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:G8C284"
                     /translation="MTWKKLVSFQLEYAPQYKITKYVSEESHLQLVHIDHKTSPLVQG
                     YFAVATECGNDSGVPHTLEHLIFMGSPKYPYKGLLDTVGNLCMSSTNAWTATDQTVYT
                     LTSAGWTGFKKLLPMYLEHIINPTLTDDAYVTEVYHIDPDTLTDKGVVYSEMEAIETQ
                     NWFVTMLEKQRMMFPEGNGYRSETGGLTENLRNLTNEEIKQFHADYYKRENLCIIICG
                     NLPEEELLATVSEWDNETMEPINSERPLMKRPFVESGISQIPQSRDEIVESVVEFPEL
                     DESQSELLFSWIGEPYDNYENDLATSILLDYLTETAIAPFNKILVEIEDPMANSVDYW
                     TDDFSRTIINLSIHGVPTGRIDETKEKVLEIIKTHKIDLPRMKQMIDNGKWDYILRCE
                     KNGDSVISQAVITDFIYGDKNGESLKRTLFDLSDFDAIFHWNEEKWQQLLNDIFINNK
                     PVIVLGKPSKALYQLQEDRQSEIIIDREAECVADENRKPFLRKLLDKAILNNEKEIPS
                     ELFDRYTIEDPLNSVDLIETQGITLIDNFKDNGSDELTKNLLTLKPKDFPFFIHAEHF
                     QSQFIEFHVLVNSWSVKDVELLPYFHIFNELFSLPMSLDDGSIMSYEEVITKLKNETV
                     DSNISLGLQGSTTDLIDFRIRCKSLNYMEAVKWIKYCLYDMIFDEKRVGILLENYCNS
                     IVELKREGDTMLESLKNRYIYNTRSMKKSVDALYVEDKLESILDDLEDGKFSSNILPK
                     LEEMRKQLRENFANYQIIILGDISKILDNFFEPWNDLINEHKKHKPSDKRNNGIPEIP
                     KHLELLTPLGNDLKQKAFIITTPASDSTYMSLVTKVKFNMDYSHPDYAAVSLASEYLQ
                     CVEGPFWKGIRGAGLAYGANMMGQTESNIWEFSIMRGTDIIKCFEIAKKIVNDYANNE
                     LNFEPKLLEGALSSIINRIATMESSYFSSAISKYIDQFLRKRGTDFNIKYLENLSNVG
                     VDDLRYVTKKYLTNLFDVKNGAVFISCHPSKLEEIQKYLKANNYEIEVEELEDDEDDD
                     NEEDEEDD"
     gene            complement(<212259..>215624)
                     /gene="TPHA0P01050"
                     /locus_tag="TPHA_0P01050"
                     /db_xref="GeneID:11530921"
     mRNA            complement(<212259..>215624)
                     /gene="TPHA0P01050"
                     /locus_tag="TPHA_0P01050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688649.1"
                     /db_xref="GeneID:11530921"
     CDS             complement(212259..215624)
                     /gene="TPHA0P01050"
                     /locus_tag="TPHA_0P01050"
                     /inference="similar to DNA sequence:INSDC:YDR490C,YOL100W"
                     /note="similar to Saccharomyces cerevisiae PKH1 (YDR490C)
                     and PKH2 (YOL100W); ancestral locus Anc_3.92"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688697.1"
                     /db_xref="GeneID:11530921"
                     /db_xref="GOA:G8C285"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C285"
                     /translation="MKGNTVVNSNSRPLLPSDEEVLTKKLEGQYKNKVRIQSTVKHVN
                     DKEISPHKRSTSNINLYNPDVLVPGKGERALTDTNNFIQMYNKQHKLQNLNDLSQESI
                     IESNEYNLSENNSDGQGSVNNDSEAISLGSIEVSDIKNTSVNEEVVDEDQITEDEDSS
                     SDLSDPEQLKMRKKYEQAKKLSSNEPSNKKESHLDEEMSLSDKLKSQREKWAERGAAK
                     IVRNVADPKTGEITKQTISKGINDFKFGEVIGDGSYSTVMLATSIESNQKYAVKVLNK
                     EYLIRQKKVKYVNVEKNTLQRLNNSRTVVKLFFTFQDEAHLYFLLEYAPNGDFLSVMK
                     KYGTLNEECACYYGAQIIDAIHFIHSKGIIHRDIKPENILLDGDMKVKLTDFGTAKIL
                     DPVTKVNNNNSKTATFDLLTRSKSFVGTAEYVTPELLNDSYTDYRCDIWAFGCILFQM
                     IAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVIRDLVKKILLKQPSQRLTISAIKAH
                     HFFNDKNFSDGSIWDDNPPEIQPYKINAKSMQPVPELKTTPGKRHLLSIPKRPSSRPN
                     YVPSTPVSSAKSSTSDISTKNTKTSSEKTSSTNVYQYKKSIWCETFKRCSISSISSVG
                     EKATPSISGHKIKSRVNSSNSTKSNLTSKSSQIAPEKSKPHGIPKSPSTPVLNNYMRS
                     SNTTPVSSPGSRILSSNEETRPLNSTIESAMELTQFLIDPQEKIIKEGDIYLTVMDSN
                     TLEKRVHKSRGHILDPQSFGAARTTLLSQAARSGGVAGLRNESNPINLSENRYYIDHS
                     CDLKTIAADYKIPGGSLYIKEEDNSISGSKSPSPSINMDERGFGKFKKLFHKQDHSNE
                     PIFMELSYKRKFVLTSYGRLLILAKNVDDESHSNGVYQLMTNILLSQTGLKIKELVIP
                     SEIENGYLNLGAIITPFKSFVFCCTKQDTSSWFINFRNSIKMNHDRMVLLSSSKSNTA
                     RDNTPSLTPSVSGTKEKSESSTTTSLDPGMKSPKIVTPTPHKSYANTPPSPGSPRVGR
                     PNRLFDSFVSSREKSKKNINPVPASTKLANGLPIKSDHSFVGLGLSSLQSKISRHNTP
                     HPSTSSFTRTSNNGKRSSTPTPTSTALGEKTLR"
     gene            <216916..>217275
                     /gene="TPHA0P01060"
                     /locus_tag="TPHA_0P01060"
                     /db_xref="GeneID:11530922"
     mRNA            <216916..>217275
                     /gene="TPHA0P01060"
                     /locus_tag="TPHA_0P01060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688650.1"
                     /db_xref="GeneID:11530922"
     CDS             216916..217275
                     /gene="TPHA0P01060"
                     /locus_tag="TPHA_0P01060"
                     /inference="similar to DNA sequence:INSDC:YDR493W"
                     /note="similar to Saccharomyces cerevisiae YDR493W;
                     ancestral locus Anc_3.89"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688698.1"
                     /db_xref="GeneID:11530922"
                     /db_xref="UniProtKB/TrEMBL:G8C286"
                     /translation="MNVNQRALIAYRNGLRATKIAFNNDTRMLISARERMREGMINPN
                     QKLTKVQQIELLEGVSEFLRKNIVQGKKTGVDKDGKDVYHLNIHSEIELGDNDSVKKA
                     ENTLKASGSGCCGGSGR"
     gene            <217643..>218377
                     /gene="TPHA0P01070"
                     /locus_tag="TPHA_0P01070"
                     /db_xref="GeneID:11530923"
     mRNA            <217643..>218377
                     /gene="TPHA0P01070"
                     /locus_tag="TPHA_0P01070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688651.1"
                     /db_xref="GeneID:11530923"
     CDS             217643..218377
                     /gene="TPHA0P01070"
                     /locus_tag="TPHA_0P01070"
                     /inference="similar to DNA sequence:INSDC:YOL102C"
                     /note="similar to Saccharomyces cerevisiae TPT1 (YOL102C);
                     ancestral locus Anc_3.88"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688699.1"
                     /db_xref="GeneID:11530923"
                     /db_xref="GOA:G8C287"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="UniProtKB/TrEMBL:G8C287"
                     /translation="MSEVGKRNVQISKALSYILRHGAVKEKLPIDTNGYIEVELILNH
                     NRLKTHHCTLDELHSIVENNDKKRFHVKKKNGTEYICATQGHSLKSVKPNEEILMKIE
                     DVSHLPEVIVHGTTITSCIAIIESGAIKKLERNHVHLSAGIIGQDLDIISGMRYSSNV
                     YIYINKTEENIKQLSLVKSLNGVILSPKDIPISMIEKIQIKTTRSSNKTDLDKLMKIL
                     EVEKYRIPFYECLNVCTLLSKFKCLI"
     gene            complement(<218424..>221417)
                     /gene="TPHA0P01080"
                     /locus_tag="TPHA_0P01080"
                     /db_xref="GeneID:11530924"
     mRNA            complement(<218424..>221417)
                     /gene="TPHA0P01080"
                     /locus_tag="TPHA_0P01080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688652.1"
                     /db_xref="GeneID:11530924"
     CDS             complement(218424..221417)
                     /gene="TPHA0P01080"
                     /locus_tag="TPHA_0P01080"
                     /inference="similar to DNA sequence:INSDC:YDR495C"
                     /note="similar to Saccharomyces cerevisiae VPS3 (YDR495C);
                     ancestral locus Anc_3.86"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688700.1"
                     /db_xref="GeneID:11530924"
                     /db_xref="GOA:G8C288"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="UniProtKB/TrEMBL:G8C288"
                     /translation="MSDENRVNSDVVDKLNDYVDKNPVEEDSESNIEITKNSTHLHST
                     HEDDEVNVLQENVDEELLPKREETGIEKDSLLENEKNNTIVLEEQDNSKDIESVQDKQ
                     ETDSKLPFKLTLDDDSFIVHPLIEHIPDELEYTCFESYEQNLYLGTESGDLLHYFEIE
                     KSNYMLVSQTKFNSEFNKPIDKIILLPNIERALLLSNNTLTQFLLPEFAPAPNTENIA
                     NISYLLLKSYSTNSNSYKILLFLENEVNEYRITQTSTNLVRRYPWKSISEASLCDKSM
                     MIARSNHYELIQARSKEVTPLFKVSESDEPLKPIISSNNGTGFNVVTGGTSIDSTAMV
                     FKVNKSGEIDSGNLVLDRYPDSVLSKSPYLIVNFNNNEIHIYKEVTNGDSALIQIIKS
                     QSKFNICESFKQFECSNIEEAKKIKSLVTEKLRLVPLEEDNGDIFRINGENSYINSLF
                     KLSTSMLLYGKAGIYLLIQKPGILRFDKYDEKEIENVRGYIGSLRGDLTKYQQIEKEY
                     LTALKILLYTLHNAAIDEKIISKWYQVAELVDIRLLLYLLDMEYYGNLCIFNGLKKFI
                     ENLKLLKLIHKVKDKISLITLLNRKLINCSKREEIRDYNNVMKSIEMNLFHLLTENNK
                     EITTDMFIEPILNEILLILQEEPEKYSVLLKKIYLEKHNYTELITLFKNEGNAQEILD
                     LIVTKFSELPKAYTANELIEDLIYIINSLPLNNEIIKKTLSVVEKANFNINDFTDKLT
                     SNVEVKVAVIEHIGAKSEVNKEFLLRYYLANFQKELELNNLWENLGKYASEYTSDLNY
                     YKSSLSDFLLIKLKYDSIFNDFLNYIQQIKLLCKDETVDNSNIRLVLDDIKKIDIGNL
                     LLMLFLMPEFIGISDILISSDELLSMYMLYNDFLNIERYLKVETFLKVFNHYLSFSGT
                     PDGVKTVITFLKRNCNTIVDNNMLVKIFELLPDNFSVMSLFDVLFPIIKKREGIKHKY
                     YLEKALARNELTSYSNTLNHFKCQE"
     gene            complement(<221871..>223820)
                     /gene="TPHA0P01090"
                     /locus_tag="TPHA_0P01090"
                     /db_xref="GeneID:11530925"
     mRNA            complement(<221871..>223820)
                     /gene="TPHA0P01090"
                     /locus_tag="TPHA_0P01090"
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /transcript_id="XM_003688653.1"
                     /db_xref="GeneID:11530925"
     CDS             complement(221871..223820)
                     /gene="TPHA0P01090"
                     /locus_tag="TPHA_0P01090"
                     /inference="similar to DNA sequence:INSDC:YDR496C"
                     /note="similar to Saccharomyces cerevisiae PUF6 (YDR496C);
                     ancestral locus Anc_3.85"
                     /codon_start=1
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /protein_id="XP_003688701.1"
                     /db_xref="GeneID:11530925"
                     /db_xref="GOA:G8C289"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012959"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8C289"
                     /translation="MAPVTKKSKENANKRSSNSKASAKPAKKARISVDSSDEDELDNT
                     ATEEVSSKEDALDDVISDDDEEEQKEDLEDEDKDDDDKTENNKATGENASSHVEQRKL
                     LKERKMQRKGGSEVQHIKSLWERLRVKTPPMPRPVREKLSNEIWELAKDCISDLVLKH
                     DASRVVQTLVKYSSKERRDQVVNALKGKYYLLATSAYGKYLLVKLLHYGSKQSRQLII
                     DELHGTLRKLMRHREGAYVVEDLFVLYATNEQRQQMIKEFWGSEYAFFRESHKDLTIE
                     EVCESSTEKRNIIARNLITTITASVEKGSTGFQILHAAMREYVKIASEKEITEFIELL
                     QEQLAELVHTPEGADVACTLIAKANAKERKALIKNLKNHADKLIKNEHGNMVFITLLL
                     TVDDTVLVFKSFGPSIKEIFSELVIDKFGRRPLLYILLGLDGRFFSPILKKELERYIK
                     MSEATSKKPIDTKRAELLNKFAPLFVSSVSKSSAEILTENLGSQFISELLLNDDLYEQ
                     LSEKEIKNFNSIIENIMITFKGDIIEEDHPIHRPFSTRLLRGLIQGGKWNNKEKQIIP
                     LSNVEGLGTPFAAKFYDDIIDSSNLLDWINNRDSAFTIVAIYETLSKSKNEGKQFLTD
                     LKSVLKNVEADESNKGAQLLIKLAK"
     gene            complement(<224254..>225399)
                     /gene="TPHA0P01100"
                     /locus_tag="TPHA_0P01100"
                     /db_xref="GeneID:11530926"
     mRNA            complement(<224254..>225399)
                     /gene="TPHA0P01100"
                     /locus_tag="TPHA_0P01100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688654.1"
                     /db_xref="GeneID:11530926"
     CDS             complement(224254..225399)
                     /gene="TPHA0P01100"
                     /locus_tag="TPHA_0P01100"
                     /inference="similar to DNA sequence:INSDC:YDR498C"
                     /note="similar to Saccharomyces cerevisiae SEC20
                     (YDR498C); ancestral locus Anc_3.83"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688702.1"
                     /db_xref="GeneID:11530926"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="UniProtKB/TrEMBL:G8C290"
                     /translation="MSVRLLEGLTELRNALIEKTQELKNTNVDAIELINARFNVPEKN
                     QNKAQNDIENIINIIINYESKLKELIVSLNNEYRGFKINWQKSMTYDYPDELTIVQFN
                     EEYMTGKTKLELQNIIDNLVCNVDWFSEYKKDFKETIKQMNDKNASEIDEKRERIIKS
                     HLIESQNDNLTNNEVNDANTDSRAKMSWTFEDKGVTSKSKLLNTTKKLTNNLIKGNQI
                     LQSSVLQSDLNLDELRQQTSSMQIMNDKYLQFEIVFNKTSQLVRRLEKASQQEKRDVY
                     LSLGFLAMCIFWILWRRVFKVPVKIGLWIVFKFFKYILVSIGFVKKVSNTINSDIISD
                     EIINTIASTIVSTTVSNITGTISSDIENNIEQVVDAAMDRILAHDEL"
     gene            <225918..>226955
                     /gene="TPHA0P01110"
                     /locus_tag="TPHA_0P01110"
                     /db_xref="GeneID:11530908"
     mRNA            <225918..>226955
                     /gene="TPHA0P01110"
                     /locus_tag="TPHA_0P01110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688655.1"
                     /db_xref="GeneID:11530908"
     CDS             225918..226955
                     /gene="TPHA0P01110"
                     /locus_tag="TPHA_0P01110"
                     /inference="similar to DNA sequence:INSDC:YOL104C"
                     /note="similar to Saccharomyces cerevisiae NDJ1 (YOL104C);
                     ancestral locus Anc_3.82"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688703.1"
                     /db_xref="GeneID:11530908"
                     /db_xref="UniProtKB/TrEMBL:G8C291"
                     /translation="MDISNEVTAIEDELNEKEHDLGFGGKNKSFRYPDFVCSHNSQRL
                     YIDGSSKFGFVHYFMNNVKIVVKDEISECPDLKSFQIFKDCFFVNQNSNLEKYFDIEV
                     LNKENHKIDDNEGTSMLSDITMTQFNFPDLTNEKPTHVQLFPKVINIRYSSGKKNILR
                     LLINHLNCLKSLFEKKNKQIVANLFLDVKRILQSYVEIVIKDVVIKWMQWLIIIQNKD
                     LTKRSSYRILCKRINSLFWRRYFCMRSSSTDSITSFSNRLHRNFREQNVKERSIIFAV
                     WWDEVNDILLFNNGISMQTSDKSKEENIVVASLGLILEDTDKNQEPENKLLLFVNMAI
                     MECLKQELNRY"
     gene            <227339..>228652
                     /gene="TPHA0P01120"
                     /locus_tag="TPHA_0P01120"
                     /db_xref="GeneID:11530909"
     mRNA            <227339..>228652
                     /gene="TPHA0P01120"
                     /locus_tag="TPHA_0P01120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688656.1"
                     /db_xref="GeneID:11530909"
     CDS             227339..228652
                     /gene="TPHA0P01120"
                     /locus_tag="TPHA_0P01120"
                     /inference="similar to DNA sequence:INSDC:YNL280C"
                     /note="similar to Saccharomyces cerevisiae ERG24
                     (YNL280C); ancestral locus Anc_3.81"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688704.1"
                     /db_xref="GeneID:11530909"
                     /db_xref="GOA:G8C292"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:G8C292"
                     /translation="MQSKLNPKTTEFEFGGTIGAIGISVGLPILTILLNQMIRPDYFI
                     EGFFTNFNFADVWNGIKPISYYLTKADLWTYYLIWYIVLAVFDIILPGRKMQGVELRD
                     GTKLNYKINGVAVSAALILVLAFRYQLTDGDLPELQYLYENQVDLCIITILFSVMLST
                     YCYVASFIPLWGKNGNNTNEKILALGGNSGNPIYDWFIGRELNPRIGPIDLKMYSELR
                     PGMLLWFLINLSCLHHNYLETAKINDALVLINCLQGFYIFDGVLNEEGVLTMMDITTD
                     GFGFMLAFGDLTLVPFTYSLQARYLSVSPIELGTYRVSFIVTVMALGFWVFRAANQQK
                     SDFRQGKLAHLKSIQTKRGTKLLCDGWWGKSQHMNYFGDWIISLSWCLTTWTQTPLTY
                     YYSAYFMSLLLHRQQRDEQKCRGKYGKDWEEYEKKVPYKIVPYVY"
     gene            complement(<228740..>229429)
                     /gene="TPHA0P01130"
                     /locus_tag="TPHA_0P01130"
                     /db_xref="GeneID:11530910"
     mRNA            complement(<228740..>229429)
                     /gene="TPHA0P01130"
                     /locus_tag="TPHA_0P01130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688657.1"
                     /db_xref="GeneID:11530910"
     CDS             complement(228740..229429)
                     /gene="TPHA0P01130"
                     /locus_tag="TPHA_0P01130"
                     /inference="similar to DNA sequence:INSDC:YNL282W"
                     /note="similar to Saccharomyces cerevisiae POP3 (YNL282W);
                     ancestral locus Anc_3.79"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688705.1"
                     /db_xref="GeneID:11530910"
                     /db_xref="InterPro:IPR013241"
                     /db_xref="UniProtKB/TrEMBL:G8C293"
                     /translation="MSNSLKAINKKISKRKQVYKPLLDNPFTNESQVWPHVNDQQLVW
                     ELLQSDVLSVCKRLKDSDRSEWPLDVAFTFNEINEYLCNNDKDEEVLMFACNRDQGVP
                     SVLLQQVPLIAYMSKTKVTLIQLPRNSAQVIVDSLPLGDDSFDGFLMVRCNEKINAHF
                     MRTIKSKVSEQKIPWLTNLKYQKANIKLVKTTIPMISKNKNKQPNQKGEDLENQKQEK
                     YTNTHKQIPKK"
     gene            <230498..>231907
                     /gene="TPHA0P01140"
                     /locus_tag="TPHA_0P01140"
                     /db_xref="GeneID:11530911"
     mRNA            <230498..>231907
                     /gene="TPHA0P01140"
                     /locus_tag="TPHA_0P01140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688658.1"
                     /db_xref="GeneID:11530911"
     CDS             230498..231907
                     /gene="TPHA0P01140"
                     /locus_tag="TPHA_0P01140"
                     /inference="similar to DNA sequence:INSDC:YNL283C,YOL105C"
                     /note="similar to Saccharomyces cerevisiae WSC2 (YNL283C)
                     and WSC3 (YOL105C); ancestral locus Anc_3.78"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688706.1"
                     /db_xref="GeneID:11530911"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:G8C294"
                     /translation="MLKSFVCVLLYSQLVAAVTYNYQGCYDSSSLRSMMSSLGTYTYQ
                     SISYCQTECNGSKFIALLDGGECYCSDDTSILDVLSSLQSDSSQCNVGCNGWPYQTCG
                     GQTYMDFYVDSSITVVNSVSSSTSLSSAAASSSSTSVQGSTSAYIATTTISTTQDSTP
                     TSSFTSTRSSSSQSSTTSIVSKLETTSTYESLSSSSSDSQAVLTSSSLISSPSTNNNS
                     VHPSTVFTSTRVTTELLTTSVVTASDNGSQVLVYVTKTETFATTSAVASSNSISVNGK
                     NSNSSSPNSLSSGDIAGIVIGVVFGTFFILAALIYANWRRKKHAKERDIEESKQHQPY
                     SYGDVDANPIILPERAASSKFHKHPKYIGPATSDSEFFFSTYDTHETDSSPSSSRDLT
                     SSSSSMNSGVNLISKEAIPIEALRDNQKMTNPKPIVRFSTTSIPFLVEDRQLRIVNPD
                     DEKIEDQYKEDFDDSSRNN"
     gene            complement(232259..232331)
                     /gene="TPHA0Ptrna12T"
                     /locus_tag="TPHA_0Ptrna12T"
                     /db_xref="GeneID:11530912"
     tRNA            complement(232259..232331)
                     /gene="TPHA0Ptrna12T"
                     /locus_tag="TPHA_0Ptrna12T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:11530912"
     gene            <232802..>233815
                     /gene="TPHA0P01150"
                     /locus_tag="TPHA_0P01150"
                     /db_xref="GeneID:11530859"
     mRNA            <232802..>233815
                     /gene="TPHA0P01150"
                     /locus_tag="TPHA_0P01150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688659.1"
                     /db_xref="GeneID:11530859"
     CDS             232802..233815
                     /gene="TPHA0P01150"
                     /locus_tag="TPHA_0P01150"
                     /inference="similar to DNA sequence:INSDC:YOL107W"
                     /note="similar to Saccharomyces cerevisiae YOL107W;
                     ancestral locus Anc_3.76"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688707.1"
                     /db_xref="GeneID:11530859"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="UniProtKB/TrEMBL:G8C295"
                     /translation="MKFDSRFLTVDIPDSFWKLQKLPTAIRIITLLAILLSGCLFIIR
                     MRSIVNIKPGEGESIDNVAFPIFQMVPSKLKYLPFSIFLSNFVDTSGWKFIVNFCNLT
                     IGGSYIERNWGSSKEMFKFLLVLGTLTNVIVVLLTIALSFIIPGIDLNKPIDGNYTVL
                     IGFPIVYKQLLPETSIFDLKNVPLISKNFRFKLLPIFVICTVTLIQILWLHHFAQLIS
                     IWLTFISTWMYLRFFQLLPLYGTDASNSENILRGDSSDTFQFIYLFPDIVKPILRPVF
                     SYVYEVFCIKLRLIRPFETTDIDKGNSVAEQRGAKPIGTPSTEANERRKQKALEVLQE
                     RMV"
     gene            <234636..>235055
                     /gene="TPHA0P01160"
                     /locus_tag="TPHA_0P01160"
                     /db_xref="GeneID:11530902"
     mRNA            <234636..>235055
                     /gene="TPHA0P01160"
                     /locus_tag="TPHA_0P01160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688660.1"
                     /db_xref="GeneID:11530902"
     CDS             234636..235055
                     /gene="TPHA0P01160"
                     /locus_tag="TPHA_0P01160"
                     /inference="similar to DNA sequence:INSDC:YOL108C"
                     /note="similar to Saccharomyces cerevisiae INO4 (YOL108C);
                     ancestral locus Anc_3.75"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688708.1"
                     /db_xref="GeneID:11530902"
                     /db_xref="GOA:G8C296"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:G8C296"
                     /translation="MSDLKLGITELDNLSEKNDGNTPKNVMKKVRKPRSKKVNKLSES
                     QIKMNHVTSEQKRRMLVRSIYDDLVEAVPDLSAEESRSELLIYLKTVNYMNWLYKRNE
                     VLRTQLVNKYKERGMYNKYSIPQNLIWEQKRNKNPNA"
     gene            complement(235310..235383)
                     /gene="TPHA0Ptrna7N"
                     /locus_tag="TPHA_0Ptrna7N"
                     /db_xref="GeneID:11530903"
     tRNA            complement(235310..235383)
                     /gene="TPHA0Ptrna7N"
                     /locus_tag="TPHA_0Ptrna7N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:11530903"
     gene            complement(<236652..>237257)
                     /gene="TPHA0P01170"
                     /locus_tag="TPHA_0P01170"
                     /db_xref="GeneID:11530914"
     mRNA            complement(<236652..>237257)
                     /gene="TPHA0P01170"
                     /locus_tag="TPHA_0P01170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688661.1"
                     /db_xref="GeneID:11530914"
     CDS             complement(236652..237257)
                     /gene="TPHA0P01170"
                     /locus_tag="TPHA_0P01170"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688709.1"
                     /db_xref="GeneID:11530914"
                     /db_xref="UniProtKB/TrEMBL:G8C297"
                     /translation="MDSILFTDKVNKLIDEAKLMDVHISEKTICENFIKSLPPSLSSI
                     LHLYVHTPKPMTLSEVLFQVEKIQPYLSNLETKSPNGRTVEKTAVKHHQHSTTIDKKK
                     FPTAKKVHYLKNTSTLSSHEQLRPASSESLDADDYLIIDSGAEITVVKDETLLQNIHP
                     NTKHVLYGAGNQKLSAPVSGTLQFTFTKIKDIKYIAWYLRK"
     gene            237500..237571
                     /gene="TPHA0Ptrna14G"
                     /locus_tag="TPHA_0Ptrna14G"
                     /db_xref="GeneID:11530904"
     tRNA            237500..237571
                     /gene="TPHA0Ptrna14G"
                     /locus_tag="TPHA_0Ptrna14G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /db_xref="GeneID:11530904"
     gene            complement(<237903..>240695)
                     /gene="TPHA0P01180"
                     /locus_tag="TPHA_0P01180"
                     /db_xref="GeneID:11530860"
     mRNA            complement(<237903..>240695)
                     /gene="TPHA0P01180"
                     /locus_tag="TPHA_0P01180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688662.1"
                     /db_xref="GeneID:11530860"
     CDS             complement(237903..240695)
                     /gene="TPHA0P01180"
                     /locus_tag="TPHA_0P01180"
                     /inference="similar to DNA sequence:INSDC:YNL287W"
                     /note="similar to Saccharomyces cerevisiae SEC21
                     (YNL287W); ancestral locus Anc_3.73"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688710.1"
                     /db_xref="GeneID:11530860"
                     /db_xref="GOA:G8C298"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:G8C298"
                     /translation="MSTHTYKKFESGDSGDLPDKMTIYQDCMTQFNESPVNAKRCRIL
                     ISRLLRLLANGEVFPETEATALFFSISKLFQHPNDSLRQAVYLSIKELSGISEDVLMA
                     TSSIMKDVQNGSDLVKSNAIRSLSVVLDESTAFSAERMLKSAVVSKNPTISSASLVTS
                     YHLLPISENTVKRFSNETQEAVVDLKPFPQQDIIGDYYPNSTFITQYHALGLLYQLKK
                     NDKMSLLKLVRQFADSNNLKNQLAKVQLIKIVNELVQRDPQLFPQFQGLLYHWLSNKY
                     ESVQIEVTKVITSFAATNQRLVSPELFAVAVQTLQSLLTVPRVTTKFAALRILNRLSM
                     VSPDKILICNPELESLINDSNRNVSTYAITILLKTGTEKNISSLISTITKFIHEVSDD
                     FKIIIIDAVRTLSLNFPQEWKAILNFLIDVLKNGEGGFKFKNNIVEALIDIVSFVPQS
                     KELALENLCDFIEDCEFNEILVRILHLLGKEGPFTSNPSLYVRHIYNRLVLENSIIRS
                     AAVVSLSKFALSKKDTSLRKSIVSLLKRIANDPDDEVRDRAVIALQFIENSNERISEE
                     FIQSKYTYDFQSLESVLSVYMNNNSDSFETPFDVSNVRKITEDEAKALELKRKQDQLH
                     NSRLEAIETCTADGSINNERADAATYAGPSSAEDQSELLASKYADELLSIEEFKPFGK
                     LINSSNVVSLTEPEAEFVVNGVKHILKEHVIFQFNITNTLNDVALDNVAVTCTPEDPD
                     NAILEELFSIPIDRLLPSTEGAVYVAFKKSEEIVMEGFLNNLTFTTKELNPETNEPFE
                     GDEGFEDEYEIDSIFLNAGDYIKNSFVGDFTTVFDELPNEEVAVYNIQENITVQEVID
                     KIIVNTSCLPLENTQFAQSESNSHILKLFGKSALTGVKIALIVRIVKSSKGVALKAQG
                     KSENATLCADLINSII"
     gene            complement(<241371..>242327)
                     /gene="TPHA0P01190"
                     /locus_tag="TPHA_0P01190"
                     /db_xref="GeneID:11530905"
     mRNA            complement(<241371..>242327)
                     /gene="TPHA0P01190"
                     /locus_tag="TPHA_0P01190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688663.1"
                     /db_xref="GeneID:11530905"
     CDS             complement(241371..242327)
                     /gene="TPHA0P01190"
                     /locus_tag="TPHA_0P01190"
                     /inference="similar to DNA sequence:INSDC:YNL288W"
                     /note="similar to Saccharomyces cerevisiae CAF40
                     (YNL288W); ancestral locus Anc_3.72"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688711.1"
                     /db_xref="GeneID:11530905"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:G8C299"
                     /translation="MEDTHIDESVHDAPAVSGAPAEAGGELHALDDPNVYHWICQLTY
                     GPHKEQAMLELGRKREQFDDLALVIWTSFGVMTSLLNEIIGVYPMLQPNYLSNQLSNR
                     VCNALVLLQCVASHPETKHQFLQAHIPLFLFPFLNTTSRQRTFEYLRLTSLGVIGALV
                     KNDSQEVISFLLRTDIIPLCLRIMESSSELSKTVAIFILQKILLDDIGLQYICATLER
                     FYAVSNVLKHMIDQLTAQTPPGRLLKHIIRCYLRLSDNLEARRLLKIVLPDKLRDDTF
                     TEVLKDDVNTKRCLAQLLLTLNEEPSQQTVPQHLAAQQQAAQ"
     gene            complement(<242758..>243765)
                     /gene="TPHA0P01200"
                     /locus_tag="TPHA_0P01200"
                     /db_xref="GeneID:11530906"
     mRNA            complement(<242758..>243765)
                     /gene="TPHA0P01200"
                     /locus_tag="TPHA_0P01200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688664.1"
                     /db_xref="GeneID:11530906"
     CDS             complement(242758..243765)
                     /gene="TPHA0P01200"
                     /locus_tag="TPHA_0P01200"
                     /inference="similar to DNA sequence:INSDC:YNL290W"
                     /note="similar to Saccharomyces cerevisiae RFC3 (YNL290W);
                     ancestral locus Anc_3.69"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688712.1"
                     /db_xref="GeneID:11530906"
                     /db_xref="GOA:G8C2A0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C2A0"
                     /translation="MNRAEKNLENLPWVEKYRPSSLDEVYGQPDIVNTVRKFVAEGKL
                     PHLLFYGPPGTGKTSTIIALAKEIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTR
                     QIFSKGFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYAYKLTPALLSRCT
                     RFRFQPIAIDALERRMNNVVLQEHLNIGQEAKDALLKVSKGDMRRIMNVLQASKSSVD
                     TADGEITREIIYECCGICRPEDVQKILKSILEDDFGTAYLTLKQICQAKGLASIDIIE
                     ELVALLECYELKNERTRQETLVCLSEIEYSISKGCNNKIVQSAIIGAIKTAFEHETAS
                     A"
     gene            <244080..>245651
                     /gene="TPHA0P01210"
                     /locus_tag="TPHA_0P01210"
                     /db_xref="GeneID:11530907"
     mRNA            <244080..>245651
                     /gene="TPHA0P01210"
                     /locus_tag="TPHA_0P01210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688665.1"
                     /db_xref="GeneID:11530907"
     CDS             244080..245651
                     /gene="TPHA0P01210"
                     /locus_tag="TPHA_0P01210"
                     /inference="similar to DNA sequence:INSDC:YNL291C"
                     /note="similar to Saccharomyces cerevisiae MID1 (YNL291C);
                     ancestral locus Anc_3.68"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688713.1"
                     /db_xref="GeneID:11530907"
                     /db_xref="InterPro:IPR024338"
                     /db_xref="UniProtKB/TrEMBL:G8C2A1"
                     /translation="MMLLCFLGIYFAALLSICKVSGSDLSNILNSGGSENSTSLLDDW
                     VPIHNSISAGETNYYSYSLGYDSWSSSFDFLFISGNLLNIPNTNGSVLRLYYSFSDTI
                     FANLSDTVYEDFYDGYVSAMVSTFSDTATDLNTTYSTLYLALQVVDQETGVALVVNGD
                     SNSDDTWDYQIAVSEKDLYYQWDRKTWIEVMDTDYNSVLLSIGQFVTATSAKSNSTSS
                     DEEYVLYIYTPEEAEKITANRNCSISAVKNGPHIISSENVTESDVDLSLLDREDFQIF
                     KLNVDAYTSNNHGQYYITGLNSSTSYVGFLTQTITGSNGSSDENSSGGLLYGNFTFST
                     KPDNTCSLVFGLNFCSGVAYSVPTPSELQGNKSAIVQIYDSIAESLYTNFTKALQIIP
                     CDTELDARYSPLRTCDDCAASYLDWLCAVSIPRCTTTETPHFIYRNKNVNRNSYINED
                     IKPIRDYYEVLPCIDMCHSIVRDCPADFGFACPEPSNSNNLLFSSYNYYYEDFDYITC
                     NFIGNYSSLIIPDAD"
     gene            complement(<245787..>246479)
                     /gene="TPHA0P01220"
                     /locus_tag="TPHA_0P01220"
                     /db_xref="GeneID:11530830"
     mRNA            complement(<245787..>246479)
                     /gene="TPHA0P01220"
                     /locus_tag="TPHA_0P01220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688666.1"
                     /db_xref="GeneID:11530830"
     CDS             complement(245787..246479)
                     /gene="TPHA0P01220"
                     /locus_tag="TPHA_0P01220"
                     /inference="similar to DNA sequence:INSDC:YOL110W"
                     /note="similar to Saccharomyces cerevisiae SHR5 (YOL110W);
                     ancestral locus Anc_3.66"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688714.1"
                     /db_xref="GeneID:11530830"
                     /db_xref="InterPro:IPR019383"
                     /db_xref="UniProtKB/TrEMBL:G8C2A2"
                     /translation="MTLSGELSRTNHQVEQRPLFFNYHEYTETYYADIGDVIEYQGHD
                     ADHELCITHFPNIYVPLDSEKFRTTRIVRIPRSFESSLEYPQFSAFLPGSESAAVTYG
                     ADGLDFVQHGYFDDQNQIFGYSSVSPLSDYLTEEEFNRIIIDINTIIRESFQVSSAYN
                     ISDLILELLTLTMWKWISKYVYPHPLLKVEEYIERVNESRAFKEKNIKMISLRESGFL
                     SLDFEIPKPVIH"
     gene            <246813..>247457
                     /gene="TPHA0P01230"
                     /locus_tag="TPHA_0P01230"
                     /db_xref="GeneID:11530831"
     mRNA            <246813..>247457
                     /gene="TPHA0P01230"
                     /locus_tag="TPHA_0P01230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688667.1"
                     /db_xref="GeneID:11530831"
     CDS             246813..247457
                     /gene="TPHA0P01230"
                     /locus_tag="TPHA_0P01230"
                     /inference="similar to DNA sequence:INSDC:YOL111C"
                     /note="similar to Saccharomyces cerevisiae MDY2 (YOL111C);
                     ancestral locus Anc_3.65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688715.1"
                     /db_xref="GeneID:11530831"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:G8C2A3"
                     /translation="MSIENIQPTELEFVSRFLTLATLSEPVFSKDYQKPLQEVTSLGV
                     ALPGLRYKYEPSRVRKNAGSSNNGSGSMSDNASNAIKLTLKSIRAPKFSIEHEFSGND
                     TVLQVKLFLVNEKKVEQKEQLKLLLKGKVLHDKFLLSDLNVTEATLNVMVSKPVLSTA
                     DEVEPEAPSLDSVSPTVSYEVPWDEIETLLNNKWNNQEQVFKALKKMKTNYEMN"
     gene            complement(<247597..>249699)
                     /gene="TPHA0P01240"
                     /locus_tag="TPHA_0P01240"
                     /db_xref="GeneID:11530832"
     mRNA            complement(<247597..>249699)
                     /gene="TPHA0P01240"
                     /locus_tag="TPHA_0P01240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688668.1"
                     /db_xref="GeneID:11530832"
     CDS             complement(247597..249699)
                     /gene="TPHA0P01240"
                     /locus_tag="TPHA_0P01240"
                     /inference="similar to DNA sequence:INSDC:YNL293W,YOL112W"
                     /note="similar to Saccharomyces cerevisiae MSB3 (YNL293W)
                     and MSB4 (YOL112W); ancestral locus Anc_3.64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688716.1"
                     /db_xref="GeneID:11530832"
                     /db_xref="GOA:G8C2A4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8C2A4"
                     /translation="MREGDMQGYVEPSAIRMKVSKSFDDDSSLSKNNSNVTSGDFDSG
                     VGMNTRKNQVASQNITMNNPIYSMKAKFGIRSPSVPNFQDSLYSGNNNSTPILNNSRR
                     FDPGINKNESNNMDTRKYWKENADVDSAKETPIDNNKTHDDPAMSVIDLYNDDDGYSR
                     NNRSSMGHQLEDYHLESDDEEDEDSENNHESSEMLAAVSNAEFLPKSITLNRKELNTE
                     HCDRYGFKKKNNYVSEETYNAWWEDYSGYCIRRKHKWLLLLQKSGLPVHNDIPVRFPP
                     HSEKLKRYVRKGIPAEWRGNAWWYFARGQEKLNKNKDVYSNLLLKMGNLEDETQKGKI
                     QDLDVIERDLNRTFPDNIHFQKEAFSTKEPVMIKSLRRVLVAFSLYNTKIGYCQSMNF
                     LAGLLLLFMDEEKTFWMLVIITSRYLPGVHNVNLEGVNIDQGVLLLCIREYLPELWTE
                     IESSYNGYTKNTPNNSANSKNLFLLKLPPITLCTASWFMSCFIGVLPIETTLRIWDCM
                     FYEDSHFLFKASLAIFKICEPDLLKGKPSHRSFSQYSLTNTKQHRSNACQDDYDMQMF
                     QVIQTFPKTIIDPNDIFEKVIFKRRLQLNRLDQNEIDKCRKYVAVQRQKHKNYDDIIG
                     KLGNTSPFDEKSDEQNLHGGKFIDNSINILGKDLKMTSEMVNEALSSEVYDFKRGFSG
                     VNWNNSIKERVKHMRKKK"
     gene            <250433..>252067
                     /gene="TPHA0P01250"
                     /locus_tag="TPHA_0P01250"
                     /db_xref="GeneID:11530833"
     mRNA            <250433..>252067
                     /gene="TPHA0P01250"
                     /locus_tag="TPHA_0P01250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688669.1"
                     /db_xref="GeneID:11530833"
     CDS             250433..252067
                     /gene="TPHA0P01250"
                     /locus_tag="TPHA_0P01250"
                     /inference="similar to DNA sequence:INSDC:YNL294C"
                     /note="similar to Saccharomyces cerevisiae RIM21
                     (YNL294C); ancestral locus Anc_3.63"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688717.1"
                     /db_xref="GeneID:11530833"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:G8C2A5"
                     /translation="MSFFDTWEVLKPMHNDYMSCTEHFLGDGMLLSPAFPIACFYADH
                     ISFKGYCKRNSPSYVMSKAKRLLEISYLDSVERDWEKYRGMLGPEGGDFRFSVYVLTV
                     VVTINLVACLFLSIYLFLAIHDRHRQFFLNIVRFAAVLSSITLILFTSRMLLLIQDEF
                     NNLGVVTAHLIAYTLGNRLDFKILDFIAISLLQFCQLINVTRLVSTLEEKRFSFIAGF
                     IMVMVSNILYAVSLFSSGSDSLTVLNPFVYLLRIAISTSYAAIVISFIIAKYKLCFIN
                     FSLGFLSIYSFLLVLFQVLFFFFDLANVWINSIGEIFNLTAYVASTAIVWEWINRIFV
                     VQKKKEAQSILGRTIYAEENVDHKIAKYALKIQDALTRTISTEYSDKNSFLNDDRSSE
                     LMLRPFDEHSLNAHSTKDGKDDEIVFNIDKNQERVLTGSSSMNQTSYELSGISTCIED
                     SSFHNSQNSRSVTAYFKEKLHMSYNKLIMLTDYMLIKILGQNSINLSTTNGEEIENNK
                     RKVKQRIGLDKVNDVHLYKTTDIIFNSDDEDYDTED"
     gene            complement(<252274..>253758)
                     /gene="TPHA0P01260"
                     /locus_tag="TPHA_0P01260"
                     /db_xref="GeneID:11530834"
     mRNA            complement(<252274..>253758)
                     /gene="TPHA0P01260"
                     /locus_tag="TPHA_0P01260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688670.1"
                     /db_xref="GeneID:11530834"
     CDS             complement(252274..253758)
                     /gene="TPHA0P01260"
                     /locus_tag="TPHA_0P01260"
                     /inference="similar to DNA sequence:INSDC:YNL295W"
                     /note="similar to Saccharomyces cerevisiae YNL295W;
                     ancestral locus Anc_3.62"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688718.1"
                     /db_xref="GeneID:11530834"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:G8C2A6"
                     /translation="MIISRYGLRSCFSKRISTLTNSKCNQTRSYSSASDKKPQALAKS
                     KKKKVSKNEEIDNYNKGMETIRKYDPNFANNTSTKLHGLKKSLLVPKVASTDNLSSAE
                     IQTEGLFAGYRPLFLGNSSLETNSKLDVLDNFFTSFANLKVSAPESETDSYNSGQIKD
                     VIDDLQNGLESEQEQSSLTRENRKPIIPWDASIGGMVYSDKAFKDLPKSVVSKLSPFK
                     LVKLERSQDKSQVKPKRFIKIKVHNSKVSDDLEMVNLFDSDKTKHYDKHIQDGSIIGV
                     TRDQMIKDRKEYENEMNHYLLLFRFLKSDQRLYITYLDKLMRFLERQIFKKIKLHTHS
                     PVLLYRLPIFIYLPPSSIGIKSLRRILRKQIINQSSPLMSILLPCYEKEFQREKLLSK
                     FNNKVNTLLNDLIIALPSYHIHDTDTDCIIQQSPVPNFKRLYWLKPTLRKNVFYGKNI
                     HQEYVFNYSKSYDITRSNIKYMRYPIGLRSKTVKEAFSKDRFYD"
     gene            complement(<254480..>257137)
                     /gene="TPHA0P01270"
                     /locus_tag="TPHA_0P01270"
                     /db_xref="GeneID:11530770"
     mRNA            complement(<254480..>257137)
                     /gene="TPHA0P01270"
                     /locus_tag="TPHA_0P01270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688671.1"
                     /db_xref="GeneID:11530770"
     CDS             complement(254480..257137)
                     /gene="TPHA0P01270"
                     /locus_tag="TPHA_0P01270"
                     /inference="similar to DNA sequence:INSDC:YNL298W,YOL113W"
                     /note="similar to Saccharomyces cerevisiae CLA4 (YNL298W)
                     and SKM1 (YOL113W); ancestral locus Anc_3.60"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688719.1"
                     /db_xref="GeneID:11530770"
                     /db_xref="GOA:G8C2A7"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8C2A7"
                     /translation="MSLSAAANNISDTDFQNIGPAPKPPISSSILNSMNELGKNSTGY
                     NQTQPIGDISSPFDFQRNNSSRAFNNAAQYPASATLTMTNRKGWISYKDDGLLSFLWQ
                     KRYIVVNDLYLSFYKNEKTTDDPLLRVPLTNIVSISRTQVKVNCMEIVRTTDRNSVPS
                     ATGSLSNINSSNDTATKKSIFISTKTEVELNSWLDLLFTRCPLLSGVSSPTNFTHKVH
                     VGFDPETGSFVGMPTNWEKLLKHSRITGEDWNNDSAAVIQVLQFYQQYNDVDGSGANV
                     QSNVNKIEKVKSNSTSSPVDSLPYGSSSHLPGTNHSSSTSLNNIDNQNKKLQLNYGHQ
                     NTGNSTMVKQNRSSPLGQQGLLPQIQAPMKVPLPTGVPNNNTTNKPLIAPINTKISVN
                     TQNHNQKLPSPINQSGMQQNQKFQQMHQFRPNESPSHPNHPQRMMPRYPQQQQQQQTM
                     NNRAQHNMVNPYSKISATSNKMPGIRGPEAQQIQTSSPPPRLHPQRAAPQRPNVNQAL
                     SSTTTINATAAAASAMRQHAKHNVGQPTPANLPPAQRQAPKKPIGTQGAVSTETKKPS
                     KPILSNAEIMARLKQVTFIQDPTPSFEMIEKAGQGASGSVYLAKRSALPPKEDKINQY
                     DEPAKIGDKVAIKQMMLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVV
                     MEYMEGGSLTDIIENSPADESINSPLTESQIAYIVRETCQGLKFLHDRHIIHRDIKSD
                     NVLLDTQGRVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLG
                     IMTIEMLEGEPPYLNEDPLRALYLIATNGTPKLRHPESLSLEIKRFLSVCLCVDVRYR
                     ASTEELLHHNFFSLACPPEELLSLLEWKL"
     gene            complement(<258196..>259710)
                     /gene="TPHA0P01280"
                     /locus_tag="TPHA_0P01280"
                     /db_xref="GeneID:11530771"
     mRNA            complement(<258196..>259710)
                     /gene="TPHA0P01280"
                     /locus_tag="TPHA_0P01280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688672.1"
                     /db_xref="GeneID:11530771"
     CDS             complement(258196..259710)
                     /gene="TPHA0P01280"
                     /locus_tag="TPHA_0P01280"
                     /inference="similar to DNA sequence:INSDC:YNL299W,YOL115W"
                     /note="similar to Saccharomyces cerevisiae TRF5 (YNL299W)
                     and PAP2 (YOL115W); ancestral locus Anc_3.58"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688720.1"
                     /db_xref="GeneID:11530771"
                     /db_xref="GOA:G8C2A8"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:G8C2A8"
                     /translation="MMSEKVQPDLIEVSSEVSEIDDNYDDYEGHLSKATEQVDSAKKR
                     KFAEDEDESVNRKKNNPVLKLANDIDKNNDFIAFSESSSDEEEVKEDGDEGVDKDGAT
                     ILNTDFPWIINHDHSKQKEVADWLTLEIRDFVSYISPNRTEIEMRNQTINNIRNSIKE
                     HWPDADLHVFGSYATDLYLPGSDIDCVINSNKGDKGSRSLMYSLASFLKRKGLATDIT
                     IIANARVPIIKFVEPVSGIHIDVSFERDNGLDAANIIRSWLTSTPSLRELVLIVKQFL
                     NSRRLNDVHTGGLGGFSIICLVYSFLSLHPRIITKEIDARENLGILLIDFFELYGKNF
                     GYDHVALTVRDNQPKYLPKSQWKGLNAKNSFTLAIQDPGDETNNISRGSFNLRDIKKA
                     FAGAFDLLTNRCFELEAASFKDRLGKSILGNVIKYRGVERDFNDDRGLVKNKAIEENK
                     SYIKKRSSIVHDAQDLSDDERQHPRKRNKTSSRKKPVPKENNEDEDDDYIPVLE"
     gene            complement(<260217..>261320)
                     /gene="TPHA0P01290"
                     /locus_tag="TPHA_0P01290"
                     /db_xref="GeneID:11530772"
     mRNA            complement(<260217..>261320)
                     /gene="TPHA0P01290"
                     /locus_tag="TPHA_0P01290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688673.1"
                     /db_xref="GeneID:11530772"
     CDS             complement(260217..261320)
                     /gene="TPHA0P01290"
                     /locus_tag="TPHA_0P01290"
                     /inference="similar to DNA sequence:INSDC:YOL116W"
                     /note="similar to Saccharomyces cerevisiae MSN1 (YOL116W);
                     ancestral locus Anc_3.57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688721.1"
                     /db_xref="GeneID:11530772"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:G8C2A9"
                     /translation="MDIIEGDGSINNRVGDLERQVLMFERMLLTLSGTLDQHFKKYDM
                     LISTQQQQMAELNAIISTLLNDQYRHSEITREKLSSALHGISATSASVSTTMNDTSLR
                     VVSNSSNSNDQLPVNDGYKGLHGNIDINRLEGSSMSQSSSLHTPLINNSAFLPTKLSQ
                     SSGIQNTNNMVNDYLKTPVSNYYSTVATTMQNSNSLNHSSISIAQDPGAVNVTEPIKS
                     GNVIFYNQAEKSTEPTRNISVDDRNVEMNGTRQRKKKKNVFVGEFQFIKSPHSILDLW
                     KEYTEGINGQPSIRELESIYQTGWRRDPAVNKRFSRRKVLYKAIENGLNRGYTLEYII
                     DLLEDFRFTDETKKQKRPIGWIFHSANIPNLLK"
     gene            <263960..>264953
                     /gene="TPHA0P01300"
                     /locus_tag="TPHA_0P01300"
                     /db_xref="GeneID:11530773"
     mRNA            join(<263960..263979,264539..>264953)
                     /gene="TPHA0P01300"
                     /locus_tag="TPHA_0P01300"
                     /product="40S ribosomal protein S19"
                     /transcript_id="XM_003688674.1"
                     /db_xref="GeneID:11530773"
     CDS             join(263960..263979,264539..264953)
                     /gene="TPHA0P01300"
                     /locus_tag="TPHA_0P01300"
                     /inference="similar to DNA sequence:INSDC:YNL302C,YOL121C"
                     /note="similar to Saccharomyces cerevisiae RPS19B
                     (YNL302C) and RPS19A (YOL121C); ancestral locus Anc_3.51"
                     /codon_start=1
                     /product="40S ribosomal protein S19"
                     /protein_id="XP_003688722.1"
                     /db_xref="GeneID:11530773"
                     /db_xref="GOA:G8C2B0"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="InterPro:IPR018277"
                     /db_xref="UniProtKB/TrEMBL:G8C2B0"
                     /translation="MPGVSVRDVAAQDFINAYATFLQRQGKLEVPGYVDIVKTSSGNE
                     MPPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKSRGARPSKHIDASGSINR
                     RVLQALEKIGVVEISPKGGRRISENGQRDLDRIAAQTLEEEE"
     gene            complement(<265254..>266810)
                     /gene="TPHA0P01310"
                     /locus_tag="TPHA_0P01310"
                     /db_xref="GeneID:11530774"
     mRNA            complement(<265254..>266810)
                     /gene="TPHA0P01310"
                     /locus_tag="TPHA_0P01310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688675.1"
                     /db_xref="GeneID:11530774"
     CDS             complement(265254..266810)
                     /gene="TPHA0P01310"
                     /locus_tag="TPHA_0P01310"
                     /inference="similar to DNA sequence:INSDC:YOL123W"
                     /note="similar to Saccharomyces cerevisiae HRP1 (YOL123W);
                     ancestral locus Anc_3.49"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688723.1"
                     /db_xref="GeneID:11530774"
                     /db_xref="GOA:G8C2B1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:G8C2B1"
                     /translation="MNSEDEDFNDIYGNDEEQTTQKGTVVAQESANVEDVEKPKEAEK
                     ETASSSLDQLAALQALSSNLTNLANQGSSTESVTPKAVGESNESNSNDDASASVNNQD
                     VSSTNQSTPGMPAGNNLPWDQLRQTMSQFQPPMPQQQQQQQPPQMNNDSQRKVKADLS
                     KDSCKMFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSV
                     DEVVKTQHILDGKVIDPKRAIPREEQDKTGKIFVGGIGADVRPKEFEEFFAQYGTIID
                     AQLMLDKDTGRSRGFGFVTYDSPDAVDRVCQSKYIEFKGKQIEIKRAEPRNNQKASGQ
                     TNNMNNMNNGMGNMNMMYQNPMMGGFNPMYNQQAMTDYYQQMQQYYQQMQQQTGVDYS
                     QMFQQQMQMMMPGMNPGAAGADPSKPGQPMGGSPSSNSATPQDNNDVQTLGNEQNKME
                     DKHGLPKGPRRPSAGSSDYDRYNDNDDYQYRGGNTGRRLNHRIGSNKNNYRGSGRGGR
                     RSHGYHPYNR"
     gene            <268197..>269504
                     /gene="TPHA0P01320"
                     /locus_tag="TPHA_0P01320"
                     /db_xref="GeneID:11530896"
     mRNA            <268197..>269504
                     /gene="TPHA0P01320"
                     /locus_tag="TPHA_0P01320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688676.1"
                     /db_xref="GeneID:11530896"
     CDS             268197..269504
                     /gene="TPHA0P01320"
                     /locus_tag="TPHA_0P01320"
                     /inference="similar to DNA sequence:INSDC:YOL124C"
                     /note="similar to Saccharomyces cerevisiae TRM11
                     (YOL124C); ancestral locus Anc_3.48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688724.1"
                     /db_xref="GeneID:11530896"
                     /db_xref="GOA:G8C2B2"
                     /db_xref="InterPro:IPR000241"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR002296"
                     /db_xref="InterPro:IPR016691"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8C2B2"
                     /translation="MKKYLLFMVHAHLNFRKAEIESLADLFNIESIDYSKYSDQSPFL
                     IADLKNDEEASTWIKRSILTKAIYEYWGEGETMEDLHKSIKEQPYTEKYIKDYELDSF
                     KFEFETYKGNSKNNNVDRVKQIESFRYLDFKGKIRMKDAKQIYTVIEKYQPVSENIGG
                     DKPVYHYFGRLVQRSNRSAMEKYDLKKRPYKGTTSFEAELSLVSANIAQVKPGTIMYD
                     PFAGTGSFLVAGGHFGALVIGSDIDGRMIRGKGAQASINSNFKKYGESEKFLDVITMD
                     FTHNALRSDLMIDTILCDPPYGIRESIKVLGAKNPEKFEGKEDVEIDGEKAYLKRDYI
                     PTKKPYSLDALLDDLLQYSTERLPIGGRLAFWMPTANDENIETIVPMHSNLELKYNCV
                     QDFNKWSRRLLVYINRGDGYNGSTNAGKQRTSNFRDRYFKNFN"
     gene            complement(<269708..>271318)
                     /gene="TPHA0P01330"
                     /locus_tag="TPHA_0P01330"
                     /db_xref="GeneID:11530897"
     mRNA            complement(<269708..>271318)
                     /gene="TPHA0P01330"
                     /locus_tag="TPHA_0P01330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688677.1"
                     /db_xref="GeneID:11530897"
     CDS             complement(269708..271318)
                     /gene="TPHA0P01330"
                     /locus_tag="TPHA_0P01330"
                     /inference="similar to DNA sequence:INSDC:YNL304W"
                     /note="similar to Saccharomyces cerevisiae YPT11
                     (YNL304W); ancestral locus Anc_3.47"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688725.1"
                     /db_xref="GeneID:11530897"
                     /db_xref="GOA:G8C2B3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C2B3"
                     /translation="MSKKKRYSLNGASPVVPIVASFESDSNISSDVEDKRASVTSTFL
                     DRHGELSRKDSFLRSNQTGKHSSFYRISSSDLSATNLSFDSLEVATTANVKIILIGDA
                     GVGKTGMVLSFYNELPTKGQFKLMREVSGSAKENFQFDKMKLPKRSINANIKRLKKKP
                     SLTSVKKRYSLNDYEELFNKKSPTSEDFDLSLNSNSGSKLKDEFHRDDVESENEDELV
                     IDTSSTIGIDIKTTTVNVDNRFFKCITWDTAGQERYKNVMIPTLYKGSNGVFLIYDIC
                     DIESFRSCCDHWLQEAIDNMSKEDLSKARFYLIGNKIDLYKKRQVRHEDVLEKMSEIE
                     FKFEVKIAGNFEVTCKWPNVVERTFNIAIKDLIEHGCYDDTEYKNTGSNIEKLPNKQS
                     GDDDENRLVDSSILETNADTSKILKDLNDLDSDDNPAEERESEGEFSNNRIRKSPPIS
                     TKSKIISQSLEYNDMVSDSESDNEHTIRNRLVENPNKNIEKNDEGKDIDEALERLFPK
                     KSSNVDITKPLGKNSETPNGSFYSSCCA"
     gene            complement(<271831..>273168)
                     /gene="TPHA0P01340"
                     /locus_tag="TPHA_0P01340"
                     /db_xref="GeneID:11530898"
     mRNA            complement(<271831..>273168)
                     /gene="TPHA0P01340"
                     /locus_tag="TPHA_0P01340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688678.1"
                     /db_xref="GeneID:11530898"
     CDS             complement(271831..273168)
                     /gene="TPHA0P01340"
                     /locus_tag="TPHA_0P01340"
                     /inference="similar to DNA sequence:INSDC:YOL125W"
                     /note="similar to Saccharomyces cerevisiae TRM13
                     (YOL125W); ancestral locus Anc_3.46"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688726.1"
                     /db_xref="GeneID:11530898"
                     /db_xref="GOA:G8C2B4"
                     /db_xref="InterPro:IPR007871"
                     /db_xref="InterPro:IPR021721"
                     /db_xref="InterPro:IPR022776"
                     /db_xref="UniProtKB/TrEMBL:G8C2B4"
                     /translation="MTEPRPKKQRLQCEYIIPNKKRRCGMTRPSNEESKHVRYCLEHR
                     HLLGVDASAGAVTDSRKRVPCPLDPNHTIWEFELAKHLQKCNKRKVLHSNDGEVYYKE
                     NHNAGVYSEQGDEEKSNLSLQDCILSTLNILKDFNKENEIVIPKLIKHSGIMEDKRFP
                     QLDENDNIGRKYHAIQQSSLIQNMFDHNILTSASNSNFIEFGCGRAELSRYINQVNQY
                     TTDTDNSTSHFVLIDRSTNRMKFDAKIMADSEEINSVRSNNNKPQIDRIRIDIKDLDI
                     TPVLKSNEKYIAISKHLCGVATDLALRCLIGHEKELREDHLQGICIAMCCRHVCNHNS
                     YINPSYIKHILQNHSAGETLTYSQFFLALTKIAPWATSGKAGTGDQAQTHFSKLNEQE
                     RFNAGIQARNIIDQGRADWLESRLDEKTFGVKLIRYCESEVTLENNAILVYRI"
     gene            <274173..>275348
                     /gene="TPHA0P01350"
                     /locus_tag="TPHA_0P01350"
                     /db_xref="GeneID:11530899"
     mRNA            <274173..>275348
                     /gene="TPHA0P01350"
                     /locus_tag="TPHA_0P01350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688679.1"
                     /db_xref="GeneID:11530899"
     CDS             274173..275348
                     /gene="TPHA0P01350"
                     /locus_tag="TPHA_0P01350"
                     /inference="similar to DNA sequence:INSDC:YOL126C"
                     /note="similar to Saccharomyces cerevisiae MDH2 (YOL126C);
                     ancestral locus Anc_3.45"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688727.1"
                     /db_xref="GeneID:11530899"
                     /db_xref="GOA:G8C2B5"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:G8C2B5"
                     /translation="MPVPAIEIIDNPSVAHNDGDSRNATRVKVSVVGAGGGIGQSLSL
                     LLKVNLNNLLANDPSANASIELSLFDVNLENLKGVTADLSHINNKIRLQVTDNLAENV
                     KDSNLIIIAAGVPRKPGMTRDDLFNINAGIIKNIATDINNANACNSQNSGNSSFILLI
                     SNPLNSLLPVLQNSLNENWIGKCFGITELDLVRASTFLEPLLQSNSGNNAEMPYIPVI
                     GGHSGDTILPVFSQITANNFTSSLYDLVRGPDSQIIRKLINRVQYGGDEIVEAKNGKG
                     SATLSMAYSAYRIAEQFTALLLNQVKTVESILYTTIVGKDFETPLSTVEGAAELHDQY
                     LERRLKFFATACTVEKLSGLTKIDNKIIGNLNAFEKDNLLPTCIDSLQINIEKGLSF"
     gene            <275675..>276541
                     /gene="TPHA0P01360"
                     /locus_tag="TPHA_0P01360"
                     /db_xref="GeneID:11530900"
     mRNA            <275675..>276541
                     /gene="TPHA0P01360"
                     /locus_tag="TPHA_0P01360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688680.1"
                     /db_xref="GeneID:11530900"
     CDS             275675..276541
                     /gene="TPHA0P01360"
                     /locus_tag="TPHA_0P01360"
                     /inference="similar to DNA sequence:INSDC:YNL305C"
                     /note="similar to Saccharomyces cerevisiae YNL305C;
                     ancestral locus Anc_3.44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688728.1"
                     /db_xref="GeneID:11530900"
                     /db_xref="GOA:G8C2B6"
                     /db_xref="InterPro:IPR006214"
                     /db_xref="UniProtKB/TrEMBL:G8C2B6"
                     /translation="MNSEYYSGATSGPYATTNTNDLPDDFKYSVKVISCEPEVRLKFQ
                     RKVYSILIIQLLITFLYSLAVLNLPYLQNFMVNHRGIFILSTIISLVTCIWLSFAPNS
                     NTEDDDISQSFMPNTGDSTLLQHRNSKPWYHLASKKAQFTVLMIFTFAEAYSMSIVTL
                     TYDSKTILSALLITLVVVVGVTVSSLSPLFQVSMNSLTSVYYWLNWALWLMIGVGIST
                     LFFGGMGGFSNLIFGWFGAFVFTIYLFIDTQLIFRKCYIDDEIKCCMMLYLDIINLFL
                     SILRIMSNSNED"
     gene            complement(<276759..>277382)
                     /gene="TPHA0P01370"
                     /locus_tag="TPHA_0P01370"
                     /db_xref="GeneID:11530901"
     mRNA            complement(<276759..>277382)
                     /gene="TPHA0P01370"
                     /locus_tag="TPHA_0P01370"
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /transcript_id="XM_003688681.1"
                     /db_xref="GeneID:11530901"
     CDS             complement(276759..277382)
                     /gene="TPHA0P01370"
                     /locus_tag="TPHA_0P01370"
                     /inference="similar to DNA sequence:INSDC:YNL306W"
                     /note="similar to Saccharomyces cerevisiae MRPS18
                     (YNL306W); ancestral locus Anc_3.42"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /protein_id="XP_003688729.1"
                     /db_xref="GeneID:11530901"
                     /db_xref="GOA:G8C2B7"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:G8C2B7"
                     /translation="MLSGKILNLPLLGKVSRFNNATVRMFSGGQVAFNEKQLFAGISD
                     MLSSSRDITNISTPIEESNGTQVVSGSGKKKIVKPNERTVKYVLSCLFGKNNTHFTYS
                     AVVEDTNYMKLNSDKSYNEQFLYYYNLPRKVKFSISTGCLGFRKAARGEYEAAFQTSA
                     KVFQMIQEKRLMDKDIEIVMKDFGKGRAAFTAALNGKEGNNIRKNNF"
     gene            <278259..>279380
                     /gene="TPHA0P01380"
                     /locus_tag="TPHA_0P01380"
                     /db_xref="GeneID:11530799"
     mRNA            <278259..>279380
                     /gene="TPHA0P01380"
                     /locus_tag="TPHA_0P01380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688682.1"
                     /db_xref="GeneID:11530799"
     CDS             278259..279380
                     /gene="TPHA0P01380"
                     /locus_tag="TPHA_0P01380"
                     /inference="similar to DNA sequence:INSDC:YNL307C,YOL128C"
                     /note="similar to Saccharomyces cerevisiae MCK1 (YNL307C)
                     and YGK3 (YOL128C); ancestral locus Anc_3.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688730.1"
                     /db_xref="GeneID:11530799"
                     /db_xref="GOA:G8C2B8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:G8C2B8"
                     /translation="MSNPTVNNSCEEFVADDVTSNRSDTTRRMLVKEYRKIGHGAFGT
                     VVQAYITPDKEQWYGPFAIKKVPAQTEYKSRELQILRITDHPNVVRLDYFFTHVSPVD
                     NKVYQHLAMECLPGTLQMEISRYSTNKLQLPIKHVKLYSYQIARGMLYLHALGICHRD
                     IKPSNILLDSRTGILKICDFGSAKKLEHNQPSISYICSRFYRAPELIIGCTQYTTQID
                     IWGLGCVIGEILIGKAVFQGPEPLLQLREITKLLGPPDKKFIFFSNPAYDGPLFSKPL
                     FSTSVLSRFEKHFGHAGPDGIDLLMKILVYEPQSRLSPRRIMAHQFFDELRNEAYFFP
                     RGETQPVRLPELFNFSEFELRVIGDLVNKIKPQEEDNIN"
     gene            complement(<279852..>282335)
                     /gene="TPHA0P01390"
                     /locus_tag="TPHA_0P01390"
                     /db_xref="GeneID:11530800"
     mRNA            complement(<279852..>282335)
                     /gene="TPHA0P01390"
                     /locus_tag="TPHA_0P01390"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688683.1"
                     /db_xref="GeneID:11530800"
     CDS             complement(279852..282335)
                     /gene="TPHA0P01390"
                     /locus_tag="TPHA_0P01390"
                     /inference="similar to DNA sequence:INSDC:YOL130W"
                     /note="similar to Saccharomyces cerevisiae ALR1 (YOL130W);
                     ancestral locus Anc_3.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688731.1"
                     /db_xref="GeneID:11530800"
                     /db_xref="GOA:G8C2B9"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:G8C2B9"
                     /translation="MSSSSDLADKETPPLSPTASLHESMVSMKTEDHNELYDHRQHDD
                     PMDMANANTTSPHTHVRPHDLLFSNNNNNSSNDQPALDANSQLDDAKNSGTNSAAAKR
                     RMSKARSMSTTNSMNLNHANLLAKTASQKSDVLPSNADANVKNPNTRNSFDSENSQAS
                     RESQETEEDVCFPMGPALHTRVNGIDFDELEEFAIQVNEQKQNYYNSMNYNNIYNTNF
                     CSANAMDSDQINKSTSQAIASSSSSLISSAALKYTPRQEKLLNSDDTSTSQKDSHDIS
                     LEDKHNDKSNNNGVFFGNNKIEDEFEEESKERVTKHNTIHKKNDGDSLTNSNDSHNPP
                     ANEQMNFTSPIRYSYFCSESEETVHAEDIASLVKDGESYFELFHGGEPTWWLDCSCPT
                     DDEMRCIAKAFGIHPLTAEDIRMQETREKVEMFKSYYFICFHTFENDKESEDYLEPIN
                     VYIVVLRTGILTFHFGPISHCANVRRRVRQLRDYVNVSSDWLCYALIDDITDGFAPVI
                     QSIEYEADTIEDTVFMVQNLDFSGMLQKIGESRRKVMTLMRLLSGKADVIKMFAKRCQ
                     DEYSGIGPALTSYINIANLQAANNNMNYNMDSSHNFTPNGTQTNIHGSSSNTNFIQNP
                     TGQQPSFQNQLPSQPFQNTFSKNAQPRSDIALYLGDIQDHLLTMYQNLLAYEKIFSRS
                     HSNYLAQLQVESFNSNNKVTEMLGKVTMIGTMLVPLNVITGLFGMNVKVPGEGGSIAW
                     WFGILGVLLLLGALGWFLASYWVSRNERPLLEGKENNDSGAKSIITNLFPRGARGARN
                     YRNTSNNGRGRHSSNHSIQSLPSRYSRYN"
     gene            complement(283228..283323)
                     /gene="TPHA0Ptrna14K"
                     /locus_tag="TPHA_0Ptrna14K"
                     /db_xref="GeneID:11530882"
     tRNA            complement(join(283228..283264,283286..283323))
                     /gene="TPHA0Ptrna14K"
                     /locus_tag="TPHA_0Ptrna14K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:11530882"
     gap             284319..284338
                     /estimated_length=20
     gene            complement(284367..284440)
                     /gene="TPHA0Ptrna12I"
                     /locus_tag="TPHA_0Ptrna12I"
                     /db_xref="GeneID:11530861"
     tRNA            complement(284367..284440)
                     /gene="TPHA0Ptrna12I"
                     /locus_tag="TPHA_0Ptrna12I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:11530861"
     gene            complement(<285031..>289965)
                     /gene="TPHA0P01400"
                     /locus_tag="TPHA_0P01400"
                     /db_xref="GeneID:11530858"
     mRNA            complement(<285031..>289965)
                     /gene="TPHA0P01400"
                     /locus_tag="TPHA_0P01400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688684.1"
                     /db_xref="GeneID:11530858"
     CDS             complement(285031..289965)
                     /gene="TPHA0P01400"
                     /locus_tag="TPHA_0P01400"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688732.1"
                     /db_xref="GeneID:11530858"
                     /db_xref="GOA:G8C2C0"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="UniProtKB/TrEMBL:G8C2C0"
                     /translation="MIYRIVLNILIKEPIDYLTIKKMDYTRATEVANDTNLDVGTTQH
                     KLVSPHGGLTRMDNDHSSSQVVKETLQSNIEIPNENTDVFIRTFKNRLSTLEGLYEKT
                     MMKHDEFLNSIEAGDYLSKITKLEEEEKGLELNIEKLRTKIIDREGLLNNRTTAHTRT
                     SINNTVTNGSNKEEGNQQTNLMNNGSLMFKTLNGKEVVINKNYLPLNIEFKLINIEDL
                     PLWIKEFVKFLNYYNLDNLNELPESTIIDPVEDQFIKGQLKENIKCEDIYDFIFMENS
                     SIKILNEVKRIFLRKLNFAKRQKLWKQVSITEKSNNLALQLNLLNKLVGIEEFIDTNK
                     MEIFNLIINRINNQVLQRINAVPIDLSKITPTQYLGIIKKHAEDAFEFHEQIKQFYSS
                     EREEAKSNSKNPETLRPIVKKVQRNPVQTKISTKKNQLKSAVDTVIDSGSGINFTNKK
                     GLIFNYRKLTTIPEYSGVGSSSNLQIIGQGSLRVRMDNNGKYQYIPVYYCPDEDATVL
                     SAIGLRKTLGFIITEDYKNLKNDSISIKIHNVANTTWIKSNDLLLSSKDNRTSEKLTK
                     ASSIRWIKPSTSFNNKTVTIHEAHERSNHLPVDVIVHNIENNAFSDVNKINLKKSELI
                     NFYCEQCAQAKMKQHDHIKDSMNKHYEQMQPGQSWSLDIRGPLGKNLAKVDNYLLLMV
                     DNVSRFLLVSTHTNKNKETISLQIKNNIQYIEKQYDRIVKELIVDRGSEFTNDSLKTY
                     VSEKGIKLMLTDTNDHASNARAERFIGIMNNDIRTLMHNSDLPWALWKYAALAAARIR
                     NLFMTKKLNCSPMTTLSGKNEQIRFNSFLPFGAHAFVKNQTNNKLTNQGIPAITLCKD
                     PNSFGYLFYLPQTRKVISTMSYILANSEVNGDFIDPNKVLSEIVPDNDDTNEVTSEDA
                     LEIEAEPSNADDITIIEGIENDTQYKIPPNIQEDTVYGLDTININDNQKVSDHTRSST
                     ADEEVKEPTLEQDTSNTSDNHSVHEAHMSTLPKDMPTATSHIDILPDSVAESEPVKNV
                     SDQELLLINRFDNKNSDKFPSTEAMKQRRTKLFLKEFASITRRPLKSRKRELTTLDLE
                     EFEAAEEQKKKIKLRSVQAVNKIRTLYFKTAITNNTDVRERKLFSEAFEKELQNLLKM
                     QVFDTSISIPRNQVPANRIIPLQTIFTVKRDGTHKARIVCRGDKQTEATYSNYHTDLL
                     QIDTLKLFLMIANNRKMWIQTLDINHAFLYADLREEIYVPLPHDRRFVTPLKKALYGL
                     KQSPKEWNEHLKKFLNSIDLDDSRHTPGIFRNHDYSIMIAVYVDDCVIAAKSQELLDE
                     FVSTLRNRFELKIIGKMNQGILRTDVLGMDLDYNIDEGKISLSLQSYIESIENDWLDK
                     ISHIKTTSTPHVSSYEHNIKNIDSMDTKTRSKKINELQKINGVINYIRSRCRYDVEFA
                     ANKLARSVNFPADNVFYMADKLMNYIFQTKSEKLVFTRETTDNPAITLLSDASLGTEH
                     DMKSRMGIMLWYGENLYKVISRASSAVRNSSTEAELDAIYEGSKEAYYLKKILEEMNL
                     QKDPTVISITDSKPSIQYLKNNYNSNRRDRFLDLKLAKLEERIRADDLLIYKIAGTDN
                     IADVLTKPVSCEDFKKLRSSMQNKTDSQRYSYDN"
     gene            <290782..>291330
                     /gene="TPHA0P01410"
                     /locus_tag="TPHA_0P01410"
                     /db_xref="GeneID:11530801"
     mRNA            <290782..>291330
                     /gene="TPHA0P01410"
                     /locus_tag="TPHA_0P01410"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688685.1"
                     /db_xref="GeneID:11530801"
     CDS             290782..291330
                     /gene="TPHA0P01410"
                     /locus_tag="TPHA_0P01410"
                     /inference="similar to DNA sequence:INSDC:YNL310C"
                     /note="similar to Saccharomyces cerevisiae ZIM17
                     (YNL310C); ancestral locus Anc_3.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688733.1"
                     /db_xref="GeneID:11530801"
                     /db_xref="GOA:G8C2C1"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="UniProtKB/TrEMBL:G8C2C1"
                     /translation="MIRGLLVKNFRLMRSRSAGYLLPITSRYNWICSPSLLNRHIHAN
                     ASLCEQSQKPGNKQHLGSIKVEQQKLMLAFTCNKCNTRSSHTISKQAYTSGTVMVQCP
                     GCKNRHLIADHLKIFDDNKVTIEDIMKLKGEKVSKSTEDLCFEDIPKDLKDLLGHHAK
                     DAPENLKKPALHADEIHTLPNK"
     gene            <291789..>293966
                     /gene="TPHA0P01420"
                     /locus_tag="TPHA_0P01420"
                     /db_xref="GeneID:11530802"
     mRNA            <291789..>293966
                     /gene="TPHA0P01420"
                     /locus_tag="TPHA_0P01420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688686.1"
                     /db_xref="GeneID:11530802"
     CDS             291789..293966
                     /gene="TPHA0P01420"
                     /locus_tag="TPHA_0P01420"
                     /inference="similar to DNA sequence:INSDC:YNL311C"
                     /note="similar to Saccharomyces cerevisiae YNL311C;
                     ancestral locus Anc_3.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688734.1"
                     /db_xref="GeneID:11530802"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:G8C2C2"
                     /translation="MRELKLFGKTKYKVLTSLESYRSGNFSGIENHNDDQEVEYPLLH
                     LLSLPKDILITILENVDRAELLTLCLVNSKFYDLISTRFIYTNVILNDKISLLKFNTL
                     IHSEYHIKVANTIENSKSVSQNVRFLVRSIEFVSPQCQDSLYKYSKYYKKENSSLIGG
                     SYFYFNQDQQPRAYKRSSSARRNTKKTSNAELDEYIDNLERKYVHYTYIELMLDIIDF
                     LPNLSHLILSDIEQNFKIPLWYSVFNDGSRDFFKKIINGIQSMNANDLRTYEFSEKFI
                     SDYDSKFYSFKRIKKLELRGALDKREKPIVCLRPNLLCCFGIFNELTLENIIIDKESL
                     DMPFEFVPFHLTTHMDGIYDLHSTIHFLTIKNCNIIPGNGILKLFRDYFKCVNSLELL
                     SITSKYDLILGSCFSALKNLTIDCNSSVFTNEIIVDDDYFYKKDKNEITQQNDMLNNN
                     SVDNNDIETLLEVQVDSSLQTPPPTSGVVISLDLGYIPRNLSTLDTPPLHNLKPAMIT
                     KEQNEFFKRSGIPEFHFFYHYFKDLWERLPYKNININVINIPFTNVYPLNPSIFWEQI
                     LFNSNKDQETLIATRAQEQDQFGEPTYSNRSNYFWMPMVRNCVKESLNSSKVSRELTA
                     EEIEEVIDTVDPDIINNFNNYRYCKDIPNLNLWYFLKSLSKFRSVRIKMLRKWLFCTP
                     RTRYDWEMLLKPVLKVNVPIEVRDKDGFVLYTYGEDLSNIGRS"
     gene            complement(<294189..>294983)
                     /gene="TPHA0P01430"
                     /locus_tag="TPHA_0P01430"
                     /db_xref="GeneID:11530824"
     mRNA            complement(<294189..>294983)
                     /gene="TPHA0P01430"
                     /locus_tag="TPHA_0P01430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688687.1"
                     /db_xref="GeneID:11530824"
     CDS             complement(294189..294983)
                     /gene="TPHA0P01430"
                     /locus_tag="TPHA_0P01430"
                     /inference="similar to DNA sequence:INSDC:YNL312W"
                     /note="similar to Saccharomyces cerevisiae RFA2 (YNL312W);
                     ancestral locus Anc_3.33"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688735.1"
                     /db_xref="GeneID:11530824"
                     /db_xref="GOA:G8C2C3"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014646"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:G8C2C3"
                     /translation="MATYQAYTEFSTGGGFDNSDSRIGSSDGEVKRTNTLTPVTIKQI
                     LESKPLVQDGPFVIHNQELHSICFVGVIRNISDQTQSIFLTIEDGTGQIEVRKWSEDA
                     NDLAAGDEDKNGAQDSQLSKQHEIGSYVIVYGALKEFGGKKNVQYAVIKNIKSFNEVI
                     AHHLEVIKSHAIANGKMKGVGASNDQGQQLFVTEGSDAGAPLQRILDFCKEQCTGKDP
                     NSFAVAIQLMTQTLNLDETVVRECCNTLTEQGYIYPTFDDNSFFAL"
     gene            <295961..>298696
                     /gene="TPHA0P01440"
                     /locus_tag="TPHA_0P01440"
                     /db_xref="GeneID:11530825"
     mRNA            <295961..>298696
                     /gene="TPHA0P01440"
                     /locus_tag="TPHA_0P01440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688688.1"
                     /db_xref="GeneID:11530825"
     CDS             295961..298696
                     /gene="TPHA0P01440"
                     /locus_tag="TPHA_0P01440"
                     /inference="similar to DNA sequence:INSDC:YNL313C"
                     /note="similar to Saccharomyces cerevisiae YNL313C;
                     ancestral locus Anc_3.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688736.1"
                     /db_xref="GeneID:11530825"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8C2C4"
                     /translation="MELVLQAHILLASTIEDDTRYASIDKNYLEISKQILKGQSIDAI
                     KTILNDLNVPKIDLSTVDSSKVGIANALNKLVNENIVGKLQSNMALLLAISLIQTFIQ
                     ENYTGPATEIEINEFIFESIEDQEKLQYALTSILSISGQPAYELTSGPLLLILALFIL
                     EKLTNSCTLFKLSDETTSDPELITIDSQNTSSLTAFAHWWRARALLAQLSLLPETTGD
                     QPAIAASIMNSIELVHAVVKEFPEDVSTEFKKKLYTIYYLENIKCSLSINAEQLFLPS
                     LTKVMKLTDFKFVLTGARAKRTKFQTVAHSGLIILAQSSTSTENSSEENEGTPEAFAL
                     NSELLLEKPVFESIGQEPLDEQIVKKQKLDEEEGLEVEKLLPVAIRQESIPIELQSLD
                     PNNQPQLTEYDNLQLLLRMYTLKQTSPAKDPLVEQELTALVSRILYQDGSKNWSIFSR
                     CLWERSIIETSKAKTIERGLLQMHSLVEDLELQITSRLLPQSSDTSSASPVPRLKFIH
                     QLPFLPRWNLDATLAEKYMSLGILKSAVEIYERLQMSCEAALCYAAVGDEKQAEEIIL
                     KSIEKNPNDARAISILGDIRQDPNLWLKSWEIGKYINAKNSLARYYYNPPTGSGLTRD
                     YGAVLKHLNDSLRQFTLNFETWYFYGCVGLECNKMQLAAEAFSRCVALDDTHSMAWSN
                     LSAANIELGKLKEALSGLKRAIACDAQRNWRIWENYMLVAAKLNEWDDVLIACRQLLN
                     INKDKNGEMAIDIPVVEKLIELLVSTDFPRGEEEKATHFQKSCIEFVCNMLPTVITTS
                     SRSWRLVAKVELWRKRPWAALDCHEKAYRAISHNPDLEIDEKIWNDTVDACEDLVAAY
                     ESLGEMEGRHGEGSLVCKDWKYKARSSIKTLMSKGKDRWDGTDGWDRLLELRSSL"
     gene            complement(<298816..>299691)
                     /gene="TPHA0P01450"
                     /locus_tag="TPHA_0P01450"
                     /db_xref="GeneID:11530826"
     mRNA            complement(<298816..>299691)
                     /gene="TPHA0P01450"
                     /locus_tag="TPHA_0P01450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688689.1"
                     /db_xref="GeneID:11530826"
     CDS             complement(298816..299691)
                     /gene="TPHA0P01450"
                     /locus_tag="TPHA_0P01450"
                     /inference="similar to DNA sequence:INSDC:YNL314W"
                     /note="similar to Saccharomyces cerevisiae DAL82
                     (YNL314W); ancestral locus Anc_3.31"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688737.1"
                     /db_xref="GeneID:11530826"
                     /db_xref="UniProtKB/TrEMBL:G8C2C5"
                     /translation="MTNDSYNLLKLIDEYQPHVKGYPERLQTWELVRKEYNSINNTRY
                     KQSRSLRNKFRNLKEQCRSKDVVNSLPPKALKLLKKLIVEEYQMFDSVFIFPNFADTE
                     NNHTSDMEFDANSKQRQIIPSLSKGREQFPKKITNFSVAPFLEVNSETDDVSDVTLYT
                     EPLDSIQIGHPHTYKTFPKLLSHPTIAVTGSEVGMANLPIFKPRGRLTIDNSIMSVDM
                     NTDHTTKNSSDNKKLCIKKVEAVDKTEDSVNSDHLDLVLKDIKAIKESQEDFQKTVLL
                     ELSIIRKNIEDVLYK"
     gene            <300113..>301123
                     /gene="TPHA0P01460"
                     /locus_tag="TPHA_0P01460"
                     /db_xref="GeneID:11530827"
     mRNA            <300113..>301123
                     /gene="TPHA0P01460"
                     /locus_tag="TPHA_0P01460"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688690.1"
                     /db_xref="GeneID:11530827"
     CDS             300113..301123
                     /gene="TPHA0P01460"
                     /locus_tag="TPHA_0P01460"
                     /inference="similar to DNA sequence:INSDC:YNL315C"
                     /note="similar to Saccharomyces cerevisiae ATP11
                     (YNL315C); ancestral locus Anc_3.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688738.1"
                     /db_xref="GeneID:11530827"
                     /db_xref="GOA:G8C2C6"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="UniProtKB/TrEMBL:G8C2C6"
                     /translation="MLGILKSSTTFRITRPTGVFCSRMSFNISNYSTDAIADRYKSKL
                     LEKAKAQGFNSVEELQESMKEKLQENRKAYDKIDPLKELEKYEQQVQMSKNIMQANKL
                     RKTKNSEGSSRSSASANTNRGSSNVGTSELSDKNAPFKTLASYLELEKVKDLSPQEIE
                     YLWRAKWGQTDGAMNAVVPLETFDKMLVKVKEHPVFVLPLPRANTSGEKDEASEGMEL
                     HYIQWQFPNSQTSHCLMTSLAEYKLHKEFARPHTTLEFHSELGKDKNIVLMNGNVEPS
                     MNISIQEAQLLLLNVQRFYGAMGYDTPSSKQRLQLLKDFTNGSSDFNLDKLIILSQSM
                     EN"
     gene            complement(<301305..>301640)
                     /gene="TPHA0P01470"
                     /locus_tag="TPHA_0P01470"
                     /db_xref="GeneID:11530828"
     mRNA            complement(<301305..>301640)
                     /gene="TPHA0P01470"
                     /locus_tag="TPHA_0P01470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688691.1"
                     /db_xref="GeneID:11530828"
     CDS             complement(301305..301640)
                     /gene="TPHA0P01470"
                     /locus_tag="TPHA_0P01470"
                     /inference="similar to DNA sequence:INSDC:YOL133W"
                     /note="similar to Saccharomyces cerevisiae HRT1 (YOL133W);
                     ancestral locus Anc_3.28"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688739.1"
                     /db_xref="GeneID:11530828"
                     /db_xref="GOA:G8C2C7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:G8C2C7"
                     /translation="MSQIENMEVDVPVNTFSTGDKKKKFEIKKWTAVAFWSWDIAVDN
                     CAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKTRDACPLDNQ
                     PWQLARCGR"
     gene            <302111..>302764
                     /gene="TPHA0P01480"
                     /locus_tag="TPHA_0P01480"
                     /db_xref="GeneID:11530829"
     mRNA            <302111..>302764
                     /gene="TPHA0P01480"
                     /locus_tag="TPHA_0P01480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688692.1"
                     /db_xref="GeneID:11530829"
     CDS             302111..302764
                     /gene="TPHA0P01480"
                     /locus_tag="TPHA_0P01480"
                     /inference="similar to DNA sequence:INSDC:YOL135C"
                     /note="similar to Saccharomyces cerevisiae MED7 (YOL135C);
                     ancestral locus Anc_3.27"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688740.1"
                     /db_xref="GeneID:11530829"
                     /db_xref="GOA:G8C2C8"
                     /db_xref="InterPro:IPR009244"
                     /db_xref="UniProtKB/TrEMBL:G8C2C8"
                     /translation="MSNNDNNDISSLYPPPPPYIKFFTDENVEKLEEYQKGRKRDDVD
                     GGTNGELANEDRLETALDFLIPPPIPTSGQYRVFGSTWQVKDKLPDLESMGLTQLYKK
                     SDQDSSADDQPREVDYQYKIQELRKLLKSLLLNYLELVGILSINPDKFEEKVVNIKTI
                     LVNIHHLLNAYRPHQSRESLIMLLEAQLEYKKGEIEHIKSVCKQVKDKLEEIKSIKV"
     gene            complement(<302996..>304375)
                     /gene="TPHA0P01490"
                     /locus_tag="TPHA_0P01490"
                     /db_xref="GeneID:11530891"
     mRNA            complement(<302996..>304375)
                     /gene="TPHA0P01490"
                     /locus_tag="TPHA_0P01490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688693.1"
                     /db_xref="GeneID:11530891"
     CDS             complement(302996..304375)
                     /gene="TPHA0P01490"
                     /locus_tag="TPHA_0P01490"
                     /inference="similar to DNA sequence:INSDC:YNL317W"
                     /note="similar to Saccharomyces cerevisiae PFS2 (YNL317W);
                     ancestral locus Anc_3.25"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688741.1"
                     /db_xref="GeneID:11530891"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:G8C2C9"
                     /translation="MDGHYHQEPQFQSAVAKKYVSQRRTVDMSSPYTRAYYLKKYGLA
                     TPTIQPETSYVADILPPDVYQSTDRIINVPNKFTHLSSNKVKHVIPAITWTPEGRRLV
                     VATYSGEFSLWSGSSFNFESIMQAHDTSVTAMEYSHAGDWMISGDADGTIKIWQPNFN
                     MVKELDKAHTECIRDIAFSKNDSKFVTCSDDNILKIWNFSNGKQERTLSGHHWDVKSC
                     DWHPEMGLIVSASKDNLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKD
                     KSCRVFDIRYHMKELTVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEP
                     QQVIPYAHDKCITSLSYNPVGHILASAAKDRTIRFWTRARPVDPNAYDDPTYNNNKIN
                     GWFYGINNCINAVREKSEFGAAPPPTDGNDNFSTMSNSTATMSQTSNAINQADDSRLP
                     GFSLPGLGN"
     gene            complement(<304752..>306341)
                     /gene="TPHA0P01500"
                     /locus_tag="TPHA_0P01500"
                     /db_xref="GeneID:11530892"
     mRNA            complement(<304752..>306341)
                     /gene="TPHA0P01500"
                     /locus_tag="TPHA_0P01500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688694.1"
                     /db_xref="GeneID:11530892"
     CDS             complement(304752..306341)
                     /gene="TPHA0P01500"
                     /locus_tag="TPHA_0P01500"
                     /inference="similar to DNA sequence:INSDC:YOL137W"
                     /note="similar to Saccharomyces cerevisiae BSC6 (YOL137W);
                     ancestral locus Anc_3.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688742.1"
                     /db_xref="GeneID:11530892"
                     /db_xref="GOA:G8C2D0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:G8C2D0"
                     /translation="MSDGQLDSTDGHKNADETARIGIDTRSVGDDSISGNDDGDVDSE
                     NFLMLDDPESNEASQDMTGETSETTFSSEFMKDVYWHGSVIKIYPLDYQKVTLIKLQL
                     AACFTIFLVFGMNDQATGSLMPSLTDHYKVSKEVVSRIFISQMTGYTLASFSNHKIHV
                     LLGQRGAFLLGASIAMIFQGVLALKPSSFNIYILSYFPVGFALGILDALCNVLIGSLE
                     VNNNELLGALHGIYGVAAMSTAPIVTYISINHSWNLFFYLPIALALVSIVIAIPAFRY
                     ETPAKYIYSTSISDQEENDTSGTSNFNDRSTEMVDGSYDSSLLTGSASSSLEYLRNPM
                     IILYSVFLFLYLGAEISTASWLYTYLLETKAYERFRMSFVTSCFWSGLTVGRFILSFF
                     TKKYFKNAYRANMHYASLTLVLFTCFVLLGLINSSSLLYSIVIGSVIFATGVFFGPLF
                     PNASLVALQVLPKSLHISGVGTAIALGGCGAAILPYLVGLGINGLGIAFMPLLCWLLV
                     CLQTLVWDLYPSFIKNQEDNL"
     gene            complement(<306713..>309256)
                     /gene="TPHA0P01510"
                     /locus_tag="TPHA_0P01510"
                     /db_xref="GeneID:11530893"
     mRNA            complement(<306713..>309256)
                     /gene="TPHA0P01510"
                     /locus_tag="TPHA_0P01510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688695.1"
                     /db_xref="GeneID:11530893"
     CDS             complement(306713..309256)
                     /gene="TPHA0P01510"
                     /locus_tag="TPHA_0P01510"
                     /inference="similar to DNA sequence:INSDC:YNL321W"
                     /note="similar to Saccharomyces cerevisiae VNX1 (YNL321W);
                     ancestral locus Anc_3.19"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688743.1"
                     /db_xref="GeneID:11530893"
                     /db_xref="GOA:G8C2D1"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:G8C2D1"
                     /translation="MVYTSHSHDSGSPLFTSKSRDKRASKTLYLNTARTSSSLPDLNK
                     LNDSIAPKLDGNEMSIFSNTSTNNHEQASDRIDADYIIEHFHVISEENVGSSVSSSSV
                     DLRGMQSLVNEMHPFGLKLWKPAIYIKKRTIEQTLYQDTHELLNHKISIFAKLSNLMW
                     LCTVGSVLFLVLMIIRTLLLILDIFVMDPLLQRFIDCYKNFAYYLLHPFGKVVYLKDQ
                     RPTKLLIINDRRKEYGSTDNQHRDVGYGAEINNTEQVNFQKSKNFLKSSLRVSTRKES
                     ESFKFPIIEFLNNVIVLNLIRAILYVTSIFLHLCVFPIPLSDILWNVSDTLKEDPLQL
                     EFLPLQDYQQLCSEQNEHTDLRYLYSTLKVAEKYYTKFTYNGINIIISNLLCFAVLTI
                     SNYYILYRYFNIENFITDPILFFIMCLVSMIPLSFYIGQSIVSISAKSSIGLSAVINA
                     FFSSIVEILMYCIALNHHEGLIVEGAIIGSILGSILLLPGSAMCSGAIKKKIQKYNPA
                     SAGITSILLIFSSILICIPSIIDIVYGEYGFECGSAYKTTQRYLSTAMDTCHVIRYEL
                     KYNDFYRHKIVHVSQLSSVILFSAYVIGLWYTLKTHALIVWSFKNSTVSNDIEMEAIA
                     VPENASEVLLAPILNDLEGNRTEQDSQNELNRNQARGKHAHKSRLSLQSETSNWSKRR
                     SIFILLVSTVVYAIIANILIESLDELMQTYSETIHPKLVGLTVIALVPNTTEFVNAIS
                     FAMQGNMPLSMEIGSAYSLQVCLLQIPALVLYSTIKMAVTSDKTSINVRADLFSMVFP
                     IWDIICLLTSNFMFTYIFSEGDSNYFKGSIIIMLYLILIPGFYLQTERT"
     gene            complement(<310090..>311364)
                     /gene="TPHA0P01520"
                     /locus_tag="TPHA_0P01520"
                     /db_xref="GeneID:11530894"
     mRNA            complement(<310090..>311364)
                     /gene="TPHA0P01520"
                     /locus_tag="TPHA_0P01520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688696.1"
                     /db_xref="GeneID:11530894"
     CDS             complement(310090..311364)
                     /gene="TPHA0P01520"
                     /locus_tag="TPHA_0P01520"
                     /inference="similar to DNA sequence:INSDC:YOL140W"
                     /note="similar to Saccharomyces cerevisiae ARG8 (YOL140W);
                     ancestral locus Anc_3.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688744.1"
                     /db_xref="GeneID:11530894"
                     /db_xref="GOA:G8C2D2"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:G8C2D2"
                     /translation="MLKRCFGSQSVQSVSGVGRKAFQVTTYARADDLVISRGVNARLF
                     DDVNGKSYIDFTAGIAVTSIGHSNAGVAGVLAEQSQRLLHSSNLYYNEECLGLSQKLV
                     QLTRQFGGQHDASKVFFCNSGTEANEAALKFAKKYGVSQNKNKQGIVAFKNSFHGRTM
                     GALSATYNSKYREPFGDLVPHFRFLDLNAKLTYLQDYIHQNRDSLAGLIVEPIQGEGG
                     IFPVPTETLLGLKKICSASNVVVIYDEIQCGLGRSGKLWAHSYLPKEAHPDMFTVAKA
                     LGNGFPIAATVVNEKINNALQVGDHGTTFGGNPLGCAVSNYVLEQIANPQFLENVNKK
                     HGLFIERLSKLKQKYPAQINEIRGKGLMIGVEFNESPAEIVKKCRERGLLVITAGKTT
                     VRFVPALTIEDDVISEGLEIFENSVDEILAKK"
     gene            complement(<311917..>314019)
                     /gene="TPHA0P01530"
                     /locus_tag="TPHA_0P01530"
                     /db_xref="GeneID:11530895"
     mRNA            complement(<311917..>314019)
                     /gene="TPHA0P01530"
                     /locus_tag="TPHA_0P01530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688697.1"
                     /db_xref="GeneID:11530895"
     CDS             complement(311917..314019)
                     /gene="TPHA0P01530"
                     /locus_tag="TPHA_0P01530"
                     /inference="similar to DNA sequence:INSDC:YOL141W"
                     /note="similar to Saccharomyces cerevisiae PPM2 (YOL141W);
                     ancestral locus Anc_3.15"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688745.1"
                     /db_xref="GeneID:11530895"
                     /db_xref="GOA:G8C2D3"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:G8C2D3"
                     /translation="MKKVIDETELTPRQKKQLEKLERRKKYADVAIQGTNTSSIASKR
                     SAELLFVPKLDMNRDVNRDLPNRQYFKYFVPKAPKRSPCMNRGYWLRLHGIRTRLQSI
                     LEENANFKKEILVINLGCGFDPLPFQLLDESNLDSIAFNKAFDFLDIDYADLIRNKIR
                     MIEAEPELLKIVGDYKTNIETKSKSPSFISEHYTALSCNLNDAAAYLDILKSNEKIAD
                     PNVIKIFIAEVSLAYMKPEYSDEIISLTSKHSPHSHFITIEQLMQEGENEPFSKQMVK
                     HFKKNDSPLQSIMTYHTIQGQIDRFNSLGYSKVNAGSIAQLWESVSPKLQKQIDDIEL
                     FDELEEFHLVSQHYLLLHATNIEHFEFIEPYKFTAPPAIPAMTCCDATVKSLDTNINR
                     RFGSAVASDKKVGFYFGGANPSRLQESIEVSLDDECNFGTVQGQINVPSPRMCHTLNK
                     INDDQYVLVGGRTAPGQGFDEVYTYRVSTKTWELKEKLRLPEPRYRHCTVNISSTTLL
                     VFGGKSTSSAEFLTLDIQSEAVTPCAITYSAEAAGYHLESLASASMTYDEGTTAVPSS
                     VARTTRQNTVSDKLVTFEVVNGNTVHIKSVVSSSLFQRYGSKTCALDDDEILLVGGTS
                     NARLFNQRTSIVKYNLHTQELASVPISDETWVSKPLCLIGFELLHSKQERRVYILGGG
                     TTCYGFGSITNANMAIDY"
     gene            <314330..>316975
                     /gene="TPHA0P01540"
                     /locus_tag="TPHA_0P01540"
                     /db_xref="GeneID:11530868"
     mRNA            <314330..>316975
                     /gene="TPHA0P01540"
                     /locus_tag="TPHA_0P01540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688698.1"
                     /db_xref="GeneID:11530868"
     CDS             314330..316975
                     /gene="TPHA0P01540"
                     /locus_tag="TPHA_0P01540"
                     /inference="similar to DNA sequence:INSDC:YNL325C"
                     /note="similar to Saccharomyces cerevisiae FIG4 (YNL325C);
                     ancestral locus Anc_3.14"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688746.1"
                     /db_xref="GeneID:11530868"
                     /db_xref="GOA:G8C2D4"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:G8C2D4"
                     /translation="MMPYLNNEGLATHNLPTEGDNVGRSSYLGLNQRHRLNCNFTLSK
                     YTVYGTGERMYVVGSNRRETMFRILEIDLTVPEDKLSVLEDNVFFSRGEVMNILSGLE
                     DAYDNSLNKLVTGYGLLGFIRFTSCYYLIVITECSQVAIIGGHSIFHIDGTEIIPISK
                     NYKKPDKYSNEGKLLTAFQNLDLTKTFYFSYTYDITNTLQTNLLRQKLTAANRGDISI
                     PTGIYDYNEMFMWNQNLLSPLFDCLDTVFDWFQVILHGFIDQVNILISSKSVYVTMVA
                     RRSRHFAGARFLKRGVNKEGYVANEVETEQIVSDMMLTSFHSSREGFFDSDRYTSFVQ
                     HRGSIPLYWTQDSSNLTAKPPIEVNLVDPYYLPAALHFDKLYQRYGGGKISVLNLIKV
                     KEKIPRETKLLTEFETCISYLNKFLPEEKKIKYTSWDMSRASKQDGQHVIEFLEDFSM
                     NTVNTTGIFHNGKDFKSTKIQEGICRSNCIDCLDRTNAAQFIIGKRALGEQLKALGIV
                     QDSFLEYDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWRSHSRDMIES
                     IKRFYSNSFVDAQRQEAINLFLGHYVKNKSSPVVWDTMDDGFLNNDKEQEKKRSYTHW
                     WNIYHIKSLRKLISEEIINKGNDVTLQNIVKNIRGYPDAFDNYWNEYYLPKSISHFQD
                     LFTYNMNSTRHYHQEGNLNKDLSPFKSRKATSINNKLRELRLDSNLAKVDDDTNGNKK
                     ISMEVNKFELDLYEQSYSTVLKDMNNLKATLNQSGNGSNNMPIIFVEVEDAGTATDKD
                     YFNGQESKQDLISSSTDKVHDAGYYDNLSVDKSFYKKIFDIDDYKGLGTYQNTFDVEK
                     VNCKQEDITAFTNYMSFNDKEIIFL"
     gene            complement(<317073..>317786)
                     /gene="TPHA0P01550"
                     /locus_tag="TPHA_0P01550"
                     /db_xref="GeneID:11530869"
     mRNA            complement(<317073..>317786)
                     /gene="TPHA0P01550"
                     /locus_tag="TPHA_0P01550"
                     /product="exosome complex component RRP40"
                     /transcript_id="XM_003688699.1"
                     /db_xref="GeneID:11530869"
     CDS             complement(317073..317786)
                     /gene="TPHA0P01550"
                     /locus_tag="TPHA_0P01550"
                     /inference="similar to DNA sequence:INSDC:YOL142W"
                     /note="similar to Saccharomyces cerevisiae RRP40
                     (YOL142W); ancestral locus Anc_3.13"
                     /codon_start=1
                     /product="exosome complex component RRP40"
                     /protein_id="XP_003688747.1"
                     /db_xref="GeneID:11530869"
                     /db_xref="GOA:G8C2D5"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:G8C2D5"
                     /translation="MSQFIVPGDDFQLDLTKETALGPGMYYDPKTQRVAVVAAGMLNV
                     VETKRGQTVYVDYNTKRYIPAVGDFVIGTITGAYGDRYKVSLSNFSNSVSLSYMAFPN
                     ASKKNRPTLKVGDLAYARICSAEKELEAEIECMDSSTGVDSGFGSLENGMVIETKLPF
                     ARRLLFDNDFPLLQLLAKHTKFEIAIGLNGVVWVKCAEVKNTLACYRSILDCQNAKIE
                     QYKNIIKMHFEQLSNAIEE"
     gene            <318550..>319545
                     /gene="TPHA0P01560"
                     /locus_tag="TPHA_0P01560"
                     /db_xref="GeneID:11530870"
     mRNA            <318550..>319545
                     /gene="TPHA0P01560"
                     /locus_tag="TPHA_0P01560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688700.1"
                     /db_xref="GeneID:11530870"
     CDS             318550..319545
                     /gene="TPHA0P01560"
                     /locus_tag="TPHA_0P01560"
                     /inference="similar to DNA sequence:INSDC:YNL326C"
                     /note="similar to Saccharomyces cerevisiae PFA3 (YNL326C);
                     ancestral locus Anc_3.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688748.1"
                     /db_xref="GeneID:11530870"
                     /db_xref="GOA:G8C2D6"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:G8C2D6"
                     /translation="MPYSWDMSLPFTTLFPRVLTVFIFLSTCWTAFEQINIISNVAKC
                     IIILPILITSLYTYFKVINLGPGSPLDFHDLHINNINDVESSFELPPQFLSQNSLTIK
                     NNGRPRVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN
                     TTYAYVIAILTSKQMYNWFDDGSYENEFVNMYLLFLWILALVVSLALSCFAGFSVYMV
                     MNNKTTIEMYAMRKYRDDLELYNRNPNRVPSVENIFDLGSKKENWEDIMGHSFIEWLL
                     PISTFHSLLMKNTLDEKGLYFKVNERVHQRLLDSANIQDQLLRRVTPGSSFDING"
     gene            complement(<319887..>323066)
                     /gene="TPHA0P01570"
                     /locus_tag="TPHA_0P01570"
                     /db_xref="GeneID:11530871"
     mRNA            complement(<319887..>323066)
                     /gene="TPHA0P01570"
                     /locus_tag="TPHA_0P01570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688701.1"
                     /db_xref="GeneID:11530871"
     CDS             complement(319887..323066)
                     /gene="TPHA0P01570"
                     /locus_tag="TPHA_0P01570"
                     /inference="similar to DNA sequence:INSDC:YNL327W"
                     /note="similar to Saccharomyces cerevisiae EGT2 (YNL327W);
                     ancestral locus Anc_3.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688749.1"
                     /db_xref="GeneID:11530871"
                     /db_xref="UniProtKB/TrEMBL:G8C2D7"
                     /translation="MISIQYLLINIVSILSLASAASNAYFSDVQLMDKYTNTNNCTDV
                     NHWFLIEAELFASKGQKDDIYLTVPTEFGALPSAFDLLHNDKVIGAVTSNSSNILTVS
                     FSDSNAANLTTSFNFLVQLTNSSKSAIEHPQTIEYTFDVSTGSSFNNEINYLAKDVSA
                     FSSNGGIYKENSTAWFTVDIPVSALSNSLFVEAMPEKNGDFTYNTDLTEFEIVIEIDN
                     FNNPIKSIPFTTARDLSDESTIRVLFSTNISGGKYLRMNFYSNKLKSETITNLVTFAN
                     TSSRSLSKRHEMFVIPSKLHSRSLANVFVSKDSTEVSGTESDYIPSSYLYSNVSSSVT
                     YNSVEDITSLDYETSSLDLQTSFIEDDASSSSMESFVNTEVASSYSIEQSNAVSEYSS
                     YGVEQSSSPEDEGTLTEEYESSRSSEAATSESSENYETSESDDIIETVSESLSTYEST
                     PSSSEIVVMSSSANETTSSIQTIGIDAELLTLAGSCSMYSSVVTSTVVDSTTFSSVMT
                     TISASTRSSTSSSSSTSSTTPATPSSTIAELSTTSKSSSISSTKTLSSASEYSVALSS
                     ASTTSTESILTISLLSSNFDSTSTNAKAAGELTSTIVTTTINGEVTTFTTFLAVSTLS
                     SSDITDNTSSFSVPEIKSTEVAIYSNSTSFAPEIITSSDVEMVATLLTTTIDGVVSSY
                     TTYYAISTLNPSQTENVDANARSQTTSTVTNSSSIYSVSSATSPAVTTSDDIIYSQTV
                     ITTTFEGSLTTYTTFYPVSTIYANTSSISTTSRSSTSNDNVSLSVVTQTVDGMKTSYI
                     TTCPLSKSTSHTKNIDAEDLSQQTDTVSGYTVITSTISGKVTKFTSWYAVSTISSSGT
                     LVKSKSTSSVIAFTAYSATVITTTIDDTLTTKTTSVPYTTISATDFTTLSQELGYNAT
                     LHSTTLKNSNSKTISLAADLKTTTSSTSATSKQSSTLKTTSSSSDFSTLNSIKESSLS
                     VPTSILSLTSSTVYGSNTESLTTTSTVRVTLAPGVDQVSSILGQTSLITSISTGNSTQ
                     EIISQYEDSANIIKSNLSSLIVLLIAAFI"
     gene            <324418..>327516
                     /gene="TPHA0P01580"
                     /locus_tag="TPHA_0P01580"
                     /db_xref="GeneID:11530872"
     mRNA            <324418..>327516
                     /gene="TPHA0P01580"
                     /locus_tag="TPHA_0P01580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688702.1"
                     /db_xref="GeneID:11530872"
     CDS             324418..327516
                     /gene="TPHA0P01580"
                     /locus_tag="TPHA_0P01580"
                     /inference="similar to DNA sequence:INSDC:YNL329C"
                     /note="similar to Saccharomyces cerevisiae PEX6 (YNL329C);
                     ancestral locus Anc_3.9"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688750.1"
                     /db_xref="GeneID:11530872"
                     /db_xref="GOA:G8C2D8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C2D8"
                     /translation="MSNLQFQDGSFIRVIFDHKQTSRGFEISADLQLLWDEFKSRTDK
                     ERYAKVTIPRYNNRKPLVKIGNCVVNEALPIGTVSLSASLYNVSLYVPQITVCKFKPV
                     SSPQTLESITFLLNSELYDKVIGSLTKSEVIEFVLRKFNILVGTTPLENEENLSKCIC
                     KVINTRPCNIGLINLDETQISIVRDDSGLLQDSMISTVIKIPKSTVSLKCLKYPVAKE
                     LLPGFLEPDENLTTDEDDDLYAFAGFKLFEEAGITDGSRVTVYNDHHSMILKLFVLRQ
                     PNNLLQSTLYVHPRVFANFQISTYVNILKYSLDRKHIPVATSVSIARVGNYIQTQRKY
                     EEIILSNLKHYLTSKIRILRKDELIPIAFDSKYTPLLIPELDNNITGKYYDKLVWFSI
                     ESISFQENGDIGNLDSDQRLFTIDPLKTKLVTENIVSKNPLIINNESYISYFGLNSNF
                     KYDYNIFTYANKLKDILNVSQNCIERKLAINTKILLYSLTPGTGKSTLVNSLALDLGF
                     ELLEMDCMNLINSNLVGSLSSVSKTVGFLKAKFESFLNYSLPAIIFLTHIDILLQKGD
                     PNQESQSANAYQIMDIEFSSLLNILQKQFPSTIFIFSTNSLDSLPRNFISKINFEIEV
                     QVPQESERREIFKWYLSSDQINKIKLEELEFKVSNNLNLNNIALKSAGLLPADLKYVI
                     DNSKHRAFERFTSSVRDDCVLIDVNDIDSAINDVRGEYAVSIGAPKIPKVTWDDIGGV
                     DMVKGEIMDTIDMPMKYPELFASGMKKRSGILFYGPPGTGKTLMAKAIATNFSLNFFS
                     VKGPELLNMYIGESEANVRRVFQKARDAKPCVIFFDELDSVAPKRGNQGDSGGVMDRI
                     VSQLLAELDGMGTNGDGVYVIGATNRPDLLDEALLRPGRFDKLLYLGIPDTNEKQLNI
                     LQALTRTFKLSSECDLKKIAELSPFNYSGADFYGLCSDAMLNAMTRTASEVDKKLDQY
                     NAVNVEKISLRYWFDNIAQEEDLEVVVKLSDFVKAQRQLVPSVSEEELKHYVRVKAQF
                     ES"
     gene            <328049..>331282
                     /gene="TPHA0P01590"
                     /locus_tag="TPHA_0P01590"
                     /db_xref="GeneID:11530775"
     mRNA            <328049..>331282
                     /gene="TPHA0P01590"
                     /locus_tag="TPHA_0P01590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688703.1"
                     /db_xref="GeneID:11530775"
     CDS             328049..331282
                     /gene="TPHA0P01590"
                     /locus_tag="TPHA_0P01590"
                     /inference="similar to DNA sequence:INSDC:YOL145C"
                     /note="similar to Saccharomyces cerevisiae CTR9 (YOL145C);
                     ancestral locus Anc_3.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688751.1"
                     /db_xref="GeneID:11530775"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:G8C2D9"
                     /translation="MESESLTSYPSMQWSTALDIPLKASEEVVSIDLETDLPDDPSDL
                     RTLLVEESSDKEHWLTIALAYCHQGKVTDGIKLIEMALEAFRNTDKAPLHTFLTWAHL
                     DLAKGTFTNSEAKQYELNQAEYHLKEAINYDPSTVSNMLATIDLYYQRGQYDKALETS
                     DIFIKGIAAEDRRNGRTTKTNCLFLLLRAKILYQKKNYSASLRFFQELLVLNPVLKPD
                     PRIGIGMCFWQLKDHSMAVKSWSRAKEIDPENKTASILVLLGDFHNSLTNSENDEQFK
                     KQYSEAILNLENLYSGNKSNPVILTLLQSYFYFKGEYQSVIDIYEKKIMGMSSITANT
                     ILSEASFWCARSYYALNDYRKAFTMFQESLKKSEDNLLSKFGLGQTQIKNDLLEEGIL
                     TFENIYKSHENIQELNYILGLLYARKCLDTKTEYSHKEHTKLISKAVQFLEKYISLTT
                     SKKNQLVIPKAFLILSQLYELQVQYKQALDILCRYLDDLKISNEKNIPIELLNNIGCF
                     YFITGQKEKSLEFFNMAKEKLDLAGNDDSLEITLQYNIARSSEEDLAATNIVYSDILS
                     KHPSYVHLKVRYLFTKFLQNKNSQSDEIEKEVNDLLQRNPADLEVRALYTWFMKNGLK
                     NSNNIDEAKYKEYRNSEISTSKDTLTKYNSHDLYALISLGNFYCVMAKENKKTPAKCE
                     QSYLKGIQLYQKALQIDPYNIFAAQGIAIIFAESKRLGAALEIWRKIRDSLDTEDVHM
                     NISHCLLEMREYVKAIEGYELILKKFPNYSKLAKVYNLLGKTWYERGNKENSLSCYKK
                     ALQNAETSLKLEIESSNDLENSPKIASYKFNTVLLHFQIAEVVRRSGSKDRTVEDISS
                     ALTGLENALVLLKELKDKSYKFIVKDEIEQRIQLGETTMKNALQRSLKEQEEYELQQT
                     GRLEQARKLIEENELKEKNRIEKEKELEQMKIAKQKEEFAKLQEEAQKIIQERDLAIV
                     EESDNDKDLNSADEDGEFVDKEKPKREKKSKKKTSKRKADVLDDDEEVTIIRKRERNG
                     KASTLSAEYIENSSASSDGALSDVGENKFDSEEAEAKVTDEEHEDLF"
     gene            complement(<331525..>332151)
                     /gene="TPHA0P01600"
                     /locus_tag="TPHA_0P01600"
                     /db_xref="GeneID:11530776"
     mRNA            complement(<331525..>332151)
                     /gene="TPHA0P01600"
                     /locus_tag="TPHA_0P01600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688704.1"
                     /db_xref="GeneID:11530776"
     CDS             complement(331525..332151)
                     /gene="TPHA0P01600"
                     /locus_tag="TPHA_0P01600"
                     /inference="similar to DNA sequence:INSDC:YOL149W"
                     /note="similar to Saccharomyces cerevisiae DCP1 (YOL149W);
                     ancestral locus Anc_3.1"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688752.1"
                     /db_xref="GeneID:11530776"
                     /db_xref="InterPro:IPR010334"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:G8C2E0"
                     /translation="MGNNNTGKDDVENSESTDVMTMEFYRKALNFNVIGRYDPKIKQL
                     LFHTPHASVYQWDFEKDEWNKLEYQGVLAIYLRDISQDSMLPDNVESNSLLNSDNPAS
                     TFSGTVLTGKDIYNYGLIILNRMNLDNFSMGIVPNSIINKRNIFDSEENKKNPLETMG
                     VEVKDDLVIIKNVKHEVFGIWIHTVADRENIYELIKYLLENSPKDSFT"
     gene            <334180..>335232
                     /gene="TPHA0P01610"
                     /locus_tag="TPHA_0P01610"
                     /db_xref="GeneID:11530777"
     mRNA            <334180..>335232
                     /gene="TPHA0P01610"
                     /locus_tag="TPHA_0P01610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688705.1"
                     /db_xref="GeneID:11530777"
     CDS             334180..335232
                     /gene="TPHA0P01610"
                     /locus_tag="TPHA_0P01610"
                     /inference="similar to DNA sequence:INSDC:YMR315W"
                     /note="similar to Saccharomyces cerevisiae YMR315W;
                     ancestral locus Anc_3.0"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688753.1"
                     /db_xref="GeneID:11530777"
                     /db_xref="GOA:G8C2E1"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C2E1"
                     /translation="MSPILKVGVVGTGIFATDRHLPSYQEMSDNFKVVAAYNRTKAKA
                     LIFAEKAGLPDNKVYDDLDQILNDKDVDYIDALLPVQFNVSTLQKAIAAGKPILMEKP
                     IAATMEQARKMVQLADSTDLPVGIAENWLYLQVIEPAKEQLKRIGEVVGFTHNSTGPF
                     VQDNKYLATTWRQNPEHIGGFLSDGGVHQLALVTDILGEFDTISALTSQVREVSGADD
                     IVFSTVRLRNKKTIGTFTYGSAFGASEKSVFLKIYGTKGSMVIDLSNKTKPVIKIRVG
                     DSAESASAEEVIEVNVEESFGVNPEFLNFHEAVAKKDKTLFKSSPRAAFHHLACVAAF
                     LESSATNGDHVTVERI"
     gene            complement(<335482..>337323)
                     /gene="TPHA0P01620"
                     /locus_tag="TPHA_0P01620"
                     /db_xref="GeneID:11530778"
     mRNA            complement(<335482..>337323)
                     /gene="TPHA0P01620"
                     /locus_tag="TPHA_0P01620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688706.1"
                     /db_xref="GeneID:11530778"
     CDS             complement(335482..337323)
                     /gene="TPHA0P01620"
                     /locus_tag="TPHA_0P01620"
                     /inference="similar to DNA sequence:INSDC:YDL229W,YNL209W"
                     /note="similar to Saccharomyces cerevisiae SSB1 (YDL229W)
                     and SSB2 (YNL209W); ancestral locus Anc_2.41"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688754.1"
                     /db_xref="GeneID:11530778"
                     /db_xref="GOA:G8C2E2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:G8C2E2"
                     /translation="MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDEDAVQEDMKTWPFKVIDAQGA
                     PMIEVEYLGENKTFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQAT
                     KDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGG
                     VFTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGSDISNDARALRRLRTAAERAKRT
                     LSSVTQTTVEVDSLFDGEDFEASLTRARFEDLNAALFKSTLTPVEQVLKDAKISKSQI
                     DEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDET
                     KDLLLLDVAPLSLGVGMQGDIFGIVVPRNTTVPTIKRRTFTTVGDNQTTVQFPVYQGE
                     RVNCKENTLLGEFDLKGVPPMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSSNITIS
                     NAVGRLSTEDIEKMVNQAEEFKAADEAFAKRHEARQRLESYVASIEQTVTDPVLSAKL
                     KRGSKVKIENALSEAMAALAIEDSSTDDLRKAEVGLKRVVTKAMSSR"
     gene            <339223..>342579
                     /gene="TPHA0P01630"
                     /locus_tag="TPHA_0P01630"
                     /db_xref="GeneID:11530779"
     mRNA            <339223..>342579
                     /gene="TPHA0P01630"
                     /locus_tag="TPHA_0P01630"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688707.1"
                     /db_xref="GeneID:11530779"
     CDS             339223..342579
                     /gene="TPHA0P01630"
                     /locus_tag="TPHA_0P01630"
                     /inference="similar to DNA sequence:INSDC:YDL231C"
                     /note="similar to Saccharomyces cerevisiae BRE4 (YDL231C);
                     ancestral locus Anc_2.38"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688755.1"
                     /db_xref="GeneID:11530779"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:G8C2E3"
                     /translation="MDRLSELKDGSPHPNINNSNNNNNNNKNVDVLRGSYSHTSFLSL
                     SDAQKSGTYTSAEKSHINQELRSRHLNKSCSFMRLENLSQSKNWGEEHLDDFALEELR
                     DEFFDSIYSKPEMINNDQYKKDDGISYTTKKVDSKESRISLFLKKSISSPTQYFNDFM
                     TYKKSIFKYFSAYFIAMVICVIRPSGEWIGHKYRYFMLLAALIHHPVRNIGVQLEITL
                     CSILGGALGMGWSSLAWYISTLSKPVADYQGAILFASLFLALTFSVWIAAIFQRFLYF
                     CKTFSIAIIFFHTAELSFSKEKLHWKLYWDFGFSFLFGLLLSLVICTFVFPTSGNQEV
                     IHTYSLCFKKSEQFLVSLVDLNSDDSDENIDIKQKEMVNFLIVTLPEAFREFSNQVTF
                     SKFDQNNLKDLRNSITKFISPLRVLPIHSKLFTKDNVKELYATLKLPQTNEGDIEEFE
                     DDSMSPTPMTFSDGVTPVPKPLNLEAGTYNAFDRELYLELLRDIFAEPAYSLVSEMIY
                     SLEQIGILFKDFENIGKKVDTLTIDKKLTVLQKKLKRRIYNLDVKYKNFTHTDHFSKD
                     LLTDTSSVALFLFLRTLRNSAKNLLDVIHSCSKLSSGIHWRIRLITYPFRRAIYRLPI
                     QCTIDEGAGNVLNYFETKRDVDEIFEKLYNVHTSSHNYDIKMNNSSSKRVFREYDRDD
                     FNFHTTSNKWRLLLWKCSKLLVDDYMKWALKKVFVIVFLSLPSWLPRSYGWYQEYQCW
                     WAPMSFYLLSHRKYSGSWDKLIRRIIFCLLGIFWGWAAAQARHFGSPYVICTFAGILV
                     VPISLNIFAYKNTRSSFTTMLCFSVIVMESYGKGQSSLNTAGIWKNTWVTGLSLFVGT
                     LISIPINWIVWSFKARSELRVAISVLLGHISQSYQLVTDRYLYRDSSDAPTELAIALS
                     HIREIRLSQSIVAIKELLEKSKEEPIYIANFEPVKYTQILDQCNYLIERIIEARISST
                     YFEVWDRDADPEITRALLSLRRDSVASVILVLYILSNCFRSKNKIPRYLPNPILSRKK
                     LYEFIQKFENRELSKNTNERHISSNNINMLDKKLLSNSSIDKNVNHETEKSHWTEIHR
                     VAFERTFTDISAILPEIAIKAKEILGEESY"
     gene            <343337..>343603
                     /gene="TPHA0P01640"
                     /locus_tag="TPHA_0P01640"
                     /db_xref="GeneID:11530757"
     mRNA            <343337..>343603
                     /gene="TPHA0P01640"
                     /locus_tag="TPHA_0P01640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688708.1"
                     /db_xref="GeneID:11530757"
     CDS             343337..343603
                     /gene="TPHA0P01640"
                     /locus_tag="TPHA_0P01640"
                     /inference="similar to DNA sequence:INSDC:YNL211C"
                     /note="similar to Saccharomyces cerevisiae YNL211C;
                     ancestral locus Anc_2.36"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688756.1"
                     /db_xref="GeneID:11530757"
                     /db_xref="InterPro:IPR020301"
                     /db_xref="UniProtKB/TrEMBL:G8C2E4"
                     /translation="MKFGNPFVFEEWLYRSLLNSKNFHSFVRRVYNRVNGIKNEPITF
                     SKPQAQDFLYKPTNYQKFIAFKKLFIQDVKSSMGISTKHNNFKN"
     gene            complement(<343892..>344617)
                     /gene="TPHA0P01650"
                     /locus_tag="TPHA_0P01650"
                     /db_xref="GeneID:11530758"
     mRNA            complement(<343892..>344617)
                     /gene="TPHA0P01650"
                     /locus_tag="TPHA_0P01650"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688709.1"
                     /db_xref="GeneID:11530758"
     CDS             complement(343892..344617)
                     /gene="TPHA0P01650"
                     /locus_tag="TPHA_0P01650"
                     /inference="similar to DNA sequence:INSDC:YNL212W"
                     /note="similar to Saccharomyces cerevisiae VID27
                     (YNL212W); ancestral locus Anc_2.35"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688757.1"
                     /db_xref="GeneID:11530758"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="UniProtKB/TrEMBL:G8C2E5"
                     /translation="MNIVKSLIVNTARQELVTVPTGRFDLLRSKTSPKSSLECIYNRA
                     CVTIAEVGFCTHELIVVKLEEYLEDDDINGSDDFTDDAISVLSTQSKMKDEQWTFRIN
                     EKLGFHKKWNTQGEMVLTWNNTLGDEEDEMVQFAVNSDTLLNEIENFIQIFYRCVYLS
                     ICKKDNVSITYDNINDMEKLSIENYKEKQEEVELEEYWQDDNRNGDANKINDHYENGM
                     GLDDHDDIYFDASDYPEIIINET"
     gene            complement(<345369..>347477)
                     /gene="TPHA0P01660"
                     /locus_tag="TPHA_0P01660"
                     /db_xref="GeneID:11530759"
     mRNA            complement(<345369..>347477)
                     /gene="TPHA0P01660"
                     /locus_tag="TPHA_0P01660"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688710.1"
                     /db_xref="GeneID:11530759"
     CDS             complement(345369..347477)
                     /gene="TPHA0P01660"
                     /locus_tag="TPHA_0P01660"
                     /inference="similar to DNA sequence:INSDC:YDL233W"
                     /note="similar to Saccharomyces cerevisiae YDL233W;
                     ancestral locus Anc_2.32"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688758.1"
                     /db_xref="GeneID:11530759"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="UniProtKB/TrEMBL:G8C2E6"
                     /translation="MAGRMYNNSSPAKTPAGNNGTPNDSGNMGNQDQMHGFDRNRNQS
                     TGPMKQNMNLNQMQQRQQFVNYFKSMQNMMMNQQLPAGVMNNNMAGQVPPQQQQPTLD
                     TAGTPSNMPPNMQAAQHQYLQQRQTQMEQALNTQFKEKAKFMMARQQQQQQQQQQQQQ
                     QQQQSQQQQLQLQLQLQLQQQQQQQQQQQQQQQQQQQQQQQQQQPKQLSIKKKDSINQ
                     NNARFSRPTTPVSYVPVSYNINQNMNINANMNSRIPNVIPVDKVPIEKNIPNNIEQSS
                     PSLPQVMTLNSTVNSNKSYIDPTSQINLNNTSDLGGQQTLSYPIRKYIANIASMKVYA
                     FFDAINSSSNHSDVLSYWKDKVQKFFSANSTIKFINKHKEIAHQVSLSSSLFPLYNVM
                     LSNCDIVRVEVTTTQLRTQVLSNGNIYFNCPHLYITHHYLDGSYVMHLAQLKGLFDPS
                     FKFDWIEISYHNFVPGIEWNSLERLINDPKAASKVFGSMKFADTKKEELRTDGPVDSK
                     PVNIETIQNLRSSFIAFQSITQTGLPVEAMKGIQLGDAMTSLSSLMMFRKIQNIKSPT
                     EALKKYVSVKSKDKHTVGVSSNNNNVSNHNNINGIQQHTRSIGSYIQQKFKSEGKKRK
                     KNPEPNINSTNYVNMTARYGNTSIGSQKLSSVSQKSSPKRRRTSGISPYSTLNLNLSE
                     ESDITALMDGEPTNDNVKKT"
     gene            <348307..>350580
                     /gene="TPHA0P01670"
                     /locus_tag="TPHA_0P01670"
                     /db_xref="GeneID:11530760"
     mRNA            <348307..>350580
                     /gene="TPHA0P01670"
                     /locus_tag="TPHA_0P01670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688711.1"
                     /db_xref="GeneID:11530760"
     CDS             348307..350580
                     /gene="TPHA0P01670"
                     /locus_tag="TPHA_0P01670"
                     /inference="similar to DNA sequence:INSDC:YDL234C"
                     /note="similar to Saccharomyces cerevisiae GYP7 (YDL234C);
                     ancestral locus Anc_2.30"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688759.1"
                     /db_xref="GeneID:11530760"
                     /db_xref="GOA:G8C2E7"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:G8C2E7"
                     /translation="MNNQLVFCKSKVCIHPSTNASNNIAGYLLITKQNNVGNVDPMLQ
                     YVTEDGLDSKHRIWLDEAEMKLSNGFTKDVRMPQDLLFSAISMPYSFAVKLNSLYSIQ
                     LRLPSPNKWWFGSVILHSKSPQEDETLPILFFHDDVCRSTIAKQKKLNKSFDPFNSTG
                     EIYWGGSDLKDAISKYVDLQQTIIEPTIWLVNATLDDLRNFSTNVSLLEAQGKSNVSA
                     NDGDDKSTFWDKMDSTKWNVMSRIADATSATGSFVSSMIRKHPIVQLAERNKNNVYVK
                     KLLNNPRVKEIQDDYDSATIYLAKWAQGVKEQSDKFNLLNETSESYRKILNNELGMGN
                     GDNDISFSDFELNKALERSFPLTQQKWNSFFDSQGRINITINEIKDFIFHGGIESIEL
                     RKTVWLYLLGVYPWDSSYDEKLQIEQTLRNIYNTEYKSKWLNRVPNSDPEEEEYWHDQ
                     IFRIEKDVRRNDRNIDIYKYNTPDGKNPPQNETADNEMDEDENTNLSDSTNSDSKSEI
                     LNPHLLALKNILISYNVLNTNLGYVQGMTDLLSIIYYIVRDEELAFWCFVNFMERMER
                     NFLRDQSGIRDQMYTLAELCQIMLPQLSKHLSDCDSSNLFFCFRMILVWFKREFDLES
                     VCSIWEILLTDYYSSQFQLFFMLAILQKNNDTVVQNLTQFDQVLKFFNDINGTLDWSD
                     LMTRSELLFIRFKKMMDLMERNKELQDDKLLPMYTNEDANESNSELKKSDYHLQLLLS
                     KQIVIQREEERTKDSIK"
     gene            complement(<350606..>352414)
                     /gene="TPHA0P01680"
                     /locus_tag="TPHA_0P01680"
                     /db_xref="GeneID:11530761"
     mRNA            complement(<350606..>352414)
                     /gene="TPHA0P01680"
                     /locus_tag="TPHA_0P01680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688712.1"
                     /db_xref="GeneID:11530761"
     CDS             complement(350606..352414)
                     /gene="TPHA0P01680"
                     /locus_tag="TPHA_0P01680"
                     /inference="similar to DNA sequence:INSDC:YNL218W"
                     /note="similar to Saccharomyces cerevisiae MGS1 (YNL218W);
                     ancestral locus Anc_2.26"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688760.1"
                     /db_xref="GeneID:11530761"
                     /db_xref="GOA:G8C2E8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR021886"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:G8C2E8"
                     /translation="MSSKKNVKSEQLISCPVCNKKIKYSIINAHLDKCTDKFNSGNDD
                     SKEKNSVMSILGGFKSRKRVAEVDVVDLEKTSSTNETTMVKEEVSPHESAKKLQIGAV
                     TKQNYVSNSPHLSTEYESKRLQKISHLPLSEKLRPHELKDYVGQQHLMSKESGILARY
                     ITEGQIPSMILWGPPGVGKTTLARIITKAASESNPDSKTSYQLVEVSATKTNSQELRS
                     IFEKSRNEYKLTKRRIVLFIDELHRFNKAQQDLLLPHIENGDIILIGATTENPSFQMN
                     NALISRCNVFVLEKLSTNEICIVLSRGVALLNKCRKLLWHTTNPLKLSRMVLEYIVNL
                     CVGDTRKALNILEMIELSTRDVSIELTVDSIKDIMRQNTSESGVNSYYDRNGDNHYDT
                     ISALHKAVRGGDANAALLYLGRMLQGGEDPLYIARRMIRMASEDIGVADSSLLTLAVS
                     THDAVMKIGLPECDVILAHCCVELARAKKSVEVYRAYNKVKTMLKENTYSLASSEIPM
                     HIRNAPTKLMKELGYHKGYKYNPDFIDGKVKQEYFPTEVLDQCLDKKELNFLTGEHLG
                     SRYDNDLVDNDEVKKKRIYNGISYHQSDLFKCLNDI"
     gene            <353025..>354719
                     /gene="TPHA0P01690"
                     /locus_tag="TPHA_0P01690"
                     /db_xref="GeneID:11530785"
     mRNA            <353025..>354719
                     /gene="TPHA0P01690"
                     /locus_tag="TPHA_0P01690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688713.1"
                     /db_xref="GeneID:11530785"
     CDS             353025..354719
                     /gene="TPHA0P01690"
                     /locus_tag="TPHA_0P01690"
                     /inference="similar to DNA sequence:INSDC:YNL219C"
                     /note="similar to Saccharomyces cerevisiae ALG9 (YNL219C);
                     ancestral locus Anc_2.24"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688761.1"
                     /db_xref="GeneID:11530785"
                     /db_xref="GOA:G8C2E9"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:G8C2E9"
                     /translation="MRVITVLLVTALAISRLYVQPWFSIISDCDETFNYWEPLNLLLR
                     GFGKQTWEYSPAYAIRSWAFLLPFYGVLYPIKKFELIGQDGTMYFYIIRAFLGLLSFL
                     FEFDLFKEIQSTISLRIADMWLFIQLFNPGWFHASVEFLPSSIAMIFYLGSIKYSLRY
                     LSSNRKSCLVSSLGFNFTAAILGWPFVLVLSVPLCLHFLLTHRLMSTIRVSFDCLVIF
                     LTIASIVIGIDSSFYGKFSPVSWNILSYNVLEADESSGPNIFGIEPWYYYLLNLLLNF
                     PLPVLGGVLFGIFNWRLWPLSSSLLLWLVIFTLQLHKEERFLYPIYGLISLSSAVGLY
                     QLVTIFSGRKKVLKRMFSFIILLGILLQASSRIIALLKNYSAPFETYSKLYEKIDSDK
                     HTNDIINVCTGREWYHFPNSFFLPDNYRLRFVKSGFDGLLPGDFDESNSSIFQKVRKL
                     PENMNNKNIFDPNKIWDAENCDYFIDLMISTDIEQDVLNPNSLSAEWSKVSCSEFIDV
                     DNSKIFGRAFYIPEPILNILSKFITPSINKCYGVNYIDYCLFEKDDNIVMEESANV"
     gene            complement(<354895..>356094)
                     /gene="TPHA0P01700"
                     /locus_tag="TPHA_0P01700"
                     /db_xref="GeneID:11530786"
     mRNA            complement(<354895..>356094)
                     /gene="TPHA0P01700"
                     /locus_tag="TPHA_0P01700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688714.1"
                     /db_xref="GeneID:11530786"
     CDS             complement(354895..356094)
                     /gene="TPHA0P01700"
                     /locus_tag="TPHA_0P01700"
                     /inference="similar to DNA sequence:INSDC:YDL237W"
                     /note="similar to Saccharomyces cerevisiae YDL237W;
                     ancestral locus Anc_2.21"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688762.1"
                     /db_xref="GeneID:11530786"
                     /db_xref="GOA:G8C2F0"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:G8C2F0"
                     /translation="MRHCSRELLKVFTNVTLLLCIIIFTVVKFWDIDTKHFEIDDKLA
                     LNDALHQYRYLIDNQIQNIELVNYYKNIEHSNKKLMNYLAYASSETNNTMISFLNKNV
                     KPNTFHSHNDYTRQMPLFEALSLGLTSIEADVWLGTDNQRLSVAHRETDLLNYPLRDL
                     NDLYTEPLLTMLNDVNEIYEHFDYNSNTTTIAKKGLYHESENRTMFLVIDFKSEDSSQ
                     TYTRLMDTYLKPFIENDFITFFNITSNEMSWRPITVILTGNKPTDLSIIDKDSETDKI
                     GYLGDSKRYVFPEQMLDNLTNLDESSKTFVASTSFSKLCMACDISPWKVILRGKLPAR
                     GLRCFKKFIDDAHANNLKTRIWGVPKSLLGFSKNFWRQQIDDLGVDFINVDHLSRVLS
                     YPNYDHN"
     gene            complement(<357242..>358312)
                     /gene="TPHA0P01710"
                     /locus_tag="TPHA_0P01710"
                     /db_xref="GeneID:11530787"
     mRNA            complement(<357242..>358312)
                     /gene="TPHA0P01710"
                     /locus_tag="TPHA_0P01710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688715.1"
                     /db_xref="GeneID:11530787"
     CDS             complement(357242..358312)
                     /gene="TPHA0P01710"
                     /locus_tag="TPHA_0P01710"
                     /inference="similar to DNA sequence:INSDC:YNL223W"
                     /note="similar to Saccharomyces cerevisiae ATG4 (YNL223W);
                     ancestral locus Anc_2.18"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688763.1"
                     /db_xref="GeneID:11530787"
                     /db_xref="GOA:G8C2F1"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="UniProtKB/TrEMBL:G8C2F1"
                     /translation="MAQNDDTVGVVKYSVLGDVYVVDNDLHKKEFENAVSRLIQMTYR
                     TRFEPIVKDDDGPSPLNIKNLLRDNFYNSIENLLFNSHCFTSDIGWGCMIRTGQTLLA
                     NALQRTNKGTPCSEIIELFVDETKNPFSIHNFITVGKDLNLVKVGEWFSPSITIQIIE
                     KLIENNNDHGIKKCIVSISSGDIYEQDVLDELDDSEPPANTKQQHILLLFGIKLGINT
                     INIEKYGQDIKDITNNKYTCGISGGQPKSSLFFFGYNNTHDRILYFDPHKPNNFTTDN
                     DYSTYHSTEFNELEMFNLDPSMIIGFLVKNNKADWNKFKSTIKHSNIIKVLSGKRTDA
                     DSSSYKITKCTSIEDDEEYIIV"
     gene            <358767..>361109
                     /gene="TPHA0P01730"
                     /locus_tag="TPHA_0P01730"
                     /db_xref="GeneID:11530788"
     mRNA            <358767..>361109
                     /gene="TPHA0P01730"
                     /locus_tag="TPHA_0P01730"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688716.1"
                     /db_xref="GeneID:11530788"
     CDS             358767..361109
                     /gene="TPHA0P01730"
                     /locus_tag="TPHA_0P01730"
                     /inference="similar to DNA sequence:INSDC:YNL224C"
                     /note="similar to Saccharomyces cerevisiae SQS1 (YNL224C);
                     ancestral locus Anc_2.17"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688764.1"
                     /db_xref="GeneID:11530788"
                     /db_xref="GOA:G8C2F2"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:G8C2F2"
                     /translation="MAKRHKHYDNRHKKSKKKSGGKPSGKVKSTASHGKKKTTAGRGD
                     GSWVDSSVPGGSVDFGMNFDKSVQNHYFGNSKNKNRHNRLRDGVFRPGYNRDSEDSYF
                     ENSSFRKRPMVFVKSDCDWNSADAKLKRLIKINNKKTKNNFKDLYESDELENSSENDL
                     TEDIQLDNNHAKTVVSHEETSDSEDILEGQISIEDVADTEPETSDNNDIQQLDNDDLY
                     FVDDDPEPMQKPVKSVHVEEPVFSKTPSAPLAVSFDPILTVGKVELKVSENEDSGKVT
                     TDIHPAKAYHPFRDYISNVMDNMETMFSDEDEFMEDDMDYEIMYDEMKSQQESSVFSQ
                     AKDIVTNIENLNISESTNSINNRVKEEIIEGETEEIIEVKKEPEYPEFGFCEEDFAVN
                     TSDLTVSNIRFGAQSNSYYFQAYKLFGDYDSRWADQDILVDFILETMGLPEHRLNAFL
                     DYIRNCVVPDEEPSEPNFDDMPFSDTSEEEESDDSDNEELTDDRLEGVDDLVYYSMKY
                     GNQRNIEYETKSIQTTGKGTKKKLLIRDDMAMDNETINELQSKLCTRLSNKAKKKKSK
                     LDFIEQEHAISEDLYKKYPLGLHILNIKDEFDNYYNDKNKKSLIFPPLDPHGNKTIRN
                     IAKYYSMKTTKIGSGRNVHMAVQKLKITYRRTPNYNIINNITEQRPIFLRFDVDKPQK
                     EHKRTETIRLSKFRKAHGVKQGNFTVKEGELVGEHAPELGHDNIGMRMLMKLGWNKGE
                     GLGTMGLGISEPVLATVKTSKKGLGHQDASTNSARSIGTD"
     gene            <361647..>362684
                     /gene="TPHA0P01740"
                     /locus_tag="TPHA_0P01740"
                     /db_xref="GeneID:11530789"
     mRNA            <361647..>362684
                     /gene="TPHA0P01740"
                     /locus_tag="TPHA_0P01740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688717.1"
                     /db_xref="GeneID:11530789"
     CDS             361647..362684
                     /gene="TPHA0P01740"
                     /locus_tag="TPHA_0P01740"
                     /inference="similar to DNA sequence:INSDC:YNL231C"
                     /note="similar to Saccharomyces cerevisiae PDR16
                     (YNL231C); ancestral locus Anc_2.12"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688765.1"
                     /db_xref="GeneID:11530789"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:G8C2F3"
                     /translation="MFKSLRKKKTETVDTSKLIQVDIPIEELPKSIAVPAVAELTADQ
                     KDKYRKVLEHFSKADLEIPVKEVKTAESAPLTEFEKAWLTRECFLRYLRATKWVLNDA
                     IDRITLSLAWRREFGISKLGEENGDEITSDSIAIENETGKQVILGYENNARPILYLKA
                     GRQNTKTSHRQVEHLVFMLERVIDFMPAGQDQLALLIDFKEYPDVPKVQGNSNIPPIG
                     VGKEVLHILQTHYPERMGKAIVTNIPWIAWTFLKLIHPFIDPMTREKLVFDEPPKNYV
                     PQDQLDKLNGGYLDFTYKHDKYWPTLLKMTKEKREHYLKRFQKFGGVVGLSEKDLRGT
                     TEELTIPVNSV"
     gene            complement(<362974..>363828)
                     /gene="TPHA0P01750"
                     /locus_tag="TPHA_0P01750"
                     /db_xref="GeneID:11530885"
     mRNA            complement(<362974..>363828)
                     /gene="TPHA0P01750"
                     /locus_tag="TPHA_0P01750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688718.1"
                     /db_xref="GeneID:11530885"
     CDS             complement(362974..363828)
                     /gene="TPHA0P01750"
                     /locus_tag="TPHA_0P01750"
                     /inference="similar to DNA sequence:INSDC:YNL232W"
                     /note="similar to Saccharomyces cerevisiae CSL4 (YNL232W);
                     ancestral locus Anc_2.11"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688766.1"
                     /db_xref="GeneID:11530885"
                     /db_xref="GOA:G8C2F4"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019495"
                     /db_xref="UniProtKB/TrEMBL:G8C2F4"
                     /translation="MSINFKFPESVIPGQLLCPAFDIKEENDKSIVYEYIAGPGTRLQ
                     KHNLNGTVVNIINSTLVGTVKIEEDFKMDSSNLDELNETAEDEKNHSNNGTREIKKIK
                     VSVVHKRNNTSSEVDNELTNNLPKEGDIVLAKVTRITLQNVSLEILAVENSPVPIDSG
                     VGSNGHGVVAAGAGSGSASYSVSQTSSDFGDPFRGTLRSQDVRATERDSVKIIECFKP
                     GDIVRAQILSLGDGVNYYLTTAKDDLGVVFAKSGNGAGNQMYALDWETMVVPSTGATE
                     KRKCAKPF"
     gene            complement(<364242..>367052)
                     /gene="TPHA0P01760"
                     /locus_tag="TPHA_0P01760"
                     /db_xref="GeneID:11530886"
     mRNA            complement(<364242..>367052)
                     /gene="TPHA0P01760"
                     /locus_tag="TPHA_0P01760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688719.1"
                     /db_xref="GeneID:11530886"
     CDS             complement(364242..367052)
                     /gene="TPHA0P01760"
                     /locus_tag="TPHA_0P01760"
                     /inference="similar to DNA sequence:INSDC:YNL233W"
                     /note="similar to Saccharomyces cerevisiae BNI4 (YNL233W);
                     ancestral locus Anc_2.10"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688767.1"
                     /db_xref="GeneID:11530886"
                     /db_xref="UniProtKB/TrEMBL:G8C2F5"
                     /translation="MNTMSDTQQDSSDIWNSSFYSSSSINSADHVKNFRNSLILNEIS
                     QDTEPAGELPDGCDSSIFHENAMPQNTQVIAQGPNSNGPHSSSKMSLEKSGNETITLN
                     MSSSPSLSALAGILTEKSRQADRKIRSSMILENSIVEESSDEKSFEGEIIQNSISEQQ
                     SLEHIHASPNKLINKNIANLIDSSSPNLIGSPNLIDIHDDDRRSKFPGGANKNINKLI
                     YEQPDFLSSPNPNGKNVLPLINKPSARPLISSKQSYSTTVPRVSSITTEQINGLSQPT
                     QSQENDNSPSKSAYSQDTLIHSQGDSSTGRVIEQVPVIRNESTEESPVASNKIVGPSE
                     TKSTSSHHSTSKIPSRDSDKKKSIPTKSESKVTPIKRQEPITTPNKKKSIFSFLKKKS
                     PKEKNSLSNGIPQSTTFSARSELNDTTPVKLTKKSHSSGSIFNNFKKNKEDKTSNTLD
                     IKKTRSRTKSKSSNNAKILQRKSTPLDFEKELMHQNKEKITSDEETKSISRKASRNID
                     YLSTDKSLNNSIDTGLSLFPKSLDSHEVESIISLERSRSLKSKRNSSASQRKSLTESL
                     SINAKNEGMFISEPTSVVLSTPDLTKSPASSILRSGRFPSGDNQSNILYFEDDDVDYT
                     EYKQSKLIDSHANDFSFGSLEEQLNSLVIDSDPEMEGNTKINNSSTLLTETTPDDELM
                     TDIMEFANIINFGDGLDFNFDISSKNEPQSIKHQNNTINLEDNSQSSIPVISIEDGCT
                     NLEPTSYNYIQNIHETIEQEDAQFKHNFTGENEYQQSENDNFNEEKIEFDDEVFRSDF
                     DNEDFNDLEELTEPSQNKHNAFLPESDNDCSRPISMSFKGLSNFQSDREDEISKSENT
                     IFSDLATTNMSYVRPNSRLKFSNQIILYETYGEHEYDRTPDISACNQLTPQLAQMIKI
                     ELNELKSEMEIHEDSKCYTHFY"
     gene            complement(<367690..>370638)
                     /gene="TPHA0P01770"
                     /locus_tag="TPHA_0P01770"
                     /db_xref="GeneID:11530887"
     mRNA            complement(<367690..>370638)
                     /gene="TPHA0P01770"
                     /locus_tag="TPHA_0P01770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688720.1"
                     /db_xref="GeneID:11530887"
     CDS             complement(367690..370638)
                     /gene="TPHA0P01770"
                     /locus_tag="TPHA_0P01770"
                     /inference="similar to DNA sequence:INSDC:YNL236W"
                     /note="similar to Saccharomyces cerevisiae SIN4 (YNL236W);
                     ancestral locus Anc_2.8"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688768.1"
                     /db_xref="GeneID:11530887"
                     /db_xref="InterPro:IPR021665"
                     /db_xref="UniProtKB/TrEMBL:G8C2F6"
                     /translation="MIELGNQAVSWSKTGLIVYSDKTSTDSNLCMTFLETINGTTWRF
                     HPPKKYTIHPHLYESQNTTSSSNSNGGKYSINAGRSGSPPNYQGSKANRTTNKNCPFF
                     YEITSVHWNNWFNLPGDMLAVCDELGNLTILILGQSLQGPVTMDKLTMLFQDNIYKIH
                     NNPMQLNETSEDSVKCVKKESKKEYPTRISELFWLSSSKPVISSQFCVLDSSINSYRN
                     KVQQIPPYGVFHPPFMKYSCLAVRKNGQIDFWYQFSNSKSHKKISLHLNTAQGKSSND
                     MDWVEYTNISALNEDQSLLISTYSRLTKVVSFYKLHVNWNITDINNSQLNDPLLSLFH
                     LSDVAVEQIDDEGNLLEFQYLYVISKAPVEKDSAPEILLLYNVLDTGKSIIKRYKLIP
                     TQLNAHYLKILKPDISRLDEQKLKPKHRYTLNCMPEIHLDKKVINIISNILDGFVSIH
                     FEDSTIETYSKTDWKVETERLHHQNRQGKFRDILTSVLSAGFNYPKLPPQSTLEWAIV
                     SPTMCGVLIKQSCKDIPQFISISHENTDDASLDKVNSTAFAFAFVASIHRQLSAEDLS
                     IACKTHLIKISDKDQDRGKECITSLMADIYSFFNITPDAPPELLEKMISSRPVQKTML
                     LQLELGSSCRHKNVYEMARIIMNLRNVYFAFNGVTRNLQFAIEQLNTISPAQLAGGKL
                     FQTSFTKQDLIHSLIPIAKWLIKFITYLIQEVLILINKGYSSASVSSLVYGVFGARIP
                     RSLLLSILNEIKRVIHLVTKFPENNYPVLNESSKFLKKILSESTVNIEKFETFLVDVN
                     TKFMNLNSKNQSTTREPSLLVKAEIPEDISKISSFLLTYSKNAIISHIDPAQVYFADT
                     SGLRISKDEIFQSSLLHLSQPLDKGLVTDTKSLGPSHQTSRSFSKIEYDGVSYDTFTD
                     NEMTNGSLKRCCRCGCVTRAGYTISEDKTIISTSIKTRRWPTMYARVCICSGYLYELE
                     KAHPEKKESK"
     gene            complement(<371134..>372492)
                     /gene="TPHA0P01780"
                     /locus_tag="TPHA_0P01780"
                     /db_xref="GeneID:11530888"
     mRNA            complement(<371134..>372492)
                     /gene="TPHA0P01780"
                     /locus_tag="TPHA_0P01780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688721.1"
                     /db_xref="GeneID:11530888"
     CDS             complement(371134..372492)
                     /gene="TPHA0P01780"
                     /locus_tag="TPHA_0P01780"
                     /inference="similar to DNA sequence:INSDC:YNL237W"
                     /note="similar to Saccharomyces cerevisiae YTP1 (YNL237W);
                     ancestral locus Anc_2.7"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688769.1"
                     /db_xref="GeneID:11530888"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:G8C2F7"
                     /translation="MILSQLINIFILIISTLANFGICDNMSMNMDDTSAYTRPDIQDA
                     GNRTFHWLCCVFLLFLLPSVSASYSFAGRINVSMFLQIISCIYSVVEALFLRFSDNDG
                     VENRTSRGSAWSILILLGLSLFFGGLASGTGLLIKNKLLQTFISNTGESRLKYAHNAL
                     SFLVVINGFTKSCLAPVAMFGFCRESHTGQCIAHGIMGNAFVLYGFIYAMVLVIPSIR
                     NNKGPYSQDYIDSWVMCLWGIVNTFTEHRWGREGWNHGDYQHTAMGIIWWAGGLLGIF
                     LGRGGKRTFVPSLLIIFTGWAMSEHSQHLIISTKVHYFFGLILMVGGSLRIIEISFLL
                     KDQRTLDKIYSFQYLAPFCLVCGGILFMGASEEQLVLVLRLGADHSAYLLVAVAAAFL
                     LYLWMLLCLELYNHLATQQEKGFLSNYASTLPSHMVDIESSTVSNQDDIDDDIDFELA
                     SN"
     gene            complement(<373247..>375646)
                     /gene="TPHA0P01790"
                     /locus_tag="TPHA_0P01790"
                     /db_xref="GeneID:11530889"
     mRNA            complement(<373247..>375646)
                     /gene="TPHA0P01790"
                     /locus_tag="TPHA_0P01790"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688722.1"
                     /db_xref="GeneID:11530889"
     CDS             complement(373247..375646)
                     /gene="TPHA0P01790"
                     /locus_tag="TPHA_0P01790"
                     /inference="similar to DNA sequence:INSDC:YNL238W"
                     /note="similar to Saccharomyces cerevisiae KEX2 (YNL238W);
                     ancestral locus Anc_2.6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688770.1"
                     /db_xref="GeneID:11530889"
                     /db_xref="GOA:G8C2F8"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002884"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:G8C2F8"
                     /translation="MFHQINVLFILIFLFIFKSAISEKVPEKNHNINQYFAIESHLSA
                     DDLLKLHSNWKFEHNVRGLENHYVFSKKYNTLSSPIQKREDLSSLEGVSSFHDLPPIT
                     LQKRQPIPVPPIDSSLLPLQEAANKLGIKDPLFSKQWHLINPSFPGNDVNVSGVWFSG
                     ITGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDYHGTRCAGEI
                     AAVKNEYCGLGVAYGAKVAGIRILSGQITAEDEAASLMYGLDINDIFSCSWGPPDDGK
                     HLQGPSDLVKKAMIKGTQEGRNEKGSIYVFASGNGGHYGDNCNYDGYTNSIYSITIGA
                     IDHKGLHPPYSESCSAVLAVTYSSGSGEYIHSTDIKSQCSDRHGGTSAAAPLAAGIYA
                     LVLEANPELTWRDVQYLSILSSVEVPNPDAEWRNGALNKRYSHRYGYGKIDSFAIVEL
                     AKTWKNVKPQSWYYHKTARPELTSNSIDKVLEHEITITKKDLTNANLKRVEHITVTVD
                     IEATRRGAVVIDLISPSGMISNLGVQRSLDVSSDGFINWTFMSVAHWGEEGVGKWKLR
                     VRTVKEENEIKFHNWRLKIFGESINPEKATKFVFGNDKELEELRTSSTTSIIQSSTTV
                     SSTSTPSKDVLPSSSITSSLLSTSSSTIASISHTTSSTLIPSETNDAIDSDLEADLNT
                     PNKLDSPKDFMHYFLSIFSFGCVLLALYYFFFLNSKRRIRRSRAETYEFDIIDSDSDF
                     DETSESINGGDDFVIDDTFDFDLSDEDAVPLTTNVQGIDEQLSESNDITKLSPHSSNN
                     K"
     gene            complement(<376361..>377803)
                     /gene="TPHA0P01800"
                     /locus_tag="TPHA_0P01800"
                     /db_xref="GeneID:11530890"
     mRNA            complement(<376361..>377803)
                     /gene="TPHA0P01800"
                     /locus_tag="TPHA_0P01800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688723.1"
                     /db_xref="GeneID:11530890"
     CDS             complement(376361..377803)
                     /gene="TPHA0P01800"
                     /locus_tag="TPHA_0P01800"
                     /inference="similar to DNA sequence:INSDC:YNL239W"
                     /note="similar to Saccharomyces cerevisiae LAP3 (YNL239W);
                     ancestral locus Anc_2.5"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688771.1"
                     /db_xref="GeneID:11530890"
                     /db_xref="GOA:G8C2F9"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR004134"
                     /db_xref="UniProtKB/TrEMBL:G8C2F9"
                     /translation="MYTAIVKKNRVFQTVFHRNRIFPSKLHKVNMSSSIEISKISEWD
                     SDNSKDLNHRLASTVLKNVNADDALLNKTRLLKQDLRIFNTAVNNESTPITNQRSSGR
                     CWLFAATNELRYNVIEELKLKEFELSQAYLFFYDKLEKANYFLDQVIDTYEEDVDSRL
                     VQYLLSAPTQDGGQYSMFVNLVAKYGLIPKDLYNDLPLSTVASSKWNSILTTKLREFA
                     EVLREELKKGNDISELRTKFQREIFKLMTLFMDMPPVKPDESFTWSYLDKDKKIHTLE
                     TTPKEFASKYCKIDCSKPVSLINDPRHPYGRIIKINRLGNVIGGESVYYLNVDNEILS
                     NLVVQRLQNQRPVFFGSHTPKFMHKKFGVMDVELWDYKSIGYDLHQSKSSRIKYGESL
                     MTHAMLITGAHVDDTTGKPIRYRVENSWGKDSGNDGLYVMTQKYFEEYAFQIVVDIDE
                     LPKDLMEKFIKKDENPIVLPIWDPMGALAN"
     gene            <378407..>379888
                     /gene="TPHA0P01810"
                     /locus_tag="TPHA_0P01810"
                     /db_xref="GeneID:11530752"
     mRNA            <378407..>379888
                     /gene="TPHA0P01810"
                     /locus_tag="TPHA_0P01810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688724.1"
                     /db_xref="GeneID:11530752"
     CDS             378407..379888
                     /gene="TPHA0P01810"
                     /locus_tag="TPHA_0P01810"
                     /inference="similar to DNA sequence:INSDC:YNL240C"
                     /note="similar to Saccharomyces cerevisiae NAR1 (YNL240C);
                     ancestral locus Anc_2.4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688772.1"
                     /db_xref="GeneID:11530752"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /db_xref="UniProtKB/TrEMBL:G8C2G0"
                     /translation="MSALLSAEDLNDFISPSMACIKPTEVNKENDNVDANGDLQVGKE
                     SELEKVSITLQDCLACVGCITSSEEILLSRQSYSVFLENYKNDGGQLVISISPQSRLS
                     MANHFGLSVMEFDIRMCQVVREKFACKYVVGTQIGREISIRETNREVREAVRAGTSSS
                     SQVSGPRLCSVCPGFVLYCEKSKPELVPYLVDIKSPQQLTGQIIKNTVGGKVYHLSVM
                     PCFDKKLEASRQDSEGEVDCVITPKEFVKMLEELDCDMGSNPATPATPTFGLDRAILD
                     EMSMPGYPWDATMSVNAGSSSGGFAYQYVLESQARHQAMGTRCAVLSTAGKNHDLLEH
                     RLVDLGSGATLASSSEVYGFRNIQNMVRRLTQAARPRTLRLRARQRAKQSPDSDPALP
                     APPAAADPYGAEFIEVMACPKGCINGGGLLDSNNTKKMNAQLIEHLNQRYHEELLQRP
                     LPQHAGVVDAATAAAVAASHRYTFHPIEKHDDGPGELLAMANW"
     gene            <380583..>382097
                     /gene="TPHA0P01820"
                     /locus_tag="TPHA_0P01820"
                     /db_xref="GeneID:11530753"
     mRNA            <380583..>382097
                     /gene="TPHA0P01820"
                     /locus_tag="TPHA_0P01820"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688725.1"
                     /db_xref="GeneID:11530753"
     CDS             380583..382097
                     /gene="TPHA0P01820"
                     /locus_tag="TPHA_0P01820"
                     /inference="similar to DNA sequence:INSDC:YNL241C"
                     /note="similar to Saccharomyces cerevisiae ZWF1 (YNL241C);
                     ancestral locus Anc_2.3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688773.1"
                     /db_xref="GeneID:11530753"
                     /db_xref="GOA:G8C2G1"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="UniProtKB/TrEMBL:G8C2G1"
                     /translation="MACNRERFETDVIITVFGASGDLAKKKTFPALFGLFREGYLHES
                     TKIFGFARSKLTGSELRQRIEPHLEKPNGKQDDEKVEQFFKLIQYHEGGAYDEDQGYL
                     ELLKEFQKVEAQKNITHPQRLYYLALPPSVFLSVAEQIKKILYTTVGVQRVIVEKPFG
                     HDLESARALQNSLSPLFTEDEIYRIDHYLGKEMVKNLLQLRFGNTFLNASWNKDFIQS
                     IQVTFKEPFGTEGRGGYFDSIGIVRDVMQNHLLQILTLLTMERPVSFDPEDVRDEKVK
                     VLKAMAPIDHNDILIGQYGKSEDGSKPAYLDDETVQPNSKCVTYCAMSFKIENERWDG
                     VPVVMRAGKALNEAKVEIRIQYKPAAPGVFRHIPNNELVIRVQPDASVYMKMNAKTPG
                     LSTTTQVTDLDLTYSTRFKDFWIPQAYEVLIRDALLGDHSNFVRDDELEVSWSLFTPF
                     LNYIESPDAPAPELYPYGSRGPSGFKEYMMKHGYKFQDNINYSWPIISPGEETH"
     gene            <382752..>383879
                     /gene="TPHA0P01830"
                     /locus_tag="TPHA_0P01830"
                     /db_xref="GeneID:11530754"
     mRNA            <382752..>383879
                     /gene="TPHA0P01830"
                     /locus_tag="TPHA_0P01830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688726.1"
                     /db_xref="GeneID:11530754"
     CDS             382752..383879
                     /gene="TPHA0P01830"
                     /locus_tag="TPHA_0P01830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688774.1"
                     /db_xref="GeneID:11530754"
                     /db_xref="GOA:G8C2G2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:G8C2G2"
                     /translation="MNAQLPKQMKAVVIGNGKAVVKKDCPIPEIEDDFMLIKVIAVAG
                     NPSEWKHIDMKLGPEGSILGCDAVGKVLKLGSKVDTNQFHVGDIVLSFVHGASNQRPK
                     NGAFGEYIAVDQATTYKAPANIKHTDLKNLYYGPCNTFEGAVALPVSLTTAGIVIHHD
                     MGLKLAWEPKEPQHDFPILIWGGATGVGQILVQLAKKIHGYSKIVVVASKKHEEMLKS
                     FGADEVYDYHDENIAQVIKSKYPNIQHAIDTVSTEQTFSTTYKCVDDVNPVSLMQLLF
                     LSENDIPVEDRKPNVKVLSTMIYKVCGMDIRMADFKFPKDVTYRKDTFEFVKFIRPYV
                     QNGEIKHMPVKVFDNGLEDIPEITNMIRDGKAAGVKFVTVL"
     gene            <386893..>388542
                     /gene="TPHA0P01840"
                     /locus_tag="TPHA_0P01840"
                     /db_xref="GeneID:11530755"
     mRNA            <386893..>388542
                     /gene="TPHA0P01840"
                     /locus_tag="TPHA_0P01840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688727.1"
                     /db_xref="GeneID:11530755"
     CDS             386893..388542
                     /gene="TPHA0P01840"
                     /locus_tag="TPHA_0P01840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688775.1"
                     /db_xref="GeneID:11530755"
                     /db_xref="GOA:G8C2G3"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:G8C2G3"
                     /translation="MSDQQKKVYALSNGFAYSHHPGASLLSRPDGSITLQDFHLVENI
                     AHFDRERIPERVVHAKAAGCKFEFELTDSLSDITFAAPYQKVGYKCPGMIRISTVAGS
                     SGSADTVRDPRGFSFKFYTEWGNHDWVFNNTPVFFIRDGLKFPQFIHTQKKDPQNHAD
                     GAEDSSRSWDFFTQNLETLHQVVYLHGPRGIPKSLSDMNAYSGHTFKMINDKGELTYV
                     NFHVKSDKGFPTLSNDEASKLAGTRPDYSTIELFNKIKEGKKPGFTCYIQTMTPEQAE
                     KFRYSVNDLTKVWPHKEFPLRKFGRITMTGNVDNYFQEIEQLAFSPSNTCIPGIQPSN
                     DNVLQTRIFSYPDTQRYRLGANFNQLDVNRPKNLNGTAASRCPYAASNFQRDGASTLY
                     NQGAMPNYISGQPNASLEYKDLTSEDFFKNKYKGAVTEESLKKYILEQESARAAHDAV
                     INAKLPGYYSVSGASELDLEQPRALYENVFTEQQRKDFIDTVVGSASNIPNPKLKTTV
                     SQYFGLLNADLGKSIAEGLGIEWVPVDLEGYFDSIGRASAK"
     gene            <390858..>391600
                     /gene="TPHA0P01850"
                     /locus_tag="TPHA_0P01850"
                     /db_xref="GeneID:11530756"
     mRNA            <390858..>391600
                     /gene="TPHA0P01850"
                     /locus_tag="TPHA_0P01850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688728.2"
                     /db_xref="GeneID:11530756"
     CDS             390858..>391600
                     /gene="TPHA0P01850"
                     /locus_tag="TPHA_0P01850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688776.1"
                     /db_xref="GeneID:11530756"
                     /db_xref="GOA:G8C2G4"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="UniProtKB/TrEMBL:G8C2G4"
                     /translation="MKNSFEITGFQVFGNSAMALILSFMFYKVMLHPTTDTFCYCGAA
                     MFFAILINAFSSLIEIFTLYEPRPIMEKHKSYSLYHPSADAFASIISEIPPKLITSVC
                     VNIIFYFLCKFRRNGRVFFFYYLISVVAVFPMSHLFKCVGSLTKTLQEAMVPASMLLL
                     ALSMYTGFAISRTKILGWSIWVWYINPLAYLFESLMINEFHGRHFPCTAYIPVGGSYD
                     SQTGTTRICSVNGAIAGQDYVLGDDYIKS"
     gap             391601..391779
                     /estimated_length=179
     gene            complement(<392313..>393347)
                     /gene="TPHA0P01860"
                     /locus_tag="TPHA_0P01860"
                     /db_xref="GeneID:11530856"
     mRNA            complement(<392313..>393347)
                     /gene="TPHA0P01860"
                     /locus_tag="TPHA_0P01860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003688729.1"
                     /db_xref="GeneID:11530856"
     CDS             complement(392313..393347)
                     /gene="TPHA0P01860"
                     /locus_tag="TPHA_0P01860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003688777.1"
                     /db_xref="GeneID:11530856"
                     /db_xref="UniProtKB/TrEMBL:G8C2G5"
                     /translation="MNWSFIRTKLSSKYIRLSILAGFIIILTIFLANPNVKLFIKGSA
                     VSSPAVILSNPQKLLKRSRWDWVTYSAVFGCVIAAGTTIRPDLVASVCLLFTGGVCAP
                     VAGLIVSVVTVGVAAYAASKAAGSATKRGGSFVKALMGQTLLFDPWLHQNGTIELGGE
                     AGTLVFHHKVQVTSDSKKRYRTTSGNGVVFSSNLGNHIALSYIHSPEELSNLIVSAQP
                     GVPNYNNYTYAKRDGYPTDGFEVSWLSYNYDNGNSDLCSVWENNEPTDEGLSYFEGQV
                     QNWIAANRDWKYCFAAVDAKAGEVINYDDISGVGSGTGNALHGEIYFNTYGGIDGFCN
                     DNHDGAQGDR"
CONTIG      join(HE612871.1:1..394523)
//
DBGET integrated database retrieval system