GenomeNet

Database: RefSeq
Entry: NC_016846
LinkDB: NC_016846
Original site: NC_016846 
LOCUS       NC_016846             111195 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS2,
            complete sequence.
ACCESSION   NC_016846
VERSION     NC_016846.1
DBLINK      BioProject: PRJNA84387
            Assembly: GCF_000240185.1
KEYWORDS    RefSeq.
SOURCE      Klebsiella pneumoniae subsp. pneumoniae HS11286
  ORGANISM  Klebsiella pneumoniae subsp. pneumoniae HS11286
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Klebsiella.
REFERENCE   1  (bases 1 to 111195)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 111195)
  AUTHORS   Ou,H.-Y., Jiang,X., Liu,P. and Li,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2011) State Key Laboratory of Microbial
            Metabolism, Shanghai Jiaotong University, 1954 Huashan Road,
            Shanghai 200030, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003224.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
            Source DNA is available from Hong-Yu Ou at hyou@sjtu.edu.cn.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..111195
                     /organism="Klebsiella pneumoniae subsp. pneumoniae
                     HS11286"
                     /mol_type="genomic DNA"
                     /strain="HS11286"
                     /sub_species="pneumoniae"
                     /db_xref="taxon:1125630"
                     /plasmid="pKPHS2"
     gene            complement(9..377)
                     /locus_tag="KPHS_p200010"
                     /db_xref="GeneID:11844974"
     CDS             complement(9..377)
                     /locus_tag="KPHS_p200010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229617.1"
                     /db_xref="GeneID:11844974"
                     /translation="MPEKSPPPRGYPLIHGHIFIKYFFIVFLYFTSFREPESRVQCGL
                     RGGLYGQLVNIIWEINHVSVGFVSTSYGIRINKLWERGQVQFSIIHLWIKCRFFRWIS
                     IAIACNFCFHCHYGWVKIYP"
     gene            680..793
                     /locus_tag="KPHS_p200020"
                     /db_xref="GeneID:11844975"
     CDS             680..793
                     /locus_tag="KPHS_p200020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229618.1"
                     /db_xref="GeneID:11844975"
                     /translation="MRSFTIMSLLETFLTASPASQGATILFLAMLIYWQKR"
     gene            922..1179
                     /locus_tag="KPHS_p200030"
                     /db_xref="GeneID:11844976"
     CDS             922..1179
                     /locus_tag="KPHS_p200030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229619.1"
                     /db_xref="GeneID:11844976"
                     /translation="MKLETIHIDNTVRSGLNSFTDGVIFRDTKVLITLNLPDGQKTTI
                     EGEWRHMSDANRLSERITMLQHAIYEQYEEYRADIPVSWSR"
     gene            complement(1225..2004)
                     /locus_tag="KPHS_p200040"
                     /db_xref="GeneID:11844977"
     CDS             complement(1225..2004)
                     /locus_tag="KPHS_p200040"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid F resolvase-like protein"
                     /protein_id="YP_005229620.1"
                     /db_xref="GeneID:11844977"
                     /translation="MNNLVPVGSPQSPGTLLPVAIDYPAALALRQMALVQDELPKYLL
                     APEVSALLHYVPDLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATLKQR
                     TEKAARTAGRVPAGSQAHRLVPLSDHHYVSQLQMMVATLKIPLERRNKRTGRMEKARI
                     WEITDRTVRTWLSEAVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMG
                     HKSISSTEVYTKVFALDVAARHRVQFQMPEADAVAMLKGNI"
     misc_feature    complement(1309..1878)
                     /locus_tag="KPHS_p200040"
                     /note="Phage integrase family; Region: Phage_integrase;
                     pfam00589"
                     /db_xref="CDD:334163"
     misc_feature    complement(order(1321..1323,1426..1428,1498..1500,
                     1504..1506,1783..1788,1828..1830))
                     /locus_tag="KPHS_p200040"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    complement(order(1321..1323,1348..1350,1417..1419,
                     1426..1428,1786..1788))
                     /locus_tag="KPHS_p200040"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(2013..2144)
                     /locus_tag="KPHS_p200050"
                     /db_xref="GeneID:11844978"
     CDS             complement(2013..2144)
                     /locus_tag="KPHS_p200050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229621.1"
                     /db_xref="GeneID:11844978"
                     /translation="MPENIVSVITDGVVLFATSSVFWLASHPDSGNITKKILGKEKS"
     gene            complement(2188..3192)
                     /locus_tag="KPHS_p200060"
                     /db_xref="GeneID:11844979"
     CDS             complement(2188..3192)
                     /locus_tag="KPHS_p200060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229622.1"
                     /db_xref="GeneID:11844979"
                     /translation="MEAKTKTFIKTSVDDNGMWLLTVPAGSAGNETVVVVVRRVEECR
                     YGSEDSPGAYLWITCSLTLYGDGQSTPQTIVAKFEHGRVELFSVEFMLNEFLPRGRGV
                     GSWIMQQMVLWTRSLPPETLVRQIHISSVDAKNIHNLIRRSRLWRGLGFRFPPGETSS
                     MPLRADELQLPRGRCSTLRVEPLVSAVRRLEDCYRGLQEKIVQLEGKKRSQKQLITSL
                     RNRPFYHLLHRKGGQLPDEKCDALPLRAEKLSLPQSGDSDLEVAQRATGVIRLATLCS
                     QSQEKIVELERDLASQSEYLLDLQTKLLSILWGKVANLTLFWGGVVIFLYFIKWMLVA
                     "
     gene            complement(3222..3425)
                     /locus_tag="KPHS_p200070"
                     /db_xref="GeneID:11844980"
     CDS             complement(3222..3425)
                     /locus_tag="KPHS_p200070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229623.1"
                     /db_xref="GeneID:11844980"
                     /translation="MMPALPGPGVSFSAAQLPMMTTLSASDGCHLYFEQGTLVWIEVY
                     SQGDKRWPFYGRPELTGITHSST"
     gene            complement(3471..3992)
                     /locus_tag="KPHS_p200080"
                     /db_xref="GeneID:11844981"
     CDS             complement(3471..3992)
                     /locus_tag="KPHS_p200080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229624.1"
                     /db_xref="GeneID:11844981"
                     /translation="MIAPGQHGKNLRDIPEQCFDYGFDREDRWPGLVLASTVTVPNGN
                     TDGWRLATQSCGGFSCNEFQAAVLPLPVRPEMLRFLETVAEEEFSPAPLDYFNMMDAA
                     DAAAVKKGFLSCLHRAGLSCSEHNLSLLTQALYPVDATAENMKILAGNCTELAAMKVP
                     GGLTIFIVGQNCD"
     gene            complement(4050..4442)
                     /locus_tag="KPHS_p200090"
                     /db_xref="GeneID:11844982"
     CDS             complement(4050..4442)
                     /locus_tag="KPHS_p200090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229625.1"
                     /db_xref="GeneID:11844982"
                     /translation="MNRTYDEPETETDVMAAAFRTIRRYGMTIITATQHMDVNGYVKT
                     DPRMPRTRLRRYLGQYGLRGEALNREVRRIVAGPERRDSKLKDGIYYTWPYGWEPCDF
                     TPMMRRIFRGKRTRHVMMSDEMPALFLN"
     misc_feature    complement(<4059..>4259)
                     /locus_tag="KPHS_p200090"
                     /note="Predicted acylesterase/phospholipase RssA, containd
                     patatin domain [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     gene            complement(4479..5423)
                     /locus_tag="KPHS_p200100"
                     /db_xref="GeneID:11844983"
     CDS             complement(4479..5423)
                     /locus_tag="KPHS_p200100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229626.1"
                     /db_xref="GeneID:11844983"
                     /translation="MAKIQARNVDDALFARIEQSAMKNERSLEGEIRLALARQYPAGT
                     TSPEILSSRQQWQKECGGRLRALFDRLSADGFFPGAGQPGPTRIADQVRIAHRLHVSP
                     GLLLDCIDGAGELTRELAERIESRFGASADWLTTGDGKMFPLVILGTYFGVSWEEFFF
                     PDDDERYVFEFIRIAGGRHDGTLMILRQHEQNGRITAGVVTEAFFLGAGMGPGGYVNL
                     KEFLLFLRQHGGNLVMNAYVFSPPEPDFDFWSVMGQHHPVWFRDARRRSPSRWLQQVL
                     SGEDPGEWFAGGWSSILKEVAEATPPDNATEHTEKNDE"
     misc_feature    complement(<5277..5423)
                     /locus_tag="KPHS_p200100"
                     /note="bifunctional SbtC-like/phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Provisional;
                     Region: PRK13982"
                     /db_xref="CDD:172484"
     gene            complement(5449..5568)
                     /locus_tag="KPHS_p200110"
                     /db_xref="GeneID:11844824"
     CDS             complement(5449..5568)
                     /locus_tag="KPHS_p200110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229627.1"
                     /db_xref="GeneID:11844824"
                     /translation="MPYHVLISSFVYKMNHNVYIYCYSGKSGFMFTSKTIYQS"
     gene            complement(5584..6045)
                     /locus_tag="KPHS_p200140"
                     /db_xref="GeneID:11844825"
     CDS             complement(5584..6045)
                     /locus_tag="KPHS_p200140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229628.1"
                     /db_xref="GeneID:11844825"
                     /translation="MARLLPFLKMDTVLIISSWPTGLYDYVQYMQMQSICIVIAYADG
                     KYMRMPHLCRCPAYGYVEPMLYSLFSRSDPKKASSGSAGTAPARSGPATQDVAVFPAE
                     DDAICCVPPLPRDRPLTTGKRRFAYSLTVVHFRKVVIRKKIGSAGNGHPVI"
     gene            6002..6232
                     /locus_tag="KPHS_p200120"
                     /db_xref="GeneID:11844826"
     CDS             6002..6232
                     /locus_tag="KPHS_p200120"
                     /codon_start=1
                     /transl_table=11
                     /product="virulence-associated protein"
                     /protein_id="YP_005229629.1"
                     /db_xref="GeneID:11844826"
                     /translation="MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVR
                     PTWGSFAQFEKADPDFMAEREDVVSDEGRFNL"
     misc_feature    6008..6196
                     /locus_tag="KPHS_p200120"
                     /note="Antidote-toxin recognition MazE, bacterial
                     antitoxin; Region: MazE_antitoxin; cl00877"
                     /db_xref="CDD:321225"
     gene            6229..6645
                     /locus_tag="KPHS_p200130"
                     /db_xref="GeneID:11844827"
     CDS             6229..6645
                     /locus_tag="KPHS_p200130"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA binding protein"
                     /protein_id="YP_005229630.1"
                     /db_xref="GeneID:11844827"
                     /translation="MNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITY
                     SEMRFGATGPKASPRHVELVDAFCARLDAILPWDRAAVDATTEIKVALRMAGTPIGPN
                     DTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR"
     misc_feature    6244..6633
                     /locus_tag="KPHS_p200130"
                     /note="VapC-like PIN domain of Mycobacterium tuberculosis
                     VapC4 and VapC5, and Neisseria gonorrhoeae FitB and
                     related proteins; Region: PIN_VapC4-5_FitB-like; cd09881"
                     /db_xref="CDD:350229"
     misc_feature    order(6247..6279,6301..6312,6337..6342,6349..6354,
                     6358..6366,6370..6378,6382..6384,6403..6417,6421..6429,
                     6433..6435,6442..6444,6448..6450,6454..6462,6472..6477,
                     6481..6489,6493..6498,6505..6507,6523..6546,6568..6573,
                     6586..6591)
                     /locus_tag="KPHS_p200130"
                     /note="oligomeric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:350229"
     misc_feature    order(6247..6279,6301..6312,6337..6342,6364..6366,
                     6370..6378,6403..6417,6421..6429,6433..6435,6442..6444,
                     6448..6450,6454..6456,6460..6462,6493..6495,6523..6546,
                     6568..6573,6586..6591)
                     /locus_tag="KPHS_p200130"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:350229"
     misc_feature    order(6250..6252,6364..6366,6535..6537,6589..6591)
                     /locus_tag="KPHS_p200130"
                     /note="active site"
                     /db_xref="CDD:350229"
     misc_feature    order(6349..6354,6358..6366,6370..6375,6382..6384,
                     6409..6411,6421..6423,6454..6462,6472..6477,6481..6489,
                     6493..6498,6505..6507,6529..6534,6541..6543)
                     /locus_tag="KPHS_p200130"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:350229"
     gene            6719..8281
                     /locus_tag="KPHS_p200150"
                     /db_xref="GeneID:11844828"
     CDS             6719..8281
                     /locus_tag="KPHS_p200150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229631.1"
                     /db_xref="GeneID:11844828"
                     /translation="MPLITRLMLQNFKKFPELDLRFTHDRNILVGDNESGKSTILLAL
                     DLVLSDSRHRVEALGVESLLSQSAVRQFQEGERRADQLPVLTADVFLSNGGDPDLNGR
                     QNLAGINADGLRMRIAPMTEEYGQDIHNVLQQDPDNFPYEYYSVRFSTFSGGHFASFR
                     RYLRHLLLDSARIDNEHAAQEYTRTVYSVNVPVADRYRLENSYRQQKMHFCTRHLSAI
                     NDTLETYQFGVRSGAKSGLEANLDITEDGISIRHRGKGRQCFIKTEFALQRHQQQGEL
                     HVLLLEEPENHLSHVSMKRLVNQLATERQTQVFIATHSSHISSRLDLRKAILLGSARP
                     VLMNELSAETAAFFMKAPDNNVLEFALARRVLLVEGDAEFILIEAFYRRLYGRAPEED
                     GVHIIAIGGTSFRRYLELARLLENRVAALRDNDGNYQQNCDERYADVICSRSRVFADR
                     DNTRSTFEISLYQDNADLCDTLFRGPRRTLTVQEYMLANKAEAAFRLLQLHAGELTVP
                     DYIQEALAWIRE"
     misc_feature    6728..>7993
                     /locus_tag="KPHS_p200150"
                     /note="Predicted ATP-dependent endonuclease of the OLD
                     family, contains P-loop ATPase and TOPRIM domains
                     [Replication, recombination and repair]; Region: YbjD;
                     COG3593"
                     /db_xref="CDD:226121"
     misc_feature    7799..8092
                     /locus_tag="KPHS_p200150"
                     /note="topoisomerase-primase (TOPRIM) nucleotidyl
                     transferase/hydrolase domain of the type found in
                     bacterial and archaeal nucleases of the OLD (overcome
                     lysogenization defect) family. The bacteriophage P2 OLD
                     protein, which has DNase as well as RNase activity;
                     Region: TOPRIM_OLD; cd01026"
                     /db_xref="CDD:173776"
     misc_feature    order(7823..7828,7835..7837,7985..7987,7991..7993)
                     /locus_tag="KPHS_p200150"
                     /note="putative active site [active]"
                     /db_xref="CDD:173776"
     misc_feature    order(7823..7825,7985..7987)
                     /locus_tag="KPHS_p200150"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173776"
     gene            8266..9288
                     /locus_tag="KPHS_p200160"
                     /db_xref="GeneID:11844829"
     CDS             8266..9288
                     /locus_tag="KPHS_p200160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229632.1"
                     /db_xref="GeneID:11844829"
                     /translation="MDKRVIFAVAGSGKTTLLIRRLSEDRRTLLLTFTVNNEAHLRAQ
                     IIRRFGFIPEGIRVMTWFEFLHGFCFRPFLQEQLASRGLSFDQPPPRIPRTNARHYQD
                     PAGRLYHRRLAHLLTARGLLPDIRIRLARYYDELLVDEVQDFAGHDFNFLLELCRAEI
                     TVLCCGDFYQHTFDTSHDGNVNSTLHDDITRYEARFDAAGFAVDRDTLNRTWRCSASV
                     CEFITGQLNIRIAAHGIHASLIETIADTERSATLHADNTVIKLFYREHHRYGCYSMNW
                     GASKGLDHFQDVCIVMGSSHWKLLTRQELATLPPSSRNRLYVACSRARGNIYFVPETH
                     LRRFRN"
     misc_feature    8278..9255
                     /locus_tag="KPHS_p200160"
                     /note="Viral (Superfamily 1) RNA helicase; Region:
                     Viral_helicase1; pfam01443"
                     /db_xref="CDD:307550"
     misc_feature    8278..8766
                     /locus_tag="KPHS_p200160"
                     /note="N-terminal helicase domain of the DEAD-box helicase
                     superfamily; Region: DEAD-like_helicase_N; cl28899"
                     /db_xref="CDD:355775"
     misc_feature    order(8293..8313,8680..8682)
                     /locus_tag="KPHS_p200160"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:350670"
     misc_feature    8680..8691
                     /locus_tag="KPHS_p200160"
                     /note="DEAD box helicase motif; other site"
                     /db_xref="CDD:350670"
     gene            9360..9482
                     /locus_tag="KPHS_p200170"
                     /db_xref="GeneID:11844830"
     CDS             9360..9482
                     /locus_tag="KPHS_p200170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229633.1"
                     /db_xref="GeneID:11844830"
                     /translation="MRFRFSLSGTWLTICNIIIKYNYASYFYSQNANNVAYTPV"
     gene            9592..9819
                     /locus_tag="KPHS_p200180"
                     /db_xref="GeneID:11844831"
     CDS             9592..9819
                     /locus_tag="KPHS_p200180"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005229634.1"
                     /db_xref="GeneID:11844831"
                     /translation="MMRNGKSTAGHQRYLCSHCRKTWQLTFTYAASQPGTHQKIIDMA
                     MNGVGCRATARLMGVGLNTILRHLKNSGRSQ"
     misc_feature    <9598..9651
                     /locus_tag="KPHS_p200180"
                     /note="InsA N-terminal domain; Region: Zn_Tnp_IS1;
                     pfam03811"
                     /db_xref="CDD:281762"
     misc_feature    9670..9807
                     /locus_tag="KPHS_p200180"
                     /note="InsA C-terminal domain; Region: HTH_Tnp_IS1;
                     cl27813"
                     /db_xref="CDD:332634"
     gene            9864..10241
                     /locus_tag="KPHS_p200190"
                     /db_xref="GeneID:11844832"
     CDS             9864..10241
                     /locus_tag="KPHS_p200190"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005229635.1"
                     /db_xref="GeneID:11844832"
                     /translation="MDEQWGYVGAKSRQRWLFYAYDRIRRAVVAHVFGERTMATLERL
                     LSLLSVFDVVVWMTDGWPMYESRLKGKLHVISKRYTQRIERHNLNLRQHLARLGRKSL
                     SFSKSVELHDKVIGHYLNIKHYQ"
     misc_feature    9864..10238
                     /locus_tag="KPHS_p200190"
                     /note="IS1 transposase; Region: DDE_Tnp_IS1; cl00721"
                     /db_xref="CDD:294470"
     gene            10243..10623
                     /locus_tag="KPHS_p200200"
                     /db_xref="GeneID:11844833"
     CDS             10243..10623
                     /locus_tag="KPHS_p200200"
                     /codon_start=1
                     /transl_table=11
                     /product="IS903D transposase"
                     /protein_id="YP_005229636.1"
                     /db_xref="GeneID:11844833"
                     /translation="MESLPTFAELKDQITYLPDNADRSVAKQKFKITNWPTYNKALIN
                     RGSITFWLDDEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFMG
                     APQKTESMVTPVFATPILTTSWLA"
     misc_feature    10369..>10551
                     /locus_tag="KPHS_p200200"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:290455"
     gene            complement(10822..11826)
                     /locus_tag="KPHS_p200210"
                     /db_xref="GeneID:11844834"
     CDS             complement(10822..11826)
                     /locus_tag="KPHS_p200210"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase InsD1 for insertion sequence
                     IS4321R"
                     /protein_id="YP_005229637.1"
                     /db_xref="GeneID:11844834"
                     /translation="MENIALIGIDLGKNSFHIHCQDHRGKAVYRKKFTRPKLIEFLAT
                     CPATTIAMEACGGSHFMARKLEELGHFPKLISPQFVRPFVKSNKNDFVDAEAICEAAS
                     RPSMRFVQPRTESQQAMRALHRVRESLVQDKVKTTNQMHAFLLEFGISVPRGAAVISR
                     LSTLLEDSSLPLYLSQLLLKLQQHYHYLVEQIKDLESQLKRKLDEDEVGQRLLSIPCV
                     GTLTASTISTEIGDGKQYASSRDFAAATGLVPRQYSTGGRTTLLGISKRGNKKIRTLL
                     VQCARVFIQKLEHQSGKLADWVRELLCRKSNFVVTCALANKLARIAWALTARQQTYEA
                     "
     misc_feature    complement(10852..11811)
                     /locus_tag="KPHS_p200210"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3547"
                     /db_xref="CDD:226077"
     gene            complement(11905..12339)
                     /locus_tag="KPHS_p200220"
                     /db_xref="GeneID:11844835"
     CDS             complement(11905..12339)
                     /locus_tag="KPHS_p200220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator MerR"
                     /protein_id="YP_005229638.1"
                     /db_xref="GeneID:11844835"
                     /translation="MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLREPDKPYGSIR
                     RYGEADVVRVKFVKSAQRLGFSLDEIAELLRLDDGTHCEEASSLAEHKLKDVREKMAD
                     LARMETVLSELVCACHARKGNVSCPLIASLQGEAGLARSAMP"
     misc_feature    complement(11908..12339)
                     /locus_tag="KPHS_p200220"
                     /note="putative transcriptional regulator MerR;
                     Provisional; Region: PRK13752"
                     /db_xref="CDD:184302"
     gene            12411..12761
                     /locus_tag="KPHS_p200230"
                     /db_xref="GeneID:11844836"
     CDS             12411..12761
                     /locus_tag="KPHS_p200230"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercuric transport protein"
                     /protein_id="YP_005229639.1"
                     /db_xref="GeneID:11844836"
                     /translation="MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNL
                     TVLEPYRPLFIGAALVALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLV
                     LVALGFPYVVPFFY"
     misc_feature    12411..12758
                     /locus_tag="KPHS_p200230"
                     /note="putative mercuric transport protein; Provisional;
                     Region: PRK13751"
                     /db_xref="CDD:184301"
     gene            12775..13050
                     /locus_tag="KPHS_p200240"
                     /db_xref="GeneID:11844837"
     CDS             12775..13050
                     /locus_tag="KPHS_p200240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229640.1"
                     /db_xref="GeneID:11844837"
                     /translation="MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKAL
                     SKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKATADAGYPSSVKQ"
     misc_feature    <12835..13047
                     /locus_tag="KPHS_p200240"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cl00207"
                     /db_xref="CDD:350951"
     misc_feature    order(12865..12873,12880..12882)
                     /locus_tag="KPHS_p200240"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            13047..13508
                     /locus_tag="KPHS_p200250"
                     /db_xref="GeneID:11844838"
     CDS             13047..13508
                     /locus_tag="KPHS_p200250"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercury transport protein MerC"
                     /protein_id="YP_005229641.1"
                     /db_xref="GeneID:11844838"
                     /translation="MSQQANDNSESRFMGLMTRIADKTGALGSVVSAMGCAACFPALA
                     SFGAAIGLGFLSQYEGLFISRLLPLFAALAFLANALGWFSHRQWLRSLLGMIGPAIVF
                     AATVWLLGNWWTANLMYVGLALMIGVSIWDFVSPAHRRCGPDGCELPAKRL"
     misc_feature    13086..13502
                     /locus_tag="KPHS_p200250"
                     /note="putative mercury transport protein MerC;
                     Provisional; Region: PRK13755"
                     /db_xref="CDD:237490"
     gene            complement(13742..13867)
                     /locus_tag="KPHS_p200260"
                     /db_xref="GeneID:11844839"
     CDS             complement(13742..13867)
                     /locus_tag="KPHS_p200260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229642.1"
                     /db_xref="GeneID:11844839"
                     /translation="MTAICNAPLLPVLSFLPSRSRILSSNPPGVETEGASASVAR"
     gene            13887..15254
                     /locus_tag="KPHS_p200270"
                     /db_xref="GeneID:11844840"
     CDS             13887..15254
                     /locus_tag="KPHS_p200270"
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric ion reductase"
                     /protein_id="YP_005229643.1"
                     /db_xref="GeneID:11844840"
                     /translation="MAAALKAVEQGARVTLIERGTIGGTCVNVGCVPSKIMIRAAHIA
                     HLRRESPFDGGIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSAR
                     FKDNRNLIVQLNDGGERVVAFDRCLIATGASPAVPPIPGLKDTPYWTSTEALVSETIP
                     KRLAVIGSSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFRMEGIEVR
                     EHTQASQVAYINGEGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQ
                     GAIVIDPGMRTSVEHIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAV
                     VFTDPQVATVGYSEAEAHHDGIKTDSRTLTLDNVPRALANFDTRGFIKLVVEEGSGRL
                     IGVQAVAPEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQL
                     SCCAG"
     misc_feature    13887..15251
                     /locus_tag="KPHS_p200270"
                     /note="putative mercuric reductase; Provisional; Region:
                     PRK13748"
                     /db_xref="CDD:184298"
     gene            15272..15634
                     /locus_tag="KPHS_p200280"
                     /db_xref="GeneID:11844841"
     CDS             15272..15634
                     /locus_tag="KPHS_p200280"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator merD"
                     /protein_id="YP_005229644.1"
                     /db_xref="GeneID:11844841"
                     /translation="MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDD
                     AALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQAAAQLAVLRQLVERRRAALAHL
                     DAQLASMPAERAHEEALP"
     misc_feature    15272..15631
                     /locus_tag="KPHS_p200280"
                     /note="transcriptional regulator MerD; Provisional;
                     Region: PRK13749"
                     /db_xref="CDD:184299"
     gene            15631..15867
                     /locus_tag="KPHS_p200290"
                     /db_xref="GeneID:11844842"
     CDS             15631..15867
                     /locus_tag="KPHS_p200290"
                     /codon_start=1
                     /transl_table=11
                     /product="putative mercury resistance protein"
                     /protein_id="YP_005229645.1"
                     /db_xref="GeneID:11844842"
                     /translation="MNAPDKLPPETRQPVSGYLWGALAVLTCPCHLPILAAVLAGTTA
                     GAFLGEHWGVAALALTGLFVLAVTRLLRAFRGGS"
     misc_feature    15631..15864
                     /locus_tag="KPHS_p200290"
                     /note="putative mercury resistance protein; Provisional;
                     Region: PRK13747"
                     /db_xref="CDD:184297"
     gene            15903..16571
                     /locus_tag="KPHS_p200300"
                     /db_xref="GeneID:11844843"
     CDS             15903..16571
                     /locus_tag="KPHS_p200300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229646.1"
                     /db_xref="GeneID:11844843"
                     /translation="MAQAAARGQLDLHYQPLVDLRDHRIAGAEALMRWRHPRLGLLPP
                     GQFLPLAESFGLMPEIGAWVLGEACRQMHKWQGPAWQPFRLAINVSASQVGPTFDDEV
                     KRVLADMALPAELLEIELTESVAFGNPALFASFDALRAIGVRFAADDFGTGYSCLQHL
                     KCCPITTLKIDQSFVARLPDDARDQTIVRAVIQLAHGLGMDVIFRRRLHQLIGRNGCC
                     AASS"
     misc_feature    15909..16511
                     /locus_tag="KPHS_p200300"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2). The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            16646..17914
                     /locus_tag="KPHS_p200310"
                     /db_xref="GeneID:11844844"
     CDS             16646..17914
                     /locus_tag="KPHS_p200310"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase core subunit"
                     /protein_id="YP_005229647.1"
                     /db_xref="GeneID:11844844"
                     /translation="MATDTPRIPEQGVATLPDEAWERARRRAEIISPLAQSETVGHEA
                     ADMAAQALGLSRRQVYVLIRRARQGSGLVTDLVPGQSGGGKGKGRLPEPVERVIHELL
                     QKRFLTKQKRSLAAFHREVTQVCKAQKLRVPARNTVALRIASLDPRKVIRRREGQDAA
                     RDLQGVGGEPPAVTAPLEQVQIDHTVIDLIVVDDRDRQPIGRPYLTLAIDVFTRCVLG
                     MVVTLEAPSAVSVGLCLVHVACDKRPWLEGLNVEMDWQMSGKPLLLYLDNAAEFKSEA
                     LRRGCEQHGIRLDYRPLGQPHYGGIVERIIGTAMQMIHDELPGTTFSNPDQRGDYDSE
                     NKAALTLRELERWLTLAVGTYHGSVHNGLLQPPAARWAEAVARVGVPAVVTRATSFLV
                     DFLPILRRTLTRTGFVIDHIHYYADGHCCK"
     misc_feature    16721..>16852
                     /locus_tag="KPHS_p200310"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:338793"
     misc_feature    17168..17584
                     /locus_tag="KPHS_p200310"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:334200"
     gene            17943..18665
                     /locus_tag="KPHS_p200320"
                     /db_xref="GeneID:11844845"
     CDS             17943..18665
                     /locus_tag="KPHS_p200320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229648.1"
                     /db_xref="GeneID:11844845"
                     /translation="MLMELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAER
                     GVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVD
                     SRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREG
                     RCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQ
                     ASAFYYGDPLGEMRLVSRVFEM"
     misc_feature    17961..18602
                     /locus_tag="KPHS_p200320"
                     /note="Transposase (or an inactivated derivative)
                     [Mobilome: prophages, transposons]; Region: Rve; COG3316"
                     /db_xref="CDD:225853"
     gene            18705..19178
                     /locus_tag="KPHS_p200330"
                     /db_xref="GeneID:11844846"
     CDS             18705..19178
                     /locus_tag="KPHS_p200330"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="YP_005229649.1"
                     /db_xref="GeneID:11844846"
                     /translation="MQQCLFTDKASGSSTDREGLDLLRMKVEEGDVILVKKLDRLGRD
                     TADMIQLIKEFDAQGVAVRFIDDGISTDGDMGQMVVTILSAVAQAERRRILERTNEGR
                     QEAKLKGIKFGRRRTVDRNVVLTLHQKGTGATEIAHQLSIARSTVYKILEDERAS"
     misc_feature    <18720..19007
                     /locus_tag="KPHS_p200330"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(18816..18818,18948..18953,18957..18962,18972..18974)
                     /locus_tag="KPHS_p200330"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(18834..18836,18849..18854,18936..18938,18945..18950,
                     18957..18962,18969..18971,18978..18980)
                     /locus_tag="KPHS_p200330"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(18903..18911,18936..18941,18948..18953,18960..18962,
                     18972..18974,18981..18983,18993..18995)
                     /locus_tag="KPHS_p200330"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(18903..18905,18951..18953,18960..18962,18972..18974,
                     18981..18983,18993..18995)
                     /locus_tag="KPHS_p200330"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(18975..18977,18993..18998)
                     /locus_tag="KPHS_p200330"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    19041..19166
                     /locus_tag="KPHS_p200330"
                     /note="Helix-turn-helix domain of resolvase; Region:
                     HTH_7; pfam02796"
                     /db_xref="CDD:335095"
     gene            19301..20281
                     /locus_tag="KPHS_p200340"
                     /db_xref="GeneID:11844847"
     CDS             19301..20281
                     /locus_tag="KPHS_p200340"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005229650.1"
                     /db_xref="GeneID:11844847"
                     /translation="MTQALHSQARTTHLIREEIRNSTLPQAELARMYNVTRQTIRKWQ
                     NRESPEDKSHAPNKMYTTLTPEQELIVVELRKTLLLPTDDLLAVTREFINPAVSRAGL
                     GRCLRRHGVSDLRNLVEQEGTAPATKKTFKDYEPGFVHIDIKYLPQMPDETARRYLFV
                     AIDRATRWVFIELYADQTDGSSGDFLNKVQQACPVKIVKLLTDNGSQFTDRFTAGGKK
                     KEPSGTHVFDRLCKQLGIEHRLIPPRHPQTNGMVERFNGRISDIVNQTRFGSAAELES
                     TLRNYVKIYNHSIPQRALQHKTPVQALKEWHEKRPELFRKRVYNQPGLDI"
     misc_feature    <19349..>19447
                     /locus_tag="KPHS_p200340"
                     /note="DNA-binding transcriptional regulator YiaG,
                     XRE-type HTH domain [Transcription]; Region: YiaG;
                     COG2944"
                     /db_xref="CDD:225495"
     misc_feature    19718..20077
                     /locus_tag="KPHS_p200340"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:334200"
     misc_feature    20000..20197
                     /locus_tag="KPHS_p200340"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:338895"
     gene            complement(20394..20540)
                     /locus_tag="KPHS_p200350"
                     /db_xref="GeneID:11844848"
     CDS             complement(20394..20540)
                     /locus_tag="KPHS_p200350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229651.1"
                     /db_xref="GeneID:11844848"
                     /translation="MKVELGVAAGCNQAATAGIRGLTLSGTKTHVKKSFFNIIEAFIR
                     VIVS"
     gene            20557..21438
                     /locus_tag="KPHS_p200360"
                     /db_xref="GeneID:11844849"
     CDS             20557..21438
                     /locus_tag="KPHS_p200360"
                     /codon_start=1
                     /transl_table=11
                     /product="Class A Carbapenemase Kpc-2"
                     /protein_id="YP_005229652.1"
                     /db_xref="GeneID:11844849"
                     /translation="MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSI
                     GVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALV
                     PWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFR
                     LDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNH
                     RIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAV
                     IAAAARLALEGLGVNGQ"
     misc_feature    20566..21348
                     /locus_tag="KPHS_p200360"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl21491"
                     /db_xref="CDD:354834"
     gene            complement(21688..22668)
                     /locus_tag="KPHS_p200370"
                     /db_xref="GeneID:11844850"
     CDS             complement(21688..22668)
                     /locus_tag="KPHS_p200370"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005229653.1"
                     /db_xref="GeneID:11844850"
                     /translation="MTEHKAERAPWGDFPAVVRNGDLKDLSKEPEYEAAKHGDHKAMS
                     YKRMKPAEDELHCEIKALLDRAKATDDQERNEPELDIPAEISRREKRLEAIQAAKARL
                     EARQREADQARGRSEDDGRRPRHPDGSDKGGGSYKREFGVPDDRDQESFTDPDSRIMK
                     HAGGGSEQSYNGYTAVDAEHQIIVAAELTNCAADSQALLGMLAAVQANTGEMPAQTLA
                     DAGFRSEAVLAKVADHHGDVIVALGREGREDAKVNAKTHPHTAAIAAKLKTEQGDAAY
                     RRRKSIVEAPNGWIKAVMGLRQFSMRGLDKVQAEWKLVCMALNLRRMAYL"
     misc_feature    complement(21712..22191)
                     /locus_tag="KPHS_p200370"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:334608"
     misc_feature    complement(21697..>21900)
                     /locus_tag="KPHS_p200370"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:338928"
     gene            complement(22673..22969)
                     /locus_tag="KPHS_p200380"
                     /db_xref="GeneID:11844851"
     CDS             complement(22673..22969)
                     /locus_tag="KPHS_p200380"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor protein KorC"
                     /protein_id="YP_005229654.1"
                     /db_xref="GeneID:11844851"
                     /translation="MIRPETLRPFAEDWQAPTADEIKEVLELIRQRKGLSKPLSGVDV
                     ADLVGLPGERGSGKGTRTFRRWVSKTNPSPIAYGAWSILAHLAGFGAIWDADRD"
     gene            complement(23015..23170)
                     /locus_tag="KPHS_p200390"
                     /db_xref="GeneID:11844852"
     CDS             complement(23015..23170)
                     /locus_tag="KPHS_p200390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229655.1"
                     /db_xref="GeneID:11844852"
                     /translation="MNTDIVSLAKHIGDALTARRPVHMPRMKMRELGLLLIELKAYRE
                     AAATVTH"
     gene            complement(23298..23723)
                     /locus_tag="KPHS_p200400"
                     /db_xref="GeneID:11844853"
     CDS             complement(23298..23723)
                     /locus_tag="KPHS_p200400"
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein Klca"
                     /protein_id="YP_005229656.1"
                     /db_xref="GeneID:11844853"
                     /translation="MMQTELNPLICSLVATPRRMAAMPRYVGRFYVVFESMLYQQMKG
                     LCREYRGAYWLMWELSNGGFYMAPGRRDEMLNIEAMNYFSGQMSADAAGITACLYLYS
                     HLSFHTEGADQERFSRLYHSLRDWACEHDEKEAILAAID"
     misc_feature    complement(23301..23585)
                     /locus_tag="KPHS_p200400"
                     /note="Antirestriction protein; Region: Antirestrict;
                     pfam03230"
                     /db_xref="CDD:335269"
     gene            complement(23834..24112)
                     /locus_tag="KPHS_p200410"
                     /db_xref="GeneID:11844854"
     CDS             complement(23834..24112)
                     /locus_tag="KPHS_p200410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229657.1"
                     /db_xref="GeneID:11844854"
                     /translation="MIHTANRTFHQLYREWIRERREHMHNVLTWERDRYGARLVGLFY
                     RYCKVANPFPRCTLNTRINYRAHAVNLPDWPARSLELNKMWLSWREKK"
     gene            complement(24096..24491)
                     /locus_tag="KPHS_p200420"
                     /db_xref="GeneID:11844855"
     CDS             complement(24096..24491)
                     /locus_tag="KPHS_p200420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229658.1"
                     /db_xref="GeneID:11844855"
                     /translation="MANLPGTGSSSTGWPSSDLDARRKSTRWPTYQAPAAARPGGQVQ
                     IWTPEGNQPGGQLTRHRQQLDQVAHFVRTKSGDAMRNLGGNPPRLRDFFNVERAFSCH
                     SRPFWPIILIKKTGHPPRSIPENSDDPHS"
     gene            complement(24646..25206)
                     /locus_tag="KPHS_p200430"
                     /db_xref="GeneID:11844856"
     CDS             complement(24646..25206)
                     /locus_tag="KPHS_p200430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative replication protein"
                     /protein_id="YP_005229659.1"
                     /db_xref="GeneID:11844856"
                     /translation="MRHLFWRLNFLLLSGATNSAQMYHEAAALSSELDTRWSYRSKEL
                     MTLYSKAKSYEAGERVEFGGKSFAPLYTPKNDTLINLFQISQQEQEQLKTIISTDEAQ
                     KRRRERDRLRDEERRRAAGQLEREAYEANSLSRQKPWEAMGMSRAKWYRLGKPSPQQN
                     SETSPSPITNGEASAVALQAARCKAV"
     gene            complement(25499..25666)
                     /locus_tag="KPHS_p200450"
                     /db_xref="GeneID:11844857"
     CDS             complement(25499..25666)
                     /locus_tag="KPHS_p200450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229660.1"
                     /db_xref="GeneID:11844857"
                     /translation="MPLHDVSLVEGGLSALSVPLCLKAHFCQAEIYNLRGHVSKNGKA
                     DSILTKRRGPA"
     gene            25655..26215
                     /locus_tag="KPHS_p200440"
                     /db_xref="GeneID:11844858"
     CDS             25655..26215
                     /locus_tag="KPHS_p200440"
                     /codon_start=1
                     /transl_table=11
                     /product="Tn4653 resolvase"
                     /protein_id="YP_005229661.1"
                     /db_xref="GeneID:11844858"
                     /translation="MQGHRIGYVRVSSFDQNPERQLEQTQVSKVFTDKASGKDTQRPQ
                     LEALLSFVREGDTVVVHSMDRLARNLDDLRRLVQKLTQRGVRIEFLKEGLVFTGEDSP
                     MANLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKALSDEQAATLRQRATA
                     GEPKAQLAREFNISRETLYQYLRTDD"
     misc_feature    25667..26041
                     /locus_tag="KPHS_p200440"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(25682..25684,25688..25690,25844..25849,25856..25858)
                     /locus_tag="KPHS_p200440"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    25688..25690
                     /locus_tag="KPHS_p200440"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(25841..25843,25982..25987,25991..25996,26006..26008)
                     /locus_tag="KPHS_p200440"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(25859..25861,25874..25879,25970..25972,25979..25984,
                     25991..25996,26003..26005,26012..26014)
                     /locus_tag="KPHS_p200440"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(25928..25936,25970..25975,25982..25987,25994..25996,
                     26006..26008,26015..26017,26027..26029)
                     /locus_tag="KPHS_p200440"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(25928..25930,25985..25987,25994..25996,26006..26008,
                     26015..26017,26027..26029)
                     /locus_tag="KPHS_p200440"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(26009..26011,26027..26032)
                     /locus_tag="KPHS_p200440"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    26075..26200
                     /locus_tag="KPHS_p200440"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cd00569"
                     /db_xref="CDD:259851"
     misc_feature    order(26078..26086,26180..26185,26189..26197)
                     /locus_tag="KPHS_p200440"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            26219..29185
                     /locus_tag="KPHS_p200460"
                     /db_xref="GeneID:11844859"
     CDS             26219..29185
                     /locus_tag="KPHS_p200460"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase for transposon Tn1721"
                     /protein_id="YP_005229662.1"
                     /db_xref="GeneID:11844859"
                     /translation="MPRRLILSATERDTLLALPESQDDLIRYYTFNDSDLSLIRQRRG
                     DANRLGFAVQLCLLRYPGYALGTDSELPEPVILWVAKQVQAEPASWAKYGERDVTRRE
                     HAQELRTYLQLAPFGLSDFRALVRELTELAQQTDKGLLLAGQALESLRQKRRILPALS
                     VIDRACSEAIARANRRVYRALVEPLTDSHRAKLDELLKLKAGSSITWLTWLRQAPLKP
                     NSRHMLEHIERLKTFQLVDLPEGLGRHIHQNRLLKLAREGGQMTPKDLGKFEPQRRYA
                     TLAAVVLESTATVIDELVDLHDRILVKLFSGAKHKHQQQFQKQGKAINDKVRLYSRIG
                     QALLEAKESGSDPYAAIEAVIPWDEFTESVSEAELLARPEGFDHLHLVGENFATLRRY
                     TPALLEVLELRAAPAAQGVLAAVQTLREMNADNLRKVPADAPTAFIKPRWKPLVITPE
                     GLDRKFYEICALSELKNALRSGDIWVKGSRQFRDFDDYLLPAEKFAALKREQALPLAI
                     NPNSDQYLEERLQLLDEQLATVTRLAKDNELPDAILTESGLKITPLDAAVPDRAQALI
                     DQTSQLLPRIKITELLMDVDDWTGFSRHFTHLKDGAEAKDRTLLLSAILGDAINLGLT
                     KMAESSPGLTYAKLSWLQAWHIRDETYSAALAELVNHQYRHAFAAHWGDGTTSSSDGQ
                     RFRAGGRGESTGHVNPKYGSEPGRLFYTHISDQYAPFSTRVVNVGVRDSTYVLDGLLY
                     HESDLRIEEHYTDTAGFTDHVFALMHLLGFRFAPRIRDLGETKLYVPQGVQAYPTLRP
                     LIGGTLNIKHVRAHWDDILRLASSIKQGTVTASLMLRKLGSYPRQNGLAVALRELGRI
                     ERTLFILDWLQSVELRRRVHAGLNKGEARNSLARAVFFNRLGEIRDRSFEQQRYRASG
                     LNLVTAAIVLWNTVYLERATQGLVEAGKPVDGELLQFLSPLGWEHINLTGDYVWRQSR
                     RLEDGKFRPLRMPGKP"
     misc_feature    26234..26725
                     /locus_tag="KPHS_p200460"
                     /note="Domain of unknown function (DUF4158); Region:
                     DUF4158; pfam13700"
                     /db_xref="CDD:338907"
     misc_feature    27959..29116
                     /locus_tag="KPHS_p200460"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     pfam01526"
                     /db_xref="CDD:334579"
     gene            29327..29521
                     /locus_tag="KPHS_p200470"
                     /db_xref="GeneID:11844860"
     CDS             29327..29521
                     /locus_tag="KPHS_p200470"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS26"
                     /protein_id="YP_005229663.1"
                     /db_xref="GeneID:11844860"
                     /translation="MIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQAS
                     AFYYGDPLGEMRLVSRVFEM"
     misc_feature    <29327..29452
                     /locus_tag="KPHS_p200470"
                     /note="DDE domain; Region: DDE_Tnp_IS240; cl26089"
                     /db_xref="CDD:330910"
     gene            complement(29723..30196)
                     /locus_tag="KPHS_p200480"
                     /db_xref="GeneID:11844861"
     CDS             complement(29723..30196)
                     /locus_tag="KPHS_p200480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229664.1"
                     /db_xref="GeneID:11844861"
                     /translation="MNNIEIIESGYNALCDAYNNSVISLKRSSLYEDLLVHMDIPEKN
                     RSRFTYATLNDRDEIIAICVFIVSLDEGTTDVGWFVRADFRGKGVGRDTVEKAFNEFK
                     NGLKGAGVEAIFIGATVDNGNTPSISLGQRFIGGEEIIEKEDGTTIYSYLNRFTL"
     misc_feature    complement(29801..>30103)
                     /locus_tag="KPHS_p200480"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; cl29704"
                     /db_xref="CDD:356580"
     misc_feature    complement(<29888..30034)
                     /locus_tag="KPHS_p200480"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_7; pfam13508"
                     /db_xref="CDD:338785"
     gene            complement(30286..30549)
                     /locus_tag="KPHS_p200490"
                     /db_xref="GeneID:11844862"
     CDS             complement(30286..30549)
                     /locus_tag="KPHS_p200490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229665.1"
                     /db_xref="GeneID:11844862"
                     /translation="MIGWMSPDRKTNFLSHSANLRFYALCSVEGLNSYIAPEKIKAQI
                     KVSRGGKGISRLIRVLGKNEFIRIVKDSQTVLTIGMDNSIATG"
     gene            complement(30616..31119)
                     /locus_tag="KPHS_p200500"
                     /db_xref="GeneID:11844863"
     CDS             complement(30616..31119)
                     /locus_tag="KPHS_p200500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_005229666.1"
                     /db_xref="GeneID:11844863"
                     /translation="MVNVGFTGSETTVRDVVAKWRKQVNSPVIAPVRLPSASRVSRWL
                     MPWRMIRGEENYASRFIESMCQKEPQLKMAQQLSLDFYRMLKTKNKSQLNQSFTDVSQ
                     SGLIDLQRVAASMEADATAIHEAISSRWSNGVVEGHVNRLKMLKRQMYGRAGFELLRR
                     RVMSPLA"
     misc_feature    complement(30631..>30915)
                     /locus_tag="KPHS_p200500"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3464"
                     /db_xref="CDD:225995"
     gene            complement(31132..31464)
                     /locus_tag="KPHS_p200510"
                     /db_xref="GeneID:11844864"
     CDS             complement(31132..31464)
                     /locus_tag="KPHS_p200510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229667.1"
                     /db_xref="GeneID:11844864"
                     /translation="MSKVFFVWDLFIKIMLLLPIPLITVFPNIIPFLTYRQNGDKNKS
                     ALMDTLAREMDKQQPCAYLVESCVSRPHNIRPIPWAFLRVVLHYSNSMEIIQLVSSGR
                     RILALLQI"
     gene            complement(31850..32803)
                     /locus_tag="KPHS_p200520"
                     /db_xref="GeneID:11844865"
     CDS             complement(31850..32803)
                     /locus_tag="KPHS_p200520"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229668.1"
                     /db_xref="GeneID:11844865"
                     /translation="MFSSFSHIIPVGPVMIKFKRIRTHNNLDFTNRHHDIFFYGEELD
                     ERTGLAIKKVNASNAFQVKYVKDEYALKLNGNKYKLLALKDALISMSPKKVIIDSTSL
                     DFPEILYLFYSINMIEGIESFTVLYIEPKEYSKSPSTEGGDEEYQLSDGRQPFSSLPV
                     FSLNTITSGLQKTSLVSFLGFENSRLGQILSNDDGASFNKLLACISVPAYIPGWENKS
                     LRKHLLHFDSMETDLRTCPGANPYAVYQTLLDIYAENPRLVLTSLGTKPTAIGICVFL
                     INNHPNNSVEKQLGAIYDYPIKSINRTIGIGEIYSYELSIS"
     gene            complement(32816..34759)
                     /locus_tag="KPHS_p200530"
                     /db_xref="GeneID:11844866"
     CDS             complement(32816..34759)
                     /locus_tag="KPHS_p200530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229669.1"
                     /db_xref="GeneID:11844866"
                     /translation="MKFNEIFSKNRAEELPDDLYGKYVLPLGYEDVNLKKTTKASIVI
                     GGRGYGKTMFLKYHCHQTALSVNKDTIGIEDLSNLGIYWRPDTSFSQLLTEAWLGKFW
                     STAFKTYMSLSLIIEFVKLTNNLLSEKSPVFSLKEKINNLKLPDTISEGLGIDKNAKL
                     VDVSDLLHERLFTLCNWINAPVTETPPFSLDTKFSLQNIISKLHAITGCIIKPNFQVY
                     IDEFENLTSDQQAIINTLMKHGSMPLLFSVAYKKNANISHKTLGNESIVEQHDFRYID
                     LEELYLNDFDTFAGEILALRFSDYIENTDHEKLRSIFTSEHQIPHRQTKEYQDSIKNL
                     ASKFLPEKSTKEISHEIFSDDALTKKLHSMIETGLSKSKSKLQVQYFIDDKFPEASLI
                     NGALLNRKSISPDEVLEQYLQYKAGHTTKYKSWIPNNLVGVILYLYNKLPTRICPLYA
                     GYKQFVYLSRGNIRHFLELCHQSVTKTNITSPLPPKTIPSMTIEAQLEATLKTSELEI
                     EKIGDFGAHGMHLKRVAKRLGAIFNYCQSRRSQSESEVNHFTLDLTDINLLAYNVKEI
                     LNESLVWSVLIEQKGTKSKSTDNLELNDYVLHPVLAPYFGISHRKKKKIKFSKGEVET
                     IFVGSDEDFSSLLKKIWSPVGYR"
     gene            complement(34763..35656)
                     /locus_tag="KPHS_p200540"
                     /db_xref="GeneID:11844867"
     CDS             complement(34763..35656)
                     /locus_tag="KPHS_p200540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229670.1"
                     /db_xref="GeneID:11844867"
                     /translation="MKIDHITARDTEAIIEQSKKLIKIGYWDNVKVSVLQRWLDNFKD
                     EKEKYLAASVLSELIYRNRETVTSMGYNISSIILPQILEELDIYHIEDIEKWMNDINS
                     PKHARNLPFRTSVINNVDSKVTKSGDVIHTFLQRDFFDKNLGVKVENIEKLPPRIKAI
                     VFFDDMLGSGTQIDTFMKETNLDELGKKIIFIPFAALRDSTIRIQSKYKNLIIRPVEY
                     LDENHSFFRASNRRINREYFYTHNDFLRLYIDICNKNSISNPLGFGNLGLSYVLANST
                     PNNNLSFLWFENEGWNRLFKR"
     gene            complement(35664..36926)
                     /locus_tag="KPHS_p200550"
                     /db_xref="GeneID:11844868"
     CDS             complement(35664..36926)
                     /locus_tag="KPHS_p200550"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase family protein"
                     /protein_id="YP_005229671.1"
                     /db_xref="GeneID:11844868"
                     /translation="MNYLLNDMAIRHDDLRAVAFQKQEQKRRKFKLSMGKTISRKKRL
                     SQYYTNRDVAELLISSLPSDEASTIIDLSAGEGSLLMTAALKYDNAKLYGIDIDDENC
                     RKLDLLQNTTSICLDATHSASFDKIKAQNSTYGIVIGNPPFYTAEHTAYTRFLFKEWA
                     LNHKTKYYRAEVLFLMLSLKLLDRDSCCGIVVPDTIFSSEKYKPLREKITSLFKYIDV
                     IELDNKAFLGTEARTHILTVSNKKSISPSITTRSSKKNKAIRLKKEEFIERADHQYNS
                     FKYNNNEKTIETSGIKVMRGNISKTKKTQLHDAIIHSSSFYNDFSLFENNNDSAENGS
                     AVQAVKGDVVVPRVGTRCLGKVGIIRNGSFSITDCVFVIKASEYECGEMVAAALKSKF
                     GVDWIKSISKGIGAQYITLNDIKKLPLR"
     misc_feature    complement(36081..>36806)
                     /locus_tag="KPHS_p200550"
                     /note="Type I restriction-modification system, DNA
                     methylase subunit [Defense mechanisms]; Region: HsdM;
                     COG0286"
                     /db_xref="CDD:223363"
     misc_feature    complement(<35670..>35909)
                     /locus_tag="KPHS_p200550"
                     /note="Type I restriction-modification system specificity
                     (S) subunit Target Recognition Domain-ConseRved domain
                     (TRD-CR) and similar domains; Region:
                     RMtype1_S_TRD-CR_like; cl38903"
                     /db_xref="CDD:365779"
     gene            37376..37585
                     /locus_tag="KPHS_p200560"
                     /db_xref="GeneID:11844869"
     CDS             37376..37585
                     /locus_tag="KPHS_p200560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229672.1"
                     /db_xref="GeneID:11844869"
                     /translation="MLLTLRGMFINYFSDTRKLNTVAAKPYPLKTSQEPLYAVGVVPT
                     RRQPQSGRISALAGRRAAYERVLNN"
     gene            37794..37928
                     /locus_tag="KPHS_p200570"
                     /db_xref="GeneID:11844870"
     CDS             37794..37928
                     /locus_tag="KPHS_p200570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229673.1"
                     /db_xref="GeneID:11844870"
                     /translation="MGALSGVAEPARPSGRCKGGHSLQPVHRAGDEQVMCLQDLLKDL
                     "
     gene            complement(38013..38171)
                     /locus_tag="KPHS_p200580"
                     /db_xref="GeneID:11844871"
     CDS             complement(38013..38171)
                     /locus_tag="KPHS_p200580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229674.1"
                     /db_xref="GeneID:11844871"
                     /translation="MPGYYVLSYLQACIPHHNSGLPGVNVALNVIAGVTFNGRFLLST
                     YNCKGVFH"
     gene            complement(38222..39079)
                     /locus_tag="KPHS_p200590"
                     /db_xref="GeneID:11844872"
     CDS             complement(38222..39079)
                     /locus_tag="KPHS_p200590"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepA"
                     /protein_id="YP_005229675.1"
                     /db_xref="GeneID:11844872"
                     /translation="MTDILQNHYSQVKNPNPVFTPREGKKTLPFCRKLMAKAEGFTSR
                     FDFSIHVAFLRSLGKRHRMPPLLRRRAIDALLQAMCFHYDPLANRVQRSITNMAIECG
                     LATESRSGNLSVSRATRALKFLAELGLITYQTEYDPQIGCNIPTDITFTPALFSALDV
                     SEVAVVAARRSRVEWENLQRKKQKLKPLEMDELIAKAWRFVRERFRSYQAERKSHGRK
                     RDTARRDASRQRHDIETRVRQQLTREYATGRFRGDKEALKREVERRVQERMLLSRGNN
                     YTRLATVPI"
     misc_feature    complement(38225..39079)
                     /locus_tag="KPHS_p200590"
                     /note="replication protein; Provisional; Region: PRK13750"
                     /db_xref="CDD:184300"
     gene            complement(39381..39650)
                     /locus_tag="KPHS_p200600"
                     /db_xref="GeneID:11844873"
     CDS             complement(39381..39650)
                     /locus_tag="KPHS_p200600"
                     /codon_start=1
                     /transl_table=11
                     /product="replication regulatory protein RepA2"
                     /protein_id="YP_005229676.1"
                     /db_xref="GeneID:11844873"
                     /translation="MLEEAEMSQVVNGVTSSSKRPYRKGNPLSAADKQRSSVAKKRAT
                     HKEVKVFLEPQLKEILMKMCHDDGLTQAEVLSRLIHREALARNIA"
     misc_feature    complement(39384..39632)
                     /locus_tag="KPHS_p200600"
                     /note="replication protein; Provisional; Region: PRK13702"
                     /db_xref="CDD:184258"
     gene            complement(39768..40247)
                     /locus_tag="KPHS_p200610"
                     /db_xref="GeneID:11844874"
     CDS             complement(39768..40247)
                     /locus_tag="KPHS_p200610"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="YP_005229677.1"
                     /db_xref="GeneID:11844874"
                     /translation="MYAASIETGYSPEGTALQLVLKTINSAQQEIRLMGYSFTSPEVA
                     GALVRAKQRGLDVKVVLDWKANTGRQNKASLAAMNLLVNAGIPVRTVSQYKIMHDKVI
                     IADGRNVEVGSFNYTRAADRVNSENVLVVWDVPVVAQHYLRHWQSRWNGGTDWYSSY"
     misc_feature    complement(39798..40235)
                     /locus_tag="KPHS_p200610"
                     /note="Catalytic domain of EDTA-resistant nuclease Nuc
                     from Salmonella typhimurium and similar proteins; Region:
                     PLDc_Nuc; cd09170"
                     /db_xref="CDD:197267"
     misc_feature    complement(order(39870..39872,39903..39905,39909..39911,
                     39948..39950,39954..39956))
                     /locus_tag="KPHS_p200610"
                     /note="putative active site [active]"
                     /db_xref="CDD:197267"
     misc_feature    complement(39954..39956)
                     /locus_tag="KPHS_p200610"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197267"
     gene            complement(40482..41204)
                     /locus_tag="KPHS_p200620"
                     /db_xref="GeneID:11844875"
     CDS             complement(40482..41204)
                     /locus_tag="KPHS_p200620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229678.1"
                     /db_xref="GeneID:11844875"
                     /translation="MLMELHMNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAER
                     GVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVD
                     SRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREG
                     RCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQ
                     ASAFYYGDPLGEMRLVSRVFEM"
     misc_feature    complement(40545..41186)
                     /locus_tag="KPHS_p200620"
                     /note="Transposase (or an inactivated derivative)
                     [Mobilome: prophages, transposons]; Region: Rve; COG3316"
                     /db_xref="CDD:225853"
     gene            41211..41540
                     /locus_tag="KPHS_p200630"
                     /db_xref="GeneID:11844876"
     CDS             41211..41540
                     /locus_tag="KPHS_p200630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229679.1"
                     /db_xref="GeneID:11844876"
                     /translation="MISLSPPTICNSAVRFIDDGISTDGDMGQMVVTILSAVAQAERR
                     RILERTNEGRQEAKLKGIKFGRRRTVDRNVVLTLHQKGTGATEIAHQLSIARSTVYKI
                     LEDERAS"
     misc_feature    <41250..41525
                     /locus_tag="KPHS_p200630"
                     /note="Site-specific DNA recombinase related to the DNA
                     invertase Pin [Replication, recombination and repair];
                     Region: PinE; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    <41250..41393
                     /locus_tag="KPHS_p200630"
                     /note="Resolvase, N terminal domain; Region: Resolvase;
                     pfam00239"
                     /db_xref="CDD:278660"
     misc_feature    41403..41528
                     /locus_tag="KPHS_p200630"
                     /note="Helix-turn-helix domain of resolvase; Region:
                     HTH_7; pfam02796"
                     /db_xref="CDD:280890"
     gene            41723..42583
                     /locus_tag="KPHS_p200640"
                     /db_xref="GeneID:11844877"
     CDS             41723..42583
                     /locus_tag="KPHS_p200640"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="YP_005229680.1"
                     /db_xref="GeneID:11844877"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW"
     misc_feature    41729..42580
                     /locus_tag="KPHS_p200640"
                     /note="beta-lactamase TEM; Provisional; Region: PRK15442"
                     /db_xref="CDD:185339"
     gene            complement(42816..43124)
                     /locus_tag="KPHS_p200650"
                     /db_xref="GeneID:11844878"
     CDS             complement(42816..43124)
                     /locus_tag="KPHS_p200650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229681.1"
                     /db_xref="GeneID:11844878"
                     /translation="MIIAAEVKRDEQGYWTHPALVRSGCETSAELSYWLRTHKLQCFV
                     MTMRDEAPEAFAAGFTDEAPDARGWIPEPPDDDGWFLGSVHDTGDGPVCYWFRHTTKS
                     "
     gene            complement(43121..43771)
                     /locus_tag="KPHS_p200660"
                     /db_xref="GeneID:11844879"
     CDS             complement(43121..43771)
                     /locus_tag="KPHS_p200660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229682.1"
                     /db_xref="GeneID:11844879"
                     /translation="MAKILMMAGSTVVVLSLLGFLVLLLKGRAVTKTSPVLRSLKALG
                     IRPSEAEQRLCRQRVWVGNDTLMTPREQHFFRALLRHTSRTRWLLCPQVRVADIATLS
                     PHIRPRSRTWWQLFRMASQWHCDVVIVDIHTFAIIGAVELDDASHQKKHRIRRDILLE
                     EVLRQAGIPLLRDRDSESLVRKVVEFLKYREAGAEEKSITVMKSTTKHSEHKEKEK"
     misc_feature    complement(43256..43576)
                     /locus_tag="KPHS_p200660"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00516"
                     /db_xref="CDD:351129"
     gene            complement(43827..44471)
                     /locus_tag="KPHS_p200670"
                     /db_xref="GeneID:11844880"
     CDS             complement(43827..44471)
                     /locus_tag="KPHS_p200670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229683.1"
                     /db_xref="GeneID:11844880"
                     /translation="MFRYFILRPEQQLFCYLYGCALALVQMVLFSPVSRASGFYLVAL
                     SVALFWAGLALYTRHIDRMRKPEVSPLVSIRDGIQVVAEVPRYEKARLEWEILRDDEV
                     FRQQRCELTGLTGRVISRGLLYTPAVMLVGIGILAWGSPQDAIRLINALRNMPAAELV
                     HQIGFVLCHFLQISVISVLIADVVAGRGLPNVFRRALLDRLPAEFCLIRRGTER"
     gene            complement(44521..45123)
                     /locus_tag="KPHS_p200680"
                     /db_xref="GeneID:11844881"
     CDS             complement(44521..45123)
                     /locus_tag="KPHS_p200680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229684.1"
                     /db_xref="GeneID:11844881"
                     /translation="MTMTEKIIALVDYENIGTLENVRLSRYERLILFTGPQQEFIRFP
                     AVTYAGDISVSVFQVSNVSKNNVDFHLVFELGRLSATAPEETIFHIISNDKGYDGVIA
                     ELCRAGRRCCRISSPCSAEKPKAAPMVISNDEVLHLTDKVQSLSKKSAGNRPANTSSL
                     MNYIKSLSGNTKGMALYGRVKEELIRRGVIAVYEKTVVWR"
     gene            complement(45284..45877)
                     /locus_tag="KPHS_p200690"
                     /db_xref="GeneID:11844882"
     CDS             complement(45284..45877)
                     /locus_tag="KPHS_p200690"
                     /codon_start=1
                     /transl_table=11
                     /product="fertility inhibition protein"
                     /protein_id="YP_005229685.1"
                     /db_xref="GeneID:11844882"
                     /translation="MAEEKRPVLSLKRKPAENSTAPAEATPAPGVVRRKKVVVVSSPP
                     AWKAKKAKLEKAKQAAEADARNAAPAPDKAVKTPPPVRYLRLLPPEQAIMTLKAFWPQ
                     LFDGNSPRLLATGMREQLFADIVNRDLPLSHKQVIKCLKSLTRSAGYLSRMKVGASRY
                     DLQGNAVATVTAEEAQYASERMMKELLRAERKMSQTL"
     misc_feature    complement(45287..45877)
                     /locus_tag="KPHS_p200690"
                     /note="conjugal transfer fertility inhibition protein
                     FinO; Provisional; Region: PRK13754"
                     /db_xref="CDD:184304"
     gene            complement(45949..46674)
                     /locus_tag="KPHS_p200700"
                     /db_xref="GeneID:11844883"
     CDS             complement(45949..46674)
                     /locus_tag="KPHS_p200700"
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     acetylase TraX"
                     /protein_id="YP_005229686.1"
                     /db_xref="GeneID:11844883"
                     /translation="MRAQHTFPGATDSWLQRLLTWTPGQTDMIKTVALVLMVTDHTGL
                     LLAGNNEVMRLLGRGCFPLFGLAWGMNLARHAEIRQSQLNNLWGWALVAQVSFMLIGY
                     SWYTGNILFAFAVTGQVLRWVSQPSWYYTLLAAGLLVTWIPLSTGSYGMAGVGMLTAS
                     WLLCRAQHAPERLGYGVLWALMVLLMNMHDVSESVAGLAIALLTLMVCSSAGERVKRF
                     WPRQFFVMFYAVHLAVLGIVVSM"
     misc_feature    complement(45961..46644)
                     /locus_tag="KPHS_p200700"
                     /note="TraX protein; Region: TraX; cl05434"
                     /db_xref="CDD:297025"
     gene            complement(46754..52012)
                     /locus_tag="KPHS_p200710"
                     /db_xref="GeneID:11844884"
     CDS             complement(46754..52012)
                     /locus_tag="KPHS_p200710"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer nickase/helicase TraI"
                     /protein_id="YP_005229687.1"
                     /db_xref="GeneID:11844884"
                     /translation="MLSFSQVKSAGSAGNYYTEKDNYYVIGSMEERWQGKGAELLGLE
                     GKVDKQVFTELLQGKLPDGSDLTRIQDGVNKHRPGYDLTFSAPKSVSMLAMLGGDKRL
                     IDAHNRAVTVALNQVESLASTRVKKDGVSETVLTGNLIIARFNHDTSRAQDPQIHTHS
                     VVINATQNGDKWQTLASDTVGKTGFSETILANRIAFGKIYQNSLRADVESMGYKTVDA
                     GRNGMWEMEGVPVESFSTRSQELREAAGPDASLKSRDVAALDTRKSKEAIDPAEKMVE
                     WMNTLKETGFDIRGYREATDARAAELARAPAAPVNTDGPDITDVVTKAIAGLSDRKVQ
                     FTYADLLARTVGQLEAKDGVFELARKGINAAIEREQLIPLDREKGLFTSNIHVLDELA
                     VKALSQEVQRQNHVSVTPDASVVRQVTFSDAVSVLAQDRPVMGIVSGQGGATGQRERV
                     AELTLMAREQGRDVHILAADNRSRDFLAGDVRLAGETVTGKSALQDGTAFIPGGTLIV
                     DQAEKLSLKETISLLDGAMRHNVQVLLSDSGKRSGTGSALTVLKDSGVNTYRWQGGHQ
                     TTADIISEPDKGARYSRLAQEFAVSVREGQESVAQISGTREQSVLNGLIRDSLRQEGV
                     LGEKDTTITALTPVWLDSKSRGVRDYYREGMVMERWDPETRTHDRFVIDRVTASSNML
                     TLKDREGDRLDLKVSAVDSQWTLFRADTLPVAEGERLAVLGKIPDTRLKGGESVTVMK
                     VEDGQLTVQRPGQKTTQTLAVGAGVFDGIKVGHGWVESPGRSVSETATVFASVTQREL
                     DNATLNQLAQSGSHLRLYSAQDAARTTEKLSRHTAFSVVSEQLKSRSGETDLDAAIAQ
                     QKAGLHTPAEQAIHLAIPLLESQDLTFSRPQLLATAMETGGGKVSMADIDTTIQAQIR
                     SGQLLNVPVAPGRGNDLLISRQAWDAEKSILTRVLEGKDAVAPLMDRVPASLMTDLTA
                     GQRASTRMILETPDRFTVVQGYAGVGKTTQFRAVMSAISLLPEETRPHVIGLGPTHRA
                     VGEMQSAGVDARTTASFLHDTQLLQRNGQTPDFSNTLFLLDESSMVGLSDTAKALSLI
                     AAGGGRAVLSGDTDQLQSISPGQPFRLMQQRSAADVAIMKEIVRQVPELRPAVYSLIE
                     RDLHRALTTIEQVTPEQVPRKEGAWAPGSSVVEFTPKQEKAIEKALSEGKTLPEGQPA
                     TLYEALVKDYTGRTPEAQSQTLVITHLNKDRRALNSLIHDARRENGETGKEEITLPVL
                     VTSNIRDGELRKLSTWTAHKEAVALVDNVYHRISKVDKDNQLITLTDSEGKERFISPR
                     EASAEGVTLYRQEKITVSQGDRMRFSKSDPERGYVANSIWEVQSVSGDSVTLSDGKIT
                     RTLTPKAEQAQQHIDLAYAITAHGAQGASEPYAIALEGVAGGREQMASFESAYVALSR
                     MKQHVQVYTDSREGWIKAIKNSPEKATAHDILEPRNDRAVKTADLLFGRARPLDETAA
                     GRAALQQSGLAQGSSPGKFISPGKKYPQPHVALPAFDKNGKAAGIWLSPLTDRDGRLE
                     AIGGEGRIMGNEDARFVALQNSRNGESLLAGNMGEGVRMARDNPDTGVVVRLAGDDRP
                     WNPGAMTGGRVWAEPAPVAPVPQAGADIILPPEVLAQRAAEEQQRREMEKQAEQTARE
                     VAGEARKAGEPADRVKEVIGDVIRGLERDRPGTEKTTLPDDPQFRRQEAAIQQVASER
                     LQRERLQAVERDMVRDLNREKTLGGD"
     misc_feature    complement(46772..52009)
                     /locus_tag="KPHS_p200710"
                     /note="conjugal transfer nickase/helicase TraI;
                     Provisional; Region: PRK13709"
                     /db_xref="CDD:237478"
     misc_feature    complement(51149..51976)
                     /locus_tag="KPHS_p200710"
                     /note="TrwC relaxase; Region: TrwC; cl19905"
                     /db_xref="CDD:303073"
     misc_feature    complement(48551..49105)
                     /locus_tag="KPHS_p200710"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:290335"
     misc_feature    complement(47690..47833)
                     /locus_tag="KPHS_p200710"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; cl22977"
                     /db_xref="CDD:304668"
     misc_feature    complement(47360..47719)
                     /locus_tag="KPHS_p200710"
                     /note="DNA helicase TraI; Region: TraI; pfam07057"
                     /db_xref="CDD:284471"
     gene            complement(52012..54291)
                     /locus_tag="KPHS_p200720"
                     /db_xref="GeneID:11844885"
     CDS             complement(52012..54291)
                     /locus_tag="KPHS_p200720"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="YP_005229688.1"
                     /db_xref="GeneID:11844885"
                     /translation="MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLM
                     LMYRLSWQTFVNGCVYWWCTTLGPMRDIIRSQPVYTIQYYGQSLEYTSEQILADKYTI
                     WCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQQSEDENTGGRQLSDKPKEVA
                     RQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVRARGDMAII
                     YDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDP
                     FWQGSGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIE
                     KTAISIRAVLTNYVKAIRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHA
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWIFADELPTLHKLPDLVEILPEARKFGGCY
                     VFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIAEFAAGEIGEKEILKASEQ
                     YSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLALKYKPRP
                     KIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPE
                     PVSPPAPAEMTVSPAPVKRRRQQSVRQRSLPSCRSRPYRCSTKAAAAAATASSAGTPA
                     AAAGGTEQELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADDQTQRDMQRREEVN
                     INHSHRHDEQDDVEIGGNI"
     misc_feature    complement(52015..54291)
                     /locus_tag="KPHS_p200720"
                     /note="conjugal transfer protein TraD; Provisional;
                     Region: PRK13700"
                     /db_xref="CDD:184256"
     misc_feature    complement(53908..54198)
                     /locus_tag="KPHS_p200720"
                     /note="F sex factor protein N terminal; Region: TraD_N;
                     pfam12615"
                     /db_xref="CDD:289388"
     misc_feature    complement(52618..53862)
                     /locus_tag="KPHS_p200720"
                     /note="Bacterial conjugation protein TrwB, ATP binding
                     domain. TrwB is a homohexamer encoded by conjugative
                     plasmids in Gram-negative bacteria. TrwB also has an all
                     alpha domain which has been hypothesized to be responsible
                     for DNA binding. TrwB is a component...; Region: TrwB;
                     cd01127"
                     /db_xref="CDD:238547"
     misc_feature    complement(order(52645..52647,52675..52677,52684..52689,
                     52693..52695,52699..52704,52714..52719,52780..52782,
                     52795..52797,52804..52806,52825..52830,52870..52875,
                     52879..52884,52888..52893,52906..52911,52918..52920,
                     52927..52929,52960..52962,53266..53271,53278..53280,
                     53299..53301,53353..53355,53458..53463,53473..53475,
                     53518..53520,53707..53712,53845..53853))
                     /locus_tag="KPHS_p200720"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238547"
     misc_feature    complement(53695..53718)
                     /locus_tag="KPHS_p200720"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238547"
     misc_feature    complement(order(52960..52962,53689..53709))
                     /locus_tag="KPHS_p200720"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238547"
     misc_feature    complement(53017..53031)
                     /locus_tag="KPHS_p200720"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238547"
     gene            complement(54418..55107)
                     /locus_tag="KPHS_p200730"
                     /db_xref="GeneID:11844886"
     CDS             complement(54418..55107)
                     /locus_tag="KPHS_p200730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229689.1"
                     /db_xref="GeneID:11844886"
                     /translation="MTISVPVRSLDTHELMPGDIYPHPAAGGIYSLSHREVCSLFSDH
                     IMYICSALVILLLVFIAGVFFRKIMTSSVERKRNTASVISDAKPEVQSKPEYFHLSIC
                     VEGPASTDDSALSSLASRVVREAENLYIPGVNRRDSADDVFAWSVQTQFPSDRLFGTR
                     IFPSTGWFERPDMIKHPVKCYCVCLQYTTETLPSTLYALVDEAGRQVAKSYIKGGHCP
                     GSEGYTFCITS"
     gene            complement(55300..56031)
                     /locus_tag="KPHS_p200740"
                     /db_xref="GeneID:11844887"
     CDS             complement(55300..56031)
                     /locus_tag="KPHS_p200740"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer surface exclusion protein
                     TraT"
                     /protein_id="YP_005229690.1"
                     /db_xref="GeneID:11844887"
                     /translation="MKLNKFMAVMVVSSALVLSGCSAMGTAIKKRNLEVKTQMSETIW
                     LEPSNNKTVYLQIKNTSDKDMSGLQAKIASAVTSKGYQVVSNPDTAGYWIQANVLKAD
                     KMDLRESQGWLSRGYEGAVTGAALGAGITAYNSSSAGATLGVGLAAGLVGMAADAMVE
                     DVNYTMITDVQIAERTKTQVQTDNVAVLRQGTSGAKVQTSTETGNQHKYQTRVVSNAN
                     KVNLKFPEAQPVLEDQLAKSIANIL"
     misc_feature    complement(55303..56031)
                     /locus_tag="KPHS_p200740"
                     /note="conjugal transfer surface exclusion protein TraT;
                     Provisional; Region: PRK13731"
                     /db_xref="CDD:184283"
     gene            complement(56217..56750)
                     /locus_tag="KPHS_p200750"
                     /db_xref="GeneID:11844888"
     CDS             complement(56217..56750)
                     /locus_tag="KPHS_p200750"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer entry exclusion protein TraS"
                     /protein_id="YP_005229691.1"
                     /db_xref="GeneID:11844888"
                     /translation="MMMTNKILIEEVDELKNVFSRGEMEIPSFWSCLWPGVIVAAWNM
                     ICALISVGGGYLSVKFIFWVLVFPGVISLIVLLGVASARSLFLSVPRTYRMRSQVYRF
                     ISRKVMVYALVYMALILALALFNRVYYASPFPFSFMILIATIFVWFVMNIDFGRYQLS
                     VLSSAINSFRAEKLGGG"
     misc_feature    complement(56232..56747)
                     /locus_tag="KPHS_p200750"
                     /note="conjugal transfer entry exclusion protein TraS;
                     Provisional; Region: PRK13741"
                     /db_xref="CDD:172283"
     gene            complement(56753..59602)
                     /locus_tag="KPHS_p200760"
                     /db_xref="GeneID:11844889"
     CDS             complement(56753..59602)
                     /locus_tag="KPHS_p200760"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer mating pair stabilization
                     protein TraG"
                     /protein_id="YP_005229692.1"
                     /db_xref="GeneID:11844889"
                     /translation="MLEIYAIAGGDWLRGNLNAIAAFMGTSTWSTIEKMCIAISVLIV
                     AGNWVKKHNVMDLIGWVFSLTLVSMLVVIRTPVQIIDYSNVAQVYEVDNVPIGLAIPA
                     SLTTRVGNALIQSYEMVFALPDSVTYSKTGMLFGSNLVAKSTDFLSQNPQITTLFSDY
                     VQNCVMGDIFLNHKYSFEELLNSPDPYTLIFANPSPLRGVFDKNNQFQTCEEASRDLK
                     SALALDTQTGGKTWNYYVRQLFGGKPNPDLLFSQMIGDSYNYFYSSGQSAGQIIRQNV
                     TMNALRSGIQSYAARSGDTASLVNMANTSSLEKQRLAQATMGHQALRALPLMQTVIMG
                     LMIGMFPIMVMAAMFNMMTLQVLKGYVFALIWLQTWPLLFAILNSAMAYYAKQNGVPV
                     VLSELSQVQLKNSDIATTAGYIAVMIPPLSWGIVKSMGAAFSSAYSHFSSSGLSATSQ
                     AASGVVDGNYSFANMQMENVSGYSWGTNSTTSFGQMSRQLANGGMSTQTRDGSMVWDS
                     GGAMSKLPVDINVGRQIASAQQQMAREADVQAESALHGYNSSVTSAWNSLQQFGTNKG
                     NSTSTTTGADTTESSQDSMARSKMWNAVVANAKANNISNEESFQQLMDDSSKRTQSFD
                     AHVSGKWSSGDQLFGKLGKWGSGFSAEVGGKGSAGWGHSSGNTDNVGTSGRESNDSRH
                     DTSSQAAKDFKEASDYFTSRKTTTSGNITDNNASSRVDQFAASLSSAKNSYDQYTSSR
                     TRSHEYSEMASRTESMTGQMNENLTQQFANFVQHRAPQDAEAILTNTSSPEIAAQREA
                     LAREFVKEQVEPRVDAAYQQGRESIGQNMAGVSGGGDNGSVMADYGQNSRRIDVMTQD
                     AGIKDNVGQKVDRMITENKQQHQETRENIQRQGAEVKSENAEMEKNHKTKANEFKGDY
                     NERKSKVNSLPGADSQAELEEKAAKTQKDFLDGKR"
     misc_feature    complement(56777..59602)
                     /locus_tag="KPHS_p200760"
                     /note="conjugal transfer mating pair stabilization protein
                     TraG; Provisional; Region: PRK13735"
                     /db_xref="CDD:184287"
     gene            complement(59602..60981)
                     /locus_tag="KPHS_p200770"
                     /db_xref="GeneID:11844890"
     CDS             complement(59602..60981)
                     /locus_tag="KPHS_p200770"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraH"
                     /protein_id="YP_005229693.1"
                     /db_xref="GeneID:11844890"
                     /translation="MEDRMRIKLLSLFCGAALGLSFSAAADVNGDMNNFFNKLGFASN
                     TSQPQVWQGQAAGYASGGSLYARTQVKTIQLVSMTLPDINAGCGGIDAYLGSFSFINS
                     EQLQRFGKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMATDMNSMNLSSCQAAQGI
                     VGGLFPRTQVAQQKVCQDIAGESNIFSDWAASRQGCTVGGKMDSVQDKASDKDKERVM
                     KNINIMWNALSKNRLFDGNKELKEFVMTLTGTLIFGENSEITPLPARTTDQDLIKAMM
                     EGGTAKIYHCNDSDKCLKVVADATVTITANKALKNQIRALLSSIQNKAVADEKLTEQE
                     KGFISSTTIPVFKYLVDPQMLGVSNSLIYQLTDYIGYDILLQYIQELIQQARAMISTG
                     NYPQSTMDMIMENLNQASVQIAAFQSRVQVQQDALLVVDRQMSYMRQQVSARMMTRYQ
                     NNYHFGGNL"
     misc_feature    complement(59611..60963)
                     /locus_tag="KPHS_p200770"
                     /note="conjugal transfer pilus assembly protein TraH;
                     Provisional; Region: PRK13723"
                     /db_xref="CDD:237481"
     gene            complement(60959..61402)
                     /locus_tag="KPHS_p200780"
                     /db_xref="GeneID:11844891"
     CDS             complement(60959..61402)
                     /locus_tag="KPHS_p200780"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbF"
                     /protein_id="YP_005229694.1"
                     /db_xref="GeneID:11844891"
                     /translation="MNKYIRSTGLYAFLFPASLKAPGQTAAEKIEQLKPEFIHRERRL
                     EIYLELFIVFLTAGALLLWIMRFLFNLCVDDWIASGDLRVKDLWNIMMYAIPYALIAV
                     GVGFFVAGVTLAIRNFFSYHLKTLFILRNDRVKKNAVRNGGQDAN"
     misc_feature    complement(60962..61381)
                     /locus_tag="KPHS_p200780"
                     /note="conjugal transfer protein TrbF; Provisional;
                     Region: PRK13743"
                     /db_xref="CDD:184294"
     gene            complement(61448..62005)
                     /locus_tag="KPHS_p200790"
                     /db_xref="GeneID:11844892"
     CDS             complement(61448..62005)
                     /locus_tag="KPHS_p200790"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="YP_005229695.1"
                     /db_xref="GeneID:11844892"
                     /translation="MKNSLMNLAKTPLAALALSLALAGVAHAGTLDEVKSLWDPRGIS
                     GTETASPQSDTPQAVSGASQPRWLRLSNGKQVDLRDWKVVLFMQGHCPYCHKFDPVLK
                     QLAGQYGFSVFSYTIDGQGDDAFPEALPAPPDVMQTFFPNIPVATPTTFLVNVNTLAA
                     YPILQGATDAQGFMARVDTVFQMMH"
     misc_feature    complement(61451..61990)
                     /locus_tag="KPHS_p200790"
                     /note="conjugal transfer protein TrbB; Provisional;
                     Region: PRK13728"
                     /db_xref="CDD:237484"
     gene            complement(61977..62216)
                     /locus_tag="KPHS_p200800"
                     /db_xref="GeneID:11844893"
     CDS             complement(61977..62216)
                     /locus_tag="KPHS_p200800"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilin chaperone TraQ"
                     /protein_id="YP_005229696.1"
                     /db_xref="GeneID:11844893"
                     /translation="MRNIRFPDLDITGMWVLAVGVFFHLIARLVRKQPELAVQAGEIF
                     GLGMVVFGGYRILNALIAEAEKEEKACEKQPDEPR"
     misc_feature    complement(61983..62216)
                     /locus_tag="KPHS_p200800"
                     /note="Type-F conjugative transfer system pilin chaperone
                     (TraQ); Region: TraQ; cl11516"
                     /db_xref="CDD:299758"
     gene            complement(62227..62979)
                     /locus_tag="KPHS_p200810"
                     /db_xref="GeneID:11844894"
     CDS             complement(62227..62979)
                     /locus_tag="KPHS_p200810"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal pilus assembly protein TraF"
                     /protein_id="YP_005229697.1"
                     /db_xref="GeneID:11844894"
                     /translation="MRTIHAAMLAGCLCCALMPAFAKDAGWQWYNEKLKPRDEDRKAV
                     PAAPPPQMDILEKLATLQAATKRSLYEAILYPSSENFVKYFRLQNYWTQQAGLFSMSA
                     KKAMLENPELDYNLQYSHYNGTVKNQLAADYAEQRQAISTLAQHYGVMFFYRGREAID
                     GQLVQVIKNFRETYGLSVIPVSVDGVINPMLPDSRTDQGQAEQLGVKFFPAMMLVNPK
                     SGQVKPLSYGFISQDDLAKQFLYVSSDFKPNF"
     misc_feature    complement(62230..62973)
                     /locus_tag="KPHS_p200810"
                     /note="conjugal pilus assembly protein TraF; Provisional;
                     Region: PRK13703"
                     /db_xref="CDD:184259"
     gene            complement(63000..63326)
                     /locus_tag="KPHS_p200820"
                     /db_xref="GeneID:11844895"
     CDS             complement(63000..63326)
                     /locus_tag="KPHS_p200820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229698.1"
                     /db_xref="GeneID:11844895"
                     /translation="MEEKKAYGLVMVFVGVFVFLLVSIISYSLWRDRQVNAFMTTNRA
                     WGIQCDTVSQAAWVIRDGERVDLQINYLPLYCSGYRFEARDDAGKVQRQLDKYSVYQH
                     LSRQSH"
     gene            complement(63339..63587)
                     /locus_tag="KPHS_p200830"
                     /db_xref="GeneID:11844896"
     CDS             complement(63339..63587)
                     /locus_tag="KPHS_p200830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229699.1"
                     /db_xref="GeneID:11844896"
                     /translation="MNQYITIEKFIDILNEENLPQEHHVMVLAVLADISLHTDRFLIN
                     SSELVQMAAQYSPAFQKLPADRQAFISSVLSMPLFLIM"
     gene            complement(63565..63819)
                     /locus_tag="KPHS_p200840"
                     /db_xref="GeneID:11844897"
     CDS             complement(63565..63819)
                     /locus_tag="KPHS_p200840"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbE"
                     /protein_id="YP_005229700.1"
                     /db_xref="GeneID:11844897"
                     /translation="MKMSFHKKPVIDFVLRLTLTIIIISPVIYFSWDAVKGTSGSDYV
                     ESVVFILMAGFAMSVCYLFFSVLEKVINARKSKDESIYHD"
     misc_feature    complement(63568..63819)
                     /locus_tag="KPHS_p200840"
                     /note="conjugal transfer protein TrbE; Provisional;
                     Region: PRK13718"
                     /db_xref="CDD:172260"
     gene            complement(63851..65806)
                     /locus_tag="KPHS_p200850"
                     /db_xref="GeneID:11844898"
     CDS             complement(63851..65806)
                     /locus_tag="KPHS_p200850"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer mating pair stabilization
                     protein TraN"
                     /protein_id="YP_005229701.1"
                     /db_xref="GeneID:11844898"
                     /translation="MKTVISVLTAHFFVLSAFIWLASPACADSGSDYKAGSDFAKQVQ
                     GNGLNSLKNFSGEQNLPGYTDNPDQTKYYGGVTASGDSSLKSDSALEFSQGDTGKTIT
                     ESFTNRPPDQISQDAPFIQAAKDTESRADSIVGDTGQSCTAQVVNRSEFTNHTCERDL
                     QVENFCTREATLKDNATTQKVNRTYQQVVTLNYARSTRQWSGNLTIPTNGRLLNASVD
                     GEPLVIPWIEECDSEGKVRDSCKSAVSESLTLFERTFPIDVISWPRSESMCSGGQNTH
                     CTKYTYDGKGKIHQSFGVDKAVIAGQNFSVSKTSRTVSSASQKPVQVTVTLVMEETET
                     VYAPEVVWVESCPFSKDEGKKTGEECISPGGTRTITLGGRDYSFTEACWKYKDTWLTQ
                     PADNGSCESLMKNTACTLSSRQCAFSSEEGTCLHEYATYSCETRTSGKQMICGGDVFC
                     LDGECDKATSGKSNDFGQAVSELAALAAAGKDVAALNGVDVRAFTGKAKFCKKFAAGF
                     SNCCKDSGWGQDVGLASCSSEEKALAKAKKDKLTVSIGEFCSKKVLGICLEKKRSYCQ
                     FDSKLAQIVQQQGRNGQLHIGFGGASSPDCRGITVAELQGIDFNKLDFTNFMDDLMKN
                     QKIPENDVLTNKTRERIKEIMSQQSAQ"
     misc_feature    complement(63884..65770)
                     /locus_tag="KPHS_p200850"
                     /note="conjugal transfer mating pair stabilization protein
                     TraN; Reviewed; Region: PRK12355"
                     /db_xref="CDD:237072"
     gene            complement(65865..66503)
                     /locus_tag="KPHS_p200860"
                     /db_xref="GeneID:11844899"
     CDS             complement(65865..66503)
                     /locus_tag="KPHS_p200860"
                     /codon_start=1
                     /transl_table=11
                     /product="cconjugal transfer pilus assembly protein TrbC"
                     /protein_id="YP_005229702.1"
                     /db_xref="GeneID:11844899"
                     /translation="MKLMNLFMVMLLLTGRAVLAETSSVTDREWLKQQENLSEQLRQH
                     PDKQLQQELEAQINRNPLPKSDRQFIDNLVSQQKAANQEKPAEGALYFVSFSIPEEGL
                     KRMLHETRQYGIPATLRGLVNNDMKTTTDAVLQLVKDGVTDGVQIDPTLYTQYSIRSV
                     PSLVVRCQAGYDVVRGNIHVKQALEKVAQTGDCAQVARQILDAPSNAAGSQP"
     misc_feature    complement(65877..66500)
                     /locus_tag="KPHS_p200860"
                     /note="conjugal transfer pilus assembly protein TrbC;
                     Provisional; Region: PRK13730"
                     /db_xref="CDD:184282"
     gene            complement(66516..67505)
                     /locus_tag="KPHS_p200870"
                     /db_xref="GeneID:11844900"
     CDS             complement(66516..67505)
                     /locus_tag="KPHS_p200870"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraU"
                     /protein_id="YP_005229703.1"
                     /db_xref="GeneID:11844900"
                     /translation="MKAIFFLICIAFSTFSGRAAADPSCEGRFVNPITDVCWRCIFPL
                     SLGSVQVGKGDLPDTSNPGSPLQLCPAPPPIFVRPGLAIGYWEPMAMTDVSRSPGCMV
                     NLGGFSINLGKTGMGTARKDDKQVNGAFYHVHWYKYPLTYWLNIITSAGCLEGGDMDI
                     AYLSEIDPTWVDSSLTTILNPEAILFANPIAQGACAADAMASAFHMPLDILFWCAGSQ
                     GSMYPFSGWVSNESSPLQSSLLVSERMAYKLHRQGQIMESIGKDKAVCYEYPSPIIPK
                     ERWRYQMVNMYPDSGQCHPVGRSVMRWEAGKNPPNTRKNYGYLMWRKRNCVFL"
     misc_feature    complement(66519..67496)
                     /locus_tag="KPHS_p200870"
                     /note="conjugal transfer pilus assembly protein TraU;
                     Provisional; Region: PRK13737"
                     /db_xref="CDD:237487"
     gene            complement(67502..67903)
                     /locus_tag="KPHS_p200880"
                     /db_xref="GeneID:11844901"
     CDS             complement(67502..67903)
                     /locus_tag="KPHS_p200880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229704.1"
                     /db_xref="GeneID:11844901"
                     /translation="MPMILALIILLTMLLLTLMWSTIRKQENVIRELSTRESWLEREV
                     ERLRTDNEKLYRWLRYNGEKVIDEMTCELDALSAVRQTNRDSYRRQLYLFDCLSLMVW
                     AGMEGAEDSTREKVRNKTDALRLVLREKTDE"
     misc_feature    complement(<67724..>67837)
                     /locus_tag="KPHS_p200880"
                     /note="CASP C terminal; Region: CASP_C; pfam08172"
                     /db_xref="CDD:336948"
     gene            complement(67938..68573)
                     /locus_tag="KPHS_p200890"
                     /db_xref="GeneID:11844902"
     CDS             complement(67938..68573)
                     /locus_tag="KPHS_p200890"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraW"
                     /protein_id="YP_005229705.1"
                     /db_xref="GeneID:11844902"
                     /translation="MIRLKDCLLAACLLSPLTQAADLGTWGDLWPVREQDMLQLITQR
                     LQSLQSSGQWGQTMDAFKQRVIENSQRPAPVEGIKRAEKYEQRWFDPSIRLTEDLKDN
                     EGRVFARKGEVVNPLKTVPFVQTLYFINGDDADQLAWMKRQVPETLMSKIILVRGSIP
                     DTSAALDSRIYFDQNGVLSKRFGLTAVPARITPAPSGERLNIETFPPVPHP"
     misc_feature    complement(67953..68555)
                     /locus_tag="KPHS_p200890"
                     /note="conjugal transfer pilus assembly protein TraW;
                     Provisional; Region: PRK13738"
                     /db_xref="CDD:184290"
     gene            complement(68573..68962)
                     /locus_tag="KPHS_p200900"
                     /db_xref="GeneID:11844903"
     CDS             complement(68573..68962)
                     /locus_tag="KPHS_p200900"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="YP_005229706.1"
                     /db_xref="GeneID:11844903"
                     /translation="MKNNTEQPVSTTSLTFRRIPVIVALVLFALATSAFLSRVVLDYS
                     TPRVVAFDMKKTLDSFMDSVSQKQLTEAQSKALSDRFNDALEKSLAEYQQQHHVVILV
                     SPAVVQGAPDVTRNIQHDIARRMKGEE"
     misc_feature    complement(68588..68902)
                     /locus_tag="KPHS_p200900"
                     /note="Type-F conjugative transfer system protein
                     (TrbI_Ftype); Region: TrbI_Ftype; pfam09677"
                     /db_xref="CDD:337473"
     gene            complement(68962..71601)
                     /locus_tag="KPHS_p200910"
                     /db_xref="GeneID:11844904"
     CDS             complement(68962..71601)
                     /locus_tag="KPHS_p200910"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer ATP-binding protein TraC"
                     /protein_id="YP_005229707.1"
                     /db_xref="GeneID:11844904"
                     /translation="MSNNIIDAVTQTVNSLVSALKLPDESAKANDTLGSMNFPQFSRI
                     LPYKDYDSATGLFINNKTIGFMFEARPLPGADKSIVATLEHLLRSKLPRGVPVSFHLV
                     SSKLVGNDIDYGLREFRWSGKQAKKFNAITQAYYLRAAETKFPLPPALDLPLTLRNYR
                     VYISCCVPRKKNSTTQIVEMENQIKILRASLGGAYIPTRILDAAGLVELMRELINPDP
                     HEMYRVPYKLDPYQDLNYQCVDDSFDMQVTAGHLKIGRLGRDGKECVTRVTSYHLESD
                     PEMAFLWTSADNYANLLNPELSISCPFVITLTLMVEDQVKTQNEANMKFMDVEKKSKT
                     SYAKFFPNVIKEMQEWGDIRQRLATNQTSLVSYFFNITTYTADSTEASLAAEQQVLNS
                     YRKGGFQLIPARYHHLRNFLAMMPFKCGEGLFKELQAAGVVKRAETFQVANLLPIVAD
                     SPLAPAGLLAPTYRNQLAFIDLFYEGMNNTNFNMAVCGTSGAGKTGLIQPLIRSVLDS
                     GGFAWVFDMGDGYKSLCENMGGVYLDGDTLKFNPFANVLDDAHFDMSAERIRDQMSVM
                     ASPNGNLDEVHEGLLLQAVQAAWLSKRNHARVDDVVQFLQDAKDSDEYADSPTIRGRL
                     DEMIILLDQYTVNGIYGDYFNSDKPTLHDDARMVVLELGGLESRPSLLIAVMFSLIIY
                     IENRMYQSPRGLKKLNVIDEGWKLLDFKNEKVGQFIEKGYRTARRHTGAYITITQNIV
                     DFDSPTASSAARAAWGNSSYKAILKQSAKEFAKYNQLYPDQFSKLEKDMINGFGSAKE
                     QWFSSFMLQVEANCSWHRLFVDPLSRAMYSSKGPDFEYMQARRQEGVDIHDAVYGLAC
                     RNFKDEMAELESRIPVNDMEDKQ"
     misc_feature    complement(68965..71508)
                     /locus_tag="KPHS_p200910"
                     /note="conjugal transfer ATP-binding protein TraC;
                     Provisional; Region: PRK13721"
                     /db_xref="CDD:237480"
     gene            complement(71673..72071)
                     /locus_tag="KPHS_p200920"
                     /db_xref="GeneID:11844905"
     CDS             complement(71673..72071)
                     /locus_tag="KPHS_p200920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229708.1"
                     /db_xref="GeneID:11844905"
                     /translation="MDMMLFLRKYGFLFIPPVYWLIYLGARLTYNGLAGEFSPDFFQG
                     IRHEGVYIICSLCVFYFFCLEVEVGDGEFSANILFLIVFFHVVLLFITLLICLWQGEV
                     LLDSIFMGQIIASMCLLFFIPVLSIIRRSF"
     gene            72255..72461
                     /locus_tag="KPHS_p200930"
                     /db_xref="GeneID:11844906"
     CDS             72255..72461
                     /locus_tag="KPHS_p200930"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229709.1"
                     /db_xref="GeneID:11844906"
                     /translation="MNNTLQLFWSSGLHIARIFNILHKKNTQLTQLKEELSKNQIAGQ
                     FLAVFPLFHPYRSIQFVNQHFILS"
     gene            complement(72448..72852)
                     /locus_tag="KPHS_p200940"
                     /db_xref="GeneID:11844907"
     CDS             complement(72448..72852)
                     /locus_tag="KPHS_p200940"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229710.1"
                     /db_xref="GeneID:11844907"
                     /translation="MKAYYILGHNVAWLNGICLILFVIGVVGALAMVAIPEKFNLRVN
                     RGDTFIYCALIAVVGFSGMFVISIHSFSMDELEAGRHWKDDCRTLEVNMPTGAFTSPV
                     NKLDCDGIIINVPGGQYYSYIHQWELYKANSK"
     gene            complement(72919..73230)
                     /locus_tag="KPHS_p200950"
                     /db_xref="GeneID:11844908"
     CDS             complement(72919..73230)
                     /locus_tag="KPHS_p200950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229711.1"
                     /db_xref="GeneID:11844908"
                     /translation="MAEYQLGFDGFVRLFFAMAIIICGYGYVIIGVFIRDTLSCILML
                     FGLTGLSALFSLMVFMDKNMWAGSPDLTLSVITGFFTATVVFYMFYVLIYYFDRMGAG
                     E"
     gene            complement(73231..73449)
                     /locus_tag="KPHS_p200960"
                     /db_xref="GeneID:11844909"
     CDS             complement(73231..73449)
                     /locus_tag="KPHS_p200960"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229712.1"
                     /db_xref="GeneID:11844909"
                     /translation="MHAFIFLVLMTPSSGGGIWDITPMPNTDVCIKMLRVLEARGGRG
                     YGSNTGECIEIKTREPLSSVIETLNEGG"
     misc_feature    complement(<73324..73410)
                     /locus_tag="KPHS_p200960"
                     /note="Domain of unknown function (DUF4336); Region:
                     DUF4336; pfam14234"
                     /db_xref="CDD:290934"
     gene            73515..73640
                     /locus_tag="KPHS_p200970"
                     /db_xref="GeneID:11844910"
     CDS             73515..73640
                     /locus_tag="KPHS_p200970"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229713.1"
                     /db_xref="GeneID:11844910"
                     /translation="MPIATYRSVRIRLAYIFNNITTLKSILPGEKNPLSSTRPFK"
     gene            complement(73772..74356)
                     /locus_tag="KPHS_p200980"
                     /db_xref="GeneID:11844911"
     CDS             complement(73772..74356)
                     /locus_tag="KPHS_p200980"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraV"
                     /protein_id="YP_005229714.1"
                     /db_xref="GeneID:11844911"
                     /translation="MKELMLLIPLGSALLLTGCAGTETEFQCNATTSDTCMTMEQANE
                     KAKLKEERSDAKPAAAGLPQLAEGNFGTTSVNPYPLPPQPNLNRARVAAERERARAVY
                     LNNPTAKNEAIYFETGKRLQSLPVVKMSLPVVASTFTSPSTPPGNYPRPLRKGEETTS
                     LWIAPYVDSDDVYHQPATVLFVVKPSAWGQPRLN"
     misc_feature    complement(73775..74356)
                     /locus_tag="KPHS_p200980"
                     /note="conjugal transfer protein TraV; Provisional;
                     Region: PRK13733"
                     /db_xref="CDD:184285"
     gene            complement(74428..75852)
                     /locus_tag="KPHS_p200990"
                     /db_xref="GeneID:11844912"
     CDS             complement(74428..75852)
                     /locus_tag="KPHS_p200990"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraB"
                     /protein_id="YP_005229715.1"
                     /db_xref="GeneID:11844912"
                     /translation="MANFNTLIKRKQYIWLGLILAGGAAAVGGGLYLSDLNMSSDEEA
                     PAQGEPAPDMTGVVDSSFNSKVEQHATTEMQATAADLNKRFDSLQGEVELLSKARTAD
                     QIRIDKLSSDNEAMQNQLKSLGVKPAVSGGEPAPTPPSPPPGPEGEPQPASYPPQTGA
                     AVPPPTAFYPGNGMTPPPQVSYQSVPVPNQIQRKTFSYDKGKKTKSLPYIPSGSFAKS
                     MLIEGADANASVTGNESTVPMQLRITGRVEMPNSKTYDLTGCFVGLEAWGDVSSERAI
                     VRTRNISCIKGDKTIDQPINGHVSFMGKNGVKGEVVMRNGKILGWAWGAGFVDGIGQG
                     MERASQPAVGLGATASVGAGDVLKMGVGGGASKAAQTLSEYYIKRAEQYHPVIPIGAG
                     NEVTVVFQDGFQLKTIEELEAEKNGQQQAQNQEAEPAQQADAHHQSGGGMNGFNTDEM
                     LKKLGKLDPREFSPGAAPQGENNG"
     misc_feature    complement(74431..75852)
                     /locus_tag="KPHS_p200990"
                     /note="conjugal transfer pilus assembly protein TraB;
                     Provisional; Region: PRK13729"
                     /db_xref="CDD:184281"
     misc_feature    complement(order(74638..74652,74659..74661,74671..74673,
                     74677..74685,74689..74691,74695..74697,74713..74742,
                     74869..74871,74878..74880,74884..74886,74893..74895,
                     74902..74904,74908..74910,74938..74946,74953..74955,
                     74971..74988,74998..75000,75004..75006,75010..75012,
                     75019..75021,75025..75027,75031..75033,75040..75042,
                     75058..75060,75064..75066,75070..75072,75076..75078,
                     75109..75111,75115..75123,75136..75141,75145..75147,
                     75178..75189,75193..75198,75208..75213,75217..75222))
                     /locus_tag="KPHS_p200990"
                     /note="putative oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:319756"
     gene            complement(75852..76592)
                     /locus_tag="KPHS_p201000"
                     /db_xref="GeneID:11844913"
     CDS             complement(75852..76592)
                     /locus_tag="KPHS_p201000"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraK"
                     /protein_id="YP_005229716.1"
                     /db_xref="GeneID:11844913"
                     /translation="MKKINPLFISGCLLLAAPAMSATLSGTLAPTVVPLTNGGQANIA
                     VSNTDPNLFTVPGDRITAINSLDGGLTNQEQTDSGGAILATVSKKPFTFIVETERGLN
                     FSIRAVPRAGSGRTIQLVSELAGTPGPAKAWEESNPYESLLVSLNRAVRQGSVPDEYQ
                     SVPVTSEVLQVPAGLRATADRVWVGHHLKVVRYSLDNVSLSARMVRESDFWQPGTRAV
                     MFSTPAGLLTAGGRMQIWVTTSDEGVKR"
     misc_feature    complement(75855..76592)
                     /locus_tag="KPHS_p201000"
                     /note="conjugal transfer protein TraK; Provisional;
                     Region: PRK13736"
                     /db_xref="CDD:237486"
     gene            complement(76579..77145)
                     /locus_tag="KPHS_p201010"
                     /db_xref="GeneID:11844914"
     CDS             complement(76579..77145)
                     /locus_tag="KPHS_p201010"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraE"
                     /protein_id="YP_005229717.1"
                     /db_xref="GeneID:11844914"
                     /translation="MEHGARQNTTRVIAVGFISLGTLLTLSLATNIIQGINNYRLQTE
                     QKVAVTPMLFRAPFAVSQNQADASYIEQLGLSFVALRLNVTPETVDAQHQQLLRYVLP
                     ASQNSLKVQLAEDAKRIKDNNVNSTFYMTSMRAWPAENRVDIRGELKTWIGDSKPYSE
                     IKSYVIQFSRVDGVSWLARFGEINNEKN"
     misc_feature    complement(76582..77145)
                     /locus_tag="KPHS_p201010"
                     /note="conjugal transfer pilus assembly protein TraE;
                     Provisional; Region: PRK13726"
                     /db_xref="CDD:184278"
     gene            complement(77165..77470)
                     /locus_tag="KPHS_p201020"
                     /db_xref="GeneID:11844915"
     CDS             complement(77165..77470)
                     /locus_tag="KPHS_p201020"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraL"
                     /protein_id="YP_005229718.1"
                     /db_xref="GeneID:11844915"
                     /translation="MTGDELKRYRFPETLTNQSRWFGLYLDELIPAVICLGWGFWTSK
                     FIFGIASAVLVFWGIKKLKKGRGSSWLRDLIYWYLPTSLLKGFFHDVPDSCFRQWIK"
     misc_feature    complement(77168..77470)
                     /locus_tag="KPHS_p201020"
                     /note="conjugal transfer pilus assembly protein TraL;
                     Provisional; Region: PRK13707"
                     /db_xref="CDD:184263"
     gene            complement(77484..77852)
                     /locus_tag="KPHS_p201030"
                     /db_xref="GeneID:11844916"
     CDS             complement(77484..77852)
                     /locus_tag="KPHS_p201030"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilin subunit TraA"
                     /protein_id="YP_005229719.1"
                     /db_xref="GeneID:11844916"
                     /translation="MNAVLSVQGSAVSEKTKPSFMSRVFNKKKALKVAKVALPVAAVA
                     AFFPDAAMATTTATDLMKSGDATVKGTFGKQSSVVKWVVLAEVVAGGIMYMMTKNVKF
                     LFGFAIISTFITIGMSVAGY"
     misc_feature    complement(77493..77852)
                     /locus_tag="KPHS_p201030"
                     /note="Region: TraA; cl11503"
                     /db_xref="CDD:299752"
     gene            complement(77914..78084)
                     /locus_tag="KPHS_p201040"
                     /db_xref="GeneID:11844917"
     CDS             complement(77914..78084)
                     /locus_tag="KPHS_p201040"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraY"
                     /protein_id="YP_005229720.1"
                     /db_xref="GeneID:11844917"
                     /translation="MLLKLDEETNRRLIKAKDRSRRSKTAEAYLRLKDHLERFPDFYN
                     SELAVPGGEKEE"
     misc_feature    complement(77917..78081)
                     /locus_tag="KPHS_p201040"
                     /note="TraY domain; Region: TraY; cl27023"
                     /db_xref="CDD:355604"
     gene            complement(78235..78972)
                     /locus_tag="KPHS_p201050"
                     /db_xref="GeneID:11844918"
     CDS             complement(78235..78972)
                     /locus_tag="KPHS_p201050"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer transcriptional regulator
                     TraJ"
                     /protein_id="YP_005229721.1"
                     /db_xref="GeneID:11844918"
                     /translation="MCAKDRSHIAVRSQTDSIHSMREMLNISSCPAFIRDSRGEVIHT
                     SPTFDKIFLTSGGTGAFDTPRAPGSWFLDLSLEIKLELMQSELKSFSEGSAVLVKNIW
                     LAGSLWTVFIETFSINEDTYSKWVFINEDEPIPHPSMEYNDFSIKMQRYIERIQRSAK
                     SDWAIFNLYAVGFSHASISKITGVGVQTSKNTVSKIKKELSFDDRDYIIMSSIYTLSY
                     GKFISNVVSILKDGVNFLLNQKYHRYF"
     misc_feature    complement(78283..78972)
                     /locus_tag="KPHS_p201050"
                     /note="conjugal transfer transcriptional regulator TraJ;
                     Provisional; Region: PRK13719"
                     /db_xref="CDD:237479"
     gene            complement(79172..79588)
                     /locus_tag="KPHS_p201060"
                     /db_xref="GeneID:11844919"
     CDS             complement(79172..79588)
                     /locus_tag="KPHS_p201060"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraM"
                     /protein_id="YP_005229722.1"
                     /db_xref="GeneID:11844919"
                     /translation="MFDAVFNKGTDMARVQAYASDEVAEKINAIVEKRRAEGAKEKDV
                     SFSSVASMLLELGLRVYEAQMERKDSGFNQTEFNKILLENVMKTQFTVSKLLAIGSLS
                     PHVTGDERFEFRSMVSNIREDAKDVISHFFPEQEEE"
     misc_feature    complement(order(79193..79198,79205..79210,79217..79222,
                     79226..79231,79241..79243,79289..79360,79406..79411,
                     79415..79432,79436..79441,79448..79450,79508..79513,
                     79517..79519,79526..79528,79532..79552))
                     /locus_tag="KPHS_p201060"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271351"
     misc_feature    complement(order(79448..79456,79517..79519,79526..79528,
                     79532..79543,79547..79549))
                     /locus_tag="KPHS_p201060"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271351"
     misc_feature    complement(79181..79531)
                     /locus_tag="KPHS_p201060"
                     /note="conjugal transfer protein TraM; Provisional;
                     Region: PRK13713"
                     /db_xref="CDD:184269"
     gene            79979..80464
                     /locus_tag="KPHS_p201070"
                     /db_xref="GeneID:11844920"
     CDS             79979..80464
                     /locus_tag="KPHS_p201070"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lytic transglycosylase"
                     /protein_id="YP_005229723.1"
                     /db_xref="GeneID:11844920"
                     /translation="MKGVAFGIILSLIPLSSMAADCFDMAGRDYKIDPDLLRAISWQE
                     SGFKIDAIGRNPVTGYGSGLMQIDSQHFNELSRYGIKPDHLLSDACLNIYTGAYYLAQ
                     AFKKWGVSWDAVGAYNAGFKKTPRQAARRYEYAKKIHYYYTAIKASKRTSSKDQKIAM
                     N"
     misc_feature    79979..80425
                     /locus_tag="KPHS_p201070"
                     /note="Lysozyme-like domains; Region: Lyz_like; cl00222"
                     /db_xref="CDD:350962"
     misc_feature    order(80108..80110,80174..80182,80189..80191,80273..80275,
                     80327..80332)
                     /locus_tag="KPHS_p201070"
                     /note="putative sugar binding site [chemical binding];
                     other site"
                     /db_xref="CDD:340368"
     misc_feature    80108..80110
                     /locus_tag="KPHS_p201070"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:340368"
     gene            complement(80497..80826)
                     /locus_tag="KPHS_p201080"
                     /db_xref="GeneID:11844921"
     CDS             complement(80497..80826)
                     /locus_tag="KPHS_p201080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229724.1"
                     /db_xref="GeneID:11844921"
                     /translation="MVGILMFEFKAVCISISHMEEGDIRVLQVLSSTTNYLTCDSYLE
                     WIHDTPYGCVIRMYDFKRHLLALKRGGVSKFLRKTLILMHREGGYLLFHFDSDADYYP
                     GIDAVDF"
     gene            complement(80859..81680)
                     /locus_tag="KPHS_p201090"
                     /db_xref="GeneID:11844922"
     CDS             complement(80859..81680)
                     /locus_tag="KPHS_p201090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229725.1"
                     /db_xref="GeneID:11844922"
                     /translation="MRLASRFGLTHSIRQERPLTNDELVKVVPSVFSEEKHNSRSDRY
                     TYIPTITLLDKLREEGFQPFFACQSRVRDEDKRGHTKHMVRLRREGANKGTEVPEIIL
                     LNSHDGSSSYQMIPGMFRFVCTNGLVCGTSFGEIRVPHKGDIVGRVIEGAYEVLGIFD
                     KITEGVDVMKSIALTKEEQRLFGQAALTYRYEDENKSPVSIEQIIHPRRYEDKKDDIW
                     TTYQRVQENLIKGGLPGRTEKGKRTTTRPVKAIDGDVKLNKALWLIAEKFRTLKG"
     misc_feature    complement(80895..81575)
                     /locus_tag="KPHS_p201090"
                     /note="Domain of unknown function (DUF932); Region:
                     DUF932; pfam06067"
                     /db_xref="CDD:336288"
     gene            complement(81791..82132)
                     /locus_tag="KPHS_p201100"
                     /db_xref="GeneID:11844923"
     CDS             complement(81791..82132)
                     /locus_tag="KPHS_p201100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229726.1"
                     /db_xref="GeneID:11844923"
                     /translation="MLRPSRSRRFHRAGEGLPALCRATPFRARALRRCGGCLLLSPGT
                     RITRLSPFAGAETSTTRLAVQGTAEPFAINFSRPFRCASLDRKKFPAHPRTSAPGRAR
                     LRPRGERLSNG"
     gene            82398..82613
                     /locus_tag="KPHS_p201110"
                     /db_xref="GeneID:11844924"
     CDS             82398..82613
                     /locus_tag="KPHS_p201110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229727.1"
                     /db_xref="GeneID:11844924"
                     /translation="MRAARQRGPVFPAPQARGLSRRGQTGTDAPFACSVPESVNKHRD
                     RDLKSICQRPHVIEGQTAFTTEDPADE"
     gene            complement(82617..82895)
                     /locus_tag="KPHS_p201120"
                     /db_xref="GeneID:11844925"
     CDS             complement(82617..82895)
                     /locus_tag="KPHS_p201120"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE-like antitoxin protein"
                     /protein_id="YP_005229728.1"
                     /db_xref="GeneID:11844925"
                     /translation="MKYKTLSQVHTEAMNDHEYSAAFEAEEASELLRETLATWRKEAG
                     LTSAQVAERMGIKAPTISRMEKNASRMSIQTLVRYARACGVNFKIQQV"
     misc_feature    complement(82635..82796)
                     /locus_tag="KPHS_p201120"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(82698..82700,82773..82775,82785..82787))
                     /locus_tag="KPHS_p201120"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(82701..82703,82776..82778))
                     /locus_tag="KPHS_p201120"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(82695..82700,82710..82712,82719..82721,
                     82752..82757))
                     /locus_tag="KPHS_p201120"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(82885..83205)
                     /locus_tag="KPHS_p201130"
                     /db_xref="GeneID:11844926"
     CDS             complement(82885..83205)
                     /locus_tag="KPHS_p201130"
                     /codon_start=1
                     /transl_table=11
                     /product="RelE-like toxin protein"
                     /protein_id="YP_005229729.1"
                     /db_xref="GeneID:11844926"
                     /translation="MFTVIFHDEAEKEFTALPAAIRAKMARLLMKLEANPRQLREPDT
                     KPLGNGLFEIRTMGADIARGIWVYQSGERIFLLRIFIKKSPKTPPAEIDLALRRLEEM
                     QNEI"
     misc_feature    complement(82906..83172)
                     /locus_tag="KPHS_p201130"
                     /note="Phage derived protein Gp49-like (DUF891); Region:
                     Gp49; pfam05973"
                     /db_xref="CDD:310510"
     gene            complement(83286..83510)
                     /locus_tag="KPHS_p201140"
                     /db_xref="GeneID:11844927"
     CDS             complement(83286..83510)
                     /locus_tag="KPHS_p201140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229730.1"
                     /db_xref="GeneID:11844927"
                     /translation="MEHVKRQIQQGAGNAYYAGMQWRGITLGHADAAALNQFDIDISK
                     AQAPEARTWLLQNKAEFIALMLGIEIVKIG"
     gene            complement(83521..83733)
                     /locus_tag="KPHS_p201150"
                     /db_xref="GeneID:11844928"
     CDS             complement(83521..83733)
                     /locus_tag="KPHS_p201150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229731.1"
                     /db_xref="GeneID:11844928"
                     /translation="MKVYGHQHSSEVFSRETSPSCFEPKAEKLIAFHGKDASYAYNVL
                     ADLKAAGASYTRRNIIADMFRRLGVE"
     gene            complement(83794..84150)
                     /locus_tag="KPHS_p201160"
                     /db_xref="GeneID:11844929"
     CDS             complement(83794..84150)
                     /locus_tag="KPHS_p201160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229732.1"
                     /db_xref="GeneID:11844929"
                     /translation="MSTQNVNVKPSTKESTTLRTDGFVRNIHSRNPFDVIRADVVLER
                     IEKEAGWCCGMHYELYQAHLLGGALDYLDALPLKDRPVLMGAAAKRGYLLTLAEEERA
                     LEARDVLMSELAANDC"
     gene            complement(84147..84272)
                     /locus_tag="KPHS_p201170"
                     /db_xref="GeneID:11844930"
     CDS             complement(84147..84272)
                     /locus_tag="KPHS_p201170"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein"
                     /protein_id="YP_005229733.1"
                     /db_xref="GeneID:11844930"
                     /translation="MKVLSRGQVQQVPAQSQNRGPGNSTGDGFKRQKKQTKEKAG"
     gene            complement(84408..84584)
                     /locus_tag="KPHS_p201180"
                     /db_xref="GeneID:11844931"
     CDS             complement(84408..84584)
                     /locus_tag="KPHS_p201180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229734.1"
                     /db_xref="GeneID:11844931"
                     /translation="MSEVRVNGSACCDRSGRAAFTVPAIKLPALCRATPFRARALRRC
                     GGCLLLSPGAVSPV"
     gene            complement(84728..84862)
                     /locus_tag="KPHS_p201190"
                     /db_xref="GeneID:11844932"
     CDS             complement(84728..84862)
                     /locus_tag="KPHS_p201190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229735.1"
                     /db_xref="GeneID:11844932"
                     /translation="MLIVLDSSIGSARYFSAGFCSYIPPFLPVMALFPAVSLFKTEKD
                     "
     gene            complement(84992..85309)
                     /locus_tag="KPHS_p201200"
                     /db_xref="GeneID:11844933"
     CDS             complement(84992..85309)
                     /locus_tag="KPHS_p201200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229736.1"
                     /db_xref="GeneID:11844933"
                     /translation="MSDVLSCRQLTANLKMIAGAIGCLNRNDVAQIISLGGVPCSKSR
                     ADSIIRSAGAEKNASGNSHLRGARIKRSADVTPEEFNAFCAGLKTFLVSFETNNVSEN
                     NDK"
     gene            complement(85324..85674)
                     /locus_tag="KPHS_p201210"
                     /db_xref="GeneID:11844934"
     CDS             complement(85324..85674)
                     /locus_tag="KPHS_p201210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229737.1"
                     /db_xref="GeneID:11844934"
                     /translation="MKKEISRNPSFTPSPKLRAHLNSHREGVTERLNNIFDRYAHLVR
                     ACALPLDAEETQVLLNVLNGSVVEPAFIEYLAQEIRDSDDYLEGIPAAKSLYEKCQSA
                     TYPQLLATVERLDR"
     gene            complement(85671..85943)
                     /locus_tag="KPHS_p201220"
                     /db_xref="GeneID:11844935"
     CDS             complement(85671..85943)
                     /locus_tag="KPHS_p201220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229738.1"
                     /db_xref="GeneID:11844935"
                     /translation="MNFTIKSRKTGEIFSFYAPDSGGYVHLESPGHPGNTGAQICCGG
                     GFMGSTLSCGASEDDLASVARKWYRQFVRERRKFLIMSGQYSEDNQ"
     gene            complement(85991..86326)
                     /locus_tag="KPHS_p201230"
                     /db_xref="GeneID:11844936"
     CDS             complement(85991..86326)
                     /locus_tag="KPHS_p201230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229739.1"
                     /db_xref="GeneID:11844936"
                     /translation="METATAELKDHESVRLSKGSPGKPGATSGCIALNPPACRVFLPE
                     KCCYNLFVQCAVSAFLVNQSPGLPGDTAVHSLYDTVMFACFLSRLFLLIMYDICHTVD
                     CVMNRNCST"
     gene            complement(86403..86567)
                     /locus_tag="KPHS_p201240"
                     /db_xref="GeneID:11844937"
     CDS             complement(86403..86567)
                     /locus_tag="KPHS_p201240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229740.1"
                     /db_xref="GeneID:11844937"
                     /translation="MKGLPFTGSPFFLLTGKKARTTGGQKSFIYLQHRFNESQVTLTS
                     FIHRNTLSSV"
     gene            complement(86636..86794)
                     /locus_tag="KPHS_p201250"
                     /db_xref="GeneID:11844938"
     CDS             complement(86636..86794)
                     /locus_tag="KPHS_p201250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229741.1"
                     /db_xref="GeneID:11844938"
                     /translation="MKLPRNTLLGCVLIVCLTLLIFTYLTRKSLCEIRYRDTNREVAA
                     FLAYESAK"
     misc_feature    complement(86639..86794)
                     /locus_tag="KPHS_p201250"
                     /note="small toxic polypeptide; Provisional; Region:
                     PRK09738"
                     /db_xref="CDD:182055"
     gene            complement(87022..87396)
                     /locus_tag="KPHS_p201260"
                     /db_xref="GeneID:11844939"
     CDS             complement(87022..87396)
                     /locus_tag="KPHS_p201260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229742.1"
                     /db_xref="GeneID:11844939"
                     /translation="MRYWLLVILMNVLFWLIVKHVAPEWYGSPCYYAGQIICTLIAAV
                     ITWRDPPDWLDGILLGVIEFGVLIAGIIFFVWGIGYKLAFWGQHDPNTIYASANDVIL
                     PNLALGTGVLIAGWVYIRYLKR"
     gene            complement(87452..87778)
                     /locus_tag="KPHS_p201270"
                     /db_xref="GeneID:11844940"
     CDS             complement(87452..87778)
                     /locus_tag="KPHS_p201270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229743.1"
                     /db_xref="GeneID:11844940"
                     /translation="MKWRYSLRWKLPHRPCPGPRELISVVVEAGQAAPEEVMSRWVAG
                     SGYAVCVDFHGQKQIQRWSDERKAAVRRRNMQARIHRVAPLFADELIERELAARPEYF
                     NGKSAR"
     gene            complement(87775..88503)
                     /locus_tag="KPHS_p201280"
                     /db_xref="GeneID:11844941"
     CDS             complement(87775..88503)
                     /locus_tag="KPHS_p201280"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="YP_005229744.1"
                     /db_xref="GeneID:11844941"
                     /translation="MIPSSSALVSLKPARQAALQAIMTVEEARQRGARLPSMPHVRTF
                     LRLLTGCSRINSDVARRIPGLHRDPKDRLSSLKQVEEALDMLISSHGEYCPLPLTMDV
                     QAELFPEVLHTRTVRRLKRQDFAFTRKMRREARQVEQSWLLRQNLLGQAVTELNFQSP
                     ETVCTWYTRWSDEFDAAELAAPFWRWQSRFTSLKELDWLRISGEPLYAVMYEIPLIVR
                     ETPEHIRVAERWQVPNKLADRSGV"
     misc_feature    complement(87796..88500)
                     /locus_tag="KPHS_p201280"
                     /note="PsiA protein; Region: PsiA; pfam06952"
                     /db_xref="CDD:311103"
     gene            complement(88500..88931)
                     /locus_tag="KPHS_p201290"
                     /db_xref="GeneID:11844942"
     CDS             complement(88500..88931)
                     /locus_tag="KPHS_p201290"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein B"
                     /protein_id="YP_005229745.1"
                     /db_xref="GeneID:11844942"
                     /translation="MKTLLTLDVLKTMSSDELEDYRAAGEDFRRELSHAVMRDLTSPS
                     GWSVNAEYRCEFGGFFPVQIRFTPSHGHFDVAVCSPGELNPRWIVVFVTRDGQPFSVV
                     RVMDAFNPELITHTLDLIECLDAGGYSFASIISTLSQEGAQ"
     misc_feature    complement(88503..88922)
                     /locus_tag="KPHS_p201290"
                     /note="Plasmid SOS inhibition protein (PsiB); Region:
                     PsiB; pfam06290"
                     /db_xref="CDD:310708"
     gene            complement(88976..91033)
                     /locus_tag="KPHS_p201300"
                     /db_xref="GeneID:11844943"
     CDS             complement(88976..91033)
                     /locus_tag="KPHS_p201300"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="YP_005229746.1"
                     /db_xref="GeneID:11844943"
                     /translation="MSATESKVKTAPKTSKKTLKSAEAEALKVALDAAQVEYVPVTAL
                     VKSPLNVRTIPYPAEKVCSMADSIEAIGLLQNLVVHNLPDGRCGVAAGGRRLKALQLL
                     QSENRIDAGYQVMVKKVPDELAVAASMAENEQQMAMHPSEQIAGFRTLAEQGKTAAQI
                     GDLLGFGTRHVQRMLKLTELAPEILAALAKDEITTEHCQALALESDQKRQVEVLESAR
                     KRSWNNEASVSSIRNLIISEEVSTNGDKFRFVGEAAFSPDEIRVDLFSSENGGYVKSA
                     SLDTALLEKLQNIAEHLREAEGWSWCDGRLDPISHYGKDTKIWRLHAVPPVEYTEAES
                     ERLAELEALEAKYEDENPGVNDDVVAGALEAVWEEQQTIAHRAKHRAWTDEMKQSAGV
                     VVSWTGQEVKVQRGVVLCADEKMEEKDASTDQAPEKVDPLDAVSVPLLTRLSSERTLA
                     VQAALLQQPQKAVALMVWKMCNSVFHTTTSVKEPFCISVSVSHYALTREAPDGENSVA
                     FQAIQSEKERLEALLPENWRKDMTTFFTLDGATLMALMAFCTACSIDGVQGKDEFGRK
                     HQSSLDGVENAIQFDLRDWWKPTADNLFSHMKLPHIVQALSQAGLAGAAQDAAKMKKK
                     DAAEHAEHFLSKIRWVPEWMTSADNQKQLAAKSELSLATSQNDTDADAGDVTDHNNPA
                     CAA"
     misc_feature    complement(90311..90931)
                     /locus_tag="KPHS_p201300"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     COG1475"
                     /db_xref="CDD:224392"
     misc_feature    complement(90629..90868)
                     /locus_tag="KPHS_p201300"
                     /note="ParB N-terminal, parA-binding, -like domain of
                     bacterial and plasmid parABS partitioning systems; Region:
                     ParB_N_like; cd16406"
                     /db_xref="CDD:319263"
     misc_feature    complement(order(90740..90745,90749..90754,90758..90760))
                     /locus_tag="KPHS_p201300"
                     /note="putative ParB Box II [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319263"
     misc_feature    complement(order(90743..90745,90749..90754))
                     /locus_tag="KPHS_p201300"
                     /note="arginine patch [polypeptide binding]; other site"
                     /db_xref="CDD:319263"
     gene            complement(91103..91351)
                     /locus_tag="KPHS_p201310"
                     /db_xref="GeneID:11844944"
     CDS             complement(91103..91351)
                     /locus_tag="KPHS_p201310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229747.1"
                     /db_xref="GeneID:11844944"
                     /translation="MDHNVLSPLVSLPDGTFTREQAQVVAAQYQNVAIEDDQGTHFRL
                     VVRHQDDGSMIWRVWNFEPGGEDMMNRYIRDYGVRKTK"
     misc_feature    complement(91112..91321)
                     /locus_tag="KPHS_p201310"
                     /note="Bacterial protein of unknown function (DUF905);
                     Region: DUF905; pfam06006"
                     /db_xref="CDD:310532"
     gene            complement(91400..91942)
                     /locus_tag="KPHS_p201320"
                     /db_xref="GeneID:11844945"
     CDS             complement(91400..91942)
                     /locus_tag="KPHS_p201320"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein"
                     /protein_id="YP_005229748.1"
                     /db_xref="GeneID:11844945"
                     /translation="MAARGVNKVILVGHLGQDPEVRYMPNGGAVVNLTLATSETWRDK
                     QTGEMRENTEWHRVVMFGKLAEVAGEYLRKGAQVYIEGQLRTRNWQDDAGVTRYVTEV
                     LVGQNGTLQMLGGRRESGVPESAAQPQNPATPAQPAQAAAKSPKAKGGKKGRQDAAPS
                     QQPPQPLPDDFPPMDDDAPF"
     misc_feature    complement(<91556..91942)
                     /locus_tag="KPHS_p201320"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:353029"
     misc_feature    complement(order(91643..91645,91652..91654,91685..91687,
                     91712..91714,91775..91777,91781..91783,91826..91834,
                     91907..91918))
                     /locus_tag="KPHS_p201320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(91634..91636,91640..91642,91679..91684,
                     91688..91690,91694..91696,91718..91723,91760..91762,
                     91766..91768,91772..91774,91778..91780,91784..91789,
                     91823..91828,91847..91849,91877..91879,91895..91903))
                     /locus_tag="KPHS_p201320"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            complement(92059..92430)
                     /locus_tag="KPHS_p201330"
                     /db_xref="GeneID:11844946"
     CDS             complement(92059..92430)
                     /locus_tag="KPHS_p201330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229749.1"
                     /db_xref="GeneID:11844946"
                     /translation="MSDVKVNGSACCDRPGRAAFTVPAIKLPALCGATPFRARALRRC
                     GGCLLLSPGTRITRLSPFAGAETSTTRLAVQGTAGPFAINFSRPFRCASLGRKKFPAH
                     PRTSAPGRARLRPCGERLSNG"
     gene            complement(92774..93337)
                     /locus_tag="KPHS_p201340"
                     /db_xref="GeneID:11844947"
     CDS             complement(92774..93337)
                     /locus_tag="KPHS_p201340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229750.1"
                     /db_xref="GeneID:11844947"
                     /translation="MHHDLKHRIQAMRDKLEGRAPVAEIQGSSQLFVTPAPECRRLVE
                     LADVRETDRILEPSAGTGAILQAIRDTVPRAKCDAVELHAGLVSHLQARFPEVRTWCG
                     DFLEYHPDRRYTRIIMNPPFHRGDDIRHIRRALTLLEPGGILTGICLDGPRQQKALES
                     LADVWEPLPRGTFTYTQVATAILRITV"
     misc_feature    complement(<92933..93223)
                     /locus_tag="KPHS_p201340"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:354317"
     misc_feature    complement(order(92981..92983,93026..93034,93092..93097,
                     93149..93169))
                     /locus_tag="KPHS_p201340"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(93385..94740)
                     /locus_tag="KPHS_p201350"
                     /db_xref="GeneID:11844948"
     CDS             complement(93385..94740)
                     /locus_tag="KPHS_p201350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229751.1"
                     /db_xref="GeneID:11844948"
                     /translation="MTPTTAQIMTENTVSQTYRATYSPDDNKLRLYASLRLDEETYSL
                     INKAGFRWAPKQELFVAPAWTPGREDVLLSLAGDIEDEDSTLFDRQEQRAGRFSDYSD
                     RRAVESEQALAHVDSLASAVPLGQPILVGHHSERRARRHAQKIENGMKRAVMLFERAE
                     YWEQRAQASLRHAKYKERPDVRYRRIKKIEAELRKSQKHIARSEKYMTMWRAQTLDLK
                     MALLVSNYDHIHACFTLDKYPRPTEKSQYEGSMSLHSALSEEIITFEQARDIAIRCHE
                     RTISHQQRWVNHYQNRLAYERAMLNENGGVVTRTEEFEPGGQVLSRGEWLTILRVNRS
                     QGEVSSVETPCYRFLGYSGTMKLTPDRITDYKAPTAEEASDAKKAAKRPPIVNYPGEG
                     FREMTKAEWAKLPADYKGVRGAAETETHGAYRFRRCMTHGCTLVNVYITDMKTVEIPK
                     K"
     misc_feature    complement(94126..94485)
                     /locus_tag="KPHS_p201350"
                     /note="Domain of unknown function (DUF3560); Region:
                     DUF3560; pfam12083"
                     /db_xref="CDD:338241"
     gene            complement(94792..95022)
                     /locus_tag="KPHS_p201360"
                     /db_xref="GeneID:11844949"
     CDS             complement(94792..95022)
                     /locus_tag="KPHS_p201360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229752.1"
                     /db_xref="GeneID:11844949"
                     /translation="MIVSIFSPSAGAVKPRRHSRILRADITAPEIDPALRAFGRHIAR
                     SHRKGRGVHIPAMKNTALGQVLRTLELKRAFN"
     gene            complement(95114..95341)
                     /locus_tag="KPHS_p201370"
                     /db_xref="GeneID:11844950"
     CDS             complement(95114..95341)
                     /locus_tag="KPHS_p201370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229753.1"
                     /db_xref="GeneID:11844950"
                     /translation="MQDPSLRTYRIAFLGSNASGNLPMFTRVQATTGKRAIKAFIERC
                     EPVKGWFLGEPEDITDQLKKEEEEAGSKPQI"
     gene            complement(95360..95788)
                     /locus_tag="KPHS_p201380"
                     /db_xref="GeneID:11844951"
     CDS             complement(95360..95788)
                     /locus_tag="KPHS_p201380"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand binding protein"
                     /protein_id="YP_005229754.1"
                     /db_xref="GeneID:11844951"
                     /translation="MLRPSRSRRFHRAGEGLPALCGATPFRARALRRCGGCLLLSPGT
                     RITRLSPFAGAETSTTRLAVQGTAGPFAINFSRPFRCRFIRPKKISRSPPDICTGPCS
                     FTPLRRTALKRVKVISRGQVQQVPAQSQNRGPGNSTGDVL"
     gene            complement(96021..96341)
                     /locus_tag="KPHS_p201390"
                     /db_xref="GeneID:11844952"
     CDS             complement(96021..96341)
                     /locus_tag="KPHS_p201390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229755.1"
                     /db_xref="GeneID:11844952"
                     /translation="MRMSLMFAAVTLLTGINLFFIPFQPVPALWGAILAVAFVLINVV
                     ADKLRLWSGIAWIIVAGIIITLMLKGKEPGDELRGLITVFAFLASAWYCVVQYRKEQG
                     ESQS"
     gene            complement(96376..96630)
                     /locus_tag="KPHS_p201400"
                     /db_xref="GeneID:11844953"
     CDS             complement(96376..96630)
                     /locus_tag="KPHS_p201400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229756.1"
                     /db_xref="GeneID:11844953"
                     /translation="MSKWNIASFSKEEQDKVAVDKVAAAVAWQERMNKPVVPELVERE
                     QPEHLREYFHERLRVHRLNSQQLPRANAPEYNKPGDEQQK"
     misc_feature    complement(96421..96624)
                     /locus_tag="KPHS_p201400"
                     /note="DNA polymerase III, theta subunit; Region:
                     DNA_pol3_theta; cl22636"
                     /db_xref="CDD:354950"
     gene            complement(96818..97009)
                     /locus_tag="KPHS_p201410"
                     /db_xref="GeneID:11844954"
     CDS             complement(96818..97009)
                     /locus_tag="KPHS_p201410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229757.1"
                     /db_xref="GeneID:11844954"
                     /translation="MKLAPQSRDILRQYKALINARRRDAGQRELTTAQVMDEICEYMT
                     CQCAVYIGGHFILQGGKAR"
     gene            complement(97052..97558)
                     /locus_tag="KPHS_p201420"
                     /db_xref="GeneID:11844955"
     CDS             complement(97052..97558)
                     /locus_tag="KPHS_p201420"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-restriction protein"
                     /protein_id="YP_005229758.1"
                     /db_xref="GeneID:11844955"
                     /translation="MTSSVTVPAVYVGTYHQYNGGSIFGKWFDLTDFDDEDEFYDACR
                     ALHAAEDDPEFMFQDWEGIPSQFASESSVKWAFIEAFRQAQDEGRAAAFVAWADYTGE
                     CDYDAFDEAYCGEAESEEDFAYGFVEDHGLLNEVPESLRVYFDYEAYARDLFSSGYVF
                     HEGYVFSN"
     misc_feature    complement(97055..97558)
                     /locus_tag="KPHS_p201420"
                     /note="Antirestriction protein (ArdA); Region: ArdA;
                     cl01953"
                     /db_xref="CDD:351646"
     gene            complement(97601..98266)
                     /locus_tag="KPHS_p201430"
                     /db_xref="GeneID:11844956"
     CDS             complement(97601..98266)
                     /locus_tag="KPHS_p201430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229759.1"
                     /db_xref="GeneID:11844956"
                     /translation="MQGCADAAILARSQVFYDARRSSRRFLAQVSLENRPDQLRAISA
                     LRPPVSPLHLPLFAGLSCRHGTTRCRSLCDYGGLSMQYVNTCPVLNVEESDRLSFMPY
                     LFGTDFMLAELQVYALAKKWMPEYEGGFWHFIRLPEGGGYMMPDCGRVHLVSSENWFD
                     RTVSADAAGIILTSLAINRRLAAHHDSSNPALTRLYMLRDAQLWNHITFHPECSAIYA
                     ALD"
     misc_feature    complement(98045..>98134)
                     /locus_tag="KPHS_p201430"
                     /note="Protein of unknown function (DUF1472); Region:
                     DUF1472; pfam07339"
                     /db_xref="CDD:115962"
     misc_feature    complement(97604..97897)
                     /locus_tag="KPHS_p201430"
                     /note="Antirestriction protein; Region: Antirestrict;
                     pfam03230"
                     /db_xref="CDD:335269"
     gene            complement(98281..98637)
                     /locus_tag="KPHS_p201440"
                     /db_xref="GeneID:11844957"
     CDS             complement(98281..98637)
                     /locus_tag="KPHS_p201440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229760.1"
                     /db_xref="GeneID:11844957"
                     /translation="MSPCRLRVHPARFPGLLGEHNPLLSPCRVLAVPCLHFSPAAAEA
                     GVRWRRHPRIRQSPACRCRRLRFTRPHPSGPWPYYCVCRVATSASAFLPVVEKRGRET
                     LYSTSCIATGSAVPSL"
     gene            complement(98710..99477)
                     /locus_tag="KPHS_p201450"
                     /db_xref="GeneID:11844958"
     CDS             complement(98710..99477)
                     /locus_tag="KPHS_p201450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229761.1"
                     /db_xref="GeneID:11844958"
                     /translation="MMKKETLNTLILRHGDRMLRQAGWPDTVDMAPVAPETVPGWLAA
                     CGSLSGVEILTLTEQLCQPLTYGRAALLLASARRLAGTPARLHLFPVQAYPHPERLAD
                     CQVIRLPYAQEWLTAAECDDLLAFLKASLTQISEIVHRDTKRIAAALTPSVNPRLMDR
                     RIGDWRLLAVEYDHDNCLDEDETDRLDQVLDAILIRDARFCPVLLTLVNEREETIRSA
                     GVIADQLRFTDTPVRRWFDRRVLREMVREARASRTQE"
     gene            complement(99531..99950)
                     /locus_tag="KPHS_p201460"
                     /db_xref="GeneID:11844959"
     CDS             complement(99531..99950)
                     /locus_tag="KPHS_p201460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229762.1"
                     /db_xref="GeneID:11844959"
                     /translation="MYGTREDLCRMLNEQYPAETPLNLIIWTPADIEALADGMEYSFS
                     EHDVRAVLERMDTIPEEQRLESGVSAGLVMALIDQVKENGQRVTVPVDLLETLLITAE
                     QALWDREWTARDRNLPVPESVMRRLADTAKVRALLKS"
     misc_feature    complement(99540..99950)
                     /locus_tag="KPHS_p201460"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:311216"
     gene            complement(99960..100181)
                     /locus_tag="KPHS_p201470"
                     /db_xref="GeneID:11844960"
     CDS             complement(99960..100181)
                     /locus_tag="KPHS_p201470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229763.1"
                     /db_xref="GeneID:11844960"
                     /translation="MNYDGHEALRRDMAGLANNLCDLKTTLKVLEDTYHYRYDGLAER
                     LAGISLRRLSVLMDEAFNIALMLDESFLD"
     gene            complement(100181..100882)
                     /locus_tag="KPHS_p201480"
                     /db_xref="GeneID:11844961"
     CDS             complement(100181..100882)
                     /locus_tag="KPHS_p201480"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methylase"
                     /protein_id="YP_005229764.1"
                     /db_xref="GeneID:11844961"
                     /translation="MSRFILGNCIDVMRGFPDRAVDLIVTDPPYLVGFKDRQGRQIAG
                     DVTDEWLQPATLEMYRVLKKDALMVSFYGWNRVDRFMAAWKAAGFYAVGQLVFTKNYA
                     SNRRNARARRGFVDYCHEGAYVLAKGRPVPPLKPLPDVLPFPYTGNTLHPTQKPVEAL
                     QPLIESFSAPGAIVLDPFAGSGSTCVAAYRAGRRYIGIEMLAQYHRAGTERLAAMHRA
                     VNTPAANDEWLPEAA"
     misc_feature    complement(100184..100882)
                     /locus_tag="KPHS_p201480"
                     /note="putative methylase; Provisional; Region: PRK13699"
                     /db_xref="CDD:184255"
     gene            complement(101084..101200)
                     /locus_tag="KPHS_p201490"
                     /db_xref="GeneID:11844962"
     CDS             complement(101084..101200)
                     /locus_tag="KPHS_p201490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229765.1"
                     /db_xref="GeneID:11844962"
                     /translation="MPVIPRSPGVNASLPPAASVSRPVWYGTGGFSAPARRR"
     gene            complement(101319..101549)
                     /locus_tag="KPHS_p201500"
                     /db_xref="GeneID:11844963"
     CDS             complement(101319..101549)
                     /locus_tag="KPHS_p201500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229766.1"
                     /db_xref="GeneID:11844963"
                     /translation="MSPGFRNVLRLARIPVDSSEPVRRKFGSRLIGIVTVCLLPLLVF
                     DVPQWVFILSQVIWGAGVYIGLSLAGDKSLNR"
     gene            complement(101612..102283)
                     /locus_tag="KPHS_p201510"
                     /db_xref="GeneID:11844964"
     CDS             complement(101612..102283)
                     /locus_tag="KPHS_p201510"
                     /codon_start=1
                     /transl_table=11
                     /product="mediator of plasmid stability"
                     /protein_id="YP_005229767.1"
                     /db_xref="GeneID:11844964"
                     /translation="MPDGQYSFYLHSDDRTDIAAMATISTISQPLRGEFIRTAATAGA
                     VVYQVDARLPALIPVFFAGQLSAVRLCAVMALVSGTWSSLTGLPDEPENGGAALPVSP
                     ETEYQRRRYTLTLQNGRSGERVESVLTEASSRLRGDLLRNLIITGLALHTTAPELPRL
                     LASMPVPPTSVSELQALVQQMAGTADVNRAAAAVPDTPAASAAPVSGSDTREIKKNMR
                     RAFGD"
     misc_feature    complement(102062..102274)
                     /locus_tag="KPHS_p201510"
                     /note="Plasmid stability protein; Region: Plasmid_stab_B;
                     pfam10784"
                     /db_xref="CDD:119304"
     misc_feature    complement(101750..101959)
                     /locus_tag="KPHS_p201510"
                     /note="Plasmid stability protein; Region: Plasmid_stab_B;
                     pfam10784"
                     /db_xref="CDD:119304"
     gene            complement(102286..103257)
                     /locus_tag="KPHS_p201520"
                     /db_xref="GeneID:11844965"
     CDS             complement(102286..103257)
                     /locus_tag="KPHS_p201520"
                     /codon_start=1
                     /transl_table=11
                     /product="mediator of plasmid stability"
                     /protein_id="YP_005229768.1"
                     /db_xref="GeneID:11844965"
                     /translation="MNIYCDDGSTNVKLAWFEGDELQTRVSANSFRHGWKVAEFSAAT
                     FNYQVGTLKYTWDSVSRDAIPTTNVEYQYGDLNLLAVHHALLNSGLEPQPVSLTVTLP
                     LSEYYDGDCQRNEENIRRKRENLMRELVLNKGRAFTVTDVKVMPESLPAAFSRLAELK
                     PGPAETTLIIDLGGTTLDAGVIVGQFDDISAVHGNPSVGVSQVTRAAAGALRAADSET
                     SALIADTVIRNRNDRQYLQRVINDAGKIDEVRNKITEAITSLGARVTSELTAFRNVNR
                     VFLVGGGASLIEEAIRQAWPLAHDRIEVIGDPQMALAREIALYNKED"
     misc_feature    complement(102304..103257)
                     /locus_tag="KPHS_p201520"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:354300"
     misc_feature    complement(order(102745..102747,103240..103242))
                     /locus_tag="KPHS_p201520"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(102400..102402,102412..102417,
                     102736..102744,103219..103221,103225..103236))
                     /locus_tag="KPHS_p201520"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(102709..102711,102760..102762,
                     102823..102825,103006..103008,103078..103086,
                     103093..103095,103156..103158,103162..103164))
                     /locus_tag="KPHS_p201520"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            complement(103388..103513)
                     /locus_tag="KPHS_p201530"
                     /db_xref="GeneID:11844966"
     CDS             complement(103388..103513)
                     /locus_tag="KPHS_p201530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229769.1"
                     /db_xref="GeneID:11844966"
                     /translation="MRKSRTPGSVRGVSGNGYPYRDIFNSVTIIQIACLKNILSK"
     gene            complement(103506..104990)
                     /locus_tag="KPHS_p201540"
                     /db_xref="GeneID:11844967"
     CDS             complement(103506..104990)
                     /locus_tag="KPHS_p201540"
                     /codon_start=1
                     /transl_table=11
                     /product="putative retA reverse transcriptase"
                     /protein_id="YP_005229770.1"
                     /db_xref="GeneID:11844967"
                     /translation="MYGEEKSDSLIVAAKQANNPKGAESVERRSGAKGNAEQPHMRRT
                     QSRESMSQRLSRVREAAKQRKKERFTALFHLLTVEALEAAFLSLSRKAAAGVDGIRWM
                     DYAGNMKNNITDLHRRLHQGSYRAQPGRRHYIPKADGKQRPLGIASLEDKIVQYALVK
                     ILNAVYENDFMGFSYGFRPGRSQHDALDALATGLVRTNVNWVLDADISQFFDRVSHEW
                     LIRFTEHRIGDRRVIRLIRKWLTAGTSEEGQWRATEEGTPQGAVISPLLANIYLHYVF
                     DLWAHQWRRRYATGNVVMVRYADDIVIGFDKRYDARRFRIAMQRRLREFGLTVHPEKT
                     RLMEFGRFAAENRAIRGKGKPETFNFLGFTHISGKDRNGRFMLIRKTRRDRMTATLKA
                     IKDGLRRRWHYSIPEQGKWLRRVVQGYLNYHSVPGNFPTMQKFRTHVTNLWRRALRRR
                     SQKDDTTWTKANKLAAAWLPRVRVLHPWPVERFTARHPRQEPGA"
     misc_feature    complement(103638..104756)
                     /locus_tag="KPHS_p201540"
                     /note="group II intron reverse transcriptase/maturase;
                     Region: group_II_RT_mat; TIGR04416"
                     /db_xref="CDD:275209"
     gene            complement(105306..105422)
                     /locus_tag="KPHS_p201550"
                     /db_xref="GeneID:11844968"
     CDS             complement(105306..105422)
                     /locus_tag="KPHS_p201550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229771.1"
                     /db_xref="GeneID:11844968"
                     /translation="MLKSCSFIFPPDTLIFTGYAYSVRRETGRDQGVKVPDH"
     gene            105400..105831
                     /locus_tag="KPHS_p201560"
                     /db_xref="GeneID:11844969"
     CDS             105400..105831
                     /locus_tag="KPHS_p201560"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein impA"
                     /protein_id="YP_005229772.1"
                     /db_xref="GeneID:11844969"
                     /translation="MKLQLFSTGKELPPQAHPLFADLASCGFPSPAADYVESDLDLHD
                     YCIRHPSATYYLRASGDSMADGSLYNGDLLVVDSAEKPRHGDIVVASVQGEFTVKRLL
                     LTPRLTLQPMNASWSPIYPDPDELDIFGVVTHIIHRPREMY"
     misc_feature    105451..105810
                     /locus_tag="KPHS_p201560"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cl10465"
                     /db_xref="CDD:353074"
     misc_feature    order(105583..105585,105694..105696)
                     /locus_tag="KPHS_p201560"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            105831..107102
                     /locus_tag="KPHS_p201570"
                     /db_xref="GeneID:11844970"
     CDS             105831..107102
                     /locus_tag="KPHS_p201570"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="YP_005229773.1"
                     /db_xref="GeneID:11844970"
                     /translation="MFALADVNSFYASCERVFRPDLKGKPIVVLSNNDGNVIARSAEA
                     KPWIKMGTPWFQIKNERYPEKIYAFSSNYELYASMSARVMNCLEELAPRVEQYSIDEM
                     FLDLTGVEHCMGLEDFGRQLRQHVYDCTRLTIGVGAGPTKTLAKSAQWASKEWKQFRG
                     VLALTRGNPQRTRKLLSLQPVEEIWGVGNRIARKLNVLGIKTALDLALTNPAFIRKNF
                     SVVLERTVRELNGESCLSLEEAPPTKQQIVCSRSFGVKITEYESLRQAICQHAERASE
                     KLRKEHQYCRHISVFIKTSPFAIKEPYYGNVATEKLLTPTQDTRDIIAAATMALERIW
                     RDGHRYAKAGVMLNDFTGSGVSQLQLFDERPPRPHSAELMRVLDGINNSGLGKVWFAG
                     RGMASEWQMKREMLSPAYTTRWSDIPAAKLA"
     misc_feature    105831..107093
                     /locus_tag="KPHS_p201570"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     gene            complement(107184..108158)
                     /locus_tag="KPHS_p201580"
                     /db_xref="GeneID:11844971"
     CDS             complement(107184..108158)
                     /locus_tag="KPHS_p201580"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein B"
                     /protein_id="YP_005229774.1"
                     /db_xref="GeneID:11844971"
                     /translation="MSNEKRKTIGRQLNTQASIAEMTDTGRSQVFTLKTGRKVTFRFV
                     RVPASEVESKTFVNQENNGRDQLALTRESLKSIIQTIKFQQFFPCIGIKQSERIEILD
                     GSRRRASAIFVRTGLDVMVTEEHLSADEARQLAKDIQTAKEHNLREIGLRLIALKESG
                     FNQKEIAELEGLSQAKVTRALQAAAVPQDLISLFPVQSELSFSDYKLLLEVNEKLSEK
                     GLTPEELIQAVSAQLDAILNDGERPEDEQKASILKLISQASQALIDPSPKEKSVVSPL
                     WSFEEKDKFARKRVKGRTLTYEFSRMSKVIQDELDKAINEVLDRNLSQ"
     misc_feature    complement(107508..108023)
                     /locus_tag="KPHS_p201580"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:272946"
     misc_feature    complement(107202..107579)
                     /locus_tag="KPHS_p201580"
                     /note="ParB family; Region: ParB; pfam08775"
                     /db_xref="CDD:337196"
     gene            complement(108158..109363)
                     /locus_tag="KPHS_p201590"
                     /db_xref="GeneID:11844972"
     CDS             complement(108158..109363)
                     /locus_tag="KPHS_p201590"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partition protein A"
                     /protein_id="YP_005229775.1"
                     /db_xref="GeneID:11844972"
                     /translation="MDNIEQLRKVATRAGKLLTSLSESIRQQKEELKLTEFYQEYSKA
                     ALYKLPKLSKGSVEYAVAEMEAGGYIFKKKPSGNTMKYAMTIQNVIDLYNHRKVPKYR
                     DRFDKAFTIFVCNLKGGGSKTVSTASLSHAFRAHPQLLFEDLRILAIDFDPQASLTMF
                     LSHENSVGLVENTAAQAMLQNVSREELLSDFIVPSIIPGVDVIPASIDDAFLAEGWKG
                     LCEEHLPGKNIHAVLKENIIDKLQHDYDFIFLDSGPHLDAFLKNCIGAADLMLTPLPP
                     ATVDFHSSLKFVASLPALIDSIEMDGHTCNLIGNVGFMSKILNKSDHKICHSQAKEVF
                     GADMLDMVLPRLDGFERCGETFDTVISANPATYDGSTEALKSAKSAAEDFAKAVFDRI
                     EFIRTNGGM"
     misc_feature    complement(108203..109045)
                     /locus_tag="KPHS_p201590"
                     /note="Cellulose biosynthesis protein BcsQ [Cell
                     motility]; Region: BcsQ; COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(order(108527..108529,108896..108898,
                     108902..108904,108983..108985,109007..109018))
                     /locus_tag="KPHS_p201590"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:349760"
     misc_feature    complement(order(108527..108529,108533..108535,
                     108539..108541,108602..108604,108611..108613,
                     108902..108904,108908..108910,108992..109015))
                     /locus_tag="KPHS_p201590"
                     /note="active site"
                     /db_xref="CDD:349760"
     gene            complement(110473..111195)
                     /locus_tag="KPHS_p201600"
                     /db_xref="GeneID:11844973"
     CDS             complement(110473..111195)
                     /locus_tag="KPHS_p201600"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication"
                     /protein_id="YP_005229776.1"
                     /db_xref="GeneID:11844973"
                     /translation="MDTQALLPATKTFKKRASIKQSNELTEAAYYLPLQAKRVLWLCL
                     MQAYFNDSQEDDSDVLPLFKISVSDYVKYFNVATSVASRDVKAGVNALGESTVTFYPK
                     EGEFEEVKRPWLAEAGMKRGRGSWQIEFNYKVMPFLVGLTSQFTTYSLYDCGQLNSVR
                     VIRLYESLCQFRSTGVWITTHDWLCERFMLPASQKNNIAEMKRTFLEPALKKINEKTP
                     LKVTYTTEEDGRLLFNFLDKKQ"
     misc_feature    complement(110491..111153)
                     /locus_tag="KPHS_p201600"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:334362"
CONTIG      join(CP003224.1:1..111195)
//
DBGET integrated database retrieval system