GenomeNet

Database: RefSeq
Entry: NC_016847
LinkDB: NC_016847
Original site: NC_016847 
LOCUS       NC_016847               3353 bp    DNA     circular CON 28-AUG-2016
DEFINITION  Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS5,
            complete sequence.
ACCESSION   NC_016847
VERSION     NC_016847.1
DBLINK      BioProject: PRJNA84387
            Assembly: GCF_000240185.1
KEYWORDS    RefSeq.
SOURCE      Klebsiella pneumoniae subsp. pneumoniae HS11286
  ORGANISM  Klebsiella pneumoniae subsp. pneumoniae HS11286
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Klebsiella.
REFERENCE   1  (bases 1 to 3353)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 3353)
  AUTHORS   Ou,H.-Y., Jiang,X., Liu,P. and Li,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2011) State Key Laboratory of Microbial
            Metabolism, Shanghai Jiaotong University, 1954 Huashan Road,
            Shanghai 200030, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003227.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
            Source DNA is available from Hong-Yu Ou at hyou@sjtu.edu.cn.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3353
                     /organism="Klebsiella pneumoniae subsp. pneumoniae
                     HS11286"
                     /mol_type="genomic DNA"
                     /strain="HS11286"
                     /sub_species="pneumoniae"
                     /db_xref="taxon:1125630"
                     /plasmid="pKPHS5"
     gene            complement(153..575)
                     /locus_tag="KPHS_p500010"
                     /db_xref="GeneID:11743763"
     CDS             complement(153..575)
                     /locus_tag="KPHS_p500010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229777.1"
                     /db_xref="GeneID:11743763"
                     /translation="MARVSISEAARLVKVSRPTIYKMINSGKLSYTSVVKHGKDIKVI
                     DVSELIRVFGSLDGVTDTVKYDVKSDAISTEVNTIGLHDLQHRIALLEAENDGLKGAV
                     KARDEHIDSLRQAMQLLEHKHDPSSPAHSPWWKFWKKS"
     misc_feature    complement(423..563)
                     /locus_tag="KPHS_p500010"
                     /note="Helix-turn-helix domain; Region: HTH_17; pfam12728"
                     /db_xref="CDD:338467"
     gene            complement(575..736)
                     /locus_tag="KPHS_p500020"
                     /db_xref="GeneID:11743764"
     CDS             complement(575..736)
                     /locus_tag="KPHS_p500020"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA one modulator-like protein"
                     /protein_id="YP_005229778.1"
                     /db_xref="GeneID:11743764"
                     /translation="MAKFIQNQSLLLLEKLNELDLDAEADLCEKLHDDAEHLFRTLSS
                     RLDSLQDGN"
     misc_feature    complement(596..736)
                     /locus_tag="KPHS_p500020"
                     /note="Rop protein; Region: Rop; pfam01815"
                     /db_xref="CDD:307776"
     gene            723..1139
                     /locus_tag="KPHS_p500030"
                     /db_xref="GeneID:11743765"
     CDS             723..1139
                     /locus_tag="KPHS_p500030"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid replication initiation protein"
                     /protein_id="YP_005229779.1"
                     /db_xref="GeneID:11743765"
                     /translation="MNLAMFSAVFCCFVIKGLRASVLSVKPVSFPLPRSLSRYAPVVR
                     LRRAAGACIEKLEKTERSKEEKKERPRRCRFSIGSAPLTSIAETDAQISGGETRQDYK
                     DTRRFPLAAPSCALLFLPFGLPVSFRCYGRGFSFHA"
     gene            complement(1502..1903)
                     /locus_tag="KPHS_p500040"
                     /db_xref="GeneID:11743766"
     CDS             complement(1502..1903)
                     /locus_tag="KPHS_p500040"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage protein"
                     /protein_id="YP_005229780.1"
                     /db_xref="GeneID:11743766"
                     /translation="MISSKEMLDFARGSYSKFDAAGYICLSEEVEYRTCARSAYYALY
                     HYLKSIADKLPGSYEDVSSHEKVIRKLLNSGDPKLMDLAQKMISTRKTRVRADYHIDK
                     NFGKSEAYKILRIVEKIFKDAELSEGEVLDS"
     gene            complement(1900..2691)
                     /locus_tag="KPHS_p500050"
                     /db_xref="GeneID:11743767"
     CDS             complement(1900..2691)
                     /locus_tag="KPHS_p500050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005229781.1"
                     /db_xref="GeneID:11743767"
                     /translation="MVSISPKKAEDEALDILNRVIVEKRNVSEFENVRIINCLDSLRR
                     ARSSSYDEISACYYAQIADIDNLLVSVSNVFSSDCEDSFFNIIYALNNAMRYREIYKY
                     VKDLDLDYNIRDFLESAIKASAFCVDKEMVDKFTTSYANAFHDESSVDFLNHISEINS
                     FFLNHESIKKEMSNYMLDCFDVFSRKSLIKTKEIDGTYGYSHHVFNDEGYEFLAFSFI
                     LRGDEIDMDMLIDIEDEFTYEISRIKYDPIIKTKISFNFELGDLS"
CONTIG      join(CP003227.1:1..3353)
//
DBGET integrated database retrieval system