GenomeNet

Database: RefSeq
Entry: NC_017659
LinkDB: NC_017659
Original site: NC_017659 
LOCUS       NC_017659             147060 bp    DNA     linear   CON 10-MAR-2020
DEFINITION  Escherichia coli O83:H1 str. NRG 857C plasmid pO83_CORR, complete
            sequence.
ACCESSION   NC_017659
VERSION     NC_017659.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603727
            Assembly: GCF_000183345.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli O83:H1 str. NRG 857C
  ORGANISM  Escherichia coli O83:H1 str. NRG 857C
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 147060)
  AUTHORS   Nash,J.H., Villegas,A., Kropinski,A.M., Aguilar-Valenzuela,R.,
            Konczy,P., Mascarenhas,M., Ziebell,K., Torres,A.G., Karmali,M.A.
            and Coombes,B.K.
  TITLE     Genome sequence of adherent-invasive Escherichia coli and
            comparative genomic analysis with other E. coli pathotypes
  JOURNAL   BMC Genomics 11, 667 (2010)
   PUBMED   21108814
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 147060)
  AUTHORS   Eaves-Pyles,T., Allen,C.A., Taormina,J., Swidsinski,A., Tutt,C.B.,
            Jezek,G.E., Islas-Islas,M. and Torres,A.G.
  TITLE     Escherichia coli isolated from a Crohn's disease patient adheres,
            invades, and induces inflammatory responses in polarized intestinal
            epithelial cells
  JOURNAL   Int. J. Med. Microbiol. 298 (5-6), 397-409 (2008)
   PUBMED   17900983
REFERENCE   3  (bases 1 to 147060)
  AUTHORS   Allen,C.A., Niesel,D.W. and Torres,A.G.
  TITLE     The effects of low-shear stress on Adherent-invasive Escherichia
            coli
  JOURNAL   Environ. Microbiol. 10 (6), 1512-1525 (2008)
   PUBMED   18312396
REFERENCE   4  (bases 1 to 147060)
  AUTHORS   Ziebell,K., Kropinski,A., Coombes,B., Karmali,M., Nash,J.,
            Torres,A., Swidsinski,A., Villegas,A., Konczy,P. and Mascarenhas,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JAN-2010) Laboratory for Foodborne Zoonoses, Public
            Health Agency of Canada, 110 Stone Road West, Guelph, Ontario N1G
            3W4, Canada
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001856.
            Sequencing difficulties because of rich transposon-like sequences
            made it impossible to circularize this plasmid.
            Bacterium available from Laboratory for Foodborne Zoonoses, 110
            Stone Road West, Guelph, Ontario N1G 3W4, Canada
            Genome was manually curated based on annotation generated by the
            NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
            Information about  the Pipeline can be found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 06:55:48
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,707
            CDSs (total)                      :: 4,596
            Genes (coding)                    :: 4,498
            CDSs (with protein)               :: 4,498
            Genes (RNA)                       :: 111
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 83
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 98
            CDSs (without protein)            :: 98
            Pseudo Genes (ambiguous residues) :: 0 of 98
            Pseudo Genes (frameshifted)       :: 47 of 98
            Pseudo Genes (incomplete)         :: 47 of 98
            Pseudo Genes (internal stop)      :: 18 of 98
            Pseudo Genes (multiple problems)  :: 13 of 98
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..147060
                     /organism="Escherichia coli O83:H1 str. NRG 857C"
                     /mol_type="genomic DNA"
                     /strain="NRG 857C"
                     /serotype="O83:H1"
                     /db_xref="taxon:685038"
                     /plasmid="pO83_CORR"
                     /note="strain associated with Crohn's Disease"
     gene            44..1076
                     /locus_tag="NRG857_RS22770"
                     /pseudo
     CDS             44..1076
                     /locus_tag="NRG857_RS22770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001346265.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            2313..3428
                     /gene="iroB"
                     /locus_tag="NRG857_RS22775"
                     /old_locus_tag="NRG857_30008"
     CDS             2313..3428
                     /gene="iroB"
                     /locus_tag="NRG857_RS22775"
                     /old_locus_tag="NRG857_30008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_001318220.1"
                     /translation="MRILFVGPPLYGLLYPVLSLAQAFRVNGHEVLIASGGQFAQKAA
                     EAGLVVFDAAPGLDSEAGYRHHEAQRKKSNIGTQMGNFSFFSEEMADHLVEFAGHWRP
                     DLIIYPPLGVIGPLIAAKYDIPVVMQTVGFGHTPWHIKGVTRSLTDAYRRHNVGATPR
                     DMAWIDVTPPSMSILENDGEPIIPMQYVPYNGGAVWEPWWERRPERKRLLVSLGTVKP
                     MVDGLDLIAWVMDSASEVDAEIILHISANARSDLRSLPSNVRLVDWIPMGVFLNGADG
                     FIHHGGAGNTLTALHAGIPQIVFGQGADRPVNARVVAERGCGIIPGDVGLSSNMINAF
                     LNNRSLRKASEEVAAEMAAQPCPGEVAKSLITMVQKG"
     gene            3568..7227
                     /gene="iroC"
                     /locus_tag="NRG857_RS22780"
                     /old_locus_tag="NRG857_30010"
     CDS             3568..7227
                     /gene="iroC"
                     /locus_tag="NRG857_RS22780"
                     /old_locus_tag="NRG857_30010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001318221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_001111199.1"
                     /translation="MPANHTPTPAQSWIVRLARVCWERKKLSVIVVVASVSTILLAAL
                     TPLLTRQAVNDALAGNPARLPWLACGLLLIAFFDFIGNYVRRGYAGMLSLWVQHTLRG
                     RVFDSIQKLDGAGQDALRTGQVISRTNSDLQQVHTLLQMCPVPLAVFTYYIAGIAVML
                     WMSPAMTLIVVCVLVCLAITALRARRRVFAQTGLASDQLANLTEHIREVLAQISVVKS
                     CVAEMRETHWLDRQSRQIVRVRIGAVISQAMPGATMLALPVLGQIVLLCYGGWSVMHG
                     RIDLGTFVAFASFLAMLTGPTRVLASFLVIAQRTQASVERVFALIDTRSQMEDGTESI
                     NSQVVGLELENMSFDYHHGDRHILSNISFSLRAGETVAVVGASGSGKSTLLMLLARFY
                     DPCSGKIWLNTSEGRQNLRDIRLEALRRRVGIVFEDAFLFAGTVAENIAYGHPQATAD
                     DIRRAAAAAGASDFINALPKGFDSLLTERGTNLSGGQRQRIALARALITAPDVLILDD
                     TTSAVDAVTEAEINTALGRYADEGHMLLVIARRRSTLQLASRVVVLDKGRMVDTGTPA
                     ELEARCPAFRALMTGDSDFLATSHNSHNELWPAEPATQDDVTDTGDKGFVARMTRVPE
                     NAVQQALAGKGRKVTSLLKPVAWMFVIAALLIALDSAAGVGVLILLQHGIDSGVATGD
                     MSIIGLCALLALCLVIVGWCSYSLQTVFAARAAESVQHSVRLRSFGHMLRLGLPWHEK
                     HADSRLTRMTVDVDSLARFLQNGLAGAATSLVTMFAIAATMFWLDPFLALTALSAVPV
                     AALATMIYRRLSTPAYAQARLEIGKVNSTLQEKVSGLRVVQSHGQQELEGARLRALSE
                     RFRATRVRAQKYLAVYFPFLTFCTEASYAAVLLVGASQVAAGEMTAGVLAAFFLLLGQ
                     FYGPVQQLSGIVDAWQQATASGKHIDELLATEGTEHLGSSSVLPVTGALHLDEVTFSY
                     PDSHEPALNKLTLTIPEGMVVAVVGRSGAGKSTLIKLIAGLYFPTHGNIRIGVQMLDD
                     ASLTEYRRQIGLVDQDVALFSSDIAENIRYSRPSATNEDVEIASQRAGLYEMVCNLPQ
                     GFRTPVNNGGADLPAGQRQLIALARAQLANAHILLLDEATSCLDRTSEERLMSSLTDV
                     VHAGKHSALIVAHRLTTAQRCDLIAVIDKGLLAEYGTHEQLLSAGGLYTRLWHDSVSS
                     TALHRQHNMKEETPG"
     gene            7331..8560
                     /gene="iroD"
                     /locus_tag="NRG857_RS22785"
                     /old_locus_tag="NRG857_30012"
     CDS             7331..8560
                     /gene="iroD"
                     /locus_tag="NRG857_RS22785"
                     /old_locus_tag="NRG857_30012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000933675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catecholate siderophore esterase IroD"
                     /protein_id="WP_000933675.1"
                     /translation="MLNMQQHPSAIASLRNQLAAGHIANLTDFWREAESLNVPLVTPV
                     EGAEDEREVTFLWRARHPLQGVYLRLNRVTDKEHVEKGMMSALPETDIWTLTLRLPAS
                     YCGSYSLLEIPPGTTAETIALSGGRFATLAGKADPLNKMPEINVRGNAKESVLTLDKA
                     PALSEWNGGFHTGQLLTSMRIIAGKSRQVRLYIPDVDISQPLGLVVLPDGETWFDHLG
                     VCAAIDAAINNGRIVPVAVLGIDNINEHERTEILGGRSKLIKDIAGHLLPMIRAEQPQ
                     RQWADRSRTVLAGQSLGGISALMGARYAPETFGLVLSHSPSMWWTPERTSRPGLFSET
                     DTSWVSEHLLSAPPQGVRISLCVGSLEGSTVPHVQQLHQRLITAGVESHCAIYTGGHD
                     YAWWRGALIDGIGLLQG"
     gene            8645..9601
                     /gene="iroE"
                     /locus_tag="NRG857_RS22790"
                     /old_locus_tag="NRG857_30013"
     CDS             8645..9601
                     /gene="iroE"
                     /locus_tag="NRG857_RS22790"
                     /old_locus_tag="NRG857_30013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000271276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catecholate siderophore esterase IroE"
                     /protein_id="WP_000271276.1"
                     /translation="MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAKPDMRPLGPNIA
                     DKGSVFYHFSVTSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDEL
                     LKQLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGHFSRKSGGSNNF
                     RQLLETRIAPKVEQGLNIDRQRRGLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRG
                     YDALLSRVTAVEPLQFCAKHLAIMEGSATQGDNRETHAVGVLSKIHTTLTILKDKGVN
                     AVFWDFPNLGHGPMFNASFRQALLDISGENANYTAGCHELSH"
     gene            complement(9646..11823)
                     /gene="iroN"
                     /locus_tag="NRG857_RS22795"
                     /old_locus_tag="NRG857_30015"
     CDS             complement(9646..11823)
                     /gene="iroN"
                     /locus_tag="NRG857_RS22795"
                     /old_locus_tag="NRG857_30015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001222186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore salmochelin receptor IroN"
                     /protein_id="WP_001222186.1"
                     /translation="MRINKILWSLTVLLVGLNSQVSVAKSSDDDNDETLVVEATAEQV
                     LKQQPGVSVITSEDIKKTPPVNDLSDIIRKMPGVNLTGNSASGTRGNNRQIDIRGMGP
                     ENTLILIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPEQVERIEVIRGPAAARYGSGA
                     AGGVVNIITKRPTNDWHGSLSLYTNQPESSDEGATRRANFSLSGPLAGNALTTRLYGN
                     LNKTDADSWDINSPVGTKNAAGHEGVRNKDINGVVSWKLNPQQILDFEAGYSRQGNIY
                     AGDTQNSSSSAVTESLAKSGKETNRLYRQNYGITHNGIWDWGQSRFGVYYEKTNNTRM
                     NEGLSGGGEGRILAGEKFTTNRLSSWRTSGELNIPLNVMVDQTLTVGAEWNRDKLDDP
                     SSTSLTVNDSDISGISGSAADRSSKNHSQISALYIEDNIEPVPGTNIIPGLRFDYLSD
                     SGGNFSPSLNLSQELGDYFKVKAGVARTFKAPNLYQSSEGYLLYSKGNGCPKDITSGG
                     CYLIGNKDLDPEISVNKEIGLEFTWEDYHASVTYFRNDYQNKIVAGDNVIGQTASGAY
                     ILKWQNGGKALVDGIEASMSFPLVKDRLNWNTNATWMITSEQKDTGNPLSVIPKYTIN
                     NSLNWTITQAFSASVNWTLYGRQKPRTHAETRSEDTGGLSGKELGAYSLVGTNFNYDI
                     NKNLRLNVGVSNILNKQIFRSSEGANTYNEPGRAYYAGVTASF"
     gene            complement(12678..>13466)
                     /locus_tag="NRG857_RS22800"
                     /old_locus_tag="NRG857_30017"
                     /pseudo
     CDS             complement(12678..>13466)
                     /locus_tag="NRG857_RS22800"
                     /old_locus_tag="NRG857_30017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001335133.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
     gene            complement(13611..14579)
                     /locus_tag="NRG857_RS22805"
                     /old_locus_tag="NRG857_30018"
     CDS             complement(13611..14579)
                     /locus_tag="NRG857_RS22805"
                     /old_locus_tag="NRG857_30018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
                     /protein_id="WP_000654811.1"
                     /translation="MKDQITHPPDNTDHSVAKQKFRITNWSTYNKALINRGSLTFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFALMNVP
                     LRCPDYTSVSKRAKSVNVSFKTSTRGEIAHLVIDSTGLKVFGEGEWKVRKHGKERRRI
                     WRKLHLAVDSNTHEVVCADLSLNNVTDSEAFPGLIRQTHRKIRAAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRLSGSNARWKWTTEYNRRSIAETA
                     MYRMKQLLGDSLTLRDYDGQVAEAMAMVRALNRMTKAGMPESVRIA"
     gene            14599..14847
                     /locus_tag="NRG857_RS22810"
     CDS             14599..14847
                     /locus_tag="NRG857_RS22810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001366840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_032300423.1"
                     /translation="MQQSPLIGELGEGLSGGQKQRIFIARALYRKPGILFMDEATSAL
                     DSESEHFVNVAIKNMNITRVIIAHRETTLRTVDRVISI"
     gene            complement(15017..15328)
                     /gene="cvaC"
                     /locus_tag="NRG857_RS22815"
                     /old_locus_tag="NRG857_30019"
     CDS             complement(15017..15328)
                     /gene="cvaC"
                     /locus_tag="NRG857_RS22815"
                     /old_locus_tag="NRG857_30019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001259758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V"
                     /protein_id="WP_001259758.1"
                     /translation="MRTLTLNELDSVSGGASGRDIAMAIGTLSGQFVAGGIGAAAGGV
                     AGGAIYDYASTHKPNPAMSPSGLGGTIKQKPEGIPSEAWNYAAGRLCNWSPNNLSDVC
                     L"
     gene            complement(15306..15542)
                     /gene="cvi"
                     /locus_tag="NRG857_RS22820"
                     /old_locus_tag="NRG857_30020"
     CDS             complement(15306..15542)
                     /gene="cvi"
                     /locus_tag="NRG857_RS22820"
                     /old_locus_tag="NRG857_30020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001323890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin V immunity protein"
                     /protein_id="WP_014640552.1"
                     /translation="MDRKRTKLELLFAFIINATAIYIALAIYDCVFRGKDFLSMHTFC
                     FSILMSAICYFVGDNYYSISDKIKRRSYENSDSK"
     gene            complement(16006..16287)
                     /locus_tag="NRG857_RS22825"
                     /old_locus_tag="NRG857_30022"
     CDS             complement(16006..16287)
                     /locus_tag="NRG857_RS22825"
                     /old_locus_tag="NRG857_30022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001105075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001105066.1"
                     /translation="MNYDEITKITAERISDYMTEAVNTDSIAVAEMFHNAAWGVRTLW
                     FELVTKIDIDIHKKNRYASYDLRRKIEMQHEEFQKMTEREQVPLLKSPE"
     gene            <16460..16627
                     /locus_tag="NRG857_RS22830"
                     /pseudo
     CDS             <16460..16627
                     /locus_tag="NRG857_RS22830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001282376.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="colicin-B"
     gene            complement(16645..17172)
                     /gene="cbi"
                     /locus_tag="NRG857_RS22835"
     CDS             complement(16645..17172)
                     /gene="cbi"
                     /locus_tag="NRG857_RS22835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000203268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin B immunity protein"
                     /protein_id="WP_000203272.1"
                     /translation="MTSNKDKNKKANEILYAFSIIGIIPLMAILILRINNPYSQVLYY
                     LYNKVAFLPSITSLHDPVMTALMSNYNKTAPVMGILVFLCTYKTREIIKPVTRKLVVQ
                     SCFWGAVFYAILIYITLFYNLELTTAGGFFKLLSHNVITLFILYCSIYFTVLTMTYAI
                     LLMPLLVIKYFKGRQ"
     gene            17416..18231
                     /gene="cma"
                     /locus_tag="NRG857_RS22840"
                     /old_locus_tag="NRG857_30029"
     CDS             17416..18231
                     /gene="cma"
                     /locus_tag="NRG857_RS22840"
                     /old_locus_tag="NRG857_30029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000449473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid II-degrading bacteriocin colicin M"
                     /protein_id="WP_001312845.1"
                     /translation="METLTVHAPSPSTNLPSYGNGAFSLSAPHVPGAGPLLVQVVYSF
                     FQSPNMCLQALTQLEDYIKKHGASNPLTLQIISTNIGYFCNADRNLVLHPGISVYDAY
                     HFSKPAPSQYDYRSMNMKQMSGNVTTPIVALAHYLWGNGAERSVNIANIGLKISPMKI
                     NQIKDIIKSGVVGTFPVSTKFTHATGDYNVITGAYLGNITLKTEGTLTISANGSWTYN
                     GVVRSYDDKYDFNASTHRGVIGESLTRLGAMFSGKEYQILLPGEIHIKESGKR"
     gene            complement(18281..18634)
                     /gene="cmi"
                     /locus_tag="NRG857_RS22845"
                     /old_locus_tag="NRG857_30030"
     CDS             complement(18281..18634)
                     /gene="cmi"
                     /locus_tag="NRG857_RS22845"
                     /old_locus_tag="NRG857_30030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_104216667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin M immunity protein"
                     /protein_id="WP_000864812.1"
                     /translation="MKVISMKFIFILTIIALAAVFFWSEDKGPACYQVSDEQARTFVK
                     NDYLQRMKRWDNDVQLLGTEIPKITWEKIERSLTDVEDEKTLLVPFKAEGPEGKRMYY
                     GMYHCEEGYVEYAND"
     gene            complement(18812..19603)
                     /locus_tag="NRG857_RS22850"
                     /old_locus_tag="NRG857_30031"
     CDS             complement(18812..19603)
                     /locus_tag="NRG857_RS22850"
                     /old_locus_tag="NRG857_30031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000016493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="WP_000016493.1"
                     /translation="MSGPQLLSLPGSFLTPPATLPVAIDYPAALALRQMALVQDELPK
                     YLLAPEISALLHYVPDLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQLATL
                     KQRTEKATRTAGRVPAGSQVHRLVPLSDTQYVSQLQMMVATLKIPLERRNKRTGRMEK
                     ARIWGITDRTVRTWLNEAVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQS
                     LMGHKSISSTEVYTKVFALDVAARHRVQFSIPESDAVTMLKNRHA"
     gene            complement(19600..20289)
                     /locus_tag="NRG857_RS22855"
                     /old_locus_tag="NRG857_30032"
     CDS             complement(19600..20289)
                     /locus_tag="NRG857_RS22855"
                     /old_locus_tag="NRG857_30032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000796228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000796228.1"
                     /translation="MADWFIATEGVKVVKDSASLGPQIITAVSTIASAVGAVFLTHHF
                     TLRREERTAAAKLASERLYISTELVFLLERFAQRCAPAATATVEHDQDGRGEAEFLLP
                     EIDYSPVSGNWRSLPSGLMYRLSELSVLSYEAVVCVDNVFVEDTPYGGAGEYSLHKNA
                     AMLGVKALRLSRELRMLCGLPLHGLSDTLSPTRLVLLKARGKTLQKEYEMVKKSKKTE
                     QEIEDFIKGTS"
     gene            complement(20333..20683)
                     /locus_tag="NRG857_RS22860"
                     /old_locus_tag="NRG857_30034"
     CDS             complement(20333..20683)
                     /locus_tag="NRG857_RS22860"
                     /old_locus_tag="NRG857_30034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000493378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000493379.1"
                     /translation="MFTAFNERNDFSYAFEKIRNAISAPGENNVYAATELGLGILLRK
                     YEQFRRELDAAGELGNWEYDLDTYNHCIAVLQRYFTGNPSGLTERDARIYSHYLQTEH
                     KGFVKLAEELAADR"
     gene            21227..22315
                     /gene="pifC"
                     /locus_tag="NRG857_RS22865"
                     /old_locus_tag="NRG857_30036"
     CDS             21227..22315
                     /gene="pifC"
                     /locus_tag="NRG857_RS22865"
                     /old_locus_tag="NRG857_30036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000952217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor PifC"
                     /protein_id="WP_000952217.1"
                     /translation="MLSQLNLRFHKKLIEALKTRAGRENTSVNALAERFLDDGLKTVA
                     PGDGYFQLIADPEATVRQLYRHIILGQTFGTSALSRDELRFVLVHVREAFLRGHNRLA
                     TLPALDTLLDITGNLLAWQVEHDRPVDGHYLKGIFRLAGKNWTEEFEAFRAALRPVVD
                     QMYAEHLLRPLESDCFGLAEVPDAVLAEIFTLPRLKAVFPLMLRGLDWNTEQARTLAQ
                     ELRPVISAVTETIEAGTLRLEIRVDGQHPGERPGAWYTTPRLHLLITGQDFVVPYGWE
                     ALSELLGLFTLYARHPEALTHGHQGERVMFSPPGNVTPEGFFGIDGLRIFMPAEAFET
                     LVRELATRCQEGPLAEALTGLRCLYGDL"
     gene            22317..24542
                     /locus_tag="NRG857_RS22870"
                     /old_locus_tag="NRG857_30037"
     CDS             22317..24542
                     /locus_tag="NRG857_RS22870"
                     /old_locus_tag="NRG857_30037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001723877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage T7 exclusion protein"
                     /protein_id="WP_000698737.1"
                     /translation="MKILRQLWNQKGLDAAVEDVPEDRYGFGNIAENISRSILTLPLE
                     ASNVVGIEGAWGSGKTSLLNLILRNLALKKDAHTHVLHISPWLSGGSPVEALFLPVAT
                     VIQQEMEIRYPPKGFKKLWRKYLLSPEAQKVIEYAQDTSSRVLPLVQYIGQFSSIINW
                     IAGGIKVFSDSRLAVDQKTTTKLRAEIAGQLVSLDLKFIVVMDDLDRLEPSQVAEVFR
                     LVRAVADLPRFTHILCYDRQIITHAVEHALNIEDGSRYLQKIIQLSFKLPRPEAFDLR
                     NEFRQRAEALYQQINNQPPDSGMVRDLIAVTDTYGAALSTPREIHQAINSLIFLYPGM
                     RDFVYFPDLCLLQLIRVTNPALYDWTEHYLTERSVIETGQGMLSDGEKADFREGLIRC
                     MKTFRASNADSFLTLADWIPGISGHNDEYLNLFEPVSEDFRHIQTTGKRLSSLTHWRY
                     YFAFSSPQNVLPPEFFRQLFEQAGVSEKQQQLSELLLSKINSVGSLSGTWFEHILSRL
                     TPGLIRERNFEECAGLVHFFFDHTDEVSTRFSIRNPWFSLREMAINEVVRHLLKHMQD
                     IDETRTITLMEKLIVTGASPFWIADFMRDLIWEHGLAQNAVPSPSDALFSRDITERLR
                     DRFAERMNQPELQQQLLLRKSLLGYLYAWRDMSSGETVKQWVREVTTTDEGLVNLLIR
                     LQTSVFSSHRGAYRRIARDQVSPFFDDWPAVEEKLKVMLSGNELTPEQEALKTALEND
                     D"
     gene            complement(24592..25491)
                     /locus_tag="NRG857_RS22875"
                     /old_locus_tag="NRG857_30038"
     CDS             complement(24592..25491)
                     /locus_tag="NRG857_RS22875"
                     /old_locus_tag="NRG857_30038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004225022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide-binding protein"
                     /protein_id="WP_000963206.1"
                     /translation="MAIDIFQSLKNCVFDLQRADVQNYQQPLKQLARLLNSENLQSVN
                     AHLTRNVELDTFLARSEDTESSMAGSAVLQWPDEPADILGLKLLLIEKMADDNNFSFN
                     FCHTFFYDRNIIESIRKFTSSLVAPFVRDYQLYVENQHDPEPAVFRPVSRKIFIVHGH
                     DNDALQSVARFISRIGLEEIILSERPDGSRTIIEKFEAESGDVSFAIVLMTPDDSGSA
                     LASESTRLRARQNVLYELGYFAGKLGRGKVLVLRKGDIEIPSDLAGVLYTELDEHGGW
                     KRKLLSELAYAGVPFDKDKALSA"
     gene            complement(25481..25771)
                     /locus_tag="NRG857_RS22880"
                     /old_locus_tag="NRG857_30039"
     CDS             complement(25481..25771)
                     /locus_tag="NRG857_RS22880"
                     /old_locus_tag="NRG857_30039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000538310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000111771.1"
                     /translation="MSVKITGLDKMQKQLKEVERATEALNGSYDVHFDANDPVSIENA
                     IQEAYSMVYERASGYATNPMVSPLIEHMKENLRQQILDRAEQQRQESGQDGN"
     gene            26067..26297
                     /locus_tag="NRG857_RS22885"
                     /old_locus_tag="NRG857_30041"
     CDS             26067..26297
                     /locus_tag="NRG857_RS22885"
                     /old_locus_tag="NRG857_30041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="WP_001261287.1"
                     /translation="MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVR
                     PTWGSFLEYEKADPDFMAEREDVVSDEGRFNL"
     gene            26294..26710
                     /locus_tag="NRG857_RS22890"
                     /old_locus_tag="NRG857_30042"
     CDS             26294..26710
                     /locus_tag="NRG857_RS22890"
                     /old_locus_tag="NRG857_30042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapC family
                     toxin"
                     /protein_id="WP_001044768.1"
                     /translation="MNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITY
                     SEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRAAVDATTKIKVALRLAGTPIGPN
                     DTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK"
     gene            complement(26872..29010)
                     /locus_tag="NRG857_RS22895"
                     /old_locus_tag="NRG857_30043"
     CDS             complement(26872..29010)
                     /locus_tag="NRG857_RS22895"
                     /old_locus_tag="NRG857_30043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000350616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_000350638.1"
                     /translation="MDIEIRHCNNIVRAHITLTADKLNIKFAPNGTGKSTLSRAISCA
                     ARDDIQGLQALMPFRLRGENPDSTGPIVIGADGIGDVMCFNEEYVSQFTFQPDELISD
                     SFNILIRNQAHAEREREIEEMTQKIRAVFTDHTELNSLIDHLQELSNAFRSTSSGISR
                     SSTGMRGLSGGNKIHHIPAGLENYQPYIRSERRVEWIDWQTKGLEFSPLSDGCCPFCT
                     GDITGKEAQIRQVREEYDKSTIKNLTAIIRLVENLGNYLTESARERLLAITMLQNGPE
                     AEHIEYLVALKRQTDTLTEKLTALRGLNVFSLQEQQNVREVLTARLIDLQFFPDLQSE
                     LMQGITDRLNAALMDLINLAGPLQGKINRHRDSMIRLIAQHKTNINNFLTYAGYKYRV
                     DIAGEGEQRKLRLRHIDFDGYVSGGSQHLSYGERNAFAIVLFMYECLSKNPGLIILDD
                     PISSFDKNKKFAILEMLFRRASGECLKNRTVLMLTHDVEPVIDTLKSVRRLFSNQVTA
                     SCLRLSAGVIEELPVNDGDIMTFMQICKSITASADCEEIIKLIYLRRYFEIVDERGDA
                     YQLLSNLFHRRVVPLDYREPAAAGSGYPKMAPEKIQQALRDIREYVDSFDYPRLQALV
                     SSPDEIKNLYRRCRNGYEKLQVFRLLELDQDHPVIRKFVNETYHIENEFICQLDPSRF
                     DLIPEYVIMECDKLIALPPAANQSSVARIA"
     gene            29364..29621
                     /locus_tag="NRG857_RS22900"
                     /old_locus_tag="NRG857_30048"
     CDS             29364..29621
                     /locus_tag="NRG857_RS22900"
                     /old_locus_tag="NRG857_30048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000371889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000343085.1"
                     /translation="MDEERVFSLSYEQLTRFAEKRIRECNLDSQGAIYLCESAKAGAV
                     LIFWHELAINGYASMNAIKRQELIDADFQRLRNLIWPEDDR"
     gene            29621..30211
                     /locus_tag="NRG857_RS22905"
                     /old_locus_tag="NRG857_30050"
     CDS             29621..30211
                     /locus_tag="NRG857_RS22905"
                     /old_locus_tag="NRG857_30050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001542561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000194575.1"
                     /translation="MTQSRRPSPLQRRVLIVLAALDEKRPGPVLTRDLERVLERSGEA
                     PVYGPNLRASCRRLEDAGWLRTLRAPNLQLAVELTDAGRAVAQPLLLAEQDRLRAEQR
                     AAEVVVLPLVPAAGLPADGTSATDLAVQLNGITYQACRGDFVVRLDGSTCLQLWNKEG
                     RVVRLEGDPLEVAQWLQACHDAGMEVRVQVNESVTP"
     gene            30474..32030
                     /locus_tag="NRG857_RS22910"
                     /old_locus_tag="NRG857_30054"
     CDS             30474..32030
                     /locus_tag="NRG857_RS22910"
                     /old_locus_tag="NRG857_30054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001743885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_000818556.1"
                     /translation="MAEKNKKTITGQVLNSIKINKLKCINGLNEIIFKPHALTAILGP
                     NGSGKSTILHAIASIYMPEEGFPGEDHRLMHFFPRSPHAEWNGSDFIVNLTYRKDGVM
                     IENELKNYGKADIRGSRWIQIYARRPLREVYYLGIDKCVPIIESEKKNNIQYETSSVS
                     NDLITNILHYASYILNKPYTSFNQHQQPNGKILIGVESGGLAYSSLSMSAGEQKIFLI
                     LETILKADKNALILIDELDLLLHDEALKKLIEVISSHAKDKNKQIIFTTHREMITTLS
                     DKINIRHVVNIQGRSYSFEETKPDAINRLTGESTTPIEIYVEDDLAVAIINKICSSLK
                     ASKYVKIFKFGAASNAFTLLASTLIRGDNLSGKLYILDGDKYSTENEKKTALDKVFTG
                     TESRTYELKAAAEGKVKQFNLPNGVKPEQYIHYLITNVPLDGLGGEYLEIIEAARDIR
                     VELDAHNYISNILTKLGIDRPSGLTRVMDLASRHPEWHQYVSEVTDWLQPVVSDLMER
                     LPENDTVDIT"
     gene            32221..32838
                     /locus_tag="NRG857_RS22915"
                     /old_locus_tag="NRG857_30056"
     CDS             32221..32838
                     /locus_tag="NRG857_RS22915"
                     /old_locus_tag="NRG857_30056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000521603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000521603.1"
                     /translation="MGKYQEEKKTPIIMVKKRRTLLPPSLSEKTGVIARSETEKMEES
                     VSEGISSPAVDTHTPDAPACKKKKKRRRFPRQPHWTHEFTHDCVEKVKSLFPHLRAEG
                     GGFLPLKIGITNDFAAFLTEHPETELTLDEWSCAISCITTRQVYLQRTAVAGIPRYGL
                     DGLPAGQVSECDALNARRWLAVREQQKLKMKTMQEQSASTEKTER"
     gene            complement(33131..34264)
                     /locus_tag="NRG857_RS22920"
                     /old_locus_tag="NRG857_30060"
     CDS             complement(33131..34264)
                     /locus_tag="NRG857_RS22920"
                     /old_locus_tag="NRG857_30060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001089728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_001089728.1"
                     /translation="MNSWIPMLQDAAEMFVFLAVELSLLFIVISAGVSLIRQKVPDHK
                     IQQMMGARKGKGYLLASLLGAVTPFCSCSTIPMLRGLLSAKAGFGPTLTFLFVSPLLN
                     PIIVGLMWVTFGWKVTLLYAIIAAGVSVLSSIILDYLGFERHIVEYKNSVSGSCATKC
                     GDSEASVKTSAVSSCCGAGLALASVKTNCCTSSAKTIINLKTVKKEQNISACCPSILS
                     EKSSESCCSSESQGNRNLTMNATSGLIKLAMKDALQQFKDVLPYLLLSVLIGSFIYGF
                     IPSEWIAAHAGADNPLAIPLSAVVGIPLYIRAEAVIPLASVLMTKGMGLGALMALIIG
                     SAGASLTEVILLKSMFRMPMIIAFLTVILGMAILMGYLTQFLF"
     gene            34369..34692
                     /locus_tag="NRG857_RS22925"
                     /old_locus_tag="NRG857_30061"
     CDS             34369..34692
                     /locus_tag="NRG857_RS22925"
                     /old_locus_tag="NRG857_30061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001175593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_001175594.1"
                     /translation="MQLEEVAKALKELGHPTRLFIFKHLVKAGEQGLPVGELQKQLGI
                     PSSTLSHHISALVSVGLVTQNRESRTLMCVSQYEILEAIIEFLREECCVNSKTDVAEP
                     AGKNG"
     gene            complement(34747..>36498)
                     /locus_tag="NRG857_RS22930"
                     /old_locus_tag="NRG857_30063"
                     /pseudo
     CDS             complement(34747..>36498)
                     /locus_tag="NRG857_RS22930"
                     /old_locus_tag="NRG857_30063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001138014.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3-like element TnAs1 family transposase"
     gene            36502..36894
                     /locus_tag="NRG857_RS22935"
                     /old_locus_tag="NRG857_30064"
     CDS             36502..36894
                     /locus_tag="NRG857_RS22935"
                     /old_locus_tag="NRG857_30064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001407380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="WP_001351729.1"
                     /translation="MLFPNFSLGEEYEHAPPATNRQISPYLPSGRFRTGLPVEGLAIE
                     RGDLFYACPRASVFYGTALDADLRTRGVSTLVMAGISTTGVVLSSVAWASDADYDVRL
                     VQDCCYDPDRDAHEALLRSGFGGRVQVV"
     gene            37032..37916
                     /locus_tag="NRG857_RS22940"
                     /old_locus_tag="NRG857_30066"
     CDS             37032..37916
                     /locus_tag="NRG857_RS22940"
                     /old_locus_tag="NRG857_30066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000058717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_000058717.1"
                     /translation="MSLRTPDLLFTAIAPAIWGSTYIVTTQYLPNFSPMTVAMLRALP
                     AGLLLVMIVRQIPTGIWWMRIFILGALNISLFWSLLFISVYRLPGGVAATVGAVQPLM
                     VVFISAALLGSPIRLMAVLGAICGTAGVALLVLTPNAALDPVGVAAGLAGAVSMAFGT
                     VLTRKWQPPVPLLTFTAWQLAAGGLLLVPVALVFDPPIPMPTGTNVLGLAWLGLIGAG
                     LTYFLWFRGISRLEPTVVSLLGFLSPGTAVLLGWLFLDQTLSALQIIGVLLVIGSIWL
                     GQRSNRTPRARIACRKSP"
     gene            complement(37948..39147)
                     /gene="tet(A)"
                     /locus_tag="NRG857_RS22945"
                     /old_locus_tag="NRG857_30067"
     CDS             complement(37948..39147)
                     /gene="tet(A)"
                     /locus_tag="NRG857_RS22945"
                     /old_locus_tag="NRG857_30067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000804064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline efflux MFS transporter Tet(A)"
                     /protein_id="WP_000804064.1"
                     /translation="MKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAH
                     YGILLALYALMQFACAPVLGALSDRFGRRPVLLVSLAGAAVDYAIMATAPFLWVLYIG
                     RIVAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPH
                     APFFAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAV
                     FFIMQLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGE
                     RRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQG
                     QLQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSG
                     AGQRADR"
     gene            39253..39903
                     /gene="tetR(A)"
                     /locus_tag="NRG857_RS22950"
                     /old_locus_tag="NRG857_30068"
     CDS             39253..39903
                     /gene="tetR(A)"
                     /locus_tag="NRG857_RS22950"
                     /old_locus_tag="NRG857_30068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000164043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetracycline resistance transcriptional
                     repressor TetR(A)"
                     /protein_id="WP_000164043.1"
                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWH
                     FRNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAG
                     TRPGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGG
                     TVEQAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"
     gene            complement(39935..40177)
                     /locus_tag="NRG857_RS22955"
                     /old_locus_tag="NRG857_30069"
     CDS             complement(39935..40177)
                     /locus_tag="NRG857_RS22955"
                     /old_locus_tag="NRG857_30069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000844627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000844627.1"
                     /translation="MKTAALDLARERQAHEAGARTRATAHERTPQQERQKAAREAERG
                     REAWTLGQGMKKPVAGCYGRLTRWKGGGDVVYMALL"
     gene            <40491..42239
                     /locus_tag="NRG857_RS22960"
                     /old_locus_tag="NRG857_30070"
                     /pseudo
     CDS             <40491..42239
                     /locus_tag="NRG857_RS22960"
                     /old_locus_tag="NRG857_30070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001138064.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3-like element TnAs3 family transposase"
     gene            42306..42683
                     /locus_tag="NRG857_RS22965"
     CDS             42306..42683
                     /locus_tag="NRG857_RS22965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000656306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_000656305.1"
                     /translation="MKDYLCKKLFNRLSGTLVIRARCGNNITGLACCNILYPSPRYSG
                     QLHIKELYVSQCDRNKGTGKAIMRFIARLALEQECLSLSWNAEKSNPGANRFYQALGG
                     RINDHIVNYYLHGESLSKLASGI"
     gene            complement(42884..43543)
                     /locus_tag="NRG857_RS22970"
                     /old_locus_tag="NRG857_30075"
     CDS             complement(42884..43543)
                     /locus_tag="NRG857_RS22970"
                     /old_locus_tag="NRG857_30075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011152976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type A-1 chloramphenicol O-acetyltransferase"
                     /protein_id="WP_000412211.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAF
                     LKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETF
                     SSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNV
                     ANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGG
                     A"
     gene            43822..44519
                     /locus_tag="NRG857_RS22975"
                     /old_locus_tag="NRG857_30080"
                     /pseudo
     CDS             43822..44519
                     /locus_tag="NRG857_RS22975"
                     /old_locus_tag="NRG857_30080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(45232..45936)
                     /locus_tag="NRG857_RS22980"
                     /old_locus_tag="NRG857_30083"
     CDS             complement(45232..45936)
                     /locus_tag="NRG857_RS22980"
                     /old_locus_tag="NRG857_30083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005221000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS26 family transposase"
                     /protein_id="WP_001067855.1"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            complement(46148..47008)
                     /gene="blaTEM"
                     /locus_tag="NRG857_RS22985"
                     /old_locus_tag="NRG857_30085"
     CDS             complement(46148..47008)
                     /gene="blaTEM"
                     /locus_tag="NRG857_RS22985"
                     /old_locus_tag="NRG857_30085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_032489893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TEM family class A beta-lactamase"
                     /protein_id="WP_000027062.1"
                     /translation="MSIQHFRVALIPFFSAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW"
     gene            complement(47191..>47529)
                     /locus_tag="NRG857_RS22990"
                     /old_locus_tag="NRG857_30087"
                     /pseudo
     CDS             complement(47191..>47529)
                     /locus_tag="NRG857_RS22990"
                     /old_locus_tag="NRG857_30087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005221001.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase family protein"
     gene            47593..48297
                     /locus_tag="NRG857_RS22995"
                     /old_locus_tag="NRG857_30088"
     CDS             47593..48297
                     /locus_tag="NRG857_RS22995"
                     /old_locus_tag="NRG857_30088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005221000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6-like element IS26 family transposase"
                     /protein_id="WP_001067855.1"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            <48347..49066
                     /locus_tag="NRG857_RS23000"
                     /pseudo
     CDS             <48347..49066
                     /locus_tag="NRG857_RS23000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001517559.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
     gene            49053..49904
                     /locus_tag="NRG857_RS23005"
                     /old_locus_tag="NRG857_30091"
     CDS             49053..49904
                     /locus_tag="NRG857_RS23005"
                     /old_locus_tag="NRG857_30091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000240539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_000240536.1"
                     /translation="MVKPKNKHSLSHVRHDPAHCLAPGLFRALKRGERKRSKLDVTYD
                     YGDGKRIEFSGPEPLGADDLRILQGLVAMAGPNGLVLGPEPKTEGGRQLRLFLEPKWE
                     AVTADAMVVKGSYRALAKEIGAEVDSGGALKHIQDCIERLWKVSIIAQNGRKRQGFRL
                     LSEYASDEADGRLYVALNPLIAQAVMGGGQHVRISMDEVRALDSETARLLHQRLCGWI
                     DPGKTGKASIDTLCGYVWPSEASGSTMRKRRQRVREALPELVALGWTVTEFAAGKYDI
                     TRPKAAG"
     gene            complement(50111..>50188)
                     /locus_tag="NRG857_RS23010"
                     /pseudo
     CDS             complement(50111..>50188)
                     /locus_tag="NRG857_RS23010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013221335.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
     gene            50212..51027
                     /gene="sul2"
                     /locus_tag="NRG857_RS23015"
                     /old_locus_tag="NRG857_30095"
     CDS             50212..51027
                     /gene="sul2"
                     /locus_tag="NRG857_RS23015"
                     /old_locus_tag="NRG857_30095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001043260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonamide-resistant dihydropteroate synthase
                     Sul2"
                     /protein_id="WP_001043265.1"
                     /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADV
                     IDLGPASSNPDAAPVSSDTEIERIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAY
                     LNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAA
                     LTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRA
                     LTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR"
     gene            51088..51891
                     /gene="aph(3'')-Ib"
                     /locus_tag="NRG857_RS23020"
                     /old_locus_tag="NRG857_30096"
     CDS             51088..51891
                     /gene="aph(3'')-Ib"
                     /locus_tag="NRG857_RS23020"
                     /old_locus_tag="NRG857_30096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside O-phosphotransferase APH(3'')-Ib"
                     /protein_id="WP_001082319.1"
                     /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASR
                     RGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAW
                     PSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPQLDLL
                     ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLA
                     LMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"
     gene            51891..52727
                     /locus_tag="NRG857_RS23025"
                     /old_locus_tag="NRG857_30097"
     CDS             51891..52727
                     /locus_tag="NRG857_RS23025"
                     /old_locus_tag="NRG857_30097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000480972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside O-phosphotransferase APH(6)-Id"
                     /protein_id="WP_000480968.1"
                     /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLK
                     PIEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATE
                     IAAELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMM
                     SNASELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDP
                     RRIAQMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQT
                     SY"
     gene            complement(52699..53817)
                     /locus_tag="NRG857_RS23030"
                     /old_locus_tag="NRG857_30098"
     CDS             complement(52699..53817)
                     /locus_tag="NRG857_RS23030"
                     /old_locus_tag="NRG857_30098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000845049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1 integron integrase IntI1"
                     /protein_id="WP_000845049.1"
                     /translation="MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAF
                     IRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQ
                     EIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDF
                     DHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALER
                     KYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATP
                     HTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDGVVCGR
                     GRNPTLRLWPTIFSGKIDVFPGDRRSRLISSMTSVAPA"
     gene            53974..54447
                     /locus_tag="NRG857_RS23035"
                     /old_locus_tag="NRG857_30100"
     CDS             53974..54447
                     /locus_tag="NRG857_RS23035"
                     /old_locus_tag="NRG857_30100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001355915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trimethoprim-resistant dihydrofolate reductase
                     DfrA1"
                     /protein_id="WP_000777555.1"
                     /translation="MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVG
                     RKTFESMGALPNRKYAVVTRSSFTSDNENVVIFPSIKDALTNLKKITDHVIVSGGGEI
                     YKSLIDQVDTLHISTIDIEPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG"
     gene            54540..55331
                     /gene="aadA1"
                     /locus_tag="NRG857_RS23040"
                     /old_locus_tag="NRG857_30102"
     CDS             54540..55331
                     /gene="aadA1"
                     /locus_tag="NRG857_RS23040"
                     /old_locus_tag="NRG857_30102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014325834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ANT(3'')-Ia family aminoglycoside
                     nucleotidyltransferase AadA1"
                     /protein_id="WP_001206317.1"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKP
                     HSDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYP
                     AKRELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQ
                     DLFEALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGRIAPKDVAADWAMERLPA
                     QYQPVILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     gene            55495..55842
                     /locus_tag="NRG857_RS23045"
                     /old_locus_tag="NRG857_30103"
     CDS             55495..55842
                     /locus_tag="NRG857_RS23045"
                     /old_locus_tag="NRG857_30103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000679427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quaternary ammonium compound efflux SMR
                     transporter QacE delta 1"
                     /protein_id="WP_000679427.1"
                     /translation="MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAF
                     YFLSLVLKSIPVGVAYAVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIIAAFLLAR
                     SPSWKSLRRPTPW"
     gene            55836..56675
                     /gene="sul1"
                     /locus_tag="NRG857_RS23050"
                     /old_locus_tag="NRG857_30104"
     CDS             55836..56675
                     /gene="sul1"
                     /locus_tag="NRG857_RS23050"
                     /old_locus_tag="NRG857_30104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000259031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonamide-resistant dihydropteroate synthase
                     Sul1"
                     /protein_id="WP_000259031.1"
                     /translation="MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDV
                     GPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLND
                     IQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
                     RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGAT
                     VGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGL
                     DHA"
     gene            56803..57303
                     /locus_tag="NRG857_RS23055"
                     /old_locus_tag="NRG857_30106"
     CDS             56803..57303
                     /locus_tag="NRG857_RS23055"
                     /old_locus_tag="NRG857_30106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004194535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_000376623.1"
                     /translation="MDSEEPPNVRVACSGDIDEVVRLMHDAAAWMSAKGTPAWDVARI
                     DRTFAETFVLRSELLVASCSDGIVGCCTLSAEDPEFWPDALKGEAAYLHKLAVRRTHA
                     GRGVSSALIEACRHAARTQGCAKLRLDCHPNLRGLYERLGFTHVDTFNPGWDPTFIAE
                     RLELEI"
     gene            complement(57479..58261)
                     /locus_tag="NRG857_RS23060"
                     /old_locus_tag="NRG857_30107"
     CDS             complement(57479..58261)
                     /locus_tag="NRG857_RS23060"
                     /old_locus_tag="NRG857_30107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004630242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_001163403.1"
                     /translation="MQHEGHVRILKSLKLFGMAHAIEELGNQNSPAFNQALPMLDSLI
                     KAEVAEREVRSVNYQLRVAKFPVYRDLVGFDFSQSLVNEATVKQLHRCDFMEQAQNVV
                     LIGGPGTGKTHLATAIGTQAVMHLNRRVRFFSTVDLVNALEQEKSSGRQGQIANRLLY
                     ADLVILDELGYLPFSQTGGALLFHLLSKLYEKTSVILTTNLSFSEWSRVFGDEKMTTA
                     LLDRLTHHCHILETGNESYRFKHSSTQNKQEEKQTRKLKIET"
     gene            complement(58251..59774)
                     /locus_tag="NRG857_RS23065"
                     /old_locus_tag="NRG857_30108"
     CDS             complement(58251..59774)
                     /locus_tag="NRG857_RS23065"
                     /old_locus_tag="NRG857_30108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001324342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21-like element IS1326 family transposase"
                     /protein_id="WP_001324342.1"
                     /translation="MINVAILSAIRRWHFRDGASIREIARRSGLSRNTVRKYLQSKVV
                     EPQYPARDSVGKLSPFEPKLRQWLSTEHKKTKKLRRNLRSMYRDLVALGFTGSYDRVC
                     AFARQWKDSEQFKAQTSGKGCFIPLRFACGEAFQFDWSEDFARIAGKQVKLQIAQFKL
                     AHSRAFVLRAYYQQKHEMLFDAHWHAFQIFGGIPKRGIYDNMKTAVDSVGRGKERRVN
                     QRFTAMVSHYLFDAQFCNPASGWEKGQIEKNVQDSRQRLWQGAPDFQSLADLNVWLEH
                     RCKALWSELRHPELDQTVQEAFADEQGELMALPNAFDAFVEQTKRVTSTCLVHHEGNR
                     YSVPASYANRAISLRIYADKLVMAAEGQHIAEHPRLFGSGHARRGHTQYDWHHYLSVL
                     QKKPGALRNGAPFAELPPAFKKLQSILLQRPGGDRDMVEILALVLHHDEGAVLSAVEL
                     ALECGKPSKEHVLNLLGRLTEEPPPKPIPIPKGLRLTLEPQANVNRYDSLRRAHDAA"
     gene            complement(59876..60604)
                     /locus_tag="NRG857_RS23070"
                     /old_locus_tag="NRG857_30110"
     CDS             complement(59876..60604)
                     /locus_tag="NRG857_RS23070"
                     /old_locus_tag="NRG857_30110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000059618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TniB family NTP-binding protein"
                     /protein_id="WP_000059618.1"
                     /translation="MSLTAQAPRPATHVRHRPEQTLLYQLVERHYPEFARLMAAQGSP
                     LPGYVAREFEDYLKCGRLEHGFLRVRCQSCHHEKLVAFSCKRRGFCPSCGVRRMVDSA
                     ALLVIDELHNVLAGNSVNRREFLNLLRFLGNELRIPLVGVGTRDAYLAIRSDDQLENR
                     FEPMMLPVWEANDDCCSLLASFAASLPLRRPSPIATLDMARYLLTRSEGTIGELAHLL
                     MAAAIVAVESGEEAINHRTLSMAC"
     gene            60686..60964
                     /locus_tag="NRG857_RS23075"
     CDS             60686..60964
                     /locus_tag="NRG857_RS23075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001611016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_001611016.1"
                     /translation="MGDSKKALAELEQKEFPQVGQVTCSIGFAAVDPAQPPANILDNA
                     DQALYYAKGNGRNRTCHYESLVETGQIARRDNMEGNASVDFDIDALFG"
     gene            complement(60972..61223)
                     /locus_tag="NRG857_RS23080"
     CDS             complement(60972..61223)
                     /locus_tag="NRG857_RS23080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000928197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000928197.1"
                     /translation="MLLYILEITLLLPFQAFGIALDTVKTLAFETGSDVTTQLDFAPW
                     QMNAIALGYQFGYLMLPFIAAAGIWILMNRELLDTLRSQ"
     gene            61154..61975
                     /locus_tag="NRG857_RS23085"
                     /old_locus_tag="NRG857_30117"
     CDS             61154..61975
                     /locus_tag="NRG857_RS23085"
                     /old_locus_tag="NRG857_30117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001611017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydrolase"
                     /protein_id="WP_014640556.1"
                     /translation="MCRAQYQTPEKAAARLSQGYITAYGSALPWSNLEQMFAGAGGVI
                     STAADMGKWLSMHTNEGKNINGERLLSKSLLEESYSPLPGSPKYGLGWSLSSANVKPA
                     RISHSGALSTIQAQQDIVPSSGYAVAVMLNSFTTTFEHAYEISSGIIKLTEGQKPNIK
                     VPMPKIIDLFLGLMTLIYLFLGIKGILRSKEWSNRRKLHPTLRYYLRLMPQIIPVLFI
                     GWLFFIVPNLQNNSSTIKDAIGIWPAAMLFLAVVFLIGTIVTVRRVYYRVRLNRN"
     gene            62895..63494
                     /locus_tag="NRG857_RS23090"
                     /old_locus_tag="NRG857_30120"
     CDS             62895..63494
                     /locus_tag="NRG857_RS23090"
                     /old_locus_tag="NRG857_30120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019381990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_014640558.1"
                     /translation="MAKFTELEKEKIREELLKVAYRFFVDKGFKNTSLEDITSSVGIA
                     KSSFYIFFESKEILYMELLAHEGEQIEKQVWPKVIAAKDIRSAIKIYLNEMALELEDK
                     ILTQRLVYDLEEYKIVSRKLNPDYVGSEHLRSIVPLVEFIKLRQDSNEIIDEEPGIIA
                     GVLRAAWLIGSQKGDLQQYNYERIKELLFEAVADRVTRF"
     gene            63531..64370
                     /locus_tag="NRG857_RS23095"
                     /old_locus_tag="NRG857_30121"
     CDS             63531..64370
                     /locus_tag="NRG857_RS23095"
                     /old_locus_tag="NRG857_30121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000140042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_000140042.1"
                     /translation="MTERIIRFNDVYICTESFGDTNDPTILLIMGATSSMIWWEEDFC
                     RKLSNQGFHVIRYDNRDVGRSITYEYGHPEYTFEDLADDAIQVLDAYRVDKAHIVGMS
                     MGGIITQIVALKHPDRVLTISLVMTSNYDSSLPKKDSKVTEVFAKININNWEDKEEVI
                     KYVMDRSKVLVGTKHPFNEEKIRKLAGKDFDRASNMESMENHEYVKGWGLYLSRTHEI
                     NVPTLVIHGTDDPIIPHEHGAHLSKIISNAVLVTLDGAGHELHYDDWDEIINALSKHA
                     ASL"
     gene            64407..65315
                     /gene="mph(B)"
                     /locus_tag="NRG857_RS23100"
                     /old_locus_tag="NRG857_30123"
     CDS             64407..65315
                     /gene="mph(B)"
                     /locus_tag="NRG857_RS23100"
                     /old_locus_tag="NRG857_30123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000031017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mph(B) family macrolide 2'-phosphotransferase"
                     /protein_id="WP_000031017.1"
                     /translation="MSKDIKQVIEIAKKHNLFLKEETIQFNESGLDFQAVFAQDNNGI
                     DWVLRLPRREDVMPRTKVEKQALDLVNKYAISFQAPNWIIYTEELIAYKKLDGVPAGT
                     IDHNIGNYIWEIDINNVPELFHKSLGRVLAELHSIPSNKAAALDLVVHTPEEARMSMK
                     QRMDAVRAKFGVGENLWNRWQAWLNDDDMWPKKTGLIHGDVHAGHTMIDKDANVTGLI
                     DWTEAKVTDVSHDFIFNYRAFGEEGLEALILAYKEIGGYYWPKMKEHIIELNAAYPVS
                     IAEFALVSGIEEYEQMAKEALEVQGS"
     gene            65427..65693
                     /locus_tag="NRG857_RS23105"
     CDS             65427..65693
                     /locus_tag="NRG857_RS23105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004083381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_071779295.1"
                     /translation="MMNRFLTLLAIEGYTQREIARKMHCSQNTIFKRLIKIKYFSKMV
                     VKKIFSLPTHCLRIGNINRYSIVVEPEMLARYGAYFSAKDPSKP"
     gene            complement(65834..67501)
                     /locus_tag="NRG857_RS23110"
                     /old_locus_tag="NRG857_30127"
     CDS             complement(65834..67501)
                     /locus_tag="NRG857_RS23110"
                     /old_locus_tag="NRG857_30127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000344783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000344783.1"
                     /translation="MDEYPIIDLSHLLPAAQGLARLPADERIQRLRADRWIGYPRAVE
                     ALNRLEALYAWPNKQRMPNLLLVGPTNNGKSMIVEKFRRTHPASSDADQEHIPVLVVQ
                     MPSEPSVIRFYVALLAAMGAPLRPRPRLPEMEQLALALLRKVDSAALLVDEVLPKVPL
                     RQWVLSVPFQLRFLFASYPDLMGKALGIVYRSIATWLLRQAGFTHDTARTGAVTFIQR
                     FGSALNLNVHFHMLFLDGVYVTRCHDGNSDDNNTSQVFRRVNAPTKGDLEAVLQQLST
                     RLARFLVKEGVLTQDSENSYLTLDHLADEPMQQVHGHSITYRIALGPQQGKKVFTLQT
                     LLPKAAEDDRLTQLAKAGGFSLHAGVAVQAHERQKLEHLCRYVARPAISEQRLALTRD
                     GRVRYELKTPYRDGTTHVIFEPLDFMAKLAALVPKPRVNLTRFHGVFAPNSHYRVTIT
                     PAKRGKGAGKVGTVHLAPEERTPLEQRAAMTWARRLKRVFNIDITECEKCQGPVKVIA
                     CIEDPVVIDKILNHLKAKEAKQVSPSTQLPPPRAPPLLPGWEQGLAD"
     gene            complement(67504..69219)
                     /locus_tag="NRG857_RS23115"
                     /old_locus_tag="NRG857_30129"
     CDS             complement(67504..69219)
                     /locus_tag="NRG857_RS23115"
                     /old_locus_tag="NRG857_30129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013741669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DDE-type integrase/transposase/recombinase"
                     /protein_id="WP_000935451.1"
                     /translation="MLNTRVHQSEVSMATDTPRIPEQGVATLPDEAWERARRRAEIIS
                     PLAQSETVGHEAADMAAQALGLSRRQVYVLIRRARQGSGLVTDLVPGQSGGGKGKGRL
                     PEPVERVIHELLQKRFLTKQKRSLAAFHREVTQVCKAQKLRVPARNTVALRIASLDPR
                     KVIRRREGQDAARDLQGVGGEPPAVTAPLEQVQIDHTVIDLIVVDDRDRQPIGRPYLT
                     LAIDVFTRCVLGMVVTLEAPSAVSVGLCLVHVACDKRPWLEGLNVEMDWQMSGKPLLL
                     YLDNAAEFKSEALRRGCEQHGIRLDYRPLGQPHYGGIVERIIGTAMQMIHDELPGTTF
                     SNPDQRGDYDSENKAALTLRELERWLTLAVGTYHGSVHNGLLQPPAARWAEAVARVGV
                     PAVVTRATSFLVDFLPILRRTLTRTGFVIDHIHYYADALKPWIARRERWPSFLIRRDP
                     RDISRIWVLEPEGQHYLEIPYRTLSHPAVTLWEQRQALAKLRQQGREQVDESALFRMI
                     GQMREIVTSAQKATRKARRDADRRQHLKTSARPDKPVPPDTDIADPQADNLPPAKPFD
                     QIEEW"
     gene            complement(69258..69926)
                     /locus_tag="NRG857_RS23120"
                     /old_locus_tag="NRG857_30131"
     CDS             complement(69258..69926)
                     /locus_tag="NRG857_RS23120"
                     /old_locus_tag="NRG857_30131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_001300294.1"
                     /translation="MAQAAARGQLDLHYQPLVDLRDHRIAGAEALMRWRHPRLGLLPP
                     GQFLPLAESFGLMPEIGAWVLGEACRQMHKWQGPAWQPFRLAINVSASQVGPTFDDEV
                     KRVLADMALPAELLEIELTESVAFGNPALFASFDALRAIGVRFAADDFGTGYSCLQHL
                     KCCPITTLKIDQSFVARLPDDARDQTIVRAVIQLAHGLGMDVIFRRRLHQLIGRNGCC
                     AASS"
     gene            complement(69962..70198)
                     /gene="merE"
                     /locus_tag="NRG857_RS23125"
                     /old_locus_tag="NRG857_30132"
     CDS             complement(69962..70198)
                     /gene="merE"
                     /locus_tag="NRG857_RS23125"
                     /old_locus_tag="NRG857_30132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="broad-spectrum mercury transporter MerE"
                     /protein_id="WP_000993386.1"
                     /translation="MNAPDKLPPETRQPVSGYLWGALAVLTCPCHLPILAAVLAGTTA
                     GAFLGEHWGVAALALTGLFVLAVTRLLRAFRGGS"
     gene            complement(70195..70557)
                     /gene="merD"
                     /locus_tag="NRG857_RS23130"
                     /old_locus_tag="NRG857_30133"
     CDS             complement(70195..70557)
                     /gene="merD"
                     /locus_tag="NRG857_RS23130"
                     /old_locus_tag="NRG857_30133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance co-regulator MerD"
                     /protein_id="WP_001277456.1"
                     /translation="MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDD
                     AALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQAAAQLAVLRQLVERRRAALAHL
                     DAQLASMPAERAHEEALP"
     gene            complement(70575..72269)
                     /locus_tag="NRG857_RS23135"
                     /old_locus_tag="NRG857_30136"
     CDS             complement(70575..72269)
                     /locus_tag="NRG857_RS23135"
                     /old_locus_tag="NRG857_30136"
                     /EC_number="1.16.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004636758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury(II) reductase"
                     /protein_id="WP_000105636.1"
                     /translation="MSTLKITGMTCDSCAVHVKDALEKVPGVQSADVSYAKGSAKLAI
                     EVGTSPDALTAAVAGLGYRATLADAPSVSTPGGLLDKMRDLLGRNDKTGSSGALHIAV
                     IGSGGAAMAAALKAVEQGARVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESP
                     FDGGIAATTPTIQRTALLAQQQARVDELRHAKYEGILEGNPAITVLHGSARFKDNRNL
                     IVQLNDGGERVVAFDRCLIATGASPAVPPIPGLKDTPYWTSTEALVSETIPKRLAVIG
                     SSVVALELAQAFARLGAKVTILARSTLFFREDPAIGEAVTAAFRMEGIEVREHTQASQ
                     VAYINGEGDGEFVLTTAHGELRADKLLVATGRAPNTRKLALDATGVTLTPQGAIVIDP
                     GMRTSVEHIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALNLTAMPAVVFTDPQV
                     ATVGYSEAEAHHDGIKTDSRTLTLDNVPRALANFDTRGFIKLVVEEGSGRLIGVQAVA
                     PEAGELIQTAALAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSCCAG"
     gene            complement(72321..72743)
                     /gene="merC"
                     /locus_tag="NRG857_RS23140"
                     /old_locus_tag="NRG857_30138"
     CDS             complement(72321..72743)
                     /gene="merC"
                     /locus_tag="NRG857_RS23140"
                     /old_locus_tag="NRG857_30138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016239395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="organomercurial transporter MerC"
                     /protein_id="WP_001340589.1"
                     /translation="MGLMTRIADKTGALGSVVSAMGCAACFPALASFGAAIGLGFLSQ
                     YEGLFISRLLPLFAALAFLANALGWFSHRQWLRSLLGMIGPAIVFAATVWLLGNWWTA
                     NLMYVGLALMIGVSIWDFVSPAHRRCGPDGCELPAKRL"
     gene            complement(72779..73054)
                     /gene="merP"
                     /locus_tag="NRG857_RS23145"
                     /old_locus_tag="NRG857_30139"
     CDS             complement(72779..73054)
                     /gene="merP"
                     /locus_tag="NRG857_RS23145"
                     /old_locus_tag="NRG857_30139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004636750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercury resistance system periplasmic binding
                     protein MerP"
                     /protein_id="WP_000732292.1"
                     /translation="MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKAL
                     SKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKATADAGYPSSVKQ"
     gene            complement(73068..73418)
                     /locus_tag="NRG857_RS23150"
                     /old_locus_tag="NRG857_30141"
     CDS             complement(73068..73418)
                     /locus_tag="NRG857_RS23150"
                     /old_locus_tag="NRG857_30141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011111453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mercuric transport protein MerT"
                     /protein_id="WP_001294663.1"
                     /translation="MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNL
                     TVLEPYRPLFIGAALVALFFAWKRIYRPVQACKPGEVCAIPQVRATYKLIFWIVAVLV
                     LVALGFPYVVPFFY"
     gene            73490..73924
                     /gene="merR"
                     /locus_tag="NRG857_RS23155"
                     /old_locus_tag="NRG857_30142"
     CDS             73490..73924
                     /gene="merR"
                     /locus_tag="NRG857_RS23155"
                     /old_locus_tag="NRG857_30142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hg(II)-responsive transcriptional regulator"
                     /protein_id="WP_000429836.1"
                     /translation="MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLREPDKPYGSIR
                     RYGEADVVRVKFVKSAQRLGFSLDEIAELLRLDDGTHCEEASSLAEHKLKDVREKMAD
                     LARMETVLSELVCACHARKGNVSCPLIASLQGEAGLARSAMP"
     gene            complement(74031..74728)
                     /locus_tag="NRG857_RS23160"
                     /old_locus_tag="NRG857_30143"
                     /pseudo
     CDS             complement(74031..74728)
                     /locus_tag="NRG857_RS23160"
                     /old_locus_tag="NRG857_30143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(75093..75494)
                     /gene="pemK"
                     /locus_tag="NRG857_RS23165"
                     /old_locus_tag="NRG857_30147"
     CDS             complement(75093..75494)
                     /gene="pemK"
                     /locus_tag="NRG857_RS23165"
                     /old_locus_tag="NRG857_30147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001398199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system toxin
                     endoribonuclease PemK"
                     /protein_id="WP_001398199.1"
                     /translation="MLKYQLKNENGWMHRRLVRRKSDMERGEIWLVSLDPTAGHEQQG
                     TRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRT
                     IDMKARGGKRLERVPETIMNEVLGRLSTILT"
     gene            complement(75427..75684)
                     /gene="pemI"
                     /locus_tag="NRG857_RS23170"
                     /old_locus_tag="NRG857_30148"
     CDS             complement(75427..75684)
                     /gene="pemI"
                     /locus_tag="NRG857_RS23170"
                     /old_locus_tag="NRG857_30148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000288814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system antitoxin PemI"
                     /protein_id="WP_000557619.1"
                     /translation="MHTTRLKRVGGSVMLTVPPALLNALSLGTDNEVGMVIDNGRLIV
                     EPYRRPQYSLAELLAQCDPNAEISAEEREWLDAPATGQEEI"
     gene            complement(75777..76430)
                     /locus_tag="NRG857_RS23175"
                     /old_locus_tag="NRG857_30151"
     CDS             complement(75777..76430)
                     /locus_tag="NRG857_RS23175"
                     /old_locus_tag="NRG857_30151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001757010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_000616807.1"
                     /translation="MIQTRNQYLQFMLVMLAAWGISWGARFVMEQAVLLYGSGKNYLF
                     FSHGTVLMYLLCVFLVYRRWIAPLPVVGQLRNVGVPWLVGAMAVVYVGVFLLGKALAL
                     PAEPFMTKLFADKSIPDVILTLLTIFILAPLNEETLFRGIMLNVFRSRYCWTMWLGAL
                     ITSLLFVAAHSQYQNLLTLAELFLVGLITSVARIRSGGLLLPVLLHMEATTLGLLFG"
     gene            complement(77370..78227)
                     /gene="repA"
                     /locus_tag="NRG857_RS23180"
                     /old_locus_tag="NRG857_30157"
     CDS             complement(77370..78227)
                     /gene="repA"
                     /locus_tag="NRG857_RS23180"
                     /old_locus_tag="NRG857_30157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="incFII family plasmid replication initiator
                     RepA"
                     /protein_id="WP_000774303.1"
                     /translation="MADLLQKYYSQVKNPNPVFTPREGAGTLKLCEKLMEKAVGFTSR
                     FDFAIHVAHARSKGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESAAGKLSITRASRALTFLAELGLITYQTEYDPLIGCYIPTDITFTPALFAALDV
                     SEDAVVAARRSRVEWENRQRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIK
                     RARARRDANRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     gene            complement(78220..78714)
                     /locus_tag="NRG857_RS23185"
                     /old_locus_tag="NRG857_30158"
     CDS             complement(78220..78714)
                     /locus_tag="NRG857_RS23185"
                     /old_locus_tag="NRG857_30158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001324615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001324615.1"
                     /translation="MQDGVANHETHSVIAGGIESDLHIDSSKYPHPFCSLLQKRAHFD
                     SFKHLIFIRGLLAIAHGKRKNKISASMVSFYVSLVQVMCAHYIPDTNKVNLSVKELSV
                     CSGGSYTRVWRALKTLDNDLHLIAFDGGTIWFRPDMFETLRVGPDELVTARRRGNSVG
                     GGHG"
     gene            complement(78695..78769)
                     /locus_tag="NRG857_RS23190"
     CDS             complement(78695..78769)
                     /locus_tag="NRG857_RS23190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001442103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepA leader peptide Tap"
                     /protein_id="WP_001442103.1"
                     /translation="MPGKVQDFFLCSLLLCIVSAGWCG"
     gene            complement(79001..79258)
                     /locus_tag="NRG857_RS23195"
                     /old_locus_tag="NRG857_30162"
     CDS             complement(79001..79258)
                     /locus_tag="NRG857_RS23195"
                     /old_locus_tag="NRG857_30162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001297746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication regulatory protein RepA"
                     /protein_id="WP_000083845.1"
                     /translation="MSQTENAVTSSSGTKRTYRKGNPVPARERQRASLARRSNTHKAF
                     HAVIQARLKDRLSELADEEGITQAQMLEKLIESELKRRATS"
     gene            complement(79542..79691)
                     /locus_tag="NRG857_RS23200"
     CDS             complement(79542..79691)
                     /locus_tag="NRG857_RS23200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001300273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system Hok family toxin"
                     /protein_id="WP_001312851.1"
                     /translation="MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLA
                     YEARK"
     gene            complement(80372..80584)
                     /locus_tag="NRG857_RS23205"
     CDS             complement(80372..80584)
                     /locus_tag="NRG857_RS23205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ANR family transcriptional regulator"
                     /protein_id="WP_001299730.1"
                     /translation="MNGFRNSSRNGQVWRYQRAGGRAVILEVSGRWMEAAEAWRRAAC
                     IAPRTDWQQFARKRAEHCHRRCRGRV"
     gene            complement(80720..81280)
                     /locus_tag="NRG857_RS23210"
                     /old_locus_tag="NRG857_30171"
     CDS             complement(80720..81280)
                     /locus_tag="NRG857_RS23210"
                     /old_locus_tag="NRG857_30171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fertility inhibition protein FinO"
                     /protein_id="WP_000139315.1"
                     /translation="MTEQKRPVLTLKRKTEGETPTRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELAAKKAQARQALSIYLTLPSLDEAVNTLKPWWPGLFDGNTPRLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEA
                     YAAGRLEKIRRQNRTKAELQAVLDGK"
     gene            complement(81383..82243)
                     /locus_tag="NRG857_RS23215"
                     /old_locus_tag="NRG857_30172"
     CDS             complement(81383..82243)
                     /locus_tag="NRG857_RS23215"
                     /old_locus_tag="NRG857_30172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_000704527.1"
                     /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPS
                     FANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIG
                     LWGTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAE
                     KKKNTGKEMFVGVTRVLSDDESKVFFEKIKARHPEMDIKIPFLTVMETLQYKPAESAA
                     SVQCPVLVVIAGQDSVNPPEQGRALYDAVASGTKELYEEADACHYDIYKGAFFERVAA
                     VQTQWFKKHL"
     gene            complement(82302..83048)
                     /gene="traX"
                     /locus_tag="NRG857_RS23220"
                     /old_locus_tag="NRG857_30174"
     CDS             complement(82302..83048)
                     /gene="traX"
                     /locus_tag="NRG857_RS23220"
                     /old_locus_tag="NRG857_30174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylase TraX"
                     /protein_id="WP_000205766.1"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLM
                     VLDHANRILHLDQTWMFLAGRGAFPLFALVWGRNLSRHAHIRQVAINRLWGWAVIAQF
                     SYYLAGFPWYEGNILFAFAVAAQVLTWCETRSLWRTAAAILLMALWGPLSGTSYGITG
                     LLMLAVSHRLYRAEDRTERLALVACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSR
                     AGKSLPRFWPGDFFPTFYGCHLAVLGILAL"
     gene            complement(83068..88338)
                     /gene="traI"
                     /locus_tag="NRG857_RS23225"
                     /old_locus_tag="NRG857_30177"
     CDS             complement(83068..88338)
                     /gene="traI"
                     /locus_tag="NRG857_RS23225"
                     /old_locus_tag="NRG857_30177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001463032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer relaxase/helicase TraI"
                     /protein_id="WP_000986959.1"
                     /translation="MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQ
                     GSVDKDVFTRLLEGKLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRL
                     IDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHA
                     VVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEALGYETEVV
                     GKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAE
                     WMQTLKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQF
                     TYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSV
                     RALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVA
                     ELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGRRQLQEGMAFTPGNTVIVD
                     QGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQR
                     PATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVL
                     GHPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLT
                     LRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVTSV
                     SEDAMTVVVPGRAEPASLPVADSPFTALKLENGWVETPGHSVSDSAKVFASVTQMAMD
                     NATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQIKVRAGETLLETAISLQ
                     KAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEETSFTELGGEINAQIKR
                     GDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSG
                     QRAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAV
                     GEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIA
                     AGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIVRQTPELREAVYSLINR
                     DVERALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGEAFPDV
                     PMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVMVP
                     VLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISRDDGLITLQDAEGNTRLIS
                     PREAVAEGVTLYTPDTIRVGIGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQ
                     QTRVIRPGQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESTYVAL
                     SRMKQHVQVYTDDRQGWTDAINNAVQKGTAHDVFEPKPDREVMNAQRLFSTARELRDV
                     AAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGN
                     GLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
                     GRPWNPGAITGGCVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEI
                     VRKMAENKPDLPDGRTGQAVREIAWQERERAVTSEREAALPESVLREPQREREAVREV
                     VRENLLQERLQQMERDMVRDLQKEKTLGGD"
     gene            88420..88647
                     /gene="vapB"
                     /locus_tag="NRG857_RS23230"
                     /old_locus_tag="NRG857_30178"
     CDS             88420..88647
                     /gene="vapB"
                     /locus_tag="NRG857_RS23230"
                     /old_locus_tag="NRG857_30178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin-antitoxin system antitoxin VapB"
                     /protein_id="WP_000450520.1"
                     /translation="METTVFFSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAG
                     ETWDEWFDGHNVSADFMDNREQPGMQERESF"
     gene            88647..89045
                     /gene="vapC"
                     /locus_tag="NRG857_RS23235"
                     /old_locus_tag="NRG857_30179"
     CDS             88647..89045
                     /gene="vapC"
                     /locus_tag="NRG857_RS23235"
                     /old_locus_tag="NRG857_30179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(fMet)-specific endonuclease VapC"
                     /protein_id="WP_000911313.1"
                     /translation="MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELI
                     YGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHSGQIRAELARQGRPVGPFDQMIA
                     GHARSRGLIIVTNNTREFERVDGLRIEDWS"
     gene            complement(89054..91207)
                     /gene="traD"
                     /locus_tag="NRG857_RS23240"
                     /old_locus_tag="NRG857_30181"
     CDS             complement(89054..91207)
                     /gene="traD"
                     /locus_tag="NRG857_RS23240"
                     /old_locus_tag="NRG857_30181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016233146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system coupling
                     protein TraD"
                     /protein_id="WP_000009324.1"
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIILYCLFIFFWILVGLV
                     LWVKISWQTFVNGCIYWWCTTLEGMRDLIRSQPVYEIQYYGKTFRMNAAQVLHDKYMI
                     WCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQQSENEITGGRQLTDNPKEVA
                     RMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVI
                     YDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIE
                     KTAISIRAVLTNYVKAIRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHA
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCY
                     VFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQ
                     YSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQTRP
                     KVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQ
                     PVSPAINDKKSDAGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAVYEAWQ
                     REQNPDIQQKMQRREEVNINVHRERGEDVEPGDDF"
     gene            complement(91460..92191)
                     /gene="traT"
                     /locus_tag="NRG857_RS23245"
                     /old_locus_tag="NRG857_30184"
     CDS             complement(91460..92191)
                     /gene="traT"
                     /locus_tag="NRG857_RS23245"
                     /old_locus_tag="NRG857_30184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000850426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="complement resistance protein TraT"
                     /protein_id="WP_023565183.1"
                     /translation="MKTKKLMMVTLVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIW
                     LEPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKAD
                     KMDLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMVE
                     DVNYTMITDVQIAERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNAN
                     KVNLKFEEAKPVLEDQLAKSIANIL"
     gene            complement(92223..92720)
                     /locus_tag="NRG857_RS23250"
                     /old_locus_tag="NRG857_30186"
     CDS             complement(92223..92720)
                     /locus_tag="NRG857_RS23250"
                     /old_locus_tag="NRG857_30186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000605858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="entry exclusion protein"
                     /protein_id="WP_000605857.1"
                     /translation="MIMRCLAHIALVTVIQFIACYLADWGNAETVFMLFFIVLWQGLF
                     IWLFSQIRKKRDVSDEFKFSKGVWYITMPVSSLLSPLLSLMVFIIGTLYELRQVSGCI
                     SIKKWGQNQLKDQYDGSEKLDFGGIEQTPTIYYNPSTGYPMHGGFDSAGNTFGTRWQD
                     YYDRQ"
     gene            complement(92736..95558)
                     /gene="traG"
                     /locus_tag="NRG857_RS23255"
                     /old_locus_tag="NRG857_30187"
     CDS             complement(92736..95558)
                     /gene="traG"
                     /locus_tag="NRG857_RS23255"
                     /old_locus_tag="NRG857_30187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001774307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer mating pair stabilization
                     protein TraG"
                     /protein_id="WP_001007018.1"
                     /translation="MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAV
                     AVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPL
                     SLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELVSKSTDFLSRNPEIANLFQDY
                     VQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTCKDASVSLK
                     DKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNV
                     TINALKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQSWPLLYAILNSAMTFYAKQNGAPV
                     VLSEISQIQLKYSDLASTAGYLSMMIPPLSWMMVRGLGAGFSSVYSHFASSAISPTAS
                     AAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDA
                     SGAMSRLPVGINATRQIAVAQQEMAREASNRAESALHGFSSSIASAWNTLSQFGSNRG
                     SSDSVTSGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRASAGMY
                     GDAHAEWGVKPKILGVGGGLGVRGGGRAGIDWSDDDAHQASSGSRASYDARHDIDAKA
                     SKDFKEASDYFTSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEY
                     AEMASRTESMSGQMSEDLSQQFAQYVMKHAPQDAEAILTNTSSPEIAERRRAMAWSFV
                     QEQIQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSNIRND
                     VKHQVDNMVTEYKGNIGDTQNSIRGEENIVRGQYSELQNHHKTEALSQNNKYNEEKSA
                     QERMPGADSPQELMKRAKEYQDKYKQ"
     gene            complement(<96017..96865)
                     /gene="traB"
                     /locus_tag="NRG857_RS23260"
                     /pseudo
     CDS             complement(<96017..96865)
                     /gene="traB"
                     /locus_tag="NRG857_RS23260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001553749.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="F-type conjugal transfer pilus assembly protein
                     TraB"
     gene            complement(96865..97569)
                     /gene="traK"
                     /locus_tag="NRG857_RS23265"
                     /old_locus_tag="NRG857_30189"
     CDS             complement(96865..97569)
                     /gene="traK"
                     /locus_tag="NRG857_RS23265"
                     /old_locus_tag="NRG857_30189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003982266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system secretin
                     TraK"
                     /protein_id="WP_072095570.1"
                     /translation="MFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFT
                     VPGDRIIAVNSLDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREG
                     AGRTIQLVSDLRGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQ
                     APAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPASQLL
                     AGARMDVYVIRDGEGN"
     gene            complement(97580..98146)
                     /gene="traE"
                     /locus_tag="NRG857_RS23270"
                     /old_locus_tag="NRG857_30191"
     CDS             complement(97580..98146)
                     /gene="traE"
                     /locus_tag="NRG857_RS23270"
                     /old_locus_tag="NRG857_30191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_490565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraE"
                     /protein_id="WP_000399792.1"
                     /translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNE
                     QRTAVTPMAFNAPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRP
                     GAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     gene            complement(98168..98479)
                     /gene="traL"
                     /locus_tag="NRG857_RS23275"
                     /old_locus_tag="NRG857_30193"
     CDS             complement(98168..98479)
                     /gene="traL"
                     /locus_tag="NRG857_RS23275"
                     /old_locus_tag="NRG857_30193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_490564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraL"
                     /protein_id="WP_000012106.1"
                     /translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITT
                     SKYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     gene            complement(98494..98859)
                     /gene="traA"
                     /locus_tag="NRG857_RS23280"
                     /old_locus_tag="NRG857_30194"
     CDS             complement(98494..98859)
                     /gene="traA"
                     /locus_tag="NRG857_RS23280"
                     /old_locus_tag="NRG857_30194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001668211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system pilin TraA"
                     /protein_id="WP_000994779.1"
                     /translation="MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMF
                     FPQLAMAAGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFL
                     AGFAIISVFIAVGMAVVGL"
     gene            complement(98892..99287)
                     /gene="traY"
                     /locus_tag="NRG857_RS23285"
                     /old_locus_tag="NRG857_30195"
     CDS             complement(98892..99287)
                     /gene="traY"
                     /locus_tag="NRG857_RS23285"
                     /old_locus_tag="NRG857_30195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001366159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer relaxosome protein TraY"
                     /protein_id="WP_014640559.1"
                     /translation="MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIR
                     LKDHLHRYPKFNRAGNIFGKSLVKYLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVI
                     DHLIKFPDFYNSEIFREADKEEDITFNTL"
     gene            complement(99386..100075)
                     /gene="traJ"
                     /locus_tag="NRG857_RS23290"
                     /old_locus_tag="NRG857_30197"
     CDS             complement(99386..100075)
                     /gene="traJ"
                     /locus_tag="NRG857_RS23290"
                     /old_locus_tag="NRG857_30197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003979562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer transcriptional regulator
                     TraJ"
                     /protein_id="WP_000283385.1"
                     /translation="MYPMDRIQQKHARQIDLLENLTAVIQDYPNPACIRDETGKFIFC
                     NTLFHESFLTQDQSAEKWLLSQRDFCELISVTEMEAYRNEHTHLNLVEDVFIQNRFWT
                     ISVQSFLNGHRNIILWQFYDAAHVRHKDSYNQKTIVSDDIRNIIRRMSDDSSVSSYVN
                     DVFYLYSTGISHNAIARILNISISTSKKHASLICDYFSVSNKDELIILLYNKKFIYYL
                     YEKAMCIINTR"
     gene            complement(100262..100645)
                     /gene="traM"
                     /locus_tag="NRG857_RS23295"
                     /old_locus_tag="NRG857_30199"
     CDS             complement(100262..100645)
                     /gene="traM"
                     /locus_tag="NRG857_RS23295"
                     /old_locus_tag="NRG857_30199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001151541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxosome protein TraM"
                     /protein_id="WP_001151524.1"
                     /translation="MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLE
                     LGLRVHEAQMERKESAFNQTEFNKLLLECVVKTQSSVAKILGIESLSPHVSGNPKFEY
                     ANMVEDIREKVSSEMERFFPKNDDE"
     gene            100966..101568
                     /locus_tag="NRG857_RS23300"
                     /old_locus_tag="NRG857_30200"
     CDS             100966..101568
                     /locus_tag="NRG857_RS23300"
                     /old_locus_tag="NRG857_30200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000243705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase SLT domain-containing protein"
                     /protein_id="WP_000243712.1"
                     /translation="MVLLVVRTTNLLSLFVEWVKLFTDKVTRGGKMKKWMLAICLMFI
                     NEICQATDCFDLAGRDYKIDPDLLRAISWQESRYRVNAIGINPVTGYGSGLMQVDSQH
                     FNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVTWEAVGAYNAGFRKTERQNQ
                     RRLAYASDVYRIYTGIKSSKGIRLPATKKSLPEINSVQNN"
     gene            complement(101864..102685)
                     /locus_tag="NRG857_RS23305"
                     /old_locus_tag="NRG857_30203"
     CDS             complement(101864..102685)
                     /locus_tag="NRG857_RS23305"
                     /old_locus_tag="NRG857_30203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001234456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF945 domain-containing protein"
                     /protein_id="WP_001234426.1"
                     /translation="MRLASRFGRYNSIRRERPLTDDELMQFVPSVFSGDKHESRSERY
                     TYIPTINIINKLRDEGFQPFFACQSRIRDLGRREYSKHMLRLRREGHINGQEVPEIIL
                     LNSHDGSSSYQMIPGIFRFVCTNGLVCGNNFGEIRVPHKGDIVGQVIEGAYEVLGVFD
                     KVTDNMEAMKEIHLNSDEQHLFGRAALMVRYEDENKTPVTPEQIITPRRREDKQNDLW
                     TTWQRVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWVIAEQFRKWKS"
     gene            complement(102803..103090)
                     /locus_tag="NRG857_RS23310"
                     /old_locus_tag="NRG857_30204"
     CDS             complement(102803..103090)
                     /locus_tag="NRG857_RS23310"
                     /old_locus_tag="NRG857_30204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001825190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000107535.1"
                     /translation="MSTRNIHVNTASYTLLVAGKKKNTGEEWDVLEFSSLTELKKYRK
                     SHPEKMAFSYSYALSQGVDKQFRHINIAEADHFKQFLRQIKRAGLDIRAIC"
     gene            103154..103390
                     /locus_tag="NRG857_RS23315"
                     /pseudo
     CDS             103154..103390
                     /locus_tag="NRG857_RS23315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001404411.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(104011..104169)
                     /locus_tag="NRG857_RS23320"
                     /old_locus_tag="NRG857_30210"
     CDS             complement(104011..104169)
                     /locus_tag="NRG857_RS23320"
                     /old_locus_tag="NRG857_30210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system Hok family toxin"
                     /protein_id="WP_001312861.1"
                     /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAA
                     FMAYESGK"
     gene            104249..104437
                     /locus_tag="NRG857_RS23325"
                     /old_locus_tag="NRG857_30212"
     CDS             104249..104437
                     /locus_tag="NRG857_RS23325"
                     /old_locus_tag="NRG857_30212"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001299721.1"
                     /translation="MKINLLRGYLLSATQHGNKPPSRHEAESLKRRAHHSPYTCTLTT
                     LTFPENNPLIQTVHGKSV"
     gene            complement(104449..105168)
                     /locus_tag="NRG857_RS23330"
                     /old_locus_tag="NRG857_30216"
     CDS             complement(104449..105168)
                     /locus_tag="NRG857_RS23330"
                     /old_locus_tag="NRG857_30216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001763821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="WP_001276238.1"
                     /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRHQGNTLAEYPYAGAF
                     FRCLNGSRRISLSDLRFFMPSLTAEELHGNRLQWLYAIDVLIETQGEVCLLPLPGDAA
                     ERLFPSVRFRVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPE
                     TVGSWYARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEAGMAARV
                     VGHAVREMERWMVPNKLREAA"
     gene            complement(105165..105599)
                     /gene="psiB"
                     /locus_tag="NRG857_RS23335"
                     /old_locus_tag="NRG857_30217"
     CDS             complement(105165..105599)
                     /gene="psiB"
                     /locus_tag="NRG857_RS23335"
                     /old_locus_tag="NRG857_30217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000845953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugation system SOS inhibitor PsiB"
                     /protein_id="WP_000845936.1"
                     /translation="MKTELTLNVLQTMNTQEYEDIRAAGSDERRELTHAVMRELDAPD
                     NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
                     QVQRRFAPEAVSHSLALAASLDAQGYSVSDIIHILMAEGSQA"
     gene            complement(105654..>105851)
                     /locus_tag="NRG857_RS23340"
                     /pseudo
     CDS             complement(105654..>105851)
                     /locus_tag="NRG857_RS23340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052657.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(105879..106112)
                     /locus_tag="NRG857_RS23345"
                     /old_locus_tag="NRG857_30220"
     CDS             complement(105879..106112)
                     /locus_tag="NRG857_RS23345"
                     /old_locus_tag="NRG857_30220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_958724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF905 family protein"
                     /protein_id="WP_000005990.1"
                     /translation="MSEYFRILQGLPDGPFTRKHAEAVAAQYRNVFIEDDHGEQFRLV
                     VRNNGAMVWRTWNFEDGAGYWMNHVIRDFGILK"
     gene            complement(106185..106724)
                     /locus_tag="NRG857_RS23350"
                     /old_locus_tag="NRG857_30223"
     CDS             complement(106185..106724)
                     /locus_tag="NRG857_RS23350"
                     /old_locus_tag="NRG857_30223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000290791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_000290840.1"
                     /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDK
                     QTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
                     VKTTGTMQMLGRAAGAQTQPEEGQQFSGQPQPEPQAEAGTKKGGAKTKGRGRKAAQPE
                     PQPQPPEGDDYGFSDDIPF"
     gene            complement(106958..107167)
                     /locus_tag="NRG857_RS23355"
     CDS             complement(106958..107167)
                     /locus_tag="NRG857_RS23355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001668326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1472 domain-containing protein"
                     /protein_id="WP_032193435.1"
                     /translation="MWTSSRVRAVPCLHLSRAGVDARGNAVSQTALHVVAAGPCPLFC
                     PVPFTCLSPCRRGLIQPQPSPPVQG"
     gene            complement(107289..107467)
                     /locus_tag="NRG857_RS23360"
                     /pseudo
     CDS             complement(107289..107467)
                     /locus_tag="NRG857_RS23360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001660165.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid/phospholipid synthesis protein"
     gene            complement(108052..109023)
                     /locus_tag="NRG857_RS23365"
                     /old_locus_tag="NRG857_30229"
     CDS             complement(108052..109023)
                     /locus_tag="NRG857_RS23365"
                     /old_locus_tag="NRG857_30229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000817038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB/RepB/Spo0J family plasmid partition
                     protein"
                     /protein_id="WP_000817028.1"
                     /translation="MKRAPVIPKHTIKTQPLEDTPSSAPAAPMVDSLIARVGAMARGN
                     AITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQ
                     TPAFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSA
                     YERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSA
                     RSGDALQRAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLS
                     SRHQFAPGATVLYKGDKMVLNLDRSRIPTECIERIEAILKELEKAAL"
     gene            complement(109023..110189)
                     /gene="sopA"
                     /locus_tag="NRG857_RS23370"
                     /old_locus_tag="NRG857_30230"
     CDS             complement(109023..110189)
                     /gene="sopA"
                     /locus_tag="NRG857_RS23370"
                     /old_locus_tag="NRG857_30230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-partitioning protein SopA"
                     /protein_id="WP_001238646.1"
                     /translation="MRLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGE
                     AADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAE
                     DVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
                     HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPT
                     DPHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQ
                     FFDMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRE
                     TDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
     gene            complement(110489..111186)
                     /locus_tag="NRG857_RS23375"
                     /old_locus_tag="NRG857_30231"
                     /pseudo
     CDS             complement(110489..111186)
                     /locus_tag="NRG857_RS23375"
                     /old_locus_tag="NRG857_30231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(111671..113872)
                     /gene="iutA"
                     /locus_tag="NRG857_RS23380"
                     /old_locus_tag="NRG857_30235"
     CDS             complement(111671..113872)
                     /gene="iutA"
                     /locus_tag="NRG857_RS23380"
                     /old_locus_tag="NRG857_30235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004213924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferric aerobactin receptor IutA"
                     /protein_id="WP_000973511.1"
                     /translation="MMISKKYTLWALNPLLLIMMAPAVAQQTDDETFVVSANRSNRTV
                     AEMAQTTWVIENAELEQQIQGGKELKDALAQLIPGLDVSSRSRTNYGMNVRGRPLVVL
                     VDGVRLNSSRTDSRQLDSIDPFNIDHIEVISGATSLYGGGSTGGLINIVTKKGQPETM
                     MEFEAGTKSGFSSSKDHDERIAGAVSGGNEHISGRLSVAYQKFGGWFDGNGDATLLDN
                     TQTGLQYSDRLDIMGTGTLNIDESRQLQLITQYYKSQGDDDYGLNLGKGFSAIRGTST
                     PFVSNGLNSDRIPGTERHLISLQYSDSAFLGQELVGQVYYRDESLRFYPFPTVNANKQ
                     VTAFSSSQQDTDQYGMKLTLNSKPMDGWQITWGLDADHERFTSNQMFFDLAQASASGG
                     LNNKKIYTTGRYPSYDITNLAVFLQSGYDINNLFTLNGGVRYQYTENKIDDFIGYAQQ
                     RQIAAGKATSADAIPGGSVDYDNFLFNAGLLMHITERQQAWLNFSQGVELPDPGKYYG
                     RGIYGAAVNGHLPLTKSVNVSDSKLEGVKVDSYELGWRFTGNNLRTQIAAYYSISDKS
                     VVANKDLTISVVDDKRRIYGVEGAVDYLIPDTDWSTGVNFNVLKTESKVNGTWQKYDV
                     KTASPSKATAYIGWAPDPWSLRVQSTTSFDVSDAQGYKVDGYTTVDLLGSYQLPVGTL
                     SFSIENLFDRDYTTVWGQRAPLYYSPGYGPASLYDYKGRGRTFGLNYSVLF"
     gene            complement(113954..115231)
                     /gene="iucD"
                     /locus_tag="NRG857_RS23385"
                     /old_locus_tag="NRG857_30237"
     CDS             complement(113954..115231)
                     /gene="iucD"
                     /locus_tag="NRG857_RS23385"
                     /old_locus_tag="NRG857_30237"
                     /EC_number="1.14.13.59"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001354579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent L-lysine N(6)-monooxygenase"
                     /protein_id="WP_000750130.1"
                     /translation="MKKSVDFIGVGTGPFNLSIAALSHQIEELDCLFFDEHPHFSWHP
                     GMLVPDCHMQTVFLKDLVSAVAPTNPYSFVNYLVKHKKFYRFLTSRLRTVSREEFSDY
                     LRWAAEDMNNLYFSHTVENIDFDKKRRLFLVQTSQGEYFARNICLGTGKQPYLPPCVK
                     HMTQSCFHASEMNLRRPDLSGKRITVVGGGQSGADLFLNALRGEWGEAAEINWVSRRN
                     NFNALDEAAFADEYFTPEYISGFSGLEEDIRHQLLDEQKMTSDGITADSLLTIYRELY
                     HRFEVLRKPRNIRLLPSRSVTTLESSGPGWKLLMEHHLDQGRESLESDVVIFATGYRS
                     ALPQILPSLMPLITMHDKNTFKVRDDFTLEWSGPKENNIFVVNASMQTHGIAEPQLSL
                     MAWRSARILNRVMGRDLFDLSMPPALIQWRSGT"
     gene            complement(115228..116970)
                     /gene="iucC"
                     /locus_tag="NRG857_RS23390"
                     /old_locus_tag="NRG857_30238"
     CDS             complement(115228..116970)
                     /gene="iucC"
                     /locus_tag="NRG857_RS23390"
                     /old_locus_tag="NRG857_30238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aerobactin synthase IucC"
                     /protein_id="WP_001015721.1"
                     /translation="MNHKDWDLVNRRLVAKMLSELEYEQVFHAESQGDDRYCINLPGA
                     QWRFIAERGIWGWLWIDAQTLRCADEPVLAQTLLMQLKQVLSMSDATVAEHMQDLYAT
                     LLGDLQLLKARRGLSASDLINLNADRLQCLLSGHPKFVFNKGRRGWGKEALERYAPEY
                     ANTFRLHWLAVKREHMIWRCDNEMDIHQLLTAAMDPQEFARFSQVWQENGLDHNWLPL
                     PVHPWQWQQKIATDFIADFAEGRMVSLGEFGDQWLAQQSLRTLTNASRRGGLDIKLPL
                     TIYNTSCYRGIPGRYIAAGPLASRWLQQVFATDATLVQSGAVILGEPAAGYVSHEGYA
                     ALARAPYRYQEMLGVIWRENPCRWLKPDESPVLMATLMECDENNQPLAGAYIDRSGLD
                     AETWLTQLFRVVVVPLYHLLCRYGVALIAHGQNITLAMKEGVPQRVLLKDFQGDMRLV
                     KEEFPEMDSLPQEVRDVTSRLSADYLIHDLQTGHFVTVLRFISPLMVRLGVPERRFYQ
                     LLAAVLSDYMKKHPQMSERFALFSLFRPQIIRVVLNPVKLTWPDLDGGSRMLPNYLED
                     LQNPLWLVTQEYES"
     gene            complement(116970..117917)
                     /gene="iucB"
                     /locus_tag="NRG857_RS23395"
                     /old_locus_tag="NRG857_30239"
     CDS             complement(116970..117917)
                     /gene="iucB"
                     /locus_tag="NRG857_RS23395"
                     /old_locus_tag="NRG857_30239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N(6)-hydroxylysine O-acetyltransferase"
                     /protein_id="WP_000011910.1"
                     /translation="MSGANIVHSGYGLRCEKLDKPLNLGWGLDNSAVLHWPGELPTGW
                     LCDALDQIFIAAPQLSAVVLPWSEWCEEPQALTLFGQVQSDIIHRSAFWQLPLWLSSP
                     ANRASGKMVFDAEREIYFPQRPPRPQGEVYRRYDPRIRRMLSFRIADPVSDAERFTRW
                     MNDPRVEYFWEQSGSLEVQIAYLERQLTSKHAFPLIGCFDDRPFSYFEIYWAAEDRIG
                     RHYSWQPFDRGLHLLVGEQQWRGAHYVQSWLRGVTHYLLLNEPRTQRTVLEPRTDNQR
                     LFRHLEPAGYRTIKEFDFPHKRSRMVMADRHHFFTEVGL"
     gene            complement(117918..119642)
                     /gene="iucA"
                     /locus_tag="NRG857_RS23400"
                     /old_locus_tag="NRG857_30241"
     CDS             complement(117918..119642)
                     /gene="iucA"
                     /locus_tag="NRG857_RS23400"
                     /old_locus_tag="NRG857_30241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001314127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aerobactin synthase IucA"
                     /protein_id="WP_000602863.1"
                     /translation="MILPSEKSATDVAAQCFLNALIRETKDWQLAEYPPDELIIPLDE
                     QKSLHFRVAYFSPTQHHRFAFPAHLVTASGSYPVDFTTLSRLIIDKLRHQLFLPVPLC
                     ETFHQRVLESYAHTQQTIDARHDWAILREKALNFGEAEQALLTGHAFHPAPKSHEPFN
                     RQEAERYLPDMAPHFPLRWFSVDKTQIAGESLHLNLQQRLTRFAAENAPQLLNELSDN
                     QWLFPLHPWQGEYLLQQVWCQALFAKGLIRDLGEAGTSWLPTTSSRSLYCATSRDMIK
                     FSLSVRLTNSVRTLSVKEVERGMRLARLAQTDGWQMLQARFPTFRVMQEDGWAGLRDL
                     NGNIMQESLFSLRENLLLEQPQSQTNVLVSLTQAAPDGGDSLLVSAVKRLSDRLGITV
                     QQAAHAWVDAYCQQVLKPLFTAEADYGLVLLAHQQNILVQMLGDLPVGFIYRDCQGSA
                     FMPHATEWLDTIDEAQAENIFTREQLLRYFPYYLLVNSTFAVTAALGAAGLDSEANLM
                     ARVRTLLAEVRDQVTHKTCLNYVLESPYWNVKGNFFCYLNDHNENTIVDPSVIYFDFA
                     NPLQAQEV"
     gene            119778..120971
                     /locus_tag="NRG857_RS23405"
                     /old_locus_tag="NRG857_30245"
     CDS             119778..120971
                     /locus_tag="NRG857_RS23405"
                     /old_locus_tag="NRG857_30245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_000095526.1"
                     /translation="MSSKIEDTPQKTLSCWPLAFSAGLLGIGQNGLLVVLPVLVIQTN
                     LSLSVWAALLMLGSMLFLPSSPWWGKQISLTGSKTVVLWALGGYGVSFTLLGLGSVLM
                     ATGAVTTAVGLGILIIARIVYGLTVSAMVPACQVWALQRAGEGNRMAALATISSGLSC
                     GRLFGPLCAAAMLVIHPLAPVWMLMAAPVWAVVMLLRLPGTPPQPTPERKSVSLKRDC
                     LPYLLCAMLLAAAMSMMQLGLSPALTRQFDTDTTTISQQVAWLLGLSAIAALIAQFVV
                     LRPQRLTPVALLLSAGVLMSSGLAIMLTEQLWLFYLGCAVLSFGAALATPAYQLLLND
                     KLADGAGAGWLAASHTLGYGLCALLVPLASKTGVSIALIVTALFAAVLFTIVSACIWH
                     YRTIK"
     gene            complement(121351..121731)
                     /gene="crcB"
                     /locus_tag="NRG857_RS23410"
                     /old_locus_tag="NRG857_30248"
     CDS             complement(121351..121731)
                     /gene="crcB"
                     /locus_tag="NRG857_RS23410"
                     /old_locus_tag="NRG857_30248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001318207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fluoride efflux transporter CrcB"
                     /protein_id="WP_001318207.1"
                     /translation="MIKSLFAVIIGGSVGCTLRWLLSTRFNSLFPNLPPGTLVVNLLA
                     GLIIGTALAYFLRQPHLDPFWKLMITTGLCGGLSTFSTFSVEVFALLQAGNYIWALTS
                     VLVHVIGSLIMTALGFFIITILFA"
     gene            complement(122072..>122485)
                     /locus_tag="NRG857_RS23415"
                     /old_locus_tag="NRG857_30250"
                     /pseudo
     CDS             complement(122072..>122485)
                     /locus_tag="NRG857_RS23415"
                     /old_locus_tag="NRG857_30250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015377870.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
     gene            <122483..122740
                     /locus_tag="NRG857_RS23420"
                     /pseudo
     CDS             <122483..122740
                     /locus_tag="NRG857_RS23420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611787.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(122974..123831)
                     /gene="sitD"
                     /locus_tag="NRG857_RS23425"
                     /old_locus_tag="NRG857_30253"
     CDS             complement(122974..123831)
                     /gene="sitD"
                     /locus_tag="NRG857_RS23425"
                     /old_locus_tag="NRG857_30253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_707259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron/manganese ABC transporter permease subunit
                     SitD"
                     /protein_id="WP_000968139.1"
                     /translation="MMALLLEPLQFTFMSHALLISLVVSIPCALLSVFLVLKSWALMG
                     DAMSHAVFPGIVLAWILGLPLATGAFVAGVFCAVATGYLKDNSRIKQDTVMGIVFSGM
                     FAAGLILYIAVKPDVHLDHILFGDMLGITIGDIIQTVIIAGLVTLVISVKWRDFLLFS
                     FDYQQAQASGLHTRWLHYGLLCMVSLTIVATLKAVGIILSISLLIAPGAIAVLLTQRF
                     HIALLLATGISILVSMTGVWLSFFIDSAPAPTIVVLFAVMFIMTFTVTSINARTKENA
                     EPRDLLSSD"
     gene            complement(123828..124685)
                     /gene="sitC"
                     /locus_tag="NRG857_RS23430"
                     /old_locus_tag="NRG857_30256"
     CDS             complement(123828..124685)
                     /gene="sitC"
                     /locus_tag="NRG857_RS23430"
                     /old_locus_tag="NRG857_30256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_707260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron/manganese ABC transporter permease subunit
                     SitC"
                     /protein_id="WP_001101723.1"
                     /translation="MNVLLEPFSYEYMLNAMWVSAMVGGLCAFLSCYLMLKGWSLIGD
                     ALSHSIVPGVAGAYMLGLPFSLGAFFSGGLAAGSMLFLNQLTRLKEDAIIGLIFSSFF
                     GLGLFMVSLNPTSVNIQTIVLGNILAIDPADILQLTIIGILSIIVLFFKWKDLMVTFF
                     DENHARAIGLHPGRLKILFFTLLSVSTVAALQTVGAFLVICLVVTPGATAWLLTDRFP
                     RLLMIAVTIGSVTSFLGAWVSYFLDGATGGIIVVAQTLLFLLAFVFAPTHGLLANRRR
                     AHKALEDRS"
     gene            complement(124682..125509)
                     /gene="sitB"
                     /locus_tag="NRG857_RS23435"
                     /old_locus_tag="NRG857_30258"
     CDS             complement(124682..125509)
                     /gene="sitB"
                     /locus_tag="NRG857_RS23435"
                     /old_locus_tag="NRG857_30258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_707261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron/manganese ABC transporter ATP-binding
                     protein SitB"
                     /protein_id="WP_000983710.1"
                     /translation="MMQSAGIVVNDVTVTWRNGHTALRDASFTVPGGSIAALVGVNGS
                     GKSTLFKAIMGFVRLTSGKISVLGIPTRQALQKNLVAYVPQSEEVDWSFPVLVEDVVM
                     MGRYGHMGMLRIAKKRDRQIVTDALERVDMVDFRHRQIGELSGGQKKRVFLARAIAQQ
                     GDVILLDEPFTGVDVKTEAKIISLLRELRAEGKTMLVSTHNLGSVTTFCDYTVMVKGT
                     VLASGPTDTTFTAENLELAFSGVLRHVTLNGSEESIITDDERPFVAHRPSAVQREER"
     gene            complement(125481..126422)
                     /gene="sitA"
                     /locus_tag="NRG857_RS23440"
                     /old_locus_tag="NRG857_30260"
     CDS             complement(125481..126422)
                     /gene="sitA"
                     /locus_tag="NRG857_RS23440"
                     /old_locus_tag="NRG857_30260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000555621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron/manganese ABC transporter substrate-binding
                     protein SitA"
                     /protein_id="WP_014640564.1"
                     /translation="MLSIKKVTMLLGCLVLTCSIAFQASAAEKFKVITTFTIIADMAK
                     NVAGDAAEVSSITKPGAEIHEYQPTPGDIKRAQGAQLILANGMNLELWFQRFYQHLNG
                     VPEVIVSSGVTPVGITEGPYEGKPNPHAWMSPDNALIYVDNIRDAFIKYDPANAQTYQ
                     RNADTYKAKITQTLAPLRKQIAELPENQRWMVTSEGAFSYLARDLGLKELYLWPINAD
                     QQGTPQQVRKVVDIVKKNHIPAVFSESTISDKPARQVARETGAHYGGVLYVDSLSTEN
                     GPVPTYIDLLKVTTSTLVQGIKAEKGRNNDAICRHCR"
     gene            126778..127475
                     /locus_tag="NRG857_RS23445"
                     /pseudo
     CDS             126778..127475
                     /locus_tag="NRG857_RS23445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(127655..>128168)
                     /locus_tag="NRG857_RS23450"
                     /pseudo
     CDS             complement(127655..>128168)
                     /locus_tag="NRG857_RS23450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001566943.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4113 domain-containing protein"
     gene            complement(<128335..128658)
                     /locus_tag="NRG857_RS23455"
                     /old_locus_tag="NRG857_30268"
                     /pseudo
     CDS             complement(<128335..128658)
                     /locus_tag="NRG857_RS23455"
                     /old_locus_tag="NRG857_30268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000952428.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            129404..130381
                     /locus_tag="NRG857_RS23460"
                     /old_locus_tag="NRG857_30273"
     CDS             129404..130381
                     /locus_tag="NRG857_RS23460"
                     /old_locus_tag="NRG857_30273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052630.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_000361611.1"
                     /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNT
                     LSRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVE
                     LPFVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSA
                     YYDTERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
                     PISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKFFCIHYRRPR
                     LKAPNDESKENPLQPSPAEKVSPEMAEKLALLEKLGITLDDLEKLFKSR"
     gene            complement(130666..131406)
                     /locus_tag="NRG857_RS23465"
                     /old_locus_tag="NRG857_30276"
     CDS             complement(130666..131406)
                     /locus_tag="NRG857_RS23465"
                     /old_locus_tag="NRG857_30276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_001066954.1"
                     /translation="MNNVIPLQNSPERVSLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLNGVRPFVRILSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWAVTDETMRNWLKQAV
                     RRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALVGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLR"
     gene            complement(131527..131715)
                     /locus_tag="NRG857_RS23470"
                     /old_locus_tag="NRG857_30277"
     CDS             complement(131527..131715)
                     /locus_tag="NRG857_RS23470"
                     /old_locus_tag="NRG857_30277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001312821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014640565.1"
                     /translation="MESEIFSCLLRASAGFFLRFCLSWHYPNSPKNGKPVLSPHHDWL
                     KTGSLRQNAPLRIWFYPQ"
     gene            complement(132089..132997)
                     /locus_tag="NRG857_RS23475"
                     /old_locus_tag="NRG857_30278"
     CDS             complement(132089..132997)
                     /locus_tag="NRG857_RS23475"
                     /old_locus_tag="NRG857_30278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000175738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antimicrobial resistance protein Mig-14"
                     /protein_id="WP_000175738.1"
                     /translation="MTLSIKNIKRIITAWKPSTFETYKKTFEKYGGSVNMHPDVVSYF
                     MIHHDWKFDFFHYEKDGDIKGSYFLCNGKQIGIMARRSYPLSSDEVLIPFSPHARCFF
                     PDKTNKLSIINKQNIINATWKIARKKQNCIIKESFSPKFEKTRRNEIQRFIRNGGEIK
                     CISQLSDKEISSSYISLFHSRFGGTLPCYEYDNLLMFISHLRELMFGHVLFWDNKPCA
                     IDIVLKSESSCNVYYDVPNGAVLNDENCMKLSPGSVLMWLNIDKARRYCQDNNKKMIY
                     SIGAFRPEWKYKLLWSVPCKVGKCLC"
     gene            complement(133060..134169)
                     /locus_tag="NRG857_RS23480"
                     /old_locus_tag="NRG857_30279"
     CDS             complement(133060..134169)
                     /locus_tag="NRG857_RS23480"
                     /old_locus_tag="NRG857_30279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004149557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_000771475.1"
                     /translation="MKLLLLTGATGFLGGAVLDKLLDNCNNINLLLLVRAPTPQAGLE
                     RIKENMRKFNVCEERLHALTNDNILPGDLNNPEAFLMDPRLDEVTHVINCAAIASFGN
                     NPFIWNVNVTGTLAFARRMAKVAGLKRFLHVGTAMSCTPHTGSLVKEESASSETGEHL
                     VEYTHSKATIEYLMRKQCPDLPLLVARPSIIVGHSRLGCLPSTSIFWVFRMGLMLQKF
                     MCSLDDKIDVIPVDYCADALLMLLESSLINGEIVHISAGKESSVTFSAIDEAVARALN
                     CDPVGDRYTKVSYDILAMSRHDFKNIFGPCNERLMLKAIRLYGAFSMLNVCFSNDKLL
                     SIGMPKPPKFTDYIKYCIETTKHLSIQQQMEVDFK"
     gene            complement(134602..135555)
                     /locus_tag="NRG857_RS23485"
                     /old_locus_tag="NRG857_30283"
     CDS             complement(134602..135555)
                     /locus_tag="NRG857_RS23485"
                     /old_locus_tag="NRG857_30283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001201845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="omptin family outer membrane protease"
                     /protein_id="WP_000280980.1"
                     /translation="MYLKILATALSAPVAFAALASDTGLSFTPEKISTEIDFGTLSGK
                     AKERVYLPEEKGRKASQLDWKYSNAPIVKGAFNWDLLPRVSVGASGWTTLAGRGGNMV
                     DRDWLDTSNPGTWTDESKHPNTRLNFANEFDLNIKGWLLNQPDYQLGLMAGYQENRYS
                     FTAKGGSYIYSSEGGFRDETGSFPDGERAIGYKQHFKMPYIGLTGNYRYDSFEFGGSF
                     KYSGWVKASDNDEHYNPEKRITYRSDVNNQNYYSVSLHAGYYITPAAKVYVEGTWNRI
                     TNKKGDTSLYSRNLNISDHTKNGAGIESYNFMTTAGLKYYF"
     gene            complement(136828..136986)
                     /locus_tag="NRG857_RS23490"
     CDS             complement(136828..136986)
                     /locus_tag="NRG857_RS23490"
                     /inference="COORDINATES: protein motif:HMM:NF025063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001312823.1"
                     /translation="MAQNAFIESFNRTYRTKILGFCLFRTLDEKRELAANWLSEYNSE
                     RHINYLTI"
     gene            137170..138383
                     /locus_tag="NRG857_RS23495"
                     /old_locus_tag="NRG857_30291"
     CDS             join(137170..137461,137461..138383)
                     /locus_tag="NRG857_RS23495"
                     /old_locus_tag="NRG857_30291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558238.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_162842477.1"
                     /translation="MTKNTRFSPEVRQRAIRMVLESQGEYDSQWAAICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFGEGGV
                     RPPLEKMMPLLDKLREQYGVGPLCSELHIAPSTYYHCQQQRHHPDKRSARAQRDDWLK
                     KEIQRVYDENHKVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKVRTTIS
                     RKAVVAGDRVNRQFVAERPDQLWVADSTYVSTWQGVVYVAFIIDVFAGYIVGWRVSSS
                     METTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYD
                     NAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLERLGHTPPAEAEKA
                     YYASIGNDDLAA"
     misc_feature    137451..137567
                     /locus_tag="NRG857_RS23495"
                     /old_locus_tag="NRG857_30291"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01497"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /db_xref="RFAM:RF01497"
     gene            complement(138531..>138799)
                     /locus_tag="NRG857_RS23500"
                     /pseudo
     CDS             complement(138531..>138799)
                     /locus_tag="NRG857_RS23500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611553.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            138856..139553
                     /locus_tag="NRG857_RS23505"
                     /old_locus_tag="NRG857_30296"
                     /pseudo
     CDS             138856..139553
                     /locus_tag="NRG857_RS23505"
                     /old_locus_tag="NRG857_30296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612230.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 family transposase"
     gene            complement(139631..141020)
                     /locus_tag="NRG857_RS23510"
                     /pseudo
     CDS             complement(139631..141020)
                     /locus_tag="NRG857_RS23510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001567368.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ISNCY family transposase"
     gene            complement(<141330..>141479)
                     /locus_tag="NRG857_RS23515"
                     /pseudo
     CDS             complement(<141330..>141479)
                     /locus_tag="NRG857_RS23515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611434.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus and C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(141657..142850)
                     /locus_tag="NRG857_RS23520"
                     /old_locus_tag="NRG857_30302"
     CDS             complement(141657..142850)
                     /locus_tag="NRG857_RS23520"
                     /old_locus_tag="NRG857_30302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000450492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_000450494.1"
                     /translation="METTSVIILNGFLGAGKTTLLKNLLIQAHEKQLSVSVIVNDMSE
                     LDVDGVLIANTDIVDAKDNNFVSITADSISSPAGLKKMDLAINHLLDHNKPDVMLIET
                     SGSSHPLPLVKYLRRHSRVRLKAFLTLVDTVMLHEDYNDGKKLIPTLQENLRHNKRGL
                     ENLLAEQIMFCNRLLLTRNDRLPFDIISAVAKAIHPLNPSVDVLAVSWGNIELSTLLA
                     IPDYNFDRVELLISELEALVGNMDTPCNNEELIWRVIRDDRPFHPQRLWDTCHRFMGM
                     GVYRSKGFFWLPGRDDLALLWNQSAGSISLALIGYWKAGVLEHTDNNLTREERSALQR
                     HIDTASGRFGDRCCQLTIIGNATEVNDFTHALSLCLLTEEEIQWWMSGGVFPDPWPQK
                     VTRLS"
     gene            complement(144073..145309)
                     /locus_tag="NRG857_RS23525"
                     /old_locus_tag="NRG857_30306"
                     /pseudo
     CDS             complement(144073..145309)
                     /locus_tag="NRG857_RS23525"
                     /old_locus_tag="NRG857_30306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_086558215.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            145936..146229
                     /gene="iss"
                     /locus_tag="NRG857_RS23530"
     CDS             145936..146229
                     /gene="iss"
                     /locus_tag="NRG857_RS23530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="increased serum survival lipoprotein Iss"
                     /protein_id="WP_000738422.1"
                     /translation="MKKMLFSAALAMLITGCAQQTFTVGNKPTAVTPKETITHHFFVS
                     GIGQEKTVDAAKICGGAENVVKTETQQTFVNGLLGFITFGIYTPLEARVYCSQ"
     gene            complement(146287..>146462)
                     /locus_tag="NRG857_RS23535"
                     /pseudo
     CDS             complement(146287..>146462)
                     /locus_tag="NRG857_RS23535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309650.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing N-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="lysis protein"
CONTIG      join(CP001856.1:1..147060)
//
DBGET integrated database retrieval system