GenomeNet

Database: RefSeq
Entry: NC_018233
LinkDB: NC_018233
Original site: NC_018233 
LOCUS       NC_018233             529559 bp    DNA     linear   CON 06-APR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 6.
ACCESSION   NC_018233
VERSION     NC_018233.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 529559)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 529559)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799593.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..529559
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="6"
     gene            complement(<1131..>1433)
                     /locus_tag="LDBPK_060010"
                     /db_xref="GeneID:13391774"
     mRNA            complement(<1131..>1433)
                     /locus_tag="LDBPK_060010"
                     /product="histone H4"
                     /transcript_id="XM_003858261.1"
                     /db_xref="GeneID:13391774"
     CDS             complement(1131..1433)
                     /locus_tag="LDBPK_060010"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_003858309.1"
                     /db_xref="GeneID:13391774"
                     /db_xref="GOA:E9B8L2"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9B8L2"
                     /translation="MAKGKRSADAKSSQKRQKKVLRDNIRGITRGCVRRMARRGGVKR
                     ISSDVYEEVRRVLKAYLEDIVRCSTAYTEYARKKTVTACDVVNALRKKGHILYGYA"
     gap             1635..1733
                     /estimated_length=99
     gene            complement(<4034..>5641)
                     /locus_tag="LDBPK_060020"
                     /db_xref="GeneID:13391705"
     mRNA            complement(<4034..>5641)
                     /locus_tag="LDBPK_060020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858262.1"
                     /db_xref="GeneID:13391705"
     CDS             complement(4034..5641)
                     /locus_tag="LDBPK_060020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858310.1"
                     /db_xref="GeneID:13391705"
                     /db_xref="UniProtKB/TrEMBL:E9B8L3"
                     /translation="MSISSLPLEGLTAIADFFDPASVPLAFTSVSPAGRVAGELAAFA
                     CPAHCYGHAASPHTPMLSMDPSLMERVSVITDTQHLKNAEWWMVRSRCNADDDPYPYP
                     LRSVYFCLSSALELSVDLLARVPLCASTVTKLNLNARCDSHNHISSLGAISRLVHLRE
                     LIMKNTTVLQSTRQLPMVMTQELHAVFRKLRKLVVGDFYLVKHLPLHDLPELEEVDLS
                     GTGVTNGVVQALSSCHRVHTLTLSGCVGIDSFAPLTALTRLSQLDLSHTRLDNTELLH
                     LCRSCPQLFFLALNSCNRITDFSPLALLEDLTYLHVARTRFRNSDLERIHAFPELEEV
                     HMSSCRVVDIFTPLADLRTLRMLDVRDTWMDDAGVEAVARCCQLLRLNMSACPAIEHF
                     SPLARLSLLEELNLSCSPVTDTCLATLCTAASSLRVFLLNGCRLVSDFTPLGILGSLE
                     EVGACDTAFNDAALEAVAQCPQLTKLHLHVCTGLTSLAPLAACSHLIYLGIGGTRFSS
                     NASERECASLQERGVRLSHQVFLGTDF"
     gene            complement(<11320..>13347)
                     /locus_tag="LDBPK_060030"
                     /db_xref="GeneID:13391707"
     mRNA            complement(<11320..>13347)
                     /locus_tag="LDBPK_060030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858263.1"
                     /db_xref="GeneID:13391707"
     CDS             complement(11320..13347)
                     /locus_tag="LDBPK_060030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858311.1"
                     /db_xref="GeneID:13391707"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9B8L4"
                     /translation="MAKQKLGFKIRGKNVSYEGYPERRPKDLMDILVKMGVDETVVVT
                     TFRENIDNHKDYSDTQVMAMYNEAKSAREKKTRAKAGNNPDESAAAAAPPQSDTADEA
                     EKPQKILLCYRGKQLSYVGLPSGKRNAVLQLLSKQEELTKELAVETFRTNLPEDSSTE
                     EEIWLLVQAVKDRKSRKNQSKGQDAEGSTGNGAAASRAAGSSAMDSITGMSERERDDL
                     NNFILQVLQQPAPDVAALLREDPKRPKDTEDNAELALTARMSGKIPVYLQEENTSGTK
                     LIYATPHMSFDDFHKIVEKKFGRKMALSFYDGDDIIMMDDDDVLAMFLEMTMQNDPKK
                     VRLICSNPELPKKVVEDRLTETRQQAPGGMQVSTTKALAYSNGELNVTETRSYSGHSL
                     AVYCCCFSPKGDMFVTASRDRTIRLWNLRTGVSTVMKGGHNGFVLSCDYSPKGNRVAS
                     SSDDRTIKLWSTSSCSKVATLKGHEDKVYCVKYNSTGELLVSASCDTTVRVWNAESQT
                     KLVTLRGHSLAVFSCAFSNTDNGKFVVSGSDDRVIKLWDWGAGREIMSLVGHIGTVWT
                     VVFSHNDRYVLSGSMDYELILWDSMTGTRLRSMDGHKTSVHHAIFSEDDAYIFSCARD
                     WSVMVWRTSDGEHVETIIGHLSTVYHMDIREDKLLTSSLDDKVKLWTIRRR"
     gene            complement(<14205..>15080)
                     /locus_tag="LDBPK_060040"
                     /db_xref="GeneID:13391708"
     mRNA            complement(<14205..>15080)
                     /locus_tag="LDBPK_060040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858264.1"
                     /db_xref="GeneID:13391708"
     CDS             complement(14205..15080)
                     /locus_tag="LDBPK_060040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858312.1"
                     /db_xref="GeneID:13391708"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:E9B8L5"
                     /translation="MRYSRPSRPLVLARVSSVLSSSRTFHSQHRTPIIPQVHVHDRPT
                     AQRIHVGYYLHRHPVVKHSPHPLEAEMGYLLEREQQRYSRHESAESATAFFASRGQTI
                     DILGRTDPNQIKGNFFGLELYQDAMKVVMQRYSPEKRLTSADLWQPNALGDAPPPRHT
                     LHRKLDDFLYLIVQEGATGKWTIPHTARKDDESLRMTADRAISSQNSDGLDCYVWSNA
                     PQATVFLKDDNTRLFIYAATYLAGRPQFASFEPKPKDHAWVTRHELLQYSDTFKSSEL
                     LKALLDISADGTFEA"
     gap             19288..19386
                     /estimated_length=99
     gap             20578..20676
                     /estimated_length=99
     gene            complement(<21855..>23300)
                     /locus_tag="LDBPK_060050"
                     /db_xref="GeneID:13391640"
     mRNA            complement(<21855..>23300)
                     /locus_tag="LDBPK_060050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858265.1"
                     /db_xref="GeneID:13391640"
     CDS             complement(21855..23300)
                     /locus_tag="LDBPK_060050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858313.1"
                     /db_xref="GeneID:13391640"
                     /db_xref="GOA:E9B8L6"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9B8L6"
                     /translation="MSAGSKNFYASMVLKSNYPDAQPPTAMGAPPKKGPQPYRSPCYN
                     SASANPTAASTLTQPFSLPTSLQSPQMLQAHVPRPTVLIPMAGHETIESSKQSGKIYT
                     HNPYASTCTTPSACLSQSTSMESSSFTSPYITAMAPRTTAMTPPHSSCASTFPVYAAS
                     EGSCCEAGALANMLEDQFLSVLGNIPSTAMSSRGRHILLNVLRLQHMDKIQMIYDELL
                     PQFNIIAMDQHGCHVARTLIEYISTPQMEALVPYIDPHVILQMATTTQHTRRVLQAIF
                     EHHKSDALMPIVEVVTSDCQHLSVTQQGCIAIIRIIEYAKPAQKRTLISALVPLLSTL
                     AKNQFGNYVVQCILKNMEGYVSLNDLVASFQGHWVELSCDKYSSNVMEKIVGMLQGSL
                     RQRIVNELIFDVAHLQCLMQNSFGNYVLQAVIGSAVNQYEYGLIYDAVTPLLHTSPYG
                     HRIEAKLKSRCDALYSKSAPAGTTPVDAMNK"
     gene            complement(<27388..>28356)
                     /locus_tag="LDBPK_060060"
                     /db_xref="GeneID:13391641"
     mRNA            complement(<27388..>28356)
                     /locus_tag="LDBPK_060060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858266.1"
                     /db_xref="GeneID:13391641"
     CDS             complement(27388..28356)
                     /locus_tag="LDBPK_060060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858314.1"
                     /db_xref="GeneID:13391641"
                     /db_xref="UniProtKB/TrEMBL:E9B8L7"
                     /translation="MNSTLGSSGSAGDEAPLVGGLDALTLRTINEQQLIILRQKELVS
                     TLKERVEELEAQPWRADVKPLEAAHKADGRKGTLSYVSEMQLRRRVKTLEDENKKLSD
                     LVDELRAEVSTISAQLYAQQLHTQSEKDVWKAKARNAEAKSVATAHLLEATDKRNQQL
                     IHHLEKLRREGEVSAYECAQWRSLATTTASHLDHANRRYARDQINSIEEDVHRYAVNR
                     LRLARVAPSASLSLESETPEETRKMWSRSAQLPKFDPAPQVFQQQQQESVCSQLHVSH
                     QRPLSQLLPCQPPQPTASHSLAPPASKHVNAETHPSPSHCAALAQT"
     gene            complement(<30574..>31392)
                     /locus_tag="LDBPK_060070"
                     /db_xref="GeneID:13391642"
     mRNA            complement(<30574..>31392)
                     /locus_tag="LDBPK_060070"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858267.1"
                     /db_xref="GeneID:13391642"
     CDS             complement(30574..31392)
                     /locus_tag="LDBPK_060070"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858315.1"
                     /db_xref="GeneID:13391642"
                     /db_xref="UniProtKB/TrEMBL:E9B8L8"
                     /translation="MTLMHDDVLVVAEVSVCNVSWLAVDTHSLLLASATAGAARISQK
                     EQWQQHRSHDGGTWTENEDFQLDFVLYDAKASAMNDKSEVVDYAFLTAQPQPSRVPGE
                     ALVTCQARLKHWMEACYAAYYAARFIDHLRSASPALSFEYDSVLKLISSADGQRTVRG
                     LVAPTLDGSGHHLISFTVPLLVKGRAAKVFQSLNNVAVLYCKVSHAKWKPSYQLTSVE
                     ADVHTRFRTAQRTGRITLIAESVVLRLRDAAAGAAAGATTEGRAADSLISFLHS"
     gap             34581..34679
                     /estimated_length=99
     gap             35885..35983
                     /estimated_length=99
     gene            complement(<35984..>36377)
                     /locus_tag="LDBPK_060080"
                     /db_xref="GeneID:13391643"
     mRNA            complement(<35984..>36377)
                     /locus_tag="LDBPK_060080"
                     /product="ATP-binding cassette protein subfamily G, member
                     1, putative"
                     /transcript_id="XM_003858268.1"
                     /db_xref="GeneID:13391643"
     CDS             complement(<35984..36377)
                     /locus_tag="LDBPK_060080"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily G, member
                     1, putative"
                     /protein_id="XP_003858316.1"
                     /db_xref="GeneID:13391643"
                     /db_xref="GOA:E9B8L9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8L9"
                     /translation="MPRLHNEQVHNGITTDAEDQQNISSNGHQTISSGEDNPQLHGSI
                     VEFDSSTPPAIGVPNSYSLPLSWHRLSYSVGKKRILCGLTGTALPGRCLAILGSSGAG
                     KTTFLNAICDRLASGGELKLSGRRQLGDC"
     gap             39976..40074
                     /estimated_length=99
     gap             40965..41063
                     /estimated_length=99
     gap             41445..42255
                     /estimated_length=811
     gene            complement(<42258..>42698)
                     /locus_tag="LDBPK_060090"
                     /db_xref="GeneID:13391644"
     mRNA            complement(<42258..>42698)
                     /locus_tag="LDBPK_060090"
                     /product="ATP-binding cassette protein subfamily G, member
                     2, putative"
                     /transcript_id="XM_003858269.1"
                     /db_xref="GeneID:13391644"
     CDS             complement(<42258..42698)
                     /locus_tag="LDBPK_060090"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily G, member
                     2, putative"
                     /protein_id="XP_003858317.1"
                     /db_xref="GeneID:13391644"
                     /db_xref="GOA:E9B8M0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8M0"
                     /translation="MPPPAATRAPTDDTYTEYSFSPIDIHEPDAPHHQRRDFGKVGAQ
                     LHGSIVEFDSSTPPAIGVPNSYSLPLSWHRLSYSVGKKRILCGLTGTALPGRCLAILG
                     SSGAGKTTFLNAICDRLASGGELKLSGRRQLGDCEFERHFRKAMG"
     gene            complement(<44108..>44215)
                     /locus_tag="LDBPK_060100"
                     /db_xref="GeneID:13391645"
     mRNA            complement(<44108..>44215)
                     /locus_tag="LDBPK_060100"
                     /product="ATP-binding cassette protein subfamily G, member
                     3, putative"
                     /transcript_id="XM_003858270.1"
                     /db_xref="GeneID:13391645"
     CDS             complement(44108..44215)
                     /locus_tag="LDBPK_060100"
                     /codon_start=1
                     /product="ATP-binding cassette protein subfamily G, member
                     3, putative"
                     /protein_id="XP_003858318.1"
                     /db_xref="GeneID:13391645"
                     /db_xref="GOA:E9B8M1"
                     /db_xref="UniProtKB/TrEMBL:E9B8M1"
                     /translation="MMEISRDSLYLFSYTAQAIFFAVVVGLIFIVFFFT"
     gap             44360..45149
                     /estimated_length=790
     gene            complement(<46563..>48368)
                     /locus_tag="LDBPK_060110"
                     /db_xref="GeneID:13391646"
     mRNA            complement(<46563..>48368)
                     /locus_tag="LDBPK_060110"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858271.1"
                     /db_xref="GeneID:13391646"
     CDS             complement(46563..48368)
                     /locus_tag="LDBPK_060110"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858319.1"
                     /db_xref="GeneID:13391646"
                     /db_xref="UniProtKB/TrEMBL:E9B8M2"
                     /translation="MRYSHSRTLLDVERQQRDGRHGWQARMWHLTWLTVVFLSFYIVC
                     TYNVWRYPRPVRHVWIDSVLVEVVEDDWVERARPWLLYGSVGCGALRALLHCVLCPAA
                     SAAPAGNTGATATARERTRGGRTRAGTATAHNASQPSLMKEISTIAVPAWARRRSDGN
                     LPRGTRGAVPADATAAAAALARQKSIFDPTRPMRTEKDLEWFLACENAQQQQRRSAEA
                     ALSGAVALRYRDRGGAAAAGGGGVDSGPVDAAERDVISVLYENKPLHQRGRSGTAAPA
                     AFGAHTSSPSSSSLSIPWAELGIFHLEETLQRTREWMSDVCRRLVADVEQCDRWFNEH
                     QIEAYDCHHSLQELAPVPPSHPQPAAMTSASTMRWGPPAPVPSVAAAPQHETKLVSLL
                     REKGHCRQTQQGMQDLDMALRYDQRLTLEARLDVSGTFPSSSASRPSNAELTACREYV
                     LQRLRTFAKQRYLISYNSSGGDVETWRSGFPCDAHLLLHVLRTSVKGLKEYVLFGYQT
                     GLQTQDLALYVGDTGEPYFYVRFRQGSNETLLSTRQGPTSLMEAILAFAAVVHVYYHD
                     VYGGVRSTVDLNEVGLLKVVTEGRRAAWASTGGES"
     gap             49394..49492
                     /estimated_length=99
     gene            complement(<49854..>50417)
                     /locus_tag="LDBPK_060120"
                     /db_xref="GeneID:13391647"
     mRNA            complement(<49854..>50417)
                     /locus_tag="LDBPK_060120"
                     /product="cyclophilin"
                     /transcript_id="XM_003858272.1"
                     /db_xref="GeneID:13391647"
     CDS             complement(49854..50417)
                     /locus_tag="LDBPK_060120"
                     /codon_start=1
                     /product="cyclophilin"
                     /protein_id="XP_003858320.1"
                     /db_xref="GeneID:13391647"
                     /db_xref="GOA:E9B8M3"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:E9B8M3"
                     /translation="MRFVAVLAVVLCALSFLNVAAEPEVTAKVYFDVMIDSEPLGRIT
                     IGLFGKDAPLTTENFRQLCTGEHGFGYKDSIFHRVIPNFMIQGGDFTNFDGTGGKSIY
                     GEKFADENLKVKHFVGALSMANAGPNTNGSQFFITTAPTPWLDGRHVVFGKVLDGMDV
                     VLRIEKTKTNSHDRPVKPVKIVASGEL"
     gene            complement(<51365..>51925)
                     /locus_tag="LDBPK_060130"
                     /db_xref="GeneID:13391648"
     mRNA            complement(<51365..>51925)
                     /locus_tag="LDBPK_060130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858273.1"
                     /db_xref="GeneID:13391648"
     CDS             complement(51365..51925)
                     /locus_tag="LDBPK_060130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858321.1"
                     /db_xref="GeneID:13391648"
                     /db_xref="InterPro:IPR012816"
                     /db_xref="UniProtKB/TrEMBL:E9B8M4"
                     /translation="MPSSSKKQNVVTFSEVHDPLYGVLSPLSPSPLVVRHVQYPSLHH
                     YFLCERFKGSPAEQWMAEATTVWSLERLVKTAEEEGYQRHNWNKVKVDVMLLGTYFKF
                     KQNEAARAVLLSTQPSLLLYHTPTDDFWGDGGDGKGKNVLGVVNMAVRARLHSEEERQ
                     KQRPSASGRHSKSAAAKSTALPATRT"
     gene            complement(<53462..>54205)
                     /locus_tag="LDBPK_060140"
                     /db_xref="GeneID:13391649"
     mRNA            complement(<53462..>54205)
                     /locus_tag="LDBPK_060140"
                     /product="proteasome beta 6 subunit, putative"
                     /transcript_id="XM_003858274.1"
                     /db_xref="GeneID:13391649"
     CDS             complement(53462..54205)
                     /locus_tag="LDBPK_060140"
                     /codon_start=1
                     /product="proteasome beta 6 subunit, putative"
                     /protein_id="XP_003858322.1"
                     /db_xref="GeneID:13391649"
                     /db_xref="GOA:E9B8M5"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9B8M5"
                     /translation="MIEDHAEYGHNHYPQKLASSTLTLPKQGAKQQQWSPYQDNGGTT
                     AAIAGKDFVILAGDTRLNGDYCLHSRHDQSKIFQLTPYTYMASNGMQADRLQLQQMLK
                     YRVKWYQYNNGGRVPPTKAIAQLMSTMLYHRRFFPYYTFNMVVGLDEEGHGVCYSYDA
                     VGSTEPFLYGTRGSAASFLEPVLDCLINRQHMTAQAPPEMTKEETLAMLKNAFTGAAE
                     RDIYTGDSVSFFIITKDGVQRESFELRKD"
     gene            complement(<55037..>55366)
                     /locus_tag="LDBPK_060150"
                     /db_xref="GeneID:13391650"
     mRNA            complement(<55037..>55366)
                     /locus_tag="LDBPK_060150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858275.1"
                     /db_xref="GeneID:13391650"
     CDS             complement(55037..55366)
                     /locus_tag="LDBPK_060150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858323.1"
                     /db_xref="GeneID:13391650"
                     /db_xref="UniProtKB/TrEMBL:E9B8M6"
                     /translation="MLRRSSRLLVRLPKCRRPRERPWEIFNVRDFGYHEGSQNYMMWL
                     GTAVVFTSMLAFEVYQQIQRVFQRGDTCSACEAARAHYRKRVEERERETEAQTRYSLK
                     LRKPHAS"
     gene            complement(<55967..>57331)
                     /locus_tag="LDBPK_060160"
                     /db_xref="GeneID:13391709"
     mRNA            complement(<55967..>57331)
                     /locus_tag="LDBPK_060160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858276.1"
                     /db_xref="GeneID:13391709"
     CDS             complement(55967..57331)
                     /locus_tag="LDBPK_060160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858324.1"
                     /db_xref="GeneID:13391709"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:E9B8M7"
                     /translation="MLRKHRPRELTILDRVYEHISLPPLVVAAIDTPAFQRLRSLHQL
                     GASSFLYPGAVHTRFEHSIGVAHMARTLLLNIQHHQPDLGLSEVDIELGMLAGLLHDV
                     GHGPFSHLFEDVVSRRCGIEFNHEDMSEKIARRVLGDLVPQTHVDVVVGLMRGKALLG
                     ITYGEIISNKRNGIDVDRLDYFIRDSMCCFGKPTVDVRINRLFNSARIVCEEGQWQLA
                     FEQKLALSLREIFTLRAKLHKNVYQHQVTKAIGHMIGDVIHAAAPYFRVGGHTLVECA
                     QDETLFLKLGDWILEAIEVSEAPHLAEAHAILHRLRTRDIYRVAYSSSLDITMRAPMA
                     AVDWAAAILEHAHPSFPLNADDFIAEVVVINQGKGTADPLESVLFFNPKKPSQPLTRL
                     KPAEDLKHGSPLFTPLQFEERTLMVFERRPTNGAVQRACERLNADPKYAAFFTESLPF
                     YNTK"
     gene            complement(<58680..>59105)
                     /locus_tag="LDBPK_060170"
                     /db_xref="GeneID:13391710"
     mRNA            complement(<58680..>59105)
                     /locus_tag="LDBPK_060170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858277.1"
                     /db_xref="GeneID:13391710"
     CDS             complement(58680..59105)
                     /locus_tag="LDBPK_060170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858325.1"
                     /db_xref="GeneID:13391710"
                     /db_xref="InterPro:IPR005651"
                     /db_xref="UniProtKB/TrEMBL:E9B8M8"
                     /translation="MRLLTHNFLACLKCDTYPLHVTAAEMEEIPVEYDAEFTRRMLAR
                     VDYASLRTTFHALREAHELVRGLSHDEGADTAEAASASSELPETMEGADFSDHSAFLR
                     TVHYAMNVVAVRNGTLECPACKTTFAINDFIPNFVPEAK"
     gene            complement(<59596..>61584)
                     /locus_tag="LDBPK_060180"
                     /db_xref="GeneID:13391711"
     mRNA            complement(<59596..>61584)
                     /locus_tag="LDBPK_060180"
                     /product="kinesin-like protein"
                     /transcript_id="XM_003858278.1"
                     /db_xref="GeneID:13391711"
     CDS             complement(59596..61584)
                     /locus_tag="LDBPK_060180"
                     /codon_start=1
                     /product="kinesin-like protein"
                     /protein_id="XP_003858326.1"
                     /db_xref="GeneID:13391711"
                     /db_xref="GOA:E9B8M9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="InterPro:IPR028763"
                     /db_xref="UniProtKB/TrEMBL:E9B8M9"
                     /translation="METEMAPAPSASPPTQLQGDCHMRDTGGTKSSYSEVIRVVTAAG
                     RLTRPMSSPYMLEVLRPPAGGAGHGRSAHRPSMPTRQSPPHSLGNGGGGGGGSSETAR
                     VYAFDYCAGPSTTQEEFFDMLEMPALCEAALAGEVVTVLCFGQTGSGKTYSLSGRTLP
                     APATAGPVSDAPTPLVAEDGLQYQAVHYIARRLKELRRTSRKLKSKRRDSDGAGKGSA
                     DRGDDGGVSGASVGASASAATVVTAKCSYVELYQESLYDLLQPDGGDGVRCRWSAAAS
                     SFFVEGSLMVECRGREDFLLVLREGQRNRQRGSHALNLDSSRSHVVFTVFFEVRDEAA
                     AATSAEGVDSDGAPSSSPPPGASAPLSSIRYGRLVFVDLAGSERLKKTLSASNAEAGS
                     INKSLFTLGRVLELLSASPPAPSDAMPPAKASTQPPPFIPYRSSVLTQLLMHSLDGHG
                     RTVMVACVSPSALHLEESLRTLHYAERARHIRATPVVHVDAATQARMALEEKVQELRK
                     ENALLRRALGLPRVGKLQDGQVEARLEELHRAWAAAQFATPPHEVPPRSAAAPPRLSS
                     TPRKGSPPQQRRATRVSPSRPAVPFVSNGATAASGAVDLRTSSPQTVVMSSTESEADD
                     GSPSATGNADLPSSVPRAAAVSILDLLEALPDTRSMHT"
     gene            complement(<63162..>64925)
                     /locus_tag="LDBPK_060190"
                     /db_xref="GeneID:13391712"
     mRNA            complement(<63162..>64925)
                     /locus_tag="LDBPK_060190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858279.1"
                     /db_xref="GeneID:13391712"
     CDS             complement(63162..64925)
                     /locus_tag="LDBPK_060190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858327.1"
                     /db_xref="GeneID:13391712"
                     /db_xref="UniProtKB/TrEMBL:E9B8N0"
                     /translation="MLDRSCRGGATSTLTNAEAGAFYLTALVAQALRLEDYWVHLGHQ
                     IEVDQHVEFIQYCAREGFGALKTMHLLNWWRQYRSLVRGDADVSAETPIAPLLLSDGN
                     PQRNIPPSHFHSGNASCGSAGGGEHGSAGGSALSHGKEGSGGRASKKGRRLSAITAAG
                     ATPSSEQDDLAGTVASLAAAVPTPLLYATHAEALHGELQRFVQWELEHEWAWRQVPRE
                     PVVSAAVALTQPRSTSLSGGPMRSISGMTAAGVAKPSRAEKAKLQQLQQQEMEAEEQR
                     LARVAAMPPENIFLTKDELDGFLQFVVEEDLLSHTALHMCVTSHAQQPMSTLSPSARA
                     PVCFSVQVETPMPVLPLRDATRLSALQRSSCSGNISTLSATRDEVAGGDATVGGAATP
                     QQSPRPTSASGHGKPVSGRPRTHSKRAIRGASKDAAAANAAEAAAAATSNLPAAPELT
                     VPPTAMETLRAEQAKEAAAYRAAYEEELAQTAAHQRAEQHAADIHLFFEKPRTNEAVQ
                     AVYASIEDALAARQHRILQRVVALERALGLSTPSAESGRLDCAGATPDGSGAAAATLK
                     PTTSRGASSSSGSTPGKRKTK"
     gap             66796..66894
                     /estimated_length=99
     gene            complement(<66972..>68462)
                     /locus_tag="LDBPK_060200"
                     /db_xref="GeneID:13391713"
     mRNA            complement(<66972..>68462)
                     /locus_tag="LDBPK_060200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858280.1"
                     /db_xref="GeneID:13391713"
     CDS             complement(66972..68462)
                     /locus_tag="LDBPK_060200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858328.1"
                     /db_xref="GeneID:13391713"
                     /db_xref="UniProtKB/TrEMBL:E9B8N1"
                     /translation="MAPRTGPRVKVISPNSEAVTVPRSLSVASSAYSSGHVTPGPASL
                     LRPGFRRGEPRRGGDEMAYGGRPEAAGAALPSRRTALRAMGVNTLHETGPSHGKSAPC
                     GLAPSPAQTVTRTTTTTTATASGSDSGGNRGKDAHPRRSLPNFFEEADFSNNSGAERR
                     QWPLKMSTSRSHSTSHHANASAVKQRQQPTSRRRADDEEAVRRATAALEHAGGAVLRR
                     PFSGGHATSDKGRAATSALGGNTSSLPVQQPERRGLCLPPTIPITSHTRRHRSDYSDY
                     SGNDSSMDSTVSSYKRARSWAEPPPLPVQAASQQPTPTSRPSFYVAQPAAESAAQRLT
                     VPRVCPGMFAGLSAIPVGEELFVGADALHPNCTSTVCAAPVMDAVAASAAGGGLAQQR
                     YCVRPLWSLVGTFKTSLSGLVTIDLKQECLRWSQRNPKGGKQTIKVPLASVLDVFTTR
                     VVQEDEHIEERQYTVVARTSTRPSQVVFGFATATEANHLRNVLKRR"
     gene            complement(<71038..>73041)
                     /locus_tag="LDBPK_060210"
                     /db_xref="GeneID:13391714"
     mRNA            complement(<71038..>73041)
                     /locus_tag="LDBPK_060210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858281.1"
                     /db_xref="GeneID:13391714"
     CDS             complement(71038..73041)
                     /locus_tag="LDBPK_060210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858329.1"
                     /db_xref="GeneID:13391714"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:E9B8N2"
                     /translation="MANDVEVDFVLVRGPWSLDRRMRVTLPSNGTPVTVGRATHCAVL
                     LDPSLLFSSQVQCSLFAMQVKSVATAPSTSTATTATETPMTADASSTPNHACAGGTAP
                     HCEDTPIDAADTLSTPRHQPTLRDGGHVDRTTRVYITDMCSSNGTFVNGIRISGTDPT
                     ELNHGDVCIFGGMRDVAVGEALPPDAYDGPELVQWRVDLRLSAERPPETFEYTSTPLV
                     LPARGVLEVEERALLDTAQRSLAKPMPSSMRTPASATPAAATVAAVVEQRSLDPAVAG
                     SAAHCLTAFDIRCDTSPRGVPQQLFTSPISHEKDATREAAEEVEEAQKPSSSGRRSVS
                     LVASQDARVTSMEAVEETSGVEDTADSIHTPLADPVAIAVPAEPPAAVVYDAVRLGNV
                     SYDARGVAREERDLEADADADVDRDVESATPSGKQRRRDSPASATPPKQKRVRHEDAA
                     VVAPTQLTFTPMHIKWTMPNPNEMWSRLQRSPSDKAAAAAAAPHDSGASGRATKPFYV
                     MLPVTSLATVVVCPERLGIAVELKDGCQLPLVDAAVLSGSAESRWVVWELSQRTAAVP
                     VPADEARSSGRGRSKVTKGNARRACKRTEKTPSVAAEPTHTATADVEKSPLTPAARFE
                     AWLMHFKLYYAAQKVPAPVVVDGAAFDVILSPSLAAPSSAVSA"
     gene            complement(<73933..>74793)
                     /locus_tag="LDBPK_060220"
                     /db_xref="GeneID:13391715"
     mRNA            complement(<73933..>74793)
                     /locus_tag="LDBPK_060220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858282.1"
                     /db_xref="GeneID:13391715"
     CDS             complement(73933..74793)
                     /locus_tag="LDBPK_060220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858330.1"
                     /db_xref="GeneID:13391715"
                     /db_xref="UniProtKB/TrEMBL:E9B8N3"
                     /translation="MKHSTVAPSSSLELTKKPFLADILRKAAERLCHKQLWRVASQLE
                     RFPSPASADMVRDALRDISVFLSDEDYAHMCEAYATGATDGQQGCRMIDTSALIESLS
                     TASLTSRRKHVVDLVIRKLDPKGTGTISYMTLSDHYDVLRHPEVRNGARSEDDVLLAF
                     FDNFCAADGTPMVQLTAAEMRMYCVGVSMRIKDDTDFELWCTRAFCLDRPKLDQSQAT
                     VQLTGSRSHSRLSRLLGEGRQHPLYTTTNEEYGKESTPSDYKLPQHGRPQQFTRNLKQ
                     RTGGATSMNM"
     gene            complement(<75484..>76125)
                     /locus_tag="LDBPK_060230"
                     /db_xref="GeneID:13391716"
     mRNA            complement(<75484..>76125)
                     /locus_tag="LDBPK_060230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858283.1"
                     /db_xref="GeneID:13391716"
     CDS             complement(75484..76125)
                     /locus_tag="LDBPK_060230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858331.1"
                     /db_xref="GeneID:13391716"
                     /db_xref="UniProtKB/TrEMBL:E9B8N4"
                     /translation="MGIILNMSVHGLMIIPLAAMVKGHNISLRRLAKLSIVMAAVQLA
                     QSTITMAVPPDVVVAQVCVQGALLPLVTVAFCFFILNDAKAAKVMHLHDCGDGDTGAA
                     VATMWCLCYTVLFRWFPWYHSMSSRGFEAANLACGAEAYLTLITMLAMCRSFTTGQSV
                     AATAAWGLHAIGAVVGAASGMPMAGTVLMTALMTAASATVFRAPAEGRGNKED"
     gene            complement(<77218..>79761)
                     /locus_tag="LDBPK_060240"
                     /db_xref="GeneID:13391717"
     mRNA            complement(<77218..>79761)
                     /locus_tag="LDBPK_060240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858284.1"
                     /db_xref="GeneID:13391717"
     CDS             complement(77218..79761)
                     /locus_tag="LDBPK_060240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858332.1"
                     /db_xref="GeneID:13391717"
                     /db_xref="UniProtKB/TrEMBL:E9B8N5"
                     /translation="MHVKRHNAKLMEWYDAQLGIQLPFSPVFELKQEERQAPLILLTF
                     RTVREPTHRMAVTIEELYEPQTAAAYREASLGRIADCAKIVGQSTARIGSKDHPAAEY
                     CYVDDHRVMNCVFSIFVVHERLAVTVQYVAPTRVRSVMPTAVYDIVRFLAFATPSPSP
                     SYLLVSEPRLGLGYHLPLDFLVHEGLAESDGVEDRLFTSSMTAGGGGLLSTFSGGINA
                     PQPYTRGTAGADGAAYPPYCRPSYYYVGHGGGGCDEGAWMVPYATAMSRGGRRMGLIA
                     SYEPAGVSTATGTLDGGGAAGATGGSGVPYAWQTYLEQQVCKAVRQLGLVLGSSDDNR
                     APHVVFQAPNAAHPPSRQTLLVEPYPLSIALKGNFSAGDDTREEDSDAVALVTAFSLF
                     REVRVDVNSAYLTLVPDALESAAAAAAAARSRSSTGVADLTAGTVKAYWSAFYVPVGT
                     ACVSFHFIASALRHTSTEFVSFCATVMNSVSLGNHYGQSVSVLYCNIRHDVLPFRLSL
                     PPTGMATVEEPMLADPLCVVQATYGVEKVGVTVRVFPLFTSTTSPVEDGSSGGGGTGF
                     AAATATTDGRPPTPSKALPPRPIAERRGTRQRSIFRQLQHMIRYYLAQFPGGVHIVSQ
                     ERTTMNAMPAVRVCFKPLWYAGDIGDGGAQRIGGGSGSAVPPAPSVTSWDEGCGVGGG
                     GGSSQVTSDWVGARDALLEEEIGQLNPFAQYFPPPPPPASYLWGQQQQPQPTPASSGT
                     TGKASTPVTAASLRKAAAAAAAGAAASGGAEASTRGDQESQPFYGPRGDESQRSQEEL
                     DDPLRVAIVVCCEGNAFLFQASASEYTLGMSVQAVQTLAMYLAPIPRGN"
     gene            complement(<81669..>82505)
                     /locus_tag="LDBPK_060250"
                     /db_xref="GeneID:13391718"
     mRNA            complement(<81669..>82505)
                     /locus_tag="LDBPK_060250"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858285.1"
                     /db_xref="GeneID:13391718"
     CDS             complement(81669..82505)
                     /locus_tag="LDBPK_060250"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858333.1"
                     /db_xref="GeneID:13391718"
                     /db_xref="InterPro:IPR026157"
                     /db_xref="UniProtKB/TrEMBL:E9B8N6"
                     /translation="MDPLAGLTTESRNVIDNFFRWSRLSLDKFKRDLTVEASAFQAGN
                     LWREQYTKAEVVQMLNGQLALMLGVVDTQMEGTTAASAELMRAVLREADRQRLTLDID
                     VKSVLNNAGGVNAMGEHGRQLMSGPTGRLAPLTVEEASGEAARQLAEANAEVKRLQAK
                     LQQVTDAYTQVMRGRSSDTENLLSMQDAMNDKERLAAELARRCQGQDPSLVATVQELR
                     AEVAEAKRELAARLHQSTQYQQVKHLLAQRNEQLKMMRERLAAYDPSFARYGDDINAE
                     DD"
     gene            complement(<84299..>88798)
                     /locus_tag="LDBPK_060260"
                     /db_xref="GeneID:13391719"
     mRNA            complement(<84299..>88798)
                     /locus_tag="LDBPK_060260"
                     /product="5'-3' exonuclease, putative"
                     /transcript_id="XM_003858286.1"
                     /db_xref="GeneID:13391719"
     CDS             complement(84299..88798)
                     /locus_tag="LDBPK_060260"
                     /codon_start=1
                     /product="5'-3' exonuclease, putative"
                     /protein_id="XP_003858334.1"
                     /db_xref="GeneID:13391719"
                     /db_xref="GOA:E9B8N7"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:E9B8N7"
                     /translation="MGVPKFFRWAAERFPSIITPFKDSPPPVDNLYLDINGIIHNCTH
                     PNDVDATRRSPTEKEMIQAMFVYLEKLFNAIQPRKYFLLAVDGVAPRAKMNQQRQRRY
                     RAGYEMMIAREEALAMGEEVPEEKDVFDSNCITPGTPFMVRVSKEFQYFITMKLSTDP
                     AWQGCQIIFSGHDCPGEGEHKIVDFIRRRKMQPNYDPNETHCMYGLDADLVMLALATH
                     EPHFVLLREVVTFGPGSRKERERQEEDEAKGLVKDKAYHKADEFVLLHINVFRDYLQL
                     EVKGYLAKAKSSVSIDFERVIDDFVFMCFFIGNDFLPTLPTIGINDGSIPALLHIYVD
                     NMLSKSKYLTHKGEIDWRNAEVWLNEVGKLEFETLRRRQQEEAEFQKNRARRDPTHEV
                     DTASVIPITSILEFKQRYYGEKHGFAGGWDANSEDMQRLREHYVEGLMWVMHYYYQGV
                     PSWKWFFPHYYAPMASDMVNLPAIAARVSFELGKPFQPHQQLLAVLPPMSYLSMPKAY
                     WPLLRSPSSPLAKYLPEHIVIDREGARAPWEGIVLIPFIDERTLLAAYESVQKNVSPE
                     DAANNVNGPPLRFCYDGKMPPYDLEDEMFGSLRNVLVRRETYAFPHIDKFIPQLCPGV
                     HVGTRQLEGFSTLQSKRDLIQPVFEAGVVSIFGRPTKNDSLILQMRDFFKAKSVDQVA
                     TLVGKEVLVGFPHYKRARIASLKDVHKSITASYSKEGTFSGTEEHKNNREESTAFVKE
                     ADTHARFMKSQLGLAVEQVEVLVYVHRFNGMQVTRKGHIERHFATTWTCYPIQLICTL
                     DNIDMQEDSRYVERDRSEGDSAFGARCVYIGPQPKSKKSQMDVYGSCGTVVTAGQHDT
                     TTQQGDQMTVRLKVFQEPLRLPAELLQFAAQRNWTALPQVAISLDILPHTLTSICSSI
                     VTSPQFGSRELGLCLKFTGRCIAKVGYAKLVQHSLNPWYVGNKDIFARMEKDTEDIGY
                     HLEMGEKGDFTGNSSSNRGGSGTWYFSRDAQELIRDYVKRFRPLIQYIEAGGVNSNSV
                     EPQRFLTGKWRDRDVDDVLTEIETFLIESGLRETPMITATEEAFPQQLLEQLEASLQE
                     QQNRSFKELSLRQVSRNQLYFPVTRSSCGHLVPLPLPQEQTFYLGSRVANCRATGIVP
                     FGTQGTIVRLLASGREAEVVYDTPFTGGTRLDGRLKDTRAAITKLSALLVLKSTDAPQ
                     PQLQPQTQPDMRAAAAATTNGSAKLRELEFLLQANGIHVDPSGKSTVSPPSLPAAFQS
                     PTSAAARAAPADSGASHSSTAGAGASVVPRPRSAAATEQTPAPATLGKRATPASATAH
                     LSSTSSVTPITRETHSSPASLKITAAPGSSGISLQDLAKHLPASTSQRSPATVASPAG
                     HAPASGAVAATTAAALSGITIPAPKSAQQHQHPMQPASPPATTAVASPSQSNESNETS
                     PGSNTRRKSRDLHVIPDDFVSGRFKIKYTNTGSLFRSWLDTFTAEAVRKTLAELEAEG
                     NANPL"
     gene            complement(<91164..>92102)
                     /locus_tag="LDBPK_060270"
                     /db_xref="GeneID:13391651"
     mRNA            complement(<91164..>92102)
                     /locus_tag="LDBPK_060270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858287.1"
                     /db_xref="GeneID:13391651"
     CDS             complement(91164..92102)
                     /locus_tag="LDBPK_060270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858335.1"
                     /db_xref="GeneID:13391651"
                     /db_xref="UniProtKB/TrEMBL:E9B8N8"
                     /translation="MDSTYREPSSAAVPTSYAVLSLPSKATMRRKGYNPDEANYNGGL
                     ATHPLATWKTFSLPDGCTYKDAVSAVQTANAKPWGPIKIRLNFSDGRYEQFERVAPSV
                     MDSLQSTTTYSPNDVFKAETLSLSTMRRTQQQPRLRPLVDKRGHHLSSKPIPRTFAPE
                     ELYKNCPPPVLCQPGYDFTPISYNTFLLNPQDPPHGVRNVQSNFMHSSCDYRPRSYLR
                     PEEATGTSHASRHCHCNEVFQVGDHTMDFACEGTTVDHRNRLVKKDYSPIGTSKASSS
                     IVGRRHACKPRFGCTGVADSETVAAAAAPAADEETA"
     gene            complement(<92808..>95375)
                     /locus_tag="LDBPK_060280"
                     /db_xref="GeneID:13391720"
     mRNA            complement(<92808..>95375)
                     /locus_tag="LDBPK_060280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858288.1"
                     /db_xref="GeneID:13391720"
     CDS             complement(92808..95375)
                     /locus_tag="LDBPK_060280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858336.1"
                     /db_xref="GeneID:13391720"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:E9B8N9"
                     /translation="MWVVLFHDTPHFWLVGGESYRVGKANCHVVIQDDRSISRTHLTI
                     TVGLQSSTAARDAKEWAPQPISLLDSSTYGTAIVACGEDADDAETLDDTPHNGGDSRA
                     GGAGAATSPAPEMGVLGFCYAPAAAAAAAAARKRQRSGSTSGRGAPQPALHLNKQVPC
                     HVPVHRSSWHQFTIYLGHHGAALKLVWLDVSALCEDVDAEVQPKLLHALHCCGVRQET
                     VSGSTQALSAAETQGSAVGRSRIDGSGLSLSQRSAVAGTPSATPSPTVVTAAAAAAGE
                     AALSSRVLRCYNTVSFLVTSTVQPSTAVVAMLCRAVPIVTPDFFMAVCDRASPQIPLP
                     DPSRYLPPLSSWWRDFLTHVRPSAGESRPCEGDASVTASTLTHLSTTVTSVAGESAAA
                     AAAASHLRYFAPHPQRRELLSGITFVLLQYPLYEEVLSYLDGTGARVVWEDGGIGGLS
                     APLCASTSSSRAALEALQSFFVRHQRHVLLFNETEPLLPWPGCVDFVRHGLSLCSVEY
                     GTLIEAIVTMRPLPLPPYPADVQMPQTFEEVEARVAAATALVSTPPAATAQEAAEEHT
                     QDSDEEGRRTDAQPLFPELVQGSDAGVGRGDMRDTRVHRRPRKEDVDGWVSFERPATI
                     APLPAGLSTDNKPNGSAAVRTVELLVGPYSLPPYPCFEDASAASADASATAAAAVGFA
                     RGAKLFVKQALPPPEPLVELEEHRPRRQLAASMLTARVPTVDAENVVPEQVVMGNGGL
                     ASRVAETTNPAFNTFDTVAHHASSRRRGTTARRGGRGGGASAAAARTPANRLPRGGMA
                     RAASRRPADNIVLAEDEEDMTTGSVGATATRVGRGGDVSASAADSAAFHIFDIDGIF"
     gene            complement(<97538..>98290)
                     /locus_tag="LDBPK_060290"
                     /db_xref="GeneID:13391721"
     mRNA            complement(<97538..>98290)
                     /locus_tag="LDBPK_060290"
                     /product="ribonuclease H1, putative"
                     /transcript_id="XM_003858289.1"
                     /db_xref="GeneID:13391721"
     CDS             complement(97538..98290)
                     /locus_tag="LDBPK_060290"
                     /codon_start=1
                     /product="ribonuclease H1, putative"
                     /protein_id="XP_003858337.1"
                     /db_xref="GeneID:13391721"
                     /db_xref="GOA:E9B8P0"
                     /db_xref="InterPro:IPR002156"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:E9B8P0"
                     /translation="MSTSLSAATPSTTASKPLATTTTTSSPGAFEVVYVDGACSHNGT
                     SHARAGYGGYYGSMSDPRNFSCPVPLTESQTNNRGEVRAVIHAIVQAFVDAGAPADAL
                     EATHLVDPSAWPLVNLTRPLPHLIIYTDSRYVIDGLTRYAKKWVQNGFLLSTNEPVQN
                     QDLWRQLIRLRDRYNTLYARQQHDQQRARQWGDGHRNEADLAEPVRYTCQNTLNDKSE
                     GVELIHVRGHSKVHGNEIADSLAVMGSRLHRS"
     gene            complement(<100566..>101075)
                     /locus_tag="LDBPK_060300"
                     /db_xref="GeneID:13391722"
     mRNA            complement(<100566..>101075)
                     /locus_tag="LDBPK_060300"
                     /product="MYND finger domain-like protein"
                     /transcript_id="XM_003858290.1"
                     /db_xref="GeneID:13391722"
     CDS             complement(100566..101075)
                     /locus_tag="LDBPK_060300"
                     /codon_start=1
                     /product="MYND finger domain-like protein"
                     /protein_id="XP_003858338.1"
                     /db_xref="GeneID:13391722"
                     /db_xref="GOA:E9B8P1"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:E9B8P1"
                     /translation="MVLHIYHAAVGEKEFQFSTNINKLTQETYELDVNEAIEEVSSTI
                     LEQLTDEDALCCVCKAAPATRLIHHTMLFAETFPPRVEDLPQPVCNSANCEVVAKSRY
                     LMDMEDATTAQGMPSPNGCFHCHKGARGAATTSVPLQRCSRCKVAKYCSVECQKADWK
                     VHKQVCTPG"
     gene            complement(<104934..>106967)
                     /locus_tag="LDBPK_060310"
                     /db_xref="GeneID:13391723"
     mRNA            complement(<104934..>106967)
                     /locus_tag="LDBPK_060310"
                     /product="folate/biopterin transporter, putative"
                     /transcript_id="XM_003858291.1"
                     /db_xref="GeneID:13391723"
     CDS             complement(104934..106967)
                     /locus_tag="LDBPK_060310"
                     /codon_start=1
                     /product="folate/biopterin transporter, putative"
                     /protein_id="XP_003858339.1"
                     /db_xref="GeneID:13391723"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9B8P2"
                     /translation="MAANYREDREKDNEFNSRLRVNLSAIDDIDNVNQADDKPDEAAG
                     EEGHYVHPDARALFEKMPCLERIPIFGKSCQGYGPRCTFSLGLVYFLNKGVGYSLINY
                     ACFSMFTSRFGVSGVRYQRLASIAKLGFSIKAFAAMTSDSLAIFGYTKRWYCAAACIV
                     GAALTVGYGCLPKKESSADIAAGFIFLTSFCIANVDILSEGHYSRLMRRRPASGPSLI
                     SWIWWFILSATIVGAVIQGPLSDKELPQVGLFIAAATQLLSALFFVWNWYGEGTNREE
                     QLADALTLKRELNRALRERQLVSSFRATGSGKEEDGKADSGLDKPVSAEAAAYYNAEG
                     ELNGDFALDTLHDGGETAEDEAPALNIVSCCGGIVEINKGVCMRNWRIFVYSSLMACS
                     VITMMCVTILGTRWQLLYSCIAVVLACGACAFWALPFLIAKVSIYFFSYAFLYLQLPG
                     ALDSFYMASKECYPEGPHFSYVFYNTIGAVIGNLAGIAAVAAFPYLFSKHSLRFTLMF
                     TYFIQVLASAFDIIIVKRWNLYIGIPDHAMYLFGDAIVYEVSYYLAWMPTVILLSRIC
                     PRGSESMVYALVAGFGNLGASMSNTVGSLLMEFKWPITTKGACDFSNVPMLLLIGHIL
                     LPMLIVPLSFVLVPAARICDDIDVNGNIIEQKARSLHRKQRREPGEPINELPP"
     gene            complement(<107909..>110983)
                     /locus_tag="LDBPK_060320"
                     /db_xref="GeneID:13391724"
     mRNA            complement(<107909..>110983)
                     /locus_tag="LDBPK_060320"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858292.1"
                     /db_xref="GeneID:13391724"
     CDS             complement(107909..110983)
                     /locus_tag="LDBPK_060320"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858340.1"
                     /db_xref="GeneID:13391724"
                     /db_xref="UniProtKB/TrEMBL:E9B8P3"
                     /translation="MPASQCMRIAAYHVSTNEADAEELYASTISTDHCSSDDERAPDL
                     EVEASPPQHDGSTDVEEVRRDVDASYFSDYAGEARRDEQAALPPPPPLGSEVEKEGDA
                     CSRKLLPHLCSDDNGAQVVTDVVAEGDADGLCDVDYESIMVSHRKDSFPAPALTLDAA
                     GHSAKIIGPSPPLKSGGGRRNSWLDPLRALSTPYSKDAAAVHPKKPQLPEDVLIRRQV
                     LPHTPARTSESRFERRTDALPYHGGSSSVMERGGTAAPSPPPVSELNGAASCMADQGA
                     RGYRRTNYASSSRASTLATIDAVHVLPLTDVLTNGNHKGCDGGKRASAATPTTPPRVA
                     PRDCDARVSFSPDDTSAAANSPPPRPITVTATPPAAQQPRGKDTRTPTMLPALETTAL
                     MGPRTRVVRDRPPRGVPLILQCTGHYPTPTRTILVDDTMMDDDEGDGEDTVTAGLHTS
                     VYKETGDRSDLSYSSSVSVEGVLLLRGGGQGGRCGRDASNCSPTPSPGVLHGRTCPVA
                     RSGSPLVSLTDAQFIGGDPATVAYQHPEPEPHHHDLDASPSLLPPKTWEEEEEVDAVP
                     DLIDFSVQTEELEPSRQDESLILCGYSVEPICASRGASAPPEARPRHRVPPCQPFFKS
                     SAIGATASAAAFSKKGREGCAASQDVEQLQVEGEGAEEDWAWPRGEASWLPQTSHLER
                     EAVQTVPREWLPRTYTHQPSREAYRATGFDDDLPQTSTPSLHDVRYLVESVQEAPAPG
                     RGFHPPPRIIDVPCEGAEVRGGRNSTLSFRKSRHVNNSVERVQATPLSSSSATRFDER
                     SSLTLQRERRNALHTLLARQMRSPSSSRCTTTSHEYADARVSVRSARLIAPAADYVAM
                     QEQLRGQRLAAEEERARLSLVLDVCEAVRPHARDLLLMFLLLVEESNMRRRHRRRGQV
                     QRRSNPTSDHGTAYSSHLDSSVWEESRVTYGMCAEAVNCVLERHGVTRVRATRELCRR
                     VVAWCKHHHSGHSLPTQGASLLDSLRGTADDASVEYATFVSSVMEFAEQYPG"
     gene            complement(<112445..>115999)
                     /locus_tag="LDBPK_060330"
                     /db_xref="GeneID:13391725"
     mRNA            complement(<112445..>115999)
                     /locus_tag="LDBPK_060330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858293.1"
                     /db_xref="GeneID:13391725"
     CDS             complement(112445..115999)
                     /locus_tag="LDBPK_060330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858341.1"
                     /db_xref="GeneID:13391725"
                     /db_xref="GOA:E9B8P4"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012317"
                     /db_xref="UniProtKB/TrEMBL:E9B8P4"
                     /translation="MPPWPILVTIHNLVNVPLSACENGLRSFVVEAHMVLRVSAYSAP
                     VATATFTTDDVVSTTPNLFEVRFDDAARCTSDGDGGGPKVWRCAVPELEVVVVVREIT
                     RSIRGSSSPYRPGRRADGDLDGTRVVGTSAPLPLNAKDIVEVHKLTTRIVGTEMGQVG
                     LSFTVDPGDKAGYRHRLESFLRAYNPQGLRLVPNVVEVVSELDTFTKLYRRYSIQNYE
                     ERLASFFDVYGPQYKSEIPSLLRQWEGREEELMRNLVLDNGPEVTTIDQHQRLTAYLA
                     AYQLDQNSSGVQEIFAAHAGEKEASIPAGLFSALVERYGPEPDPRTYLFATPRYTPAP
                     PSPPRTREVPVGAGSHGHSHFSLHHGSPSLARSSAGASAAAAAAPQRCPPTPAPERPY
                     VSVPMFPTPIPNREAPLETARSLDRSPSFAVDDGAPRGGEHRATVAGDRHETKPVITP
                     KDQVIVPGTTIGASRRDVTALRDALWRKMCSMMQTRQRHSKPWREHLLFFLDQDEFAA
                     AVRALHVFSEAPDGGEVQVLVEEWTHRLDHAFRTEALGSGDAYYAAAVQEAVRLTRLQ
                     PLHLQVMSVSSLFHKEQYAGFVAYVEGQAKRAKTERLVLVGGWKNLMDVARFGLRAAA
                     DPAGRYGDVLASSLATVHDASATTGDGPFIFLREPFRHCTEKHSCALLVCEVAVGEMY
                     SCPTTVHAPRRSAADFLAKYDSCAYVDQANGPVVAVYFRQQVLPRLLLQCVVDPQLQP
                     CPAHPDRPVEYYVMENHAFACSRCVVMGAYKGKEVAPIEEAAVMARAGLAEVERMVSA
                     LKESMLAYANQLQNEESSMPTAPRRVEAEREIDRLQKETEERVRRIRRQVQLEDEAQL
                     SRINAERTEVQATLEAVDGLGEKLAFAMQQRTPVAAVNALQHIQQERQVEQLMARAQE
                     RVPSAPLELVLPLDGPPPALPPRSSPTSKVRSKGSPVVVGLNESRLPEASADDGRESR
                     VPGSAAPHASRAPSTRHTKHASPPPSSLYAQYLAIAGADGKRAVAEGSSRIEQPSLDR
                     STAVFASRPRPVPVPASDDSDGGGEMSALSAKEALTRGWALLRRGDVAAAHRAWTAVC
                     RAHGTNDVMGTKAHAYIAEAIEKDYAAAAQWYARSLQLDPQDRMTAYNYGVLLEALLD
                     KPQEALRLYDRAAALGDAVAGARARELRSRLAASTSRQ"
     gene            complement(<116735..>119452)
                     /locus_tag="LDBPK_060340"
                     /db_xref="GeneID:13391726"
     mRNA            complement(<116735..>119452)
                     /locus_tag="LDBPK_060340"
                     /product="oligopeptidase B-like protein"
                     /transcript_id="XM_003858294.1"
                     /db_xref="GeneID:13391726"
     CDS             complement(116735..119452)
                     /locus_tag="LDBPK_060340"
                     /codon_start=1
                     /product="oligopeptidase B-like protein"
                     /protein_id="XP_003858342.1"
                     /db_xref="GeneID:13391726"
                     /db_xref="GOA:E9B8P5"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002470"
                     /db_xref="InterPro:IPR023302"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9B8P5"
                     /translation="MAALFPWVPTSNLGYSLSRRVVNKWCPQLRSSYPLPMLDGPFPT
                     EKPEGLELHGETQKPDPFRYMEDLFDRNTQEYTKKEMQHFSLISSKFDFRHSKGRLWA
                     ELDAKVVVSSREGGYDKGEERIGDYVYFTRVVPGHDSNAIGFYRKRFGEVDLLAEELI
                     NPLFLQQHFGYKDCSIGICRVSEDGRYLAYTLSVEGGDRYLCHIRSVDNATLFHVIRG
                     TNIVSIEFGSGNQFFYTESNELNRPHRVMMQEIRPGILEPPVEIYRDDDEQFFVDVRK
                     TKDNKYVTITSDSKVNCNALVVPASFPVIPTPLKSFFKEGKPLEIAGKSGWNWLDHYN
                     GSFVMVTSDKGPNYRVVYIRDEVALAYGKEAEWKELVPHRDNVQIDDVDLFHGRIILH
                     ESHFAFERIQHIRVIKCDGGLDAAAQTPRSEDVVLHFPPLSTVTPGLNKNFRQKAMSF
                     VYSSLIQPPRDCVFNFDSDITPSQARLCASEALFTQRQSEHFTPWDYMWPYSIYRDVC
                     VSEDGTEIPITICQRRDAFIQEATDFEAQPNTPKHCLIYVYGSYGEVPSMHFQLAPYM
                     WMLRRRWTVAFAHVRGGGELPNWAQLGKGENKIKSIQDFIACCEHMVDMGYTKPELMV
                     AAGASAGCVPIAAAMNMRGCGLFGNVLMRSPFLDIINTMIDPDLPLSLAEREDWGDPL
                     NNKRDLDLLKQYDPYYNLNDRVTYPGMMISACLDDDRVPAWNALKYVAKLRQQRTRKD
                     VDPVARPLVLRMRPSGGHYFWGDTENICEELAFLCSQLDLEGPGKMLNDMDVMTHMHN
                     LTATGAMDHDDQQKVFLKWDNWERERIDYHVKLNSFNWEPNFRTVKARKEPFFWVPTD
                     SELDQKKVDEIFRAKERDARESVRSGAKLGSFGKATGRNLYREEQRGKP"
     gene            complement(<120205..>121428)
                     /locus_tag="LDBPK_060350"
                     /db_xref="GeneID:13391727"
     mRNA            complement(<120205..>121428)
                     /locus_tag="LDBPK_060350"
                     /product="NAD(p)-dependent steroid dehydrogenase-like
                     protein"
                     /transcript_id="XM_003858295.1"
                     /db_xref="GeneID:13391727"
     CDS             complement(120205..121428)
                     /locus_tag="LDBPK_060350"
                     /codon_start=1
                     /product="NAD(p)-dependent steroid dehydrogenase-like
                     protein"
                     /protein_id="XP_003858343.1"
                     /db_xref="GeneID:13391727"
                     /db_xref="GOA:E9B8P6"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:E9B8P6"
                     /translation="MPPKELNPLLSPEQKRAASQSYPPVPKKCVVTGGTGFVGTRLVE
                     MLVERGAEKVVCFDIVPKEKAIGVWDHPAIEYVVGDITSYSDVSAAIEGSDCVWHLAA
                     AVGPFHPHDLYRRVNYGGTVNVIRACKEHGVKKMIFSSSPSTRFNGSLFHRPNVDGLT
                     EDEMPKLPLERYMQMYAQTKAEGEMAMRESIDDDFWSIAVAPHQVYGPRDNLFLPNML
                     EAAGTGKLRVFGKGDNRICFTHVDNYCHGLIIAEKQLYKNSPYLGRFYIVTDADTHPE
                     PAAYCIFWKELDKAIVRMGFGSIMNKVHYPFWFLYIAALFAELAGWVMGTTFKLNVFN
                     VFVLTMNRWFRVDAAKRDLEFQPIIPFGDGWNDTIEWFQLNWLPKFKKQDHSSIAGIS
                     SGSQQKINIQARKDK"
     gene            complement(<122010..>123365)
                     /locus_tag="LDBPK_060360"
                     /db_xref="GeneID:13391728"
     mRNA            complement(<122010..>123365)
                     /locus_tag="LDBPK_060360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858296.1"
                     /db_xref="GeneID:13391728"
     CDS             complement(122010..123365)
                     /locus_tag="LDBPK_060360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858344.1"
                     /db_xref="GeneID:13391728"
                     /db_xref="UniProtKB/TrEMBL:E9B8P7"
                     /translation="MSQLQSQVKTCVDDIEDVLASSDSLFSNEVHNRLSATYQRFLQH
                     VWCEVPMNSADGSALATVSCMPIWELLNQHTSACVLSAAPEKAIAVQLLSSMYPKSKD
                     RRCVFQQPSCYGSNSQTAVPLSTHVPIQMFVPDNSSAEQNLEYVKAAQRILRIATVGN
                     YTDAKESASVASAVRTFINTVLPRCTLISHPGELPKHTRGEVHILWDSPTCDWSSGRI
                     FLLTLWCLLVAAEYLSLPEARNLSLFLCSSRWSTRLVELDGRKVSYSELLSPLLDICS
                     LCLSVNPRCVSASVDTVPLIDPRVMPFLMGSGIKEEHYEIGASFATEYSAKPATKGKK
                     SLTLRRAECVREQLMESIPNEIGFMGTSSSCRDFDQLAYLCRDCLFVPTTKSIASGIS
                     ASRRRDMLFNRKRTRSISSSDGPCFIPVKSAVTNMLEKTDTDALVTLERLCCKWREDA
                     A"
     gene            <129705..>131159
                     /locus_tag="LDBPK_060370"
                     /db_xref="GeneID:13391652"
     mRNA            <129705..>131159
                     /locus_tag="LDBPK_060370"
                     /product="glutamine synthetase, putative"
                     /transcript_id="XM_003858297.1"
                     /db_xref="GeneID:13391652"
     CDS             129705..131159
                     /locus_tag="LDBPK_060370"
                     /codon_start=1
                     /product="glutamine synthetase, putative"
                     /protein_id="XP_003858345.1"
                     /db_xref="GeneID:13391652"
                     /db_xref="GOA:E9B8P8"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:E9B8P8"
                     /translation="MKSMGDRHTQRSERGFERRHWVCVRMLRGGPATHESRCSFLGCT
                     WLLDILPHFCHSSFNHVLFFNRYKYQQVVWYPLLRLGDWLKAHCSSPTTDNAATVTTN
                     SITMSSSNKQTVRVTYIWLSGKDSHHDIRSKDRTMYLSQEHVAKHPKDLLANGVFPVW
                     NFDGSSTGQAKGLDTEILLKPVNAFPCCLPRTSSKIPWILVLAECYLPSGEPTRDNSR
                     ATARETFEQCPEEHPWFGLEQEYFIMGRDGRPYGWPAHGFPAPQGAYYCSTGSKSAWG
                     RKFCDQHYEVCLEMGLNISGTNAEVTPGQWEFQIGPCEGLEMGDQLTVARWVLLRLLE
                     EEGLDADYHAKPIQGDWNGSGLHTNFSTESTRAENGLEVIHQYIDRLSKTVSKDIVFY
                     GSENNERLTGKHETSKVSEFSAGVGTRCTSIRIPNAVASEGKGYMEDRRPAGDADPYL
                     VTSRLFASCIGLETPSLDLASPTHERDWMRNAFK"
     gene            <131970..>133175
                     /locus_tag="LDBPK_060380"
                     /db_xref="GeneID:13391653"
     mRNA            <131970..>133175
                     /locus_tag="LDBPK_060380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858298.1"
                     /db_xref="GeneID:13391653"
     CDS             131970..133175
                     /locus_tag="LDBPK_060380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858346.1"
                     /db_xref="GeneID:13391653"
                     /db_xref="GOA:E9B8P9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:E9B8P9"
                     /translation="MSQLLPRLFPAFLLSPTDTLVSFPSAAMIPQRQKPGGRVKRHWQ
                     KKKSLYDEYLADSGDSEGTGADEEREETFECEQYCVHMDVNILIQQTVQNIVQSVCLE
                     DPDGFAIFGDHELICFAAAVKHNSSIMSLQIRYLDVSDVSLIPLCKALEQHPSIRALD
                     LSGTHGGEGTSKALRQLVCTNPNIIFMRLEDTIVNPKDASIIEKATRYNSMSCPDPNN
                     NPFHLGLLRRMSAMDEEHKFHEQLHARPWLLGNGPSNQKRFKKTVLSTAASSHIGGEI
                     CAQFIQGRCPYGSRCKYIHPERTVALKNAVASSLYNRAEQSGGGDAVSTAFSTTSVSR
                     QRLQSRLRPPAFMLKKPEQCEREQENYEISMESPPAEDAPSTQPPVSSWWVMSVTVVC
                     CCVIIVAAL"
     gene            <134125..>136848
                     /locus_tag="LDBPK_060390"
                     /db_xref="GeneID:13391729"
     mRNA            <134125..>136848
                     /locus_tag="LDBPK_060390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858299.1"
                     /db_xref="GeneID:13391729"
     CDS             134125..136848
                     /locus_tag="LDBPK_060390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858347.1"
                     /db_xref="GeneID:13391729"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q0"
                     /translation="MTYCIPPRVVRRLCDSEWFKTEFLDKETGTVNHDLAVVSSQCRS
                     VGQASKHECAQLISSSFRPFIEKVLPLPASACDSVAVECGGCWFWETYRHALFGENVL
                     IHLGGSGISLAEDRLDAQVELRLRMCASNTLALPSQHRTKVLLHGSAKLEVVYALALS
                     VALHVAKQPLLEHGEGPQALVLCATKDQCDEIACALNEFCASLHLIVHNLFEPYPPMP
                     ADKRAEVVVATPPLWESLAKFMQHPNHARLGTASQNEGLEDLLLKVEGEGQLPPTYDL
                     TRWRPYNLTHVAQLVIFDVELQINMGFGTLLKHLLGLPHETFPVRCKLESSSAVGKLP
                     LSCQLYAVAGGDRFSVEADTVRSLLEAIRTNGRLRFNHGTAELSLVSPRPVLDSDEDG
                     RAPLSHGVRKRQRTEDGLGDRSGQERPWKANATTLRHGNGTSFEGILIRSALSHGRLL
                     ADFTAFTDFVSRVMQEASTFWESFESGICDDSGSHGTPSPASSPLTTGNKVRDVDRFP
                     TSAASASFLQCARVELALVCTNSANPGSHSCFAASETYRAQEVGVWVHSAPSSPASLS
                     SRLTLLFQHLNDRLNGELFDGSVVQCVLASDMARLPFTLSPITASATDGEGSRLVQQH
                     ELFCYGPNLMQPALLCAARKSGDEAAAAAAARNAERVETLSVVEELTAATKGAERSPG
                     CVPRCCFLSTPPHAGQAASSSRGSTVAPSDVSTVLVVRHVAPSSVALCGGERTTSSQT
                     CPPGEVKPLALYLLEECCQYGRVLSYYAYEATRTTVVDAVEDGQEAGGSDGAALAART
                     ETAMEQGQPLATEGQLTTASLFIEFASADSAVEAVRLLSRRFAFQHQQSQSQGAPARL
                     PRARLFTNRTYYEGVRQELSSKMLYDGTMGRDQSSDDDSRFSDLHISLLAE"
     gene            137231..137632
                     /locus_tag="LDBPK_060400"
                     /pseudo
                     /db_xref="GeneID:13391730"
     misc_feature    137231..137632
                     /locus_tag="LDBPK_060400"
                     /pseudo
                     /db_xref="GeneID:13391730"
                     /db_xref="PSEUDO:CBZ31624.1"
     gap             140186..140284
                     /estimated_length=99
     gene            <140610..>141347
                     /locus_tag="LDBPK_060410"
                     /db_xref="GeneID:13391731"
     mRNA            <140610..>141347
                     /locus_tag="LDBPK_060410"
                     /product="60S ribosomal protein L19, putative"
                     /transcript_id="XM_003858300.1"
                     /db_xref="GeneID:13391731"
     CDS             140610..141347
                     /locus_tag="LDBPK_060410"
                     /codon_start=1
                     /product="60S ribosomal protein L19, putative"
                     /protein_id="XP_003858348.1"
                     /db_xref="GeneID:13391731"
                     /db_xref="GOA:E9B8Q2"
                     /db_xref="InterPro:IPR000196"
                     /db_xref="InterPro:IPR015972"
                     /db_xref="InterPro:IPR015974"
                     /db_xref="InterPro:IPR027547"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q2"
                     /translation="MVSLKLQARLASSILGCGRARVWLDPNEAVEIQNANSRKSVRKL
                     IKDGFIIRKPVKVHSRARWRKMKEAKDMGRHNGVGRREGSREARMPSKELWMRRLRIL
                     RRLLRKYRADKKIDRHVYRDLYVRAKGNVFRNKRNLVEHIHKIKNEKKKERQLAEQLA
                     AKHLRDEQNRNKARKQELRKREKERERARRDDAAAAAQKKKADAAKKSAASAAKSAAP
                     AAKSAAPAAKVAAPATKGAAPVKKSKK"
     gap             141859..141957
                     /estimated_length=99
     gene            <143165..>143731
                     /locus_tag="LDBPK_060420"
                     /db_xref="GeneID:13391732"
     mRNA            <143165..>143731
                     /locus_tag="LDBPK_060420"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858301.1"
                     /db_xref="GeneID:13391732"
     CDS             143165..143731
                     /locus_tag="LDBPK_060420"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858349.1"
                     /db_xref="GeneID:13391732"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q3"
                     /translation="MSHMTADLEYFKCDMCGVYMHRDIFCDHRRDCHGLGSTQLKRGE
                     CQRIAEALGRETRELLLRKDGGGMRAASSSQGSTHTQTGAACTTTVTAGERKDLEAHA
                     ESTRYVEGAAAASSGHVPLSSSAVSSVRAGGAVPISLTLSTKAMEKRQEARTRRAVSD
                     RYQAGVDAKISSLLTEGKKAALLDFLNS"
     gap             144550..145358
                     /estimated_length=809
     gene            <147386..>149104
                     /locus_tag="LDBPK_060440"
                     /db_xref="GeneID:13391654"
     mRNA            <147386..>149104
                     /locus_tag="LDBPK_060440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858302.1"
                     /db_xref="GeneID:13391654"
     CDS             147386..149104
                     /locus_tag="LDBPK_060440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858350.1"
                     /db_xref="GeneID:13391654"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q4"
                     /translation="MIPALNMNSIHRHTTVAIPAVGGSGGTGLNSSGSGSGGARLATG
                     RQISPRTSYLTSTGETSSLPAAHLQRRAADVANVLEMNPLQCHSVADLQRKLIETAEW
                     VVKLRHWYTHQLQERDLWCESRLRGLEDSFHAALAASAAAGTAHATAGAGAVYTATED
                     SFTEHAAPSTISASRAVASGAPASSAIAATASASADKEAGSGTPLRHRSRAHKNSASE
                     ASEAGANTANSSHPVKRNQSSSAGTAAGVAGGGNSGDRCSSAPLRAGPPKRSALLPIA
                     QGRLTASAGSPGRQPLHPEDNEPPCTSVATTVIDRGESRPTLAARAVAVTTPVIVEGD
                     YDASGVPHHPSASPHPRGSRAGSLSLPSSAVRTQVNGIPAAGAIRLRRDVHSSRTPLS
                     GRPSSANALLLAAGAATESSGRFSARAGGSGGRRSDVAQSERRQYYASLSRTGSGSIN
                     ISVPHYAQYLDVSTSRNPIAAEVNTGNSATDVAAPAFHKTAPRFSNYLYLLTSGDDNH
                     TRKPKRRSLSSSGGRHASRVYTTSGAKQNAMGRGASSQNRKGTGNADASRHSSPTCFI
                     RQQSWT"
     gene            <150681..>152756
                     /locus_tag="LDBPK_060450"
                     /db_xref="GeneID:13391655"
     mRNA            <150681..>152756
                     /locus_tag="LDBPK_060450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858303.1"
                     /db_xref="GeneID:13391655"
     CDS             150681..152756
                     /locus_tag="LDBPK_060450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858351.1"
                     /db_xref="GeneID:13391655"
                     /db_xref="GOA:E9B8Q5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q5"
                     /translation="MDAFSRSKSYSQAASTSTPPPSRSGAAAPGSTAAQQQQHVFKNI
                     LKSVESHVRIMSAVERTATSSSYTSLRVRQPDSDGAGDSGTASSSSQGPQSSQSAGGW
                     SQPFNVTRVHRGGTTARFYEEVVAPCVSNCTSGQSYVFLVNGPPESGRSQTLYGSPHH
                     SELGIVELAASDLLERMASRGKVIMRNHRDRPDATGKENEAACGTQSSTTANSGREDV
                     SEVATTGGITVTYAAFTTRGGKMLETETGEPVPLVEFPPPLGLVPLPRMRLLEDASKS
                     VLLPERKHVDTSCVIQFHVYAPVDTTGRRSMATLTFVDVAAIREPLCKEVSHLIDTVE
                     RVAGVSTSGGDPNFKETRLTTLLEPVLVGYITLVSITTVSGRADLYESTCTALRFASH
                     LSRIHQVLMLIHMNAPRWIFDTAVNLEQLRMRRDQLMAEHYARGVYDCYQRTSRWLQA
                     NVSDVGGSVDDLLQETARLRKDIARAVEDIAKELQAAIEREDANCRAEVEAARTAYEA
                     TSQLFEEVRRLDEIITAQQQKISQTDMQSSQRISEMRLEISALEAKANNRQQQLQQLE
                     KEMRLYLLKSGEVAATLSKAAEDTQYAQSSYAMSHELLQIGRKRKRLEADLELASHVA
                     QRTTDTMRVDRERRSRISRLSAMQQRVHSLRDTVCCSTSNPTTAPSQHPQQPSQRAFS
                     AGSRSGQTQ"
     gene            <153990..>156968
                     /locus_tag="LDBPK_060460"
                     /db_xref="GeneID:13391656"
     mRNA            <153990..>156968
                     /locus_tag="LDBPK_060460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858304.1"
                     /db_xref="GeneID:13391656"
     CDS             153990..156968
                     /locus_tag="LDBPK_060460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858352.1"
                     /db_xref="GeneID:13391656"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q6"
                     /translation="MLHEGQPMYDTAPLSAFDTGDVAERDVLASVDNTYSPCHSSLST
                     RQRQQHQQRMLRHSMSGSGSCIAAVRCTSSLPVPQGSVGSNPLSPPAAAQPQLPFAPV
                     GAAGTADWGDHEHSIPQQLRQLEKNLPPEVPPLTPAAEDFVHEILAMNTLAMEQCYAA
                     IAATSGATLVGAAVANSTPNVTAASEEPMRILSEAYMRVDETSAQDFPVPLLDELKTT
                     TLNNMGVVECNRGQPRQALSHFEAARQLEENNGMASPSIALNMCAAYNALRMFDKATA
                     AALETIDMLRSLALQRRRNRRLNATATALLGGSGLPWHGSGGGAMDGAKDGDTSTTDL
                     LLEAAAAPKIADSQNEALWGAAWNNLAVAQINTARGSKDTSEYTNALSLFQNAMRATQ
                     ELLGMQHPMSKAVVETFRSVRRALRYHGAFKQHRSLLRAPLPPVDPREREWEERQVEV
                     MPGHTRHGTLQQQRQQLTITFRGEVTGGQKVVERLDSTPYPGAASEPYQKQQRMCGSN
                     SGCGNTSAATGSRNRSRSGSKKQPKPQSGISQLMRSIPLSSTLCHASAVYGNPHPLLY
                     SPPPSGQYAESAPLSFSGSVRATVNQYDGSAAAPGRAMSAADSSRQGRNRGQHSHTTR
                     SRSGATGRTPPPHRQQQQPAATAATERGGGKRSKSRKTGNNHFQTAPHPSSSRSYQHG
                     NAVGAAAAPPAPQPTRPPVSKALPPIDMGAAAGGAAATPAALAEYNEGHAGAAGAVPL
                     GYATGTFGDRSSRPTVTSIFTQHQPQRPSKRIPSAPHGSTSVSPSAGVVHSGAAATSH
                     VQQSKMLLLAAPASGVATTTTYYPLEVPSEAVAKSAEHRGPMLTPATVQSAWHDAGDP
                     SAGTHELFRGMWVTADPHYVHRGPRVFGRPAYYTIATTLGVTEDGVGGGASVAGTGTG
                     AAASTTQTDSAPRPVLPTLTYSSSGSEEDNDAEGEEGHGCEGGAMDVRHHTSVSTDAP
                     SSSASPKKNTLAETSRMTSS"
     gene            <158939..>160312
                     /locus_tag="LDBPK_060470"
                     /db_xref="GeneID:13391657"
     mRNA            <158939..>160312
                     /locus_tag="LDBPK_060470"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858305.1"
                     /db_xref="GeneID:13391657"
     CDS             158939..160312
                     /locus_tag="LDBPK_060470"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858353.1"
                     /db_xref="GeneID:13391657"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q7"
                     /translation="MLAHRRYSSVSSSSSGVFSEPSDGGTSSGNDSNSYYSEGSGSYR
                     SVSSVLTSSRSGATTTAATAASSTSAVDSSSTNTFSDVLTTSSARSHSSAPPRRAVAR
                     SAASRSEVVGHKTTKGASGVVVANHNNKGVGDTLAQRTVFTFTETTTASSATVDDTDA
                     LVSAPQSPMPQAALAPVSNRTADVAREKRYHISEEELVRHPWAPVDCDTTVDARKGGG
                     DRGGLALSVLDTIHTVSMAVPPPPEEAQRRREEGGLTYPSRLTLRFVRSSSPLRHCAS
                     AVAQDKDGTGNGGGGATLGADGATATRARKTFICCCFHGCSGKAPCKMKSYTAMRRKR
                     HHPLRSHHVPLVNFCTTREHGIPMEGVQNVLPSVEEAAGYQNLKVDMMGTEELPKQLQ
                     KAIQPWGRPASGLRLEKSYAFGHGAGGGQDGAGQSAFMRDGDPQGFWIAQLHRHASVR
                     LEPIGIE"
     gene            <162693..>166523
                     /locus_tag="LDBPK_060480"
                     /db_xref="GeneID:13391658"
     mRNA            <162693..>166523
                     /locus_tag="LDBPK_060480"
                     /product="ATP-NAD kinase-like protein"
                     /transcript_id="XM_003858306.1"
                     /db_xref="GeneID:13391658"
     CDS             162693..166523
                     /locus_tag="LDBPK_060480"
                     /codon_start=1
                     /product="ATP-NAD kinase-like protein"
                     /protein_id="XP_003858354.1"
                     /db_xref="GeneID:13391658"
                     /db_xref="GOA:E9B8Q8"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q8"
                     /translation="MRRMQVALCTSGDPYHVPSLARVALFPLHLDPPTKQHRELFRLL
                     LGAPDLAAGPSMPSSTASKLASPLPSISTAATSAAAAASSSSCLPRRSPSVSPGLLSA
                     TAVPSHAKAIQSGVTARGLNVFDRSTEGTMSTSLPPSPVAQTKSSGEWQQGVHFASAT
                     APTPSTDTASSSGISSVNDSDPISCGTSSPYWYMEAFATSLREDSQLAPFDYIILIPN
                     TRYPVSLRQSTHLAALAVLAARGLARVHVDFTALEHPDESMPIVYELICRYPNSVLVH
                     WLHDAYEVLNWSHFADFKSTVPMLLLQTQSYPPKALERQRPMGSVSRLTSRQYHSPIG
                     QYVRSPEEADYYRRAERFMKAASKYRRRNATPMTTATADGGDPERRYESASLVDRESD
                     YFDDVPNVPSPRRKLDEDVPESGTEATKRSLQPEYAKVLARSPLLRGVDTTTRTASTA
                     STSVSISAAGGRATGLKTGLPWRESSSVHGEPGLSYVNCAKGRWWNTPGGRGDDEVEV
                     SRSYWSSTSSSWLGGGTASSAALPEWMEEEGVTTADQARGRHQRRRVRDASTVAAEAH
                     EAGDVFETGDCSGESDQRSQKMDTVVSDDGFALMEDTPADEGAGAGVSRAGSKTNTER
                     RQLSLAKSVAGAASITTRAGTAPAVPTSPEGREAADEETRKRFLTREIEEVRAELKRM
                     LRPGSAAAATAVSMTTSGGVTTGAAAAAAGGNSSDGVGAARSSSASGGRVSKTRANIT
                     ARLAAHCAASPFGAEDARHEEHYPARRRNRTVRQLIDELYPPRAYASVSAATSASAAS
                     AATEAGVVGATFATDSSHFFSSSHPMLKPRAEPQSSAAAMPFNQHDGSSHNYESGDRN
                     SSSGSAFMDLSAWSDAPMVEVHPITRSTGADVRQALWEQEIHPSFILTDCVQRYVEGH
                     GLYRDPRKATAASLYGSVGVSSDYGNGARSGSGGGGGASGLGGSAGAVGQMGGSDAGF
                     RDSAAAGVCGASSGVGGGMGNSAGGSIGIRRVVAPRDTATLSFPGLIPRLELHYDRNN
                     LLAREQYEKLRIFQCQDGEEPDLIVPIGGDGYMMHCIRKNWRRFIPFYGVNAGHVGYL
                     LNDRSTLEELFSSPLKLHFTTMLYCQAEKESDTGERMLLSELAFNDAWVERSSGQTAL
                     IRILVNGQERIRRLRGDGVLVSTAAGSTAYSQALGASPVPVGAPLIQIVGSNVVSPAQ
                     WRPAHLDQEDQVEFEVIDSTKRPCRCYVDSVDVGNVTRLLIRSSRVAGVTLAFSKSCD
                     LQHKLYQMQFPKTL"
     gene            <167815..>171285
                     /locus_tag="LDBPK_060490"
                     /db_xref="GeneID:13391659"
     mRNA            <167815..>171285
                     /locus_tag="LDBPK_060490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858307.1"
                     /db_xref="GeneID:13391659"
     CDS             167815..171285
                     /locus_tag="LDBPK_060490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858355.1"
                     /db_xref="GeneID:13391659"
                     /db_xref="GOA:E9B8Q9"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:E9B8Q9"
                     /translation="MHTPEPRPRHSRGGNASTTPQVDSSNATPTPRAGFLRRGGDDGG
                     GDTLHGAIAAGPSVLFDEETGTAVAVDGSPQPTQLTQQQQLYPGQARLPRQRPRFHTV
                     QDLDVALNQAIEGKITSRNAWASKEASDLLEGITHTIETTLDNASTDDYAGFAKAATV
                     VEGCSKVWTSRVDSTYQRSNQMVQRLLRKDDTSGKPPTGGRDDGEGGDGEEGEEQQRA
                     KSRSRSVATASAAAAATRTLAMEAAEINLDSKSRTALTQTHVNAQFRAITSKFDQGNA
                     QGLLMNNAPMGRAGNIILDVDYSVMPASDAVDGCSRQGSRRISGPSAPSPSGGSGAEG
                     QETQAETVTPSRVSQHASVELDAAVYETVADLPPYYGVTTVVPLTGQLRSIRGSESFP
                     QARDSAGGVSSAGDARGSQASAIDPLLLLPHVSPPRQDLSDLARVSLKSDPREGYNGS
                     GASGEANRESRSCITSHSDRTAATAGGGDAAMSAYDSQQEQEAEGGFATRGNGNDDGV
                     DGDNADFDDWDGVGDDDDDSRCYNKADISARTDSEGADRGAEARRLVSGAAEMELMDN
                     LFHGHTQLALEAEDPTSWCPLSEVSANPLAGVQGLSALSRLHREHRFAQSQKGADGDD
                     AARNRNGGERGSSLSSPVGAQLQPTTKRGRKERTVVFQLPQSPSCGRGAGASGVASAT
                     AAFATESRLLLDDSALRQATTAARNITPLGKQLLFARNAAQEVLAYTQSAVQRSKAEQ
                     AGLLLPEAPIRGKTIPSYMPFPVHTQDFFQPFSTSLTHWNLLRKSATGHLVDSTAGAR
                     NNEGPSSSSVMAGGSSSCCITGDCSSRLGLATRTGEYFSAEALDEDSYGGVGARYGDD
                     NMPVEFFPGGAEVEAQDGGEAGGDYADYAELYGPDDNHSDEEEESRYVQGGFHSSADA
                     RLIAEMELAAAAATSVTVSGGSSTRSSGTTTDALLADPLELLKVLSPPEATLPNQVDV
                     VKLRQLMWEALRGRLAANQQEKAVDLATLRCGAAAAVSQIAEEDEDGVASLRENRKVA
                     MVKAHAQAALNALRQRVRSTDAGEDAQSANCNEDTVADQFLDADSAATGAAAAAAATP
                     AGVPPTRFSDVVRSVLPHISVVSSTNTLSPAFFFFSILFLANEHNVVLQSVEDLNDLV
                     ACGIAGRVGE"
     gene            <172314..>173291
                     /locus_tag="LDBPK_060500"
                     /db_xref="GeneID:13391660"
     mRNA            <172314..>173291
                     /locus_tag="LDBPK_060500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858308.1"
                     /db_xref="GeneID:13391660"
     CDS             172314..173291
                     /locus_tag="LDBPK_060500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858356.1"
                     /db_xref="GeneID:13391660"
                     /db_xref="UniProtKB/TrEMBL:E9B8R0"
                     /translation="MPHIPRNHYLVVHDAIRKLLGPDAQLAAFVKAQHAFQCDMLVND
                     ARTDPEELMRAGARHSGGGIGDDAAAKAGVGEFARRLQGVLGICDVVPHTRRVDVIFR
                     DRSLIQLALGAAKRDLPYALETGADVNQEPDWRLRNRLRISLGYDEELFLAQCTRSMN
                     VAARILEKCAFDSARYSALMSTNAAMAAMYEASGQRWQAVLPPVTYWQAHCYSLMKAY
                     PCRHYQQIVATVEHNYAAYYGEFPMTNPYCDGEDLNTIQVVKWLCEAFNAGAAVSQVT
                     SAASSPATSNEWQTVDCSMPAAMEDGDAEKGAAVMDNMTDGRSSQEGRH"
     gene            <174448..>175908
                     /locus_tag="LDBPK_060510"
                     /db_xref="GeneID:13391661"
     mRNA            <174448..>175908
                     /locus_tag="LDBPK_060510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858309.1"
                     /db_xref="GeneID:13391661"
     CDS             174448..175908
                     /locus_tag="LDBPK_060510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858357.1"
                     /db_xref="GeneID:13391661"
                     /db_xref="UniProtKB/TrEMBL:E9B8R1"
                     /translation="MAAGGRKGSALAADPHHPSTPHGSAHGRHALTAFGARRGGELAF
                     YIQQGGDLTSQGRYLVIGDGLMAPFMALCLRVHGLECDLAHHPSQNDLDRGTIVLTPS
                     VTQLMGDVLNVSVPSGSVVGRVLTFDHVGNDMCDIDLNEFREKGESPTFFCCDRLKVE
                     SALMSLCRIGAHSCMVLPKPQIDKGGLEPLESGGVRVRFTSGLQQDYLGVICTARNQE
                     LVPELTITNEELQARAENAEKYRDTFSKSVRWMELCVPPLPELGKFEKRFTPGSQEIV
                     EILTPRDAKMTVRPTMMATKLFYNVTLTIPDGTADPRLKSTSTKLFWDDVVMHWTSGV
                     PGYISHTMFRPMFTHLQQNFTKSSALVYRTPLFLMPHWSEGGGRVIKVAHAAHGSCFD
                     AVDVSDAQSFTDCFTLARTIAGGEDVAAFLKERRLQVMEEMDHHSRLTYYGLKERGQM
                     AYMMSRFNMKIMRKYKKSWRFILQNYVTLMPKSIPR"
     gene            <177071..>178708
                     /locus_tag="LDBPK_060520"
                     /db_xref="GeneID:13391662"
     mRNA            <177071..>178708
                     /locus_tag="LDBPK_060520"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858310.1"
                     /db_xref="GeneID:13391662"
     CDS             177071..178708
                     /locus_tag="LDBPK_060520"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858358.1"
                     /db_xref="GeneID:13391662"
                     /db_xref="GOA:E9B8R2"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:E9B8R2"
                     /translation="MAAQTSAFVLRCTRPLLAYNKSSGYRWSPIPKPPPPHYDRLYGV
                     HSVLNTLRVAAQRQQQQQKTDPLQETADTPGSASAATAAASTALHDAHQSSTAAMPVS
                     LLHPHRAHLACLYVRDFSLEEGGEGVEELGGSNADDAVAYDAVNSTDPGSRPDKHSHC
                     PGRGRHIRRKKVIPSRYTAVRCITALAKSLNVPVRFVPRAELVQLCGERRNQNIVLEA
                     SSYKPQRIRHLGEIWGAEGAAAKTTAAASAGLVTVLFLERIVDPANIGGILRTAFFFG
                     VDHVILSRQCASCTAAVSRTSTGFLEHLRVYQASTSSAAFLRASRQVWASAVPSLSSS
                     ITGASGLEVIASMVVSRTRAQRRDRNESAPALQFPASDESAPSEVSVESGSDHVRLFA
                     QQPNSCLPAVRVLLLGNEDAGLPPDLLQWCTHVAHIRSPRQARLRHTRTNMQGASHEE
                     EPETCAVDAAVGGTDVQLSSNPLDSTAVASAASAEAFDKHQHNLRRLARLRDKEVSLN
                     VNTAAAALLAALGGVEGRLGNGGGQLGLVDVQPLCSP"
     gene            <179449..>181434
                     /locus_tag="LDBPK_060530"
                     /db_xref="GeneID:13391733"
     mRNA            <179449..>181434
                     /locus_tag="LDBPK_060530"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858311.1"
                     /db_xref="GeneID:13391733"
     CDS             179449..181434
                     /locus_tag="LDBPK_060530"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858359.1"
                     /db_xref="GeneID:13391733"
                     /db_xref="GOA:E9B8R3"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B8R3"
                     /translation="MQTMNSLLVSRAVARLCAVLGDELFPVVIWLSMFGATRLAPSLV
                     LHLSMSLPQVMDVPRLLLWRRRRGVYDGAPNSSYLGSSISAAADAAAAHLAELIKNTP
                     PGSSSDGILLGGGSSSSSSGAYDAALRASWQRIYHQSLEVLVSLVTYPTRLWTYFLFQ
                     RSQRASLRDAAAAARGGGNGRAAVAELLVRLVTSFTSTWIHASGSMLFDTIVTYLSTR
                     IGSWGSGSVGGGNAIGGSGRRHSGWRDLLVASCVSTGLNFALQTYWVEALTSMGELRA
                     LPLATTAREALSLSFSERMQLALSALSRLGGKEFLYRLCRVALQPQPDQRTSPAEGEQ
                     VYASPLSPSNTAALQPRTRAADSSLLSSPASATPRAQSQPARAYLCGGNAFVFALSGF
                     RFSYYGDPQQFTTAASNCITDALDLVLRQARQRAAAQNGRVTEALLEGQVWRPPVSSS
                     SSYSHDVVLAPAASLQLLPVYIANFAVGAGVGLVWRRRHLLAAARRVPLLRRVVKLLF
                     PLPPPPLRLPEALQELSPECHVLLVHPDGRVEVSGNAPLPESISKADAPAATTTMMPD
                     TPSADASPSPRITRIVVAQDLFCPIKRTLMCDPVQTADGFTYDRDSIEEWLLAHDTAP
                     LTNLHLDNTTLRVNWRARQLISGLVLQYTAAAGITSI"
     gap             182563..182661
                     /estimated_length=99
     gene            <184378..>190023
                     /locus_tag="LDBPK_060540"
                     /db_xref="GeneID:13391734"
     mRNA            <184378..>190023
                     /locus_tag="LDBPK_060540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858312.1"
                     /db_xref="GeneID:13391734"
     CDS             184378..190023
                     /locus_tag="LDBPK_060540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858360.1"
                     /db_xref="GeneID:13391734"
                     /db_xref="UniProtKB/TrEMBL:E9B8R4"
                     /translation="MSSLPPSQPRCEAPTVGATHALRPLHSLPPPLTSAPAGSTAALY
                     EGVRLTPSALKSIIGYLPCNATATIGNTANIHRNGGAVISASRAADGRPACSPLIMAD
                     ALFAAAAQAPSTSAATAASAGAPLTPPVPVTVTRPLAFVAASPQSRRGLEMHLTGGCA
                     LPPLGSLVLQVQPHRPSPVAAMRPLRVGARHASRRRVASPAQVGAAHHHDERASAASL
                     PALIVSSTNVAIPALPFQPVRSLSSSPVTRPQTAAMPSTLSTPLPPAMAAALGDDDVR
                     TSGSFSPAPQPPPPLPSQSAVRQSRRLPVVAATPPADWSPFSSALVARTRTSPVSASR
                     RSLKTASPTSTAQEAFGAVAAGADSKAAFALGASEAPTTRACVSTGASPSLRPARATP
                     PATSPPPAPPPSSTSAALQTLCHALWWVRRGPLPVSLSLWRYRQADISVVWAMLSESP
                     PPHPQEAAGLVMRGEGTEKPRPLPSSPMHEHRGQAAHTLDKPRENCHPTPAREGDDVR
                     GFRAPANDPAHGLVADVSGGAVVVASAEGVTDTTQSSGITEVITTTAACSGHLCPACH
                     SLNFDPASTQPIWPPRAPEGEGAAANADKNNGTLEHRLGSPADTVPTSSFAPAAPANP
                     MLRSPVMQLHVHGKAADAALTELLPAHPEVRSLRLTHGTLSDAQLRHLARVCPDVTHL
                     SLAMNSRIQTTAFLCPPLSDTSSVSPSATTVTTTATSRTEAVGSPKQDFPHQLTRLHP
                     GGIYHTAATTSQTAPPVLSPLSSRPPFATRGASDTADALGTRIEGSRGTDASPPQSPS
                     YLPHSLCSPYQNSQLDLFAPDEEGELEMRISLWQAAQTDAEERRQPVFILRPQDVVLG
                     RYGGAAGKDGSRTGASTTGGSRDAAAGTTAAAFSRTLQDSAIEQWTASHRRPSPHTKT
                     AAIGGTPTNAESAHDSRRVAPGAPLLMASTAASLADLSGTILSPLHLSSAAHTPTLAS
                     AAVWAHTDPRHGLRLRSSNASYPELVVSLRQPSAPTSTSVTAAASPLALSLPTPPTAT
                     DAAAAAADEAGRSATSDAKRADGRAFAVPGPPAPAAPVHPSSPSSGSAMEPAAPSASP
                     RHRSRERRHHCEGYGGPLLRPRPTYWADTLVDLDLSYTQVSDEDATRDLPQLRCLHRL
                     SLEGCMRLSQVTWAPLLLHLRELNLSLSSLQGHALHPLGRCPRLVWLKLEGCSSFTAV
                     HQLWNREADTVDAGAGGDGSGSTAAVARIVAPATPVVRHTTIGGIPVITVLPPPAGLI
                     TTSTATATPTAAPALATSPSTGARAATAARGVAAADAHGEGSAAATVDEAVAAGSAEP
                     VPLLSTLCVLIAASTGLTDAGLRSLNKFVGLDCLVLDRCPGVTDVSVAATLPSLHTLD
                     ASRTRVTSEGVAGLRLSRTLKQLRLQECPALSRLPVLLVEPGNREATTAGGAGDEASG
                     LRRPAAKTAGISRRPFHKYPPLTVLDLSYTRQLTADGLAGLVGDEATVTAQAAAAVVE
                     HLGGREVDGDDMGLALAVDESLSPASVFPHVRHVLLRSCDAVTQLRPLRGFTNVVELD
                     LYHTSVTEAALTAALASWTCLEVLNIASTRVRSLAAWCPYEPSETVATVAATTGRSGD
                     GDAVEGDGDLHAQLPPLPWHGRLPAFAATLRVLVLSNTDVTASGLAALTFFPQLEVLQ
                     LSSCPRLLSLRFLALAAGGAARRPALGELTVTEAAYLTNAEAFPYIARCPGLRLLSLV
                     GCVQLGSGGNALPARGTQHEHLSSSTDDDVGVLGRLRGLAELNLSNTGVDLLDLKKML
                     CAPTSLGLLTATAAQHEHLYQRVPLSLQRLWLRGCRHLDEGALMSTAAAALEHSELPC
                     DGSGSGGGRPMTCRLLPLLREVYLSHGKYGAAVLSGLFS"
     gene            <190706..>191587
                     /locus_tag="LDBPK_060550"
                     /db_xref="GeneID:13391735"
     mRNA            <190706..>191587
                     /locus_tag="LDBPK_060550"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858313.1"
                     /db_xref="GeneID:13391735"
     CDS             190706..191587
                     /locus_tag="LDBPK_060550"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858361.1"
                     /db_xref="GeneID:13391735"
                     /db_xref="UniProtKB/TrEMBL:E9B8R5"
                     /translation="MSSHAFSSGSAPNVSSATTGTVAQQADTLTRNLILGIPKEGLSP
                     NSPEAADLQAAEAFVSDIQQEILAYDIANAKAIESYAVRWWSAVPFFGRHAKRALEAE
                     STAAATAAAGETHKSTEAAAVVDGNANSSEGHGLRLSPEEAAAALQSGGAYLHRQASQ
                     TPRGFKVERTSAIDPAQLSQLTGGARCASGSKAVPVPKVNTWLFRRQHPSWVPLMQRW
                     WVPWLCCGSIVLIWTPDVWKLRTLYFCDHQYALLRQSIHKAYWWATMAPEDYAAHMAA
                     IAAERPSRVRGTSCPFE"
     gene            <192689..>193084
                     /locus_tag="LDBPK_060560"
                     /db_xref="GeneID:13391736"
     mRNA            <192689..>193084
                     /locus_tag="LDBPK_060560"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858314.1"
                     /db_xref="GeneID:13391736"
     CDS             192689..193084
                     /locus_tag="LDBPK_060560"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858362.1"
                     /db_xref="GeneID:13391736"
                     /db_xref="UniProtKB/TrEMBL:E9B8R6"
                     /translation="MHAMVCSANRGTGATPHRLRGKRRCSRAGGCRLFLEHACLPLPF
                     KPRRRRRCMLSSSLHPPPSSCNTSWAHSPAANKRHRQTLYTRCFGRRWSRAAPAPPPP
                     HPSRYAVHCNSGRSSDGSSVCRRPRCCRR"
     gene            <196470..>201701
                     /locus_tag="LDBPK_060570"
                     /db_xref="GeneID:13391663"
     mRNA            <196470..>201701
                     /locus_tag="LDBPK_060570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858315.1"
                     /db_xref="GeneID:13391663"
     CDS             196470..201701
                     /locus_tag="LDBPK_060570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858363.1"
                     /db_xref="GeneID:13391663"
                     /db_xref="UniProtKB/TrEMBL:E9B8R7"
                     /translation="METGRRRQVRNARRLRRHQRSGADGNDAQERCTGSAADSGRSIP
                     PPPSSAPGVMMGTGAAASGAVGHRTSVVASRDEAQRLSERMKQQRQVKSRADQILSQR
                     EALIRERYAPNAVAATAQWQSQQQQQQQASAYAFDKDDLLANLIGESRANFLKLDHDL
                     TEDHTIATHRLHTSVFSHAKSFLLLFRDVDRASDLVEALKANVQGTKAAISSISKYSA
                     NFVAGGSMSSADKLPGSATADVRGCSAGSGSVFSAALGGTPSDGDPRRFARPSLVSRR
                     ITQRYASGGSSDMAWLNDGDAGFGWGTGGTANTGPSAAARSSRTTTWASTVHRSGVAD
                     EEGAAADGGADAVTTNAGASRPTTRGLNVSSVRQWRYTIGMGTGLAARGSAGDREAAE
                     SRLTAPGRQLRGGSGLRAKSRASTGHTTTAARSEKEAADTTAFVDILREEVNQLLTER
                     RHVDAAELLYRLADEAKAKGCVPFLLDLEAALVSSVITNVVKIPITPMYVESLHVPLI
                     QLLLRFGRSRSAAAVYLTMHTSWLHSEVQRLQSRVDPQYASLIAVDFLVRATRATVRR
                     QRTLGLALAAARPFMEDGGAGTAGAAAAGKTDGRRPAAGASRATASDAAGAVTTQKPA
                     PPRGATAASPGSWIPPNSAVLLWVRRNVERFACDVLATHLLSFGSGTDGGDPTRIRQA
                     AQMMAQTSRVMQTLSSDGFAGCDTLIMRQLTPSLVILEDDFTRLTGERVEHGGRAMME
                     QLIMGSLAFYETHAANTAATATAATTAATTTADVKAATATPPLSPMPVQSVSRLYTPP
                     YQPSRCDDVARKVRVHCQGLVQLIRSLPLSGHSLLVQLLLAPASSSLFKNVTSAGSAA
                     QGTSSPSRPGPATRSCGSASGATGGAAAYRTGGGCGATALLSKAGATSAAPPAASLTT
                     PLFSTAPPPPLSSERFRFLRYANGCSSTHVRLLQSLCGYVAALTGTDQLPAEVMASAA
                     AQEQESTNSAAAMAMRVQQAECVAYLLTSAVVTESIDVVLCNLLSHMMAVLLRQRKAL
                     VRFLSSETFLTNHRRAFPSAAAKSAVPDAPFFSDPASSPAWVLDSTLCLLSDVLGLGA
                     WVSFFTRGGAMAHMLADAQFGFRTQHLERVQWEMPRLVQGWMCAALLLNADVTRANTV
                     LAPPTTSVKASAPSTAPGRGSSVPTPLFSPQQSILFGSQPPDRVDGRPPTLWSKSSVS
                     FSAVAAAAATAAGATAAAAAKKASKAGADAASVLLSIPITSPSATSLSAATADKRETI
                     TAPFFADAGVREERVLKLIMAFLNRKYSTPAGYMVHRYVVDSANASSNGSASAGLNGV
                     WAIRSRLSSYPEFPIGEMREHRGDEVFLFHWCVQVSLHLLTFFQERLITPSYVMNQRA
                     AEVQGGMTSFLNAGLPFPLKGCITPQEDTVLAGWCAGGGNYVTAVALLQFLVMRVLRD
                     GLCRADTWSAVYGCPMAQWRSDEAVLRQQLFFFSLFAYLWAPLFTGGRTPRARAAAAG
                     SSPAKEEAPVSSYVVDGLPSLAVLEWMTCGGVLNPSTNADSVAAAMASAALATIPANL
                     TAVDVLFATEGTIHMSSGGDEGAGAGAACAAHSATGGGAASWRAKAAGRGTTAPAAVT
                     GASVASPATPTNAMLAKRELFGSCASYIPDGPLRVLRHFFEEQLGESRAARAITSDVM
                     RTRVERAMAEINLLDFVDTSLGVGDEGESEDEATSSTATRSTAGAGSANRMSPSSQKV
                     TLQNLRDLIAVYTVPLS"
     gap             202181..203058
                     /estimated_length=878
     gene            <203558..>204364
                     /locus_tag="LDBPK_060580"
                     /db_xref="GeneID:13391737"
     mRNA            <203558..>204364
                     /locus_tag="LDBPK_060580"
                     /product="deoxyuridine triphosphatase, putative"
                     /transcript_id="XM_003858316.1"
                     /db_xref="GeneID:13391737"
     CDS             203558..204364
                     /locus_tag="LDBPK_060580"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase, putative"
                     /protein_id="XP_003858364.1"
                     /db_xref="GeneID:13391737"
                     /db_xref="InterPro:IPR014871"
                     /db_xref="UniProtKB/TrEMBL:E9B8R8"
                     /translation="MKRARSANIPGAILHSLAELQDGLNAMIDPSWRAARSLDNWALA
                     ITMESTELLDSYPWKWWKNVNATPDLANVRIELVDIFHFSLSGAMQMRSTPDDEIPAA
                     FLKPLKEVMTTFLPAKECTSDPYGFVFFPLTDTQNAIASFRNVIQLANAYRFDVIIES
                     IIYAAEDLGFNLVAYYIAKHTLNCIRQLSGYKDGSYVKVNNGVEDNALLHGCIKDVSL
                     EEVLDADKYVQAWNSIMANVYEAFQVKESDRKDAERWFALAKENRLAIKA"
     gene            <205751..>206188
                     /locus_tag="LDBPK_060590"
                     /old_locus_tag="LDBPK_060600"
                     /db_xref="GeneID:13391738"
     mRNA            <205751..>206188
                     /locus_tag="LDBPK_060590"
                     /old_locus_tag="LDBPK_060600"
                     /product="60S ribosomal protein L23a, putative"
                     /transcript_id="XM_024473485.1"
                     /db_xref="GeneID:13391738"
     mRNA            <205751..>206188
                     /locus_tag="LDBPK_060590"
                     /old_locus_tag="LDBPK_060600"
                     /product="60S ribosomal protein L23a, putative"
                     /transcript_id="XM_003858317.1"
                     /db_xref="GeneID:13391738"
     CDS             205751..206188
                     /locus_tag="LDBPK_060590"
                     /old_locus_tag="LDBPK_060600"
                     /codon_start=1
                     /product="60S ribosomal protein L23a, putative"
                     /protein_id="XP_024329219.1"
                     /db_xref="GeneID:13391738"
                     /db_xref="GOA:E9B8R9"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="InterPro:IPR019985"
                     /db_xref="UniProtKB/TrEMBL:E9B8R9"
                     /translation="MPLAQKTAKKAAPKDAKATKVVKVTKRKSYTRPQFRRPHTYRKP
                     AMAKPSNRVTVESKDIAAFSVIRYPLTTDKAMKKIEENNTLTFIVDSRANKTEIKKAM
                     RKLYQVKAVKVNTLIRPDGLKKAYIRLSAAHDALDTANKIGLV"
     CDS             205751..206188
                     /locus_tag="LDBPK_060590"
                     /old_locus_tag="LDBPK_060600"
                     /codon_start=1
                     /product="60S ribosomal protein L23a, putative"
                     /protein_id="XP_003858365.1"
                     /db_xref="GeneID:13391738"
                     /db_xref="GOA:E9B8R9"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="InterPro:IPR019985"
                     /db_xref="UniProtKB/TrEMBL:E9B8R9"
                     /translation="MPLAQKTAKKAAPKDAKATKVVKVTKRKSYTRPQFRRPHTYRKP
                     AMAKPSNRVTVESKDIAAFSVIRYPLTTDKAMKKIEENNTLTFIVDSRANKTEIKKAM
                     RKLYQVKAVKVNTLIRPDGLKKAYIRLSAAHDALDTANKIGLV"
     gene            <207847..>212373
                     /locus_tag="LDBPK_060610"
                     /db_xref="GeneID:13391740"
     mRNA            <207847..>212373
                     /locus_tag="LDBPK_060610"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858319.1"
                     /db_xref="GeneID:13391740"
     CDS             207847..212373
                     /locus_tag="LDBPK_060610"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858367.1"
                     /db_xref="GeneID:13391740"
                     /db_xref="UniProtKB/TrEMBL:E9B8S1"
                     /translation="MDIRRILRIPDSRGCAPAAHGDALKSYPDSYVMCEYLSCSSGMG
                     HSSRDDQAAVVSKLHVLASKYAQFQRSIEGCVFAMSSGIAASLWGSAPAARQASSRSP
                     SEGLAPFSAADNGRAAAASRMGAIATSVSTGSTSQVPDLESCWMSTSPLPPTAVLAAL
                     YGMTPLHRISWSGSDGGGPDAGAGENVGTVPTVDASNLGETDSSTSSFELQWSLCRCA
                     TDAMAAQGRYQVTFRDAFAMTTVVAHMAAASADGGSSWQGSTSLLPPPSSSSSTSSYS
                     LAQQLRRASALLGVDSEGPLPEASAAAAPSTSLLDWPEEFLWNLLVSLLSSLALVHSA
                     GLHLFGQLTAADVLCVACAPTLPRQLEQTWADVAAATAAAASKEDARRAVSGTVSSSN
                     IDDDRVPMHKEEDAIFRRFCSTAVPSVLLPQATVTAATPCHHVFFVLHPSPELLQQQG
                     DGRAHVPRQSVPRLSAAQEAEQATPAQQAQHQASDLASVGRLMSLLMELRARGRQSRS
                     GHAEPAAAAPSSELAFLVGRLCECGGASAGPAAPTQSPTALQLLQLQALRLRTESWYY
                     RRLAEEACDRLLLARRRLENTDATLPQPSSATLPHARDTDTKGQSREAQLADREAQLA
                     ERESKLNVLLGLYELTHEHLDALKLPQLPPAQGGTKLVTLSSALPSDAAAAAAVDASA
                     TSTARNGSTRGADSVEAEQRMASQVPQGDSLDRLLIQTLLQQQHQLAGSAGALLAGVP
                     AASGATPAGVRDGSHLSPPATTTAASVAAADELLGLSPLACLTTADDRLLSKSAATPS
                     VVAETLPALTTDRHVDVESVPGGGVATLTAAALTGHHPNNESRVAVVEVDLDAAENDG
                     RGISMASQGSASPTAIHATLAGGFETRAAWGWAPTTTSPSASLSVSAAATLQQGAHGS
                     PLPTSQQQRQQRQLFSPPLHASPCQDMETPMRSPALPNMGYVGGAAGGAVASPGAGFN
                     GGGGRSHSKYSALSLLRTPPSARRAGTGPGAAADAAVATAATRAAPSFFRSQSLHSPD
                     SYRSSTRPHNAATVDASASAAAASSPHDTAERFLPQPRQQRRRSSSRGNTSNNSGGAY
                     TATLGGRSPRTEDHRQHKDGVAASWAHQQLTTLEEMQTALRAQQSSTPRSRALAAAAI
                     RSRSADMAAPPRMQSPATPPLAPRAAPRLYSSSTLASSDVTPVRGTTPSYYGDDSAEM
                     FRVESAHMRSSDNRSGVRRGDDWGGSVGASRDFGGVVIAEPPRVLLSFTPPYNTPPTS
                     SPYIYQASTATTTAAESGASLAYAATGPSAARDGAAGQHTPPQMQKPTATALYRSAPQ
                     EPASSFSPQMLAKFVGSETAAATRRGNNSRSGAPNAFHASAPSARGASARGNGAANLH
                     QRSPPHHATSSPAIVSTVRAAASAFGVSAGISAQGTGGRGSHRSLSSRTASANATGHS
                     AGGTVARGTTVSTSSGRASGGHGGGGGGPLQRFGDAYSPSPSSASFVHAGASRTSSTT
                     AVELLRRLRANTGA"
     gene            <213246..>217346
                     /locus_tag="LDBPK_060620"
                     /db_xref="GeneID:13391664"
     mRNA            <213246..>217346
                     /locus_tag="LDBPK_060620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858320.1"
                     /db_xref="GeneID:13391664"
     CDS             213246..217346
                     /locus_tag="LDBPK_060620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858368.1"
                     /db_xref="GeneID:13391664"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9B8S2"
                     /translation="MTLYRLCRRPGGSTIDIVSVGTSSGGSGAGAASATEEAAYCVCA
                     AVMALEPNLWASLVRRAQLLRPRKPSFLFVAPVAVPPVVVKDVVRFFGRSRHLMRSTA
                     APTVLVGGIPTRAAASTGAATSSLACTGVVRAPAPAASASASPFSTTTSTTSTAATAT
                     ATFGLPARQAEAVAACFFFKTMSAAERLRRSDVFEVHARLPDASRAVGASDKANTLTT
                     AAALDSTPVGAPAVDERGGVVVSSSLQKLTGAVTVATATSAQELTAGPGKGGRRSGLR
                     AMARDAAAPGDTDRSLHTRPTRSAASLLPSHLPAASMLFNDGLGGWGGQQVAGSTRTN
                     PLLLSSTRRPGCVDGAEDDAGIGGWPSGISSESSSQSRGSSPGDGDIGTGKAQGRHPL
                     AVKGDSAHDRQAADTAAVLTRLYALALSAEDPAADVPLNAEAATQQQQQNSCGSDQHR
                     VGDAAALSIGTHTLFSAAVPPAMLSSGSGLNLVALGASVTYACDALHWGRLQMMVRYP
                     LLFRAIPAPAETSTTIALAGGGEALTVEAMARMSGTLGMARTAATVFSPASETPPDST
                     AGNCDATPPSSASLLAYMSSLYGAAGSIFSPARLRTSSPPLLLPPSPSLVTDGFLFTR
                     LLICSAWLLVYADGLFGSDDSVASVEPTQSVTSGRGRGGGAWPRVRPTPAVQAIVAYC
                     VAVVREAREMSAGVTAAARSGHGSLNGTVCCPVCDDLVKEKQPVLWWSTLCDDRASWR
                     AQVRSVLENSSTDGDEAEIAAALTDHLACEGRGRRYATPLLSGSEGAPCRVTALQQRW
                     GAYIMRADTSATDYRSAAATSVTRSGAEDTSVRVDAVEADADLQTGGAAADARGTAGD
                     SAKEAAASAEALWTALTQRIAAATDFCVFLSAHPTESAASDSPAAASVTSGRPKRPRA
                     EYDKDAASRTLLRHRRQDRHHRGERAVGSDDSDDSEWGDENGTRADKASRAGVALRGS
                     RHAVEEAEEWSRLLCRCGWANAAPPSGATSLRVYEEWASSLFLPSAIPTPQQAATLRR
                     RLSRYSLEEVVRKLVLGRGGSWDRYARLLFGDDVRTDSTASPFCPPPAMEVGAAETND
                     APAQPMAQSPASHSSPRPRAPSLSLLEEAVPDTEGVHVPHMHVNPRATQISPPPRQLI
                     AAAQSTPHCSSGLALSPPLPSDAAPANADADANHAVAAERWAATPVGKGKVPSIPLLV
                     SPLTRQHQMRAVLGAAAASPPRLPSPADAVDRATSVVPECVSDADAAPARRTDASART
                     SLSVPLEQLRAQQAALYDLLRFRPRLPPLREEDAVLECASCFSLFHQECIAPVQRNFM
                     GQTFLCHTCRLRWARPYVAGCGLAHQAPEQHHDPEVAGGRCAADRP"
     gene            <218575..>219495
                     /locus_tag="LDBPK_060630"
                     /db_xref="GeneID:13391665"
     mRNA            <218575..>219495
                     /locus_tag="LDBPK_060630"
                     /product="carbonic anhydrase family protein, putative"
                     /transcript_id="XM_003858321.1"
                     /db_xref="GeneID:13391665"
     CDS             218575..219495
                     /locus_tag="LDBPK_060630"
                     /codon_start=1
                     /product="carbonic anhydrase family protein, putative"
                     /protein_id="XP_003858369.1"
                     /db_xref="GeneID:13391665"
                     /db_xref="GOA:E9B8S3"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:E9B8S3"
                     /translation="MSLCSCGCPHPTKPTLDVPSMYFSTTPELLCNRNMSEPSANATL
                     TKEKLASLVGGRLVQSVQREQPPRGSGIQPLLDFNKHWAGEIVQLNPDYFVELAKQQK
                     PQYLWIGCSDSRVPANEIVGLYPGDIFVHRNIANIVCNSDLNALAVIQYAIDCLKVEH
                     VIVSGHYKCGGVTAALHEDRVGLADHWILHVSAVKKRHWRRMLTELPTRNHLDALCEL
                     NVLAQMEHVVETHLIQRVWSRQNEEDAAAKRENRPSQNKPENEVEIHGWVYGLEDGLI
                     RPLLTLNRRSNAEKELHNAADALFWRYGQL"
     gene            <221220..>224252
                     /locus_tag="LDBPK_060640"
                     /db_xref="GeneID:13391666"
     mRNA            <221220..>224252
                     /locus_tag="LDBPK_060640"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858322.1"
                     /db_xref="GeneID:13391666"
     CDS             221220..224252
                     /locus_tag="LDBPK_060640"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858370.1"
                     /db_xref="GeneID:13391666"
                     /db_xref="GOA:E9B8S4"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="InterPro:IPR016965"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9B8S4"
                     /translation="MKGIGRQSFLVVFDFDHTIVDCNTDEVIPAALGRRDMQRRMMLE
                     KNRMQWTKLMDTIIAPFHKEELRKAAQDSVTIDPKMPEVFQYLRDAQKQYVVAAPGPA
                     PPGDARAATVQDNMPGFIEMNIASDSNLLFIDAALDARLPGVKECMSQIHSNPYYDLT
                     APGVSQSAGLDVCYGADRPAGSLNVNDEADRNAMHNPGMTRKSRVCWYEPHGHQCQCC
                     LAGGKPNMCKSIIIERLLQTTSLIDPTVIFIGDGANDYCPVLNVLRPRDYMFARRDFP
                     IHHILAGAPHPASSKNGVAGDVGGCCHIGLWRNAAELRELFQLAMEHPGARLPTLVRF
                     RDAAAKEFRSVTMVKRIPSVLRRTLEELRNASAASEKGRQRAIELMRAVEANGMVPPL
                     PGQACVPAWLRNYAYVSEYDNVNATDVARRVSPPAAKGKEHLIVPRWGQLPWLHGEIY
                     FYHVLWQCLMMQDVAEGAAEEDVTAAAGTAATFNVVTQHALHNPLFSQECRVTSTPGL
                     VSPPAIAMQSARNVAPLVCRPASIAESVVVRRVQPGSDRPARQVPYAEMVRQPSGCVI
                     PPAATFFSQYRDIFAHEKHDVLMDFLKVRVVPMLACQPWGADRDYGGILLRWMLWGNG
                     IDLSMFTLDQLADSHGKAAGGEDKSHAGDVAALREAEKAASLAQDANLVGNEVAKVEA
                     YLQRLLDPGDACNGTRQVDVVMDNVGVECISDLCFGLWYVNQAAKLGAAAAAGNARVV
                     FHVKPMPYYVSDVTPRDFDLTLAALEDSYTSEAFEPDAARRMTLKAVLEPFIAQVRDC
                     FARGAFAVDADTVWTQPSEYRDLPPRVINLYFFTQCVSAPTSARDAATTMAVSGVAAA
                     LADTACPASSAAGLYRMNKAHVQARSGLVLFKGDLNYRRLVGDRYWDRTDFLATLAKE
                     ERPDLRKAPESYSALEQSIVAELTQDTPATALMDAPTFAEVMSAYWPTQVVPVCSIRT
                     IKSECCVGVPGDVKARLDQELGLPWRVSGKYGEILFAC"
     gene            <225887..>231619
                     /locus_tag="LDBPK_060650"
                     /db_xref="GeneID:13391741"
     mRNA            <225887..>231619
                     /locus_tag="LDBPK_060650"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858323.1"
                     /db_xref="GeneID:13391741"
     CDS             225887..231619
                     /locus_tag="LDBPK_060650"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858371.1"
                     /db_xref="GeneID:13391741"
                     /db_xref="UniProtKB/TrEMBL:E9B8S5"
                     /translation="MPRLHRRQTRGVRTLCTAAPPAHPSRALGNAGGAEVSRRRVAVT
                     PENAPSYGSSSLLQSSLQSLSPQSPSAAPVGRVRLSCRHQGRRLRHRWTLLCVSSALV
                     VLVALTQMLARPASTSTSHGCGKDILSSGLLGQMETATAVSAHWLRAQDKLSAPVLPQ
                     CKDFAPNVSSAGDALWKADNAEGHLAACPPRDDGDDVSDADADGVVEHMEEVVCGGSE
                     ARGDRGRGRYEDARQMDGCTPTFDGSWTRLRSPSSSWWFSHSRSSTGRNAAPPSATRR
                     SASGTSGATASASSAAVNPEVAPQNEVTLNLAGNVQTRWREYRSSYPTLREIVHQLAQ
                     AYKEEQRMKHACLSAMKAAAIARYGERTSDNGTSSCRCCGGGDAHYVVNRTRNDASPK
                     ASPAAATCAALPTLRTSLDWVRYLPYVPMHPIEEAVEHLEHKQDDDILLALFYSPDLF
                     NAYNYVQWIGLMVKTTCSLLRAGVLDPITHIRGDDDVDGVFSSWFPPSNSTGAMMNSG
                     NRSSSSSCGGAHHRCQPPLFCRDLALPSLEGMLGPADITHMRDNKVRVAIIDGYYPLR
                     NVTHTVWRHMDRGTYHVHERYWGFGSSDGDDSDHYDEADATEAAETVEAPTANGAGSL
                     GVTRDAEGHEELQAHTSAAAFTGSSTSTYSSTFDSTSTAPDPAAAFPAGDWGLTSVQH
                     CNALLRLLAHEGGRPDDIREALRSMSSPAQRGDATSMAETAEDEVHDARAQRDQGRGD
                     SLQDWREQRRNTHRPRAREDATVQTATVTETKAGSGEVKEYTDAARKASITAAAADTS
                     STAASSSSLHSFMSAEEARLCPNDRIHLLARYIIDESNTFPLNRPSVLLDALQNSLHR
                     VRHRKQLLVERIFSWSQRMTYRLHVNVSAQRIDALFSDHLCDVRYQAMPHTSGVTAPT
                     AGGDSTEEELEDEEAMDNDVVVDAALVQSGLGARTSYFYHQRMCSFHTSAALDSASAL
                     QFRKRKRMHRRNGPSASMSPLTEAMTTLSTPKQQQQQHTAPASPPPAALSLTHDSADG
                     LCEPLDVRVADASVAATLTTLATTTAMASGAQGDGGDSRGAENVSDDAASVQGDGSAG
                     GTGDASGSATGTQGLSGTPACRHYLLRKSPPVLLFPRKQGSRPYLFPQTLLRLTPLSF
                     PKSRGQPPPHEHARRMRSRWGCMPVVNLSTTEGVAGEPSMPYGGAAADGGGDGDSGNV
                     RRGPNDAWAAAEGEGKPQGSSTRSGPRPHNGDDGSSVGTSAAPSLASEAASPTPATYR
                     VVSVLDNPFSRIGVEHLHYDFLISGPSSPMSTVQLLVEESRRASTPGELETRTHRESV
                     YRLQRRQWMEARAKAAVVAAAASSNVGVDSDDGVGGAGSTDTDSPAEAVSRQLSSETA
                     SFFSHQYPTHATSTSGDHGEPCNTTDSHRSHDRLHRSRQHRLDSSVWTRSGVDETFFE
                     HDVSFRPDPDRFIESAPLTLQFFLRTPMHIIEESIIEPLRKQVKTLRQRLLDAIVEEA
                     LRYGRCEISGQRYMQLLADGSNPMCANGTRQPALENRVTKPVAECSVEGVLDAVTERS
                     ASGGVLGDDEMSAIPYGYTDDGKPLLHSLRHSAALSVWRFTADLQRQFLQALRGSRAR
                     TSASASHPPSNDDEMREPIPLPRDLASVVELLHQPHDVLQSSSPQFRSSSSSSCFSRL
                     SALRATDAADPATAPTNDASSTRAGEKDGDGDDDAGTPFFLAHLFGWEHGPMDLDTSH
                     GRLAARHQTLLQRRQLQERLSMLQLAMRALLERSSPWSTDSFFQLISAEPGAALLVET
                     SSTRPPESATTTTPDDGSEPSPSPSKPPDCLGQFNATYLAVAYLFFNGTAEAYFRTHS
                     LNQRRMHLLQRLDEAVRLSLKARLILLTATEEDYRARHVETAIQDAARRHCIFRRARS
                     PHEEKQPSPS"
     gene            <234045..>243497
                     /locus_tag="LDBPK_060660"
                     /db_xref="GeneID:13391742"
     mRNA            <234045..>243497
                     /locus_tag="LDBPK_060660"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858324.1"
                     /db_xref="GeneID:13391742"
     CDS             234045..243497
                     /locus_tag="LDBPK_060660"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858372.1"
                     /db_xref="GeneID:13391742"
                     /db_xref="GOA:E9B8S6"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B8S6"
                     /translation="MQPPQLKPALAGTADVALPAAFAGPSMTYDGSSGKCENLDSNPR
                     SCEEGDEDAGTYSADYRVYQQRPDDTHNATRRRSSSVGQLSVEQVLTSVAPLSSPPQH
                     MAARTRSSHLPHGNGTSADRSASVSLPPAYPDRFSTHAVGDCPAHHGTVSSSWCCDST
                     CATRTGEANGKVPPEGNGCSERFSPHRIGSALLSSTAETAPGYLLALIGVVTGVLLFL
                     PWSSNPVHIALMVLSSLVGCVCGLLYWISERRWYRRWRHGFYDASGAAAASCSAGGAR
                     GWHVESAAVSAGPRYHDHDADDEVSSVGMCCCAGCVSHLIDRQHFRVVLPTAQLLLLG
                     TFVLVSPQVMATWTAPMASTTGRGGGAILADRGAGHAARYGATLYPVEAVWKTCLLHA
                     WIGMRFSLPLLWSLLVGLVHMAVLLAQYQHAGPGTLLTLVVWMSVPLLCFAFAMCITR
                     PRPAVVEEQQHHQLLRGLASGGGAAGYSASYGAGVGEPLPPFVNFSIGRRRDALEATC
                     ASVPYSSPSTVTTAAPAPATQYSAHPSRRVVLPPPPVAAYSPASYAQMFSAEGIDGSY
                     LARLKVGEFGSLVRGGSGGVGIAAARYPQANYGGLGTAVPSRYESDQRLIAPQRPVRP
                     RYNAAARSPAPSVQQGAPLLAPKFFDSAGVPPRDDLIGLATPHDITLPPQHGRARDLS
                     APLYSPSSLSQAVREARYEPAHYPINNMDEVTYPTTSAAAMLPSSGDGTHPSLPLPQT
                     SRQLAPPSRLSIVSSSTPSTMLVSNLEPAPQPRRQRRKHVQQAAAGEVEEAGAFRDDA
                     VDSDGAAAAIVPADSSHQKTRQHRRTGSATAKGQRTWSGVAATAAAAKSMSAAAPAAD
                     DDGCANGVDVPNAPVHGRGDDGEEWDSEPPIPAGTSLEDACAPYLVLDAALVIVDVGP
                     SLCRLLGTTVDAVLFRRLPDVLAWLDVVERETAVMLVSAVAQPLRTAAAAVRGEKRGA
                     GAHSTREEKAKKGKGMKRRHSGAQDGMRDNHHDTNENRNASSGAAKQLQKPSEMEVRD
                     NVAEGAPVRRITLRGHCPYYAKASGSTREISAGRCSRRPPFALCFDVWAERLAAPAPS
                     TAGSWRRHRSSAVGGGRPLPTPFVIILRRPLLHGLCDALPLPVALVHPRTGEVLCWNR
                     YAARLTGCTAYDMLGTPAYGSFVYEGLPGAATTAASQGGFSSTGRHLPPPPPSPSVEF
                     ASSTHRRQQSSNTAALSAATAAGTVPDGEVASNGFAPPPVKSTSPTTAALLLSSQQTT
                     STAFSPLQNARLQRQHGGAGSPTFVDQASPPPHAAGLYGTFTVVASQQHRDTPLPGFF
                     YVPCTRAAAAVAGVPLSAVGHSGELAMTTAIGGGGARPSSSSSTGGGPHQISSLQLPW
                     SLAGRGGTVAAAAGHADRVPSQLTAASQSPLSFGVGGGGGDNKNSTSGVAVGARCPRP
                     PPPPPLAAGLDRGTDPYDEAGVATAFETDGSKEAQGDGDEDVMAAPYCSSPVMVHGLL
                     FRATLRPLRGVLCSEEGGVVENQLGGPLRTSASAVEGEHAGGRGAEGNPFFNQPPRAA
                     HEEDSAAVEGKDAEEGQALARDKNMQAHGDDKSGSDDSVEALLSERQPHHRHHRLHRT
                     AAGARMRNSECEEDSGAEDQSDMDDDDDDDTPFDEDDLPKAMAGTMNGGLTLAATLEQ
                     LFATKAMACNFGLDKEPAACPRRSAASTVTTTATAASGALLSSELLPQYSLREALQQL
                     AASESPLLLTFSEPPLYATTCASAEALLQERRLSHHRVSSPSPDEHGYSGVLTHANNG
                     GVAAAASGGDCTSVPESYLGTPQAPFLRRQRPQVPALWGDGSSSLQFVAAVKEAVDSY
                     RESIEEDSSGYTDLLGLLSLSGANGGCCPSSGYAARNSSSSLTPTSFGGAPDAAVTTA
                     ITADAVRQLRLLKSLSDQLLQATAAYNRTRQSMSSTTCGLSGGCGCGGVAARVSPSSS
                     SPSLSLGLFAAPSVPDADAAHERHLHARRHGSATTPSPHKDPPAGGPLGFSAHQSPFQ
                     PPPPPPHLAFTSEEARGAHRRLQGGGPHRRQPGEPAASASTGGSGAHTGIYRDPNSTP
                     FSVASEDVTGVAPSAVGDSRNWALKEPPPPPHHGATRTSGSGGRRDIQDGGASPVKSR
                     PRHAAKSSTASAPLKVSRGRHTGARHGRRGGAGAGASTPAPSPPLVPLDAAVDVAKES
                     RSSGYMGEISGSTPSSASPCGVGGSGRTAAAAPAATSSLNASTLLVAAGSVPAMSTPR
                     PHATGASASALDVATPQTELHSSPRPCDTVVASGEGEASGRGGGAGEDTAAAGGVTSR
                     LTTSPRYQGSLLLSPSLAAAEMGELEASYGTESRQQRPQHRSSPNIISGAGSGSGATP
                     VKRDASPRRRSSAVYRRESSLDVLPSAPLGSGSFRGNGGLVPTSSSASPSAGAGAGGQ
                     GTGSPSPHPARTGSGSLNANANAAAAATAAVRSTPRRPGEGAVWAVLVSRDEATIPSC
                     CISVNLGDEFRLGRSSKCTAVVSDSFVSSTQFSIVRTVSASTTAQDSQSPGSGRSERG
                     ARRNKAFTVTLYDRSANGTYVNVKKLGKDKSCVLRDRALITFRLSTSQFFLGFVFMLT
                     DERGVPLDDRTGMGGGSGLRSLLDARLSPQPQTGRRTNASSTGGGGKESSSSQNTVMA
                     SPNALSTSAARRNTPRALSTPDNSSFASGTPNGSRRAGGGAPRSSRHAHRETIEWKIG
                     EEMLGKGGNAEVYLGINLTNGQLIAVKRVRLPTFAHGSDAEQDPEAKAILQQYRSLQE
                     EISVLSKATHPNIVQYYGSSQNSTYFNILLEFVPGGSLRHLLDNFGALSPGVILSYVH
                     QALEGLAYLHRHNIVHSDFKAANILITEKGKVKLTDFGTARLLTRPHATAARGGGEAQ
                     SVTSRTTPGQRKDDPVSVGAGGTLHIAGTLRWMDPALFHNPHSSGAADVTAAATAKDS
                     SDKLGGPTKAGDIWSVGCTMIEMMSGEAPWFEYDFESEEQIVNLLTYTAEPPEIPECP
                     ECPDLVTIAQTCLKMDPARRPTCEELLRIVEEATARLQAQSTSPSVSPSREVSQQHPA
                     VPGSVSGAGTGLRSSSTLLCPQMEPGTNSAFASLTANPAAAAYGPGTDDRRRAERVGR
                     PSDSTPMSFAVGGDGGSSAPLSARDAALPTVL"
     gene            <245026..>248049
                     /locus_tag="LDBPK_060670"
                     /db_xref="GeneID:13391743"
     mRNA            <245026..>248049
                     /locus_tag="LDBPK_060670"
                     /product="lanosterol synthase, putative"
                     /transcript_id="XM_003858325.1"
                     /db_xref="GeneID:13391743"
     CDS             245026..248049
                     /locus_tag="LDBPK_060670"
                     /codon_start=1
                     /product="lanosterol synthase, putative"
                     /protein_id="XP_003858373.1"
                     /db_xref="GeneID:13391743"
                     /db_xref="GOA:E9B8S7"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR018333"
                     /db_xref="UniProtKB/TrEMBL:E9B8S7"
                     /translation="MHTNKGQPSSSRAAVSGSPTKPHDTRVNGLTTSSCGKQRDPPRG
                     AVTNAVEFVSDILRNLYARVAAIAQPYAAEHASFVEYQRTLPVRTVVPEPPNTLRDYI
                     RRQLWCVGRTCLFFFFFLFTWPVWLTLHLLLKLLDAHQRRLRLQHHRAWVHPSVPHVR
                     ANVHKHSKEFPLGSWHLRCEDGRQRWYFGEPLREGEEHNELAMAQLCGLHTVGDYHAL
                     LRQRAASDSGGGDEKQDSRGSGFNGTGLNGAGVTNSRVPWLPDILQEKCSKRSFVERY
                     HIGLIPASPPQPRTTSEAAMDDGIRFLVKLQDPFSGHWPNNYSGCMFLVAGFVITKYI
                     VAGGETNRLFPPFPDHHHVRLDSNGTKRRGNGGDIPERILGVPAFEHAGEVGCRCGEA
                     TRQELIRYIRNHQNPDGGWGQHTEGHSTMMGTVLNYVSVRLLGVPASDPQATCARNWI
                     LAHGGATKTPMWGRVWLSILGVYSWDGVNPIPPEMILMPDWIPFSLGKMWCHSRVIAM
                     PFSYFYGLRWSAPAFPTTLALRKELYTEPYDAIPWRSFRGVACELDVYTPTSPLLRVA
                     MGLFDLYERHPIPFLRRYALEENWRHIAYDDESTSFICLGPVNKWLNMLATWVREGEH
                     SARFQKHCHRVQDYFYLENTGLSMSGYNGSQLWDTSFAVQAICACRREMMFPAEMELA
                     HHYIDVAQVQANPMAAADFYRHRTKGAWNFSTRAQGWQVSDCTAEGLRVLLLLPQYEF
                     PVRRIFDGVDEVLSLRNSGFGGDGGWASYEPTRGPAYCELLDCAELFKDVMIDYSYVE
                     CSSSCIHTLSLFREHYPHYRRRDVDRAISEGIAYVLGQQQPDGGFYGSWGICYTYAAW
                     LVADALQASKELPDMAVHPHCVKLVDFLLSHQGADGGWSEDVSASARQTWVDSPDGSQ
                     VVNTAWAVMAIICAAGKAAHTEPTRQRNIRSAVDRGVQLIMSRQLASGDWPQERISGV
                     FNGNNPIHYPGYKNSMTVWALGKYNSWKREYVVAA"
     gap             249122..249220
                     /estimated_length=99
     gene            <250403..>252442
                     /locus_tag="LDBPK_060680"
                     /db_xref="GeneID:13391667"
     mRNA            <250403..>252442
                     /locus_tag="LDBPK_060680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858326.1"
                     /db_xref="GeneID:13391667"
     CDS             250403..252442
                     /locus_tag="LDBPK_060680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858374.1"
                     /db_xref="GeneID:13391667"
                     /db_xref="UniProtKB/TrEMBL:E9B8S8"
                     /translation="MGCKCTKTKDKRKHEGLPGASAEDAGHEAVQYAGTSELDEALVS
                     ESVRPSATASASHRRGEGSPRSPARLPEEAVAEQQADDAAAAVGAPDDSTQTTTEMSV
                     KPKQSDNAPAEADDASKSVGVVPHSFTSRTWTPSEQQKPEREVPKVGSQFDFEAESTD
                     SEEKAAADEWEVELSQPCSLPPSTQQQPEPAPVPPAAVTATLNDAEATTPVAMESVPQ
                     PIPKRESPRSLPDVASGQSASAATSLNAPAPAPRRLSRKPSIASSSSVSARPSRRPSQ
                     RNLLQPSTHNGGSLRASQYVASPAAAAPPPPLALPRDEYRAAAAAPPSPTPSTASTSV
                     TPINKKALIPVGKPSERMEALHHGADTGRETVASRQHLNRFLYRESPVGLCTPHSQPP
                     LRPVSGQWRRGFLSPIPYRRGYTNPNPGAAPHKHRISTTYMPPPTAYVMGAAGGAPPR
                     LLFDASTLATIEASTTRLIEAHTLRLAGAHNGAAAMITGNGRANGAPVSAPQRFVAPL
                     MSVPLASRLPTSNLSDPVPSLAASAAGVSAGASAPPSTTAGSSYSRGSQKPKLAMPAP
                     RAQQQQRFPAALHAAEQSSEQHTSNRAGMPAQAAVNQTARYDDDGVDAPSADVSYGAV
                     QEPGVHEQQYCNTLEPREDSVTTYEPSTTDEVPTNAAVLLPVGCDEGSSPIFQYP"
     gene            <254982..>258893
                     /locus_tag="LDBPK_060690"
                     /db_xref="GeneID:13391668"
     mRNA            <254982..>258893
                     /locus_tag="LDBPK_060690"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858327.1"
                     /db_xref="GeneID:13391668"
     CDS             254982..258893
                     /locus_tag="LDBPK_060690"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858375.1"
                     /db_xref="GeneID:13391668"
                     /db_xref="UniProtKB/TrEMBL:E9B8S9"
                     /translation="MGGVCSRATAKRARHDRGSAAGKDANQNHASLPKSPAANAAPGG
                     SSGTYVRVTDRNGGAGNPEAGVPERPLSGSALVLPTSVDARSSNASSDFTRNIGLLSA
                     KAPLRDMETKTSSVATAISSAGGNLAPLMNNGGACPSSAQAGPLYDTYFPPGHDAGMR
                     LGTDKYTGVGASPLSAVNSPDLQSFASTASCGKESKPRDQVVHPGIARPHANPMIFTD
                     DDTSVMETASSAFATPRELRKSSSSIAGFPRSASIISRGSMMSQQPHGYSYYNSSATC
                     AEHRPMPPSASLPLSAAPASLTPAAPKGSQRQQLQQKPQPVSPGQHSNTTLTNVRANR
                     QVLATRSFGGGSTPLTRQGSIVGSDCFQSCCSYTDVISSAAGHLTPATPAGAAAEADV
                     RLLSGGYPASTAGGASSMGRQLYTCRSAYTPSTHARSLSSPAAATTGSAHPLAVTHSQ
                     GGTMLSSVQDASLLPPRSPLQTPRSAAGPCSTPNAQQLYLRRQASLCSGIEDAPASED
                     FFSVPPSARNFFLERSSAAASTPANHFALGRGFTDTAAAAAANASHQSTTTTLTGSGS
                     AARKSRRVEKCNVASPESRYSRSFDDAAALSSLKPFSESFNSGSAPSSWTDASPLTRK
                     ALPEEQQLSHTPAATGKKAASHGKNNSGGGRKGRRLRKRPHARSDFLLDLNPPPQAAL
                     EMAAAATGKANPSPSSTSAADAMAMPPLPSVASNTVALVDNHGTEAAFVSSSTASKTS
                     TRKPDAADGHVAARGVRLTQAYVETLPLASDAAAAGGGGGNTAVLPTSPSGSMSSFST
                     VASSYRRDVRVRASSRGSSEVPQQSQRPESDTAPCRRRHSSRGAGGDSSKLRSKEASA
                     AFSDSAEHGGMESHTPAAKATRGAGAAAGAEATSASSVVPLTTNPKPWVPSGRSAAAN
                     AVRSDPRSTAATTTGPPGDTSRRSSLARRSSTPKKSIGARPASATMAATARRSPGGAA
                     KPGSGKGAPRRTSASGSLVPPSPTGARKPTAKRTAAAADREPSDAEKSESVVEYAIGI
                     GDTEESEGPGMDVVHIDGGSRDNGLQTALEAASPQQPSPQQHADRTEDAVKFNDAKDG
                     FPEPERVPQPCDSNADDADEPRLAGFRASPDVSNATVITSLADSACLQLYTEAQLVTI
                     FGGSAARLHGCDSDDKHLWASDEGRGGGGAAKDVDDSEDDRAALPADLEMVVEHRAVF
                     STDGDGLGPSSVSATSAEEVMLAATPSSAARSNAESPTAKYRDAPTLTKEDTVPPALA
                     VSNGGNKCEEAMDYSPVEISSRSFSSGSDSHASEMQVTTLH"
     gene            <260482..>261213
                     /locus_tag="LDBPK_060700"
                     /db_xref="GeneID:13391669"
     mRNA            <260482..>261213
                     /locus_tag="LDBPK_060700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858328.1"
                     /db_xref="GeneID:13391669"
     CDS             260482..261213
                     /locus_tag="LDBPK_060700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858376.1"
                     /db_xref="GeneID:13391669"
                     /db_xref="UniProtKB/TrEMBL:E9B8T0"
                     /translation="MGTKGSKAVSSSSAVPAAATTTGDNKGTSNWWDGAVSDASDADL
                     GLTPDVSLSSDISTPEENAAKRKAYAHLKSPYARHRPAASMKGRGSSGNNGAEASANA
                     HVNLIEQIYNEDFETIDHIQALRLPPMVARQLQNTVRDEAERHCAEVEKTMARCLQDK
                     MWTSWKCQKERDTYYHCVEEIEQRNLRPDPTNPHWVDMLTSFRWKYNLGVFHGEIMGR
                     NNIMKEIWREHYPDRELPHPWVKDT"
     gene            <261955..>263178
                     /locus_tag="LDBPK_060710"
                     /db_xref="GeneID:13391670"
     mRNA            <261955..>263178
                     /locus_tag="LDBPK_060710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858329.1"
                     /db_xref="GeneID:13391670"
     CDS             261955..263178
                     /locus_tag="LDBPK_060710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858377.1"
                     /db_xref="GeneID:13391670"
                     /db_xref="UniProtKB/TrEMBL:E9B8T1"
                     /translation="MIRVFAKTDVPVMDIIELQGKIVITEEALRAARDAKERRRTSRR
                     ERRRRGAANSGTAVGEDASCTGDDLMPLSLVPSSSYPSSGCSSSRSSSCSSSSTGGDD
                     DDEGGDCATADPGELADVDAHCYSSHNSGDQRGAADSTSAAASAPRRTSSPGCPSPAS
                     PRRPRPNSPSASRRAAVVEVPLGHVEQDRLDEKRCTLCIDTLRVHGSRSSFKRPWLVL
                     RECTPARMRKLRRQVVRPQIPRDVTEPRELLATGDGGGGGGGAGVAESADGASPSPTP
                     ETTILFSEWLGQHPDALSLNSLFLDDFATGDGDDVSGCGPTAAGSACAASASASSGRS
                     GNGVGAHKRPREAENVGGTALDGPPFSPQSPQSASDVLSAAQTTAATVYKDYELVGVV
                     RGSVLFNSKPARVFQ"
     gene            <264311..>272206
                     /locus_tag="LDBPK_060720"
                     /db_xref="GeneID:13391671"
     mRNA            <264311..>272206
                     /locus_tag="LDBPK_060720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858330.1"
                     /db_xref="GeneID:13391671"
     CDS             264311..272206
                     /locus_tag="LDBPK_060720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858378.1"
                     /db_xref="GeneID:13391671"
                     /db_xref="GOA:E9B8T2"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:E9B8T2"
                     /translation="MRPPLTLRSSPSRHPQWAWGCPTPPPSLQAGSSAYETTALSRYA
                     AMATPTAVVAAAYSGRCASACAAPSRAQISSSSLLTAPVGSNGAPLPCGDGGGNAVRA
                     HVARAATTMTAAAFLPGITRLDGALLCRDGGDDGSYWHTSACRGVARLRTLALASTIL
                     GASAGLPAALPLGHAARHASTYTGRSGTGTEASFHEPSTQLHAAAAPHSRGHVAEESG
                     DGESVQTTFGSAHHRGRSAPSATSSRSPSTTPRHASAKAAVTRGGGSDRVSGAVLAAA
                     IMRHHRLHTSLHYLAISSGVEVPECAGGAYHLQERPPLRHSAFDTSAAAASGDRGGYL
                     TRSRTCANNVRISVFPAASLRPAPGTGGVSSSSAPSPDAWSSSTSTSSATAARASPTV
                     LHRDAAHLRAQQYEPFDRLLHRYLERGHVAYITQRLLHHPDAPAPAVLLDTILRHRLP
                     APSFVCQALLATIHTARRDRSTAAAAGLALDRVAVRLRTDEKARLLYQTPQVRALLLE
                     ATLQESLFDTAVDVVTDMPAEWITPHAWSQLVVMAGKSKLPHSQLLWRLLSLREEPSS
                     TSRSSSCETPMSVHPVLTRAGESALLGALRQRPLSASPSAVHLRDVAATVAATAVPHG
                     ALDARACATVLAPANGAIGSAVFADATVAGEELPSDEGDEESAQLASGGSEDQPSATP
                     VTAVVPAGSAAGGGCGVRWCAVGAVELGYAVEHHNGDTTPAAGDFRATGAAGALYSHS
                     SFQALLADVEREGVQEGGAAATSPAARARTLWETTALRMINSRHGIVYGLNATMAAQV
                     MLRCGVSFAAQASPLLALHVLRRYLRSCHLLRDQVVAAQRLVEAQLEAAAEGSKDRAS
                     RAATTTTASTENPPRSHHHGEKVVAADPYPRLSRAVMPHPAPFLIFFKVMRDARDVLA
                     HAVYGGDEEDDAVTALSAARRYRGTAAAAAGRAHASLPMMHWELVWHTFQQLNCENPH
                     WYTQLDVPEAGDLCLDAMEVLCHGADPWMTLNVARRVSARHIIDGVEMSLWLLNRLDP
                     SHHTDEAREVARKLFRWLLVDVGVHVQPPLHRHLVPAARALIRLGLQEELSTLYNAVL
                     DNVFLFTSEHRDAFIHVLCDLICPACASVLPEVDVYVDRACPNCMGVVPAKDADTIPS
                     FRLSAEHVERQRAQRKQRRQRTRQRLSASVRRLQQGAEGWTSSDAALCHPPRDAAEIL
                     RWHLKRDGTEQGGENGALDVPLSSSLLVATGAAAEAPLVPGVSVSTELALFPVAGEAA
                     SGVQVLDVRAAMEESSRRLELQRAARRYVLAQRGVRDVADDGAAGAASRVAFATLPMT
                     LPVSAQSLDSSTLKYLSTAANAAAAAGSTLTSKQAVDGAWVCVWCHENNTEWSSRVQC
                     SACGAETGPAAPWRGFAYAAASGDAMEELRGRMSNCEARPVDAVVAGYLLMLYRRTFQ
                     LRATPADQDRLLRLVEVLCRLQERVLAGYVYTRFIPVSQRRLGIPLSSLAQACGQDMS
                     PAYRALTQKDLTRPDADDIFFDAVFGAQTCRVCFGQHDWRLCPIVTRDFAASASAAGE
                     GRPRTAISLSPEEKQRAVLERLSQRIHQAVTSLAPSAAEPESAAASSSSPPMLLPPGK
                     PSARLVVDAYTAFVSSPFREIFAELHSSDANRLSLLLSRVQQYRRAAFVLCHVPPPQR
                     ATEAYLRMVHYFNVTEAEALALLEQPPTPTPTTPSKGPTASGSSRSGHPTSAARQVNF
                     VQVTQTCCMCLDARHASHTCPRLDEWLKGVQRLALSGSGSTSSGAAGEPSRSPTAAAV
                     LDIEGDARLRRRLKAQVDGWTTAGPERLHAFYRYLIAHVDLLRPVAFASTGAGQQLAR
                     RRADFDDPLVYAVNKTIAKLSAVGQRSETYRLYAHTPVEYVSTATTATVLRMNGFSDE
                     SVRVLLTCASSSSTDGTAIASDSDSFTSSHCSSLMQHAPVAARAAAVPVRQCCLICFS
                     PDHAFVECPELAAASTEVERLLLVLRNVAGIACVHDGIGAAAAYVYSEYNRGRLSADM
                     MRSHPELVTELLTLTRRCFATRQLNHGVRVLRRIPVEMVPPDAAYVDLWRAAGLPEAE
                     VEQKHAQLLALLDAEAVRPSIDPLPPRPTYTNAFLSKLSRTLHDDLCRHCYEHGHTIA
                     TCPLFHAEVSFGRDYVAAYRMSMMSEQLDRAWQEAYLLKLVDFFAAHYLFMPYHIAGV
                     ANALNAIASMWSFRGEPGIALRHLLRIPPAYRRRQAFKHVLHCLRVPPAEITKLLGDF
                     YFAPDGNATAVQQQQKGSGPHSTSRYYAQQQQEVVMAQHLLLPKPAIRDVARKQIFDQ
                     VPAAIAALEESEERMAEIRTRHERRGEGGGSITAEVRECLLRQQKSEQPGRRSAEMGD
                     ADLPHAAASFHAPALRHVMQSGDIAQLREDFDPILSELEDAVGMKLGSRHTLFTSTVD
                     ILSAATAAAAASNPTPAPPSPSALASSASSSASTSERSGINSTASSAAAPSSPTFSQT
                     PEAEVVTEVQTRHAQPRRPGSSGDRSHSSRQPSATKAPTTSSAAAAAGAASFSERIQH
                     QAGEGDASEPVGASPGRSSGSKDNDRGRGNMSGNGSRAGDGRNERRDARGWHSNRERN
                     PRHRGGSQSPSHAYNHDRGGRSRHHGNHRNRSDAS"
     gap             272698..272771
                     /estimated_length=74
     gap             272924..273455
                     /estimated_length=532
     gene            <274101..>276320
                     /locus_tag="LDBPK_060730"
                     /db_xref="GeneID:13391672"
     mRNA            <274101..>276320
                     /locus_tag="LDBPK_060730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858331.1"
                     /db_xref="GeneID:13391672"
     CDS             274101..276320
                     /locus_tag="LDBPK_060730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858379.1"
                     /db_xref="GeneID:13391672"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:E9B8T3"
                     /translation="MPNAVVTLTIVKAEALVALNPGGTSNPFFTATIGAQSVTTPVVC
                     KTVNPVFNTTFTFYGCPLPAMLTLRAFNKIQFVDIEDPLGTATVTLFDLQPETTTKVV
                     QLSHGGVAALAQRALNGCGAVTITYSVAPMPAEEADPAVENAASKPSSLPSSTAAPIS
                     VPAAHNIDGTGPASIPVASVPREGAAGTLGSVTHGSSSNLLASDPSATNPAATTARLK
                     PNEGATAAAREGAAPSFSVLGATPQQRSQLTPPSLSPARPPAIATYLVPQVAPPPSSP
                     ATMHMSVKTVPTNGYESYAVQGAKLPPPPPMPEEAAAADQVPSSTPAESYYANNTAHN
                     ASAAPPSSAADAPSLGSLATLPVAPNIPASTRFASLQESTSAALSFDTQQQTASASSL
                     YTSAAQAPATASQARLLVIPPHINGTVTPTFFHASQASSLAGSRHPSAGQLPASTRNP
                     SECFPAHAQPPPLAGALPVATAPRSPPLTSSTTSSLRSTPAAQSAQRRHNTVSFAASP
                     FPAENFVAAPSSASTCAAATRRGVAPASATAGLQHSAGAGAAFPSGADRCATYASASV
                     ASGTTSPRRRSPRSETEPGAEASAITSASQIYADKEYLFEVAATGADVEVFRRLRQVD
                     PTLTNGFLECLDYSGRSLLHIAAWNGQLRVLQILLCPQPAEPMIDLRSVVAAKSGNTI
                     LHAAACGGQAEVAQWLRYSHPTAGPLLLSMHNARSMTAAECAMEAGFPHVARLLMPN"
     gap             280180..280278
                     /estimated_length=99
     gap             281999..282097
                     /estimated_length=99
     gene            <283306..>283827
                     /locus_tag="LDBPK_060740"
                     /db_xref="GeneID:13391673"
     mRNA            <283306..>283827
                     /locus_tag="LDBPK_060740"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858332.1"
                     /db_xref="GeneID:13391673"
     CDS             283306..283827
                     /locus_tag="LDBPK_060740"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858380.1"
                     /db_xref="GeneID:13391673"
                     /db_xref="UniProtKB/TrEMBL:E9B8T4"
                     /translation="MLTETGAASRGSATAVDGATRTRHLWMPLLPLQDLVKQFTTHLN
                     HYGLTEHVPKALVGAMAMVSAVTDAAKDDADSSDGELHRALEAFTQYAHETASVELSV
                     DVFDSIRGAYMLHMHPLRAAAARAAKSDNAGETASLRHVPGVSIVRGCSGCFLHPLPG
                     RRGASGWAAPVAA"
     gene            <286876..>292164
                     /locus_tag="LDBPK_060750"
                     /db_xref="GeneID:13391674"
     mRNA            <286876..>292164
                     /locus_tag="LDBPK_060750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858333.1"
                     /db_xref="GeneID:13391674"
     CDS             286876..292164
                     /locus_tag="LDBPK_060750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858381.1"
                     /db_xref="GeneID:13391674"
                     /db_xref="GOA:E9B8T5"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:E9B8T5"
                     /translation="MYHPLPHGGGGSSKSVELHVDGRVSQVSLQAAAHATVADLLSTA
                     VAASLSTMSTKTLSPRELAKGFACTDTAGNRVDLSALAVSVPPQLVVTHTATAGSGGG
                     GSAGRGGGSGRSVLSASAPGRGRGRGRGRGRGRCGGRGRGGAAAAAKAQIAVDDEEDG
                     ENGVDAEDGDDGEEAESGGAFRGIASDGATAEEDESASDEPDGTSEGYSSDDEDSAEE
                     EDSDNADSSLATASTSTTTTRSRGDRGGATSSAGRGRGRGRSGSGRVAGRTSAASSRG
                     SSAPPTPTAASATAARRTRRRSVSGSPLLFTPDGLPIKRKRGRPPKSQQLAFATAAAA
                     AADAAAASSGTMSTAAGEKPPRRTRRSVKEALAEAATEEVKPRRGGRRRRADAESEEL
                     KGQQRASASYKLKGRSSAVTVASVDDVTGTLSGSDRRGGWRRGSGDAVTKRSRSPSPP
                     SQSSGNSSTTTTAAAATPLFTVPAVIVTAVDGTGGGCATPLSPGALTALASGAATNAA
                     SATSAPGARTIAALEQQQQEQPLRQQRRRVRLTYNAFYPSSALHAAVPATMGTYGGSG
                     AGGGTAGTRAHQAHSTAAAAPLEDPSARPMRPRYVWNGGDRYQQHSLPSAASSSPAND
                     VQLGGRGVRTIFSEAWATLSSCLSSTTERQGASSTASVSPTMVDPSHTTSASQLYMQA
                     QRIVSSWRAEQHRTPSMLLSHPYSPLLMPGLRVYQHPLPLLASTPASLAAPADANAAT
                     PSTDRLSAVKAEADDEESGAGSRHRRHHRCGAAPHTTSVAAAGPGAECGSSRVYCYPN
                     QTLIVPVVVGGCVQLVNPESKDKSHQWTVYVRGLWNGHPEEVAGANVRPPSSSHVQQL
                     RAFPSSPSSTPPARSNNSRASLGDSSAAADRGGGGGAAAAAAALGAMGDSQASVFSAS
                     TASPDDYLSDFIDKVVFVLDESFVPCVRTVSSAPFELTEVGWGEFIVSMHVYLKVPVH
                     TSASRRAQGQLLEYYCGFNGRTAMQTCDGRGTKPHDPVSTYVTGGVRGPRHLWNALTT
                     PPPSTSGTVPPTPALSLHELRHECHYDSLLDINSNSGARATYYRGPYLPVHLVTCDAT
                     SSSASSQPSSSSSDSDADGGGGSDGARGRSGSEVSICGGSPTDSAHALSFPTKSEMSG
                     DGSFSSSRSGSVTPSPAPAPQHHASLSSQQHEARMGGSNTAHTSSGCIADGQPLAGIA
                     AGVADASSPHARPPPLPVPTVGRGTGRRPRGFGASRARSGTPRSPANAGAPGAAGGGG
                     VHRTFTEVHVGHGGNVVVLQHLLRFSHRPRYAAAIPPARDPRTQGVHPELLGYTMVAE
                     PVVTEQYDELVIPLEPFAAVAGRGRSQASRRRQTTQRKGGEASPKKPDTASAEAKLHH
                     LMAASSSLEGHLRATLRRQLSLMCGDSPSQSFHALPPLSNSEAQALGHPGGISCWPHV
                     LDYGNGIERDTSYTAAYLASIATSAEMEGWLSQALGARRAALFGSPAAPCAWVTTADD
                     AEEPQPQPQRDGEAAGGCKAEGEGCDGVANRLPGRVAIPSLIPNPTTTGTWLTALEYD
                     MASALLRLAAGASVVTAHDVFFHVVLPRADDIGAAVWCNLHEGTHAALTRASAVGAFP
                     SDATGAAALKAEPAFGCTSEVQQEAKKGADVRMEQAYADEERDGNEMLSVSSATALSR
                     GYPLCSLRPSDTGIAALRNVLCANKGSGSASATHHPSQEALMASLLRDGQSRGSFGHD
                     SDVAQLMTWKAALEDAIDTMRVEAARRQATAVMEDL"
     gene            <293379..>294395
                     /locus_tag="LDBPK_060760"
                     /db_xref="GeneID:13391675"
     mRNA            <293379..>294395
                     /locus_tag="LDBPK_060760"
                     /product="threonine ammonia-lyase"
                     /transcript_id="XM_003858334.1"
                     /db_xref="GeneID:13391675"
     CDS             293379..294395
                     /locus_tag="LDBPK_060760"
                     /codon_start=1
                     /product="threonine ammonia-lyase"
                     /protein_id="XP_003858382.1"
                     /db_xref="GeneID:13391675"
                     /db_xref="GOA:E9B8T6"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:E9B8T6"
                     /translation="MPTFSDIMAARKALDGYVYETPIIESNALHGKTRHESVLLKCEN
                     LQRTGSYHVRGMTYRVIRAKEEDLGINNFVTHSSGNGGAALACAASNFQSTAHVVVPE
                     DTNALITRSIRLYHGNFYYCKPDLKSRVEMEARLHAEFNKVAGKKRNQCMLVNPYSDE
                     AIIAGHGTTGIEIMLQTDCSVDCVVIPVGGGALLAGAAIAVKGMKPHVGVFAAELAVP
                     PDHYTVFKRGEVIEARKLKGDEKRPKGNKHGIRTELTDLANSYIDRYVDGVVHVSKEE
                     MCYAFRYVYERCKLVVDTNAAIAVAAVLACPQELSNYRRICIVLSGGNVDLNDVPKIA
                     TARL"
     gene            <296647..>299448
                     /locus_tag="LDBPK_060770"
                     /db_xref="GeneID:13391744"
     mRNA            <296647..>299448
                     /locus_tag="LDBPK_060770"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858335.1"
                     /db_xref="GeneID:13391744"
     CDS             296647..299448
                     /locus_tag="LDBPK_060770"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858383.1"
                     /db_xref="GeneID:13391744"
                     /db_xref="UniProtKB/TrEMBL:E9B8T7"
                     /translation="MMLSASSSSSSSRWGPPLERPASPQHPQQQQQQRVLQGNAHFMS
                     LLQRPREGPPLPQVPADNAVPAPRVAAPLPAQEQQQPLPSHKPSFTAAAAVLSPNAFV
                     QAPPQLQREREHPQHRSVPADGTSATATSRGGGGDIDDSSSAPSDASVPASWPCESSA
                     LPHHDEDSGRSSDGTYQFTTTSSTMTGRRPVSPEHTTSVRSSDDTTCLVDLRRRDAAQ
                     VEKCDRRRPTAPGAVGASAAVVSPSFSTSSCGCPSNCACRSDASDDDVFGVSVDAHGR
                     ARPAWRVRPASWPRAASADERLDACTDCRERAAQDMTRCSDASSETGTTPLQRSSEED
                     GDDLCSSCRQHRCDCGHPSFEWRRAQRGDGEFSLKLSSQGSSEGDSGSGEDASLCSLC
                     KDAARTRAVHQAGAAAFFAHQEDPFSEAVREDRRCAGVPPLLRLSTPSSSASTKRGSA
                     SDAVTMAQRERADRRMVYMQSAAALASDAGGERRGAHDAAVAAVRGLDRCTGSTQTDT
                     VAAAAATATLSEEQRRLHAEQEAAALKSIAAAHVAEVTRPLLQGELASFEARAAVQQQ
                     ARFDVVESQLRVYLDEFRQRMQELSDLQMQQHATRQEEAEAVRRAAARVDRATSPMDS
                     ALIAEAAASTPQAAPSPVPPQRTVGTQHSDGTLELLTIVRTEAASWMAQLLFSIEAER
                     RDAVMQDEAESRDRLLHVMEEPRRRQLLRYQAELLHWQQECAAVRHRASFASDLLALE
                     LRERLVRQELNEEASVARRELGEAFERQRCQAAEAAAHSQVKALEDELVKVRSKLSIV
                     EAEHADTLEHAKQLRLQLIHALRMPTVTLVDRSGVPAAARGAGDAAASAAYAYANATA
                     ETGPGDTLGMRGDTQGCADRALKAHAASSTGSGTGVAAWHTVPSGIHEGLEDLPVHRR
                     FARAHQEALRVTRAQCRTV"
     gene            <300208..>302313
                     /locus_tag="LDBPK_060780"
                     /db_xref="GeneID:13391745"
     mRNA            <300208..>302313
                     /locus_tag="LDBPK_060780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858336.1"
                     /db_xref="GeneID:13391745"
     CDS             300208..302313
                     /locus_tag="LDBPK_060780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858384.1"
                     /db_xref="GeneID:13391745"
                     /db_xref="GOA:E9B8T8"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:E9B8T8"
                     /translation="MDRKHTRRAGLPSRPGAPRSGDDGAPVAPAVAMQRGRGGSSWSS
                     DGPSPAVLSSAGSLWSRVCREVTSWRRGTVSIHEVDAWLRFNPYIRRGFRHRFLRKRE
                     ALGSIVLYFHNETFNIVSHLAMAVLMALLLLWPPRVTAMSSGGGASDIYDGVGGGYGL
                     YTAAASAGGQGGGGGAYFGEHAAGAPFRGHRSEAAEVPSWLRGLHGLAAASGATAAGT
                     DNDGTQGCAPSGDETAFPRHVLSDAAAGAATSSPSFRFFASLSGDSAAPSSPAWIVSG
                     IDSALPPPPMSVAARLSLSLTPLVLGFLLTFVMSVLYHAFMPCCRSRRGYQQLLQCDV
                     MGVVCAISGSAYAYFTCGMPCAGEYVQAWTAALMVAATLLCIYVVVLVPMWGVVADVC
                     ALALHLVQWVAAAVIAAVLEFLMGRPLPSAPPCPLPVQRGGRDRDSQSRPLPPPEHHS
                     RQHLLLAWVQQHRHLYSVQLGDAPTAAAPAVAANTSIDLVPLSALQRSTVVGAYCLLH
                     LYVYLALVYPKSRAAMGGFTQATHYHNASYVWLCLGGLINAARFPEVVVFHWTRRAAR
                     HTRRVAAAEAAARCVDELRRDAAVAEMDARGAPMASSSSRGSARPLRASPGGVATELA
                     AQATSVLSTSSPPATTPTLWDRLCIPKLMVTYVVSASTLDYIGNSHNIWHVCTALSAL
                     SAILGVYYDCMEYDLVQCG"
     gene            <303416..>306970
                     /locus_tag="LDBPK_060790"
                     /db_xref="GeneID:13391746"
     mRNA            <303416..>306970
                     /locus_tag="LDBPK_060790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858337.1"
                     /db_xref="GeneID:13391746"
     CDS             303416..306970
                     /locus_tag="LDBPK_060790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858385.1"
                     /db_xref="GeneID:13391746"
                     /db_xref="UniProtKB/TrEMBL:E9B8T9"
                     /translation="MLGLHHRHEPLARERLLPQLKPAQLHELGQEVGSSQEASQPSRT
                     LSPSCHVAAARHSACPIGIDLFASRAASDAPLHPSAPKTTLAQLTHPGHIAGCPPTEW
                     PSSCTTPPSSDGAARVFLCVDNTSAATAAAPAASRYPSAWQTLMAATQATTTYAASVQ
                     QAKQLLRDFEGYQRSVGASPLNHDQRRAKLTPGCLESGSGSAGTTNCPRLDVDALGQR
                     GTPSATISTKARGSAPSFGTGHAAQPPQASPSSSPSLSFPLDPAAYELARRRSLQALH
                     DNARARAAYVDQGLRLSRAVHAALLKRPGMAIDGVVAMEGSSGHPTSTAMAHHDGQAL
                     SPAAGAGDAPRTSNAAASPSLAAAGQQKTDQPPIAAVPVMSVAEQAAATKEAERALSL
                     LCTIRAMRRQTEELTVLLLHACGEYGCWSVPTAEEGVAWGTRRTPLPSSPLPRRVRHS
                     RHLFTDLFMAAPPAPAAPCTSPSGSPVGVSDGPARAHLLDLRAAEDADTARLSAASVF
                     AKESACRRERACRALRQALQQQRQRWPLSTAAAATVTLAAGAAFLEMALAPPQRAVPP
                     PPPMSVQLDLYAVQQCALHSSSHEWRRGAAQTAATGATKTDGAPSSEEAASPHGSLQQ
                     LLHTLRRQRPQLQRSYDVLHAAAGQRHRTNTHSCTDEQRGVPSRETTTGVTKAVEARA
                     VAHKTRGTSAAASDAPQQVEAPLLPSSSPPLAVTPDTLRHTPSSLPRQHSSTTPSSSS
                     QALPSSDTLLRLPVQLAVDHTRLWADPPTPLQRADFSRAAAAAPTSTEISGRGARIPV
                     QQAGRSAVEDASSHRAKGKPELEARIEVEVIGGNAGGSHAAAGAPPSNSTQVTSMRRT
                     SLSSSTPFPSPAAVDARGGVVGAPREVCEASWQPCANAMPSTRPEAARDVAVKEGKLA
                     SQHQKERRRRRGDRGGSATAAELEDSVWRHLTRWISQQQKRTAPDAAASLSSLALSPH
                     DLSAAAAWLRSTSPRFAISQTVAAPPPALVRILKHAFPDFVAPSSWNALRAAPTAAVV
                     VEADQPDGDEEPRAPQQPQIQPPSLTITSTTSSHPYSAATSSAPEAARLPRRPPPQTA
                     PDGPAVSHSPTSSMKFSQAPSGGTDTAAVAPPGQLLLAPVAAVNPRPAPLSAPLPPPP
                     ASSPKAKPAKGGGSAGVTKLPQRQRHRNFFSRLFRCGG"
     gene            <311064..>317042
                     /locus_tag="LDBPK_060800"
                     /db_xref="GeneID:13391747"
     mRNA            <311064..>317042
                     /locus_tag="LDBPK_060800"
                     /product="RNA-binding protein-like protein"
                     /transcript_id="XM_003858338.1"
                     /db_xref="GeneID:13391747"
     CDS             311064..317042
                     /locus_tag="LDBPK_060800"
                     /codon_start=1
                     /product="RNA-binding protein-like protein"
                     /protein_id="XP_003858386.1"
                     /db_xref="GeneID:13391747"
                     /db_xref="GOA:E9B8U0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9B8U0"
                     /translation="MPNTCSKGQLLDVSCAMRATDDSDTAAPGDGADGADRHALGSPG
                     DGVGGAGPQPHPLRRQLGLEGCTDAFSSDEGDASATPEAAGGAPLSGEVDVCSSSLSA
                     TARHQNLLNHVLLGGDSEFTLTGGPTIHSAPSPAQELMASGPAVAATATHLPVSSAPS
                     RSFSSQGKPLSAILVPASRSDDSAAAARCYIDPFAAAVVGSGSTSRSSSVGIGRPCTS
                     TGMEGLYGDHYVHPLLRSRSGRSGGSSGFFGGADDVEDDEDGSAALQAAVDAAVRFDD
                     LASEDDTVSGGGERRRSLRAGPTALSHLLAVASDPEDGAFTCAHRTKADFSSPFGTPG
                     GLGDGESERHQPHSPKTPGMQQCGRRGDRRTDGRPQMPNRAAIGATATPSSAPYFAAS
                     GSAIVSPLQSMQPLASPAAAAPNPATTIVTSAHPGYAAAQAQQPPQQPLYPYIVTSAG
                     TVAKPSAPACSLTSPQQSSIPVPPSRNGARQLQLQQQQLRDHHHQCSSSLHPSPHGRK
                     ASPVAVPHTFPAGTAAMPKLDDVDSFRYVSPPQASIAATHHHSVSGASIGGSTAAQNS
                     TDISFAVQLGTAGSGTGTGIGGQTPSNSLLSSPSVQPFYLYQVPQATVAMEPPPPQQP
                     PPPGSANVLLYSPPQAYVGLGQVVAAHLHPAPPTTAAATAVLGDSSRARSTSTPSGSY
                     QRPAVTQQQQPQVIGGYTLMPSAAAAAAAAAATTPSEESGRASRNLYFRNLPHSWNTS
                     MLRELCSRYGAVLSAKVAHHSTTNESLGYGFVLFEHKQSAVTCMAMLNQAHVHAEGEE
                     SRTLLVRMAHATAAPGFQEEGASDSTASSLRQPTELTPPSGSVSRAGAAGGRLPQWIL
                     QQQQQQTTTSGLRSPRTPLSGSASMMLLSPGSAPQFYSRELSGASVADAHRGQAPPHS
                     IGDSIRTNANASSNTSCAGGDSLRCTSPVGGAGNNSCVAVSRTSMPPSFSETFNFMSP
                     KGAAKALAPPLRGLYRVPSTNTTSSLLSPHQPHQLQQQQQQEGSLSYSSASASRSATA
                     GATATATAMAAAATQRAGCNFCSPLSLSPNDTASLLLLSPSAPHPTVQLPQSLHAPCA
                     SVSGKASSAKPASATTSTRNVYITNLPLTWNTTKLRELCGRYGEIVSASVAHHPETNG
                     SRGYGFVLFAEERDAAACVMALHHCRVPASPHVLRCRFAKDKATPPIAYALLSPSQQP
                     GRDSVGSGSGSPLPTATVGGSPTAATSKTMVPMIAMGGDADVFESSLASNGTGNSTRV
                     STKGAVQDAVCMPIDVFCTLQQRVHAQCVQYLTQKHQLQRKGTEDNSEPTSAVVTAEV
                     QSEELENMMRSCVVYGAHVPTQGYGCVRPMDCRKASFRRAVARSPTAAVVEDAEQLLS
                     GPPAEPSTPASSGLRSVGSALSTERGDPSGEVLEAADTAAPVTLPGTAVCTHAIAVGC
                     AQPASPTLAGTTTMPAAPSTRRSMSDEPSCAPPRGVGMPDAESASRVATPEAMASPAA
                     PLELWYTCTLFTTQLAAEAFVRAAAEASLGSGATINAGRGDFGTSSGIVVDASTVQLS
                     SNGKDSLADTTLPSPSPSFDKTAKIQQTRFGLRDQVMVLSSAPLTVPAAPLSTSSAND
                     MAANSTRLHPTEEPNTQHRPTATPPQQQYQWHHLRPSHQLPPPTPLHAQTRDGSAAAS
                     ATQPRGSSLCSATGIAAAAAHPSASMAEPAPELSQPPHLQQQRLLCFPSSAETFLCSP
                     PSHAAHYTYPRVALTSPADGATLTSPTPLMMVMGGDGDGSSSTSSTAAPLTFPKDLVT
                     SASAGAAGRYPSATVAECAYLLGSPASTSSVSLSTGTHILSGSTPPPLGVALNFPSAS
                     STHSTLFSAAGAGSPSGHPAPAVHAAPAAFAAAPSHMAATRAWSVATSGAAAAMSNVL
                     SAPPPVSSGPSSSLSTEQAPPPPPHISYPLGSTIYAVPEAAALTAPATGGPPVFSAAP
                     ISDAASPATPASSAQVSCTTPNATSQRSAQPLHP"
     gene            <322571..>332602
                     /locus_tag="LDBPK_060810"
                     /db_xref="GeneID:13391676"
     mRNA            <322571..>332602
                     /locus_tag="LDBPK_060810"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858339.1"
                     /db_xref="GeneID:13391676"
     CDS             322571..332602
                     /locus_tag="LDBPK_060810"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858387.1"
                     /db_xref="GeneID:13391676"
                     /db_xref="UniProtKB/TrEMBL:E9B8U1"
                     /translation="MDRPLSNAKDGDGVAVSGPPPAQATRLSAAPVVGASGSRRGSCN
                     RSPGLDTTTNRVSRSNSRSTSGSGVAVGGAHPGVKSTGAVVPAAALKAFGMKRRSGSD
                     APTSPQPPSVPSAPEAPLRKPRRGMGEAVASRDSPACVPSLSVGISIPSRATDDTPPV
                     PTKKKSNGQTSQSELSGQQSPNCRAARTSRVHHGRIGVSAQLRFLSVTNCNSHASLLS
                     GSGSRIGCSPVLREFARESFSLATASDDDVVKEDSACGQRSGTTATSSLSSSSTAPRR
                     HSLTPHSTNAQYGARAVLIPTPPAVAAVGVSSLSSPHDLGGGSRPDSHAPVYHGSDAA
                     RRPSLLAGVKPAHVSTSSVGSEGRGESGCAQPPSVSRAGLSSSPFARCPSLVSSTNAG
                     SPRDGTAKRSLAGCPFAAARPAPRSPSLSFADTNTSANTTASSPSSHTESTMAFGTST
                     TVMALASATGTAAMPRLNNAAAKKSLMSSAVASPHLMVPQRLASLASRLPATTCSAAT
                     TSTTHTATRDPKIISEAVLTTSTTATSITPTKGRRFNLRLSMFPVTASVATTAADCRV
                     GSTLSDATHAITESAAVAAMTRASATAQYTVLEPLTSPSSSKSIASGITSAVSPDKLH
                     PGPDGAQLCRRLRGSSELVASMPSMPSAPERLSGPTPLAEASTVIQGSHQPSPTQLSR
                     QSQLVDYASKEDGSIVDMPVLTGRAASPHIPDAPPAASAAPPPLMRSSLSSVCSSSAV
                     NSSLVRRQGSMPLLSASHAGAAMMEAIGDGHGGQQASMVEKCGSAASPPRMPHHPQHA
                     ASEDGTASENAVLEVRARGTESPHLRSTTIASKLSPSGGGGTQYEAPPTLSSLDIVGV
                     GKDEEGGVGADVVFVAGSSPLGEKPMPVPAHHSSGSNDRDDAAAPRGGVPRLHNRLSH
                     DVALFPQTTPLQSALSTTPSRSKASSSAAGQRGLLTLFAELPSASPAATEAPADPNGD
                     CGGSAVAAARDVPRLREGTGIGAMPSILTACPADFGGGMDTAHLSGRLHAGLPAPPGA
                     PTLSPRLEVAERDLQHQDSTAPPPTFSSHTAEVPALAACASSPDGADVVARAKDAAAA
                     KAMPPSSCFAGPLAESGLVTPLRTVPGRPKPGTSGSRIDSRLCTPSSDTSFLESKAGR
                     LICSSTRWSVPTVSLVSTTQLPSNGATALLPTQGLATPRAPSAYPRGTHSSPKALSSV
                     TSSAASSLLMRGAAAKSPTAGASRPPLSPPHLAAAAAAAPTPSTASDIAPVALLALAD
                     VASLSPRSASLGDGNKVALAAAQHRRTLDALAAGTLRSTAGSVSVRQTSSLSPFPPAK
                     APDDDTATWATPRSGSNSRVAVSTPNPPQRAGVFPSMPPPPSLSNTGGVSSLASHGVC
                     PTTTANAHRFCDCSDGSLSDIGGSILTHHFVSSSRLVFDAPTTPKLPLHTGASAATAA
                     TAGAVGSSADVSSDDVTVAVGTSCGHDEPPAHDSLTFTEDAKGDERAPVGGGGSGAAT
                     VSTEAGYAAENPAHTQKTDSSLSSGRGNSTGGSGGDGDHRPSAARSFSGQATPTHRTA
                     TDNTAHHLSATCVMELPAHRPIAYLSAEKKREPHCRHHDDSKQPQRIEPMTSSQTAQS
                     DSGAGRPRLTSLSSMTASANGDPLHLSTSACSSSKDVPENPSKSIVTDDGDDSARRLH
                     KSKMPSLLDVDRLVSWLRSTSENGKSSMVRPSAEVDIGADGSATEGPGADAQLQASST
                     TAADTLAVSSAKGTSLRGTASKTMPYADGSISTNSPLLVRDGTRAGPSMCAPSLEKQS
                     CFGDPHTTAHTAPTVPNAAAVVTATALSLQLSQSSTVSVHASVPADVGGVALCGSLDA
                     RGSACPLAVPSLPAGCQPHRQRAASTLGRGGPHAEIMGSSKGARAIVDKNASAAECDC
                     EADETRSAAAEFSASTAAAASQLSVAQGDHNTRSSSRLSVAPSAPSDTAKAAEAAAGR
                     RSVASAPASTEVRDAGDKHANDRCGGGPSRPVPLSSAMTSDGHRTDAAASHTQSQLHE
                     SSNSSLPTPRSTFLGSVPREIKRWAIAVLRRHRNRRSSGRCTGTEKDGTGSEVSSSSQ
                     ASSLCARTREGRSHPPAAWKALEVKSARPLYAGQGQQTYNLFQSDGGVAMANGAAPAP
                     LLLPARPLVPAASSLSEAPLPGVRSNRTSRSSSATSRSSFIHTAPLTPLFYSVLDYAA
                     AGADDGGPHTAEVPYSVFGSAARAFRRCFSSAIAGGDGTNTPEHKRASDDTTASGSLA
                     SPASSTVVVLPAAQNSVITLAAATQRNVFRGTPLSRRTFLSALSGTAAPTLDAAGNAD
                     EISLAPPMPDLPACPITTKTVSMLQPGSDQLSGRTSTLHATDSTATSLSATITAPSSS
                     SLRTTQPSGSSGAAAATALSSLSREPKYAPTPTNAADGAQSPGSAPRLLGSQRRRDRS
                     TGDRDDPLGGTAAHQNVKADKHDQPPHHSCHLAAARLSLEPHPQSTRAPATARRPLSG
                     CYGEDTTTIASMSRRGSAAITVEGCSSNTVLVLDAAHASALHTSLIPRTRCFSPTMPT
                     VAAKTSCGRRGGNRRFSAGCSPLHPLAAHERWPVPTEKAESAAVAHDKMPSRIVLAAA
                     AMPAPQVTSVSATTSTITTSTPYSVSLTDMSSGGGFERGAAGDPATPDATENRACGTL
                     SNSAAAPSSWQRSHTGSFGGGKVNVATTTSSHAIAHPFAPSSSLPFMNSAGPVHRSGE
                     SSGSIAGGREGAVSRASVITATAPSTGADEGRSDDDAANENAATPPPAATRTAGANYS
                     PPPLLSCDASPALFHLSSPLAFLHDRNESFTSGGIPALMLDDHDRNSQLSSPKRPRSD
                     TGVPQPAALCSAAARGSVSRHQQDQQDRVVPVPAPPDSPARPSRAPSCTGATAAIPSP
                     PAATSNYGVHAIVRTTAAGEAYTMLCGGNGGNGGTAGARAGSLNTTSHSVHDSPSSTV
                     DAGAPAAGAAWPSANIPPFHYSLAQSPHATPSSPLSGAECDLATPVPPWDASGSGTRS
                     GSGSLGGGHSVRTSSEFPSGTLSSLLYIPPELRRGPQWRHLKQHLGGLNNISSPSLSA
                     IARHRRGRVGAARRSSSHRQAAPTSSSSLAVLAAAPGVDAGAKTPSRVSSPRSPSERC
                     IAPTALAAGRRRVSDGAATNSAEELRFSRSFKANCSYKTLSYQVIGMRPLSDDVSELS
                     LVSAVNNATVATVMSEWPSGNNASSSAMSRESTSMHANDVLPTTAAAEGPVVGARPSY
                     ATSSNAVHGSEEDEASSDTAAVTAAVHVSLPSRLLLRPTHERRSARLREVVGDGRPLR
                     VPAVVIQSNADIDEGHNHPDRGDRDDGSDTEASANTHATSGSMLCHCRSPR"
     gene            <336256..>339480
                     /locus_tag="LDBPK_060820"
                     /db_xref="GeneID:13391748"
     mRNA            <336256..>339480
                     /locus_tag="LDBPK_060820"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858340.1"
                     /db_xref="GeneID:13391748"
     CDS             336256..339480
                     /locus_tag="LDBPK_060820"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858388.1"
                     /db_xref="GeneID:13391748"
                     /db_xref="UniProtKB/TrEMBL:E9B8U2"
                     /translation="MWPSRAQQRLPRLLLVVVGTATVATAAGETADGISHDFWWWLAL
                     GFSGFFIVLLIFTLLFSWSRSLDASASVPASSLHGRRHQQKQDNVGLFDGATFVSPAV
                     TAMRNASTGMDGTSHGPGEASVSLLQYADHTNRCENAEMMAAALEGGVTPLSHYGEPP
                     APRPPATTTVLLAGHRPKKVTPASSRRSLDIHFRSAATVAPRAALATPPAAASLPKQL
                     RSFPRAQRHRCPNDLGEVTPEADMDVAVSSLENPLTATDLHRAVPKLLADLVGGSALH
                     STPAAAAGEGRGGDDTPRDLPLDELTFSGAPALAWHGKPATQPTSPVPLQRASSQPQR
                     SSSSDEVKQYYFGFKRSQETAATAACSELMPRRAWHEAAHAPVHRRSSQARRRPAEVQ
                     SEPAPGASREALLTNAPTTTVAAAALASLSPHDGAMFKPLTLTLATMPPFAARESGDA
                     TSLTELEPSPQGLHMASEDGAAAAGAATCRSSPRKSQHVSSLSRRRLRPELFRASGDG
                     IPATAKAAVCRAQFNKRPVAQLHSSDARPTRQLLILHAAPASANSKPRGHWRDRPLSS
                     QPPVRSRGGASSSLAAQRTASAGSTTAVRSVSTTVTKGVPQLFFGKRGASPVRPPAAA
                     ASSQPTAATAKGARGGSGGTAARRPPIAKPLSVDHLTEALAPALVSPSVFSSVSPQPA
                     AASVARGSPAPTMFTAAGGASISPSGWAVAPHRGSFSPSMNGRSPLHNSPRRKRSASL
                     VTFLDKDDVRAGSEPRGVHAPPPLAQKVQLPQSCELSAGPPSSFYASPSASGSAGAAR
                     LERVSDPAAATAATGVDVAPVLRNAGVAVAQGHQILTLPSAAAAVERRRAQSPATREP
                     SAAAPATPPHSATTATPLELPTDVAARRTPAALAQPAFLTTRHHGGGATAAAALTPGP
                     AEESRGIGAEESCDSDDGDSVSSGASTVAAGMLPAAPRGRRGTFTTVPPASTVTAQQR
                     QLHSTASAYSDARQQLFCTSGIEVLRITHPTGVVQESPAPLSALARDPRHYDVTHTAS
                     HYPSTTSDRHLLAAHSNAALPARSHFSGAQVTNASATRSTGSIH"
     gene            <340786..>345606
                     /locus_tag="LDBPK_060830"
                     /db_xref="GeneID:13391749"
     mRNA            <340786..>345606
                     /locus_tag="LDBPK_060830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858341.1"
                     /db_xref="GeneID:13391749"
     CDS             340786..345606
                     /locus_tag="LDBPK_060830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858389.1"
                     /db_xref="GeneID:13391749"
                     /db_xref="UniProtKB/TrEMBL:E9B8U3"
                     /translation="MAAIASKDTAGAAAAEIESCMNPLSPPQESSTRAHQWRLVDVDR
                     DSAATARPGTSVWSMDSFRESTLSSPRSDDVELAMVAPALSWKEERRQASGAAAADRK
                     SPPLSGAPLSLQDHAAVSHRLQNLQIRNRAQRQAVRSSDVKEDGAAAGDGECRSFTRC
                     VLHSEATMEKRSVSVARTPSTAAPQPRLTGEHPQRAPPSQAQQPHPKHSPLLSFCQSA
                     PHQLPLQAAWVSGGGGGGRAALNPGDEPLSTAYTAAATSEANSTTSGIFPASQWIRAT
                     LGVLPTRSRPHKETVATSPLPPQPVTLASRKNPPAAQAATQLHERRVAAALQSQKEMR
                     EFMVIMRRMEAAGGANAVRRQTHQRRRRETCDGAENGLLACWRASHQATTPRSNSTVS
                     HPSEQPSLHGSAGAGDGGRASMDGEGTDKDEARSSATFSEMTELDEDDHIVATPGPYL
                     RTGSAAGPVQATRVRGRRRGARGASEVVSSKTLAASAEVAAAANMSRMAVYKLRDRTA
                     RGWVALQHRRVACMRAGTPVLQREIQASQQRLLHAYKGNTEGSGAGVQAQAGPREAIV
                     EAATTDDGLMSVAGLPDGTPNLFKVPVAGNLMALTVSWGGIPDDVQPDDGAASSDDDS
                     VDSDFLNMRHSAANAKRVTQAPAADREADGVRGKKNSGGGSGVGGGKDSDPLWFGGDT
                     PLALIAAPDQRRTSLARSSSTLSNGTLRTANAQTLTSASCLLGGDVATLEQAADNTTC
                     LSARASVAAAAASGAAAAEEEQYLRNELQRRLAQASECTIYGLHNALCGTRGGHPSRP
                     ARTAAAATDPGVVVGGADAAPLSSPEVAARRHHLGQSATSPDLRFPAQQTLSRRTSVK
                     MPSIIQTRNAAITTPASATAAGALERRADASLFPPDSCGSPNRRKRQGRAQLGSDAAN
                     SMSVLSSVPAAPLSTLLLPLGGGGGTAAAARPRAVAAQAITSVPSAFGAQTPADSLAA
                     AAAVPPPSGRPRRKKSFPKQKTVRRHKPLPPVIGVGEHAAVLLQQELLATRRWELEAE
                     QAHAHDIECTCAMLQRLRPLREQMMACDTCPGTRRTGAAKRVAEEPTNPLLLMRSRTL
                     LSQMATPPDAALATPTPLPPPPPPGLSNARLRSTAVTAKGIAASPPPRRNKADAAIAR
                     SHLPQAVLCRQRQLIYDEAVRLDTGNRLEAHTAYLDALTQLAHKHVPSVSWPAVSALM
                     SELRDRLQREAQLTIGAPSATWDGTASKPTVQAAAISSSSSALALTATKPTARRLSSS
                     STTPSLLRTSAALQANPPAPPPSAQQYGGLQQLIATHLGVLELTQWPVQEVLQHLAAL
                     YRVPLSLLHEWIAEQQRRYSRPYSYEERFLAVDCTIAGRAATADAVLRLTLHRCRRPP
                     LAPLQISPRTAGSERTGYVNSLQQQQPSGEEGGLYYIRVRSAVQSVASTAVPLSLTAA
                     VPFSGAAAPVRAFSASSGKGAHSLTVRSLSAMASDASTLPPSSCARALNFLGQTLIVN
                     LLSAAATASGRSRDHRRRTATRGTLIHRSNGSSGADADAETDGSVLMVELMQAGCTTP
                     LACGELNLRKLGFNAHNTNNGGGGGSRMRAQNVQIALRRKGYRSAMLRTTLEMM"
     gene            <347400..>358178
                     /locus_tag="LDBPK_060840"
                     /db_xref="GeneID:13391750"
     mRNA            <347400..>358178
                     /locus_tag="LDBPK_060840"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858342.1"
                     /db_xref="GeneID:13391750"
     CDS             347400..358178
                     /locus_tag="LDBPK_060840"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858390.1"
                     /db_xref="GeneID:13391750"
                     /db_xref="UniProtKB/TrEMBL:E9B8U4"
                     /translation="MQRRGWRPGHDPPGSSPVTWLSNTSCTFSYASSAAARGALICGA
                     AAASIVETQQLADAAARARCRAHCRCGSAATALRRSSLQLPTRRLQSSTLASAPFIVT
                     RKCPLHTASSPPPCAEPAPQGHSGGDGRFSVPTPSAAAAATDSTRQEVVHRRRQAKRA
                     AARSESASTSAEKRASEEAGRYGRDARDTSSGHPRHTKQPLSAAAASQRTPMPARQDE
                     CIPGQGPALLEAARLPAPPTRYNATPESICSYLLTLRRAVSCNRAGTHLSSMTRRAAL
                     VFMHQILPTLMAMPPVPEADLLTGSTVSTPGGDAAVERHDVESGASSSIADAARASCD
                     VEPLAHPSFPPQPPPRASHPNTLESLPASADASRQLKEWGKGTVPWTEPLAEAILLMC
                     NRLDCEIRQMWVARAALLYLVFEEGKACADPLQPQPAALGAPASSPTRTPRSTLNDKA
                     QLALALMRTLEVHRRQSRLMREVLRPVTMRFALQLREKANAAASSDGLGSRGEAAAVA
                     LSELRSRDRRAAGVGGDGKVAAHASFVPRAVAAPLPPRESSFVNLERYLADGLLPLLY
                     GEFVHYCRAVEQWHDCSYRAVAHTTVEATTAAASTAAAAPAASPQQQHAPRPSAQDGG
                     TCLPYMSRADIETFSLLAAVLHRALGLRGVARCGDEVYFDLNGHGADAYTSVAPRSHG
                     IASDPSGGVGASADHLQYGREQLRGSMTDAAPAGAPRPPRKPRCQPAVPLRALRLTIE
                     AITARLDADGGPHTGAQELVSRNSMQQVRAGYDVRTYSPPPFVPPLDARGARGGGDPS
                     PPSSASSPTSRFGGAAASSSARSPRVPSATAPSPKAAREGRCHGGCKGHDCMTTGSGS
                     PRTTTTTPSPLDGFGNFNIGSFLPILTLCAHDRSFNIFVTTAADRTGVHAATTSVAGS
                     ASPASPTPAAEPSAPPEEDVSALAAAVSRLLLLGVYWAPLCRTYQLPAVLAFFARATT
                     VELTHAAAEKSTSAAAAAAGPSPHPASSHSTAASQSTGPAREAAPAPLDTKVLQLVRD
                     AFLPPSDDLAAPSSPFVQQLSRLIYSSGRYIEWLNFGTFANIAATLDRVLSQWPMHHA
                     DVATAAPARFLSGNADVGCGCASDDRGGGGGGACVATAATASSGGELSSSAATSSFQR
                     HDVVARDAGTTPAADAAGTAVAPHATGSCVVFRAPVAAGMATLHVFAAIADEFWSREH
                     GRIMWQAISRQARQRLAVMSSTALMRAYSTRFLGFSTHTCTYTRLRVAVPNVTGDGTT
                     TTTAAANGVREILTVPFYVLRLMGVRSAAAESMGTPDEVLRVYRTSERAESYMAVLNA
                     LGSTTAARPLICEYLRSDFMWRTIPNDAFVPLVTALVELELTSMTVPELLWVSGSLEH
                     STGPKHGQTATWSLPGRLAGCFSSHTMKSLNARVEPHELRLLTTDDEDAYTFCMETDA
                     RELQEMTGTDNRHGGGKLPLLHFTLRRISRDGRVLDPPPSATTTPSAVRGHTGGRGSA
                     TRSSTVRHAPRQGAGGGRTPTRFVGAPTCYSLESVAKLLWEPAYSKSPNEGARMPLTA
                     FPPLLRSMTLLSEAERRVDDAMLHDAADLRRDGASPGSSEWHAGSEPLSLCNVELILR
                     MAWRLLFGSASEAAAVAAPTEAVPLEALVTLYLSLTSVASQWTASSHTRALGARAASR
                     EPAETSPVAGERARRIGGAAKALAPPSILLAVDCCLAHCEAALRPRLMAIALHTDGSG
                     AGDAACMKPERVATDLRVSLQLAVLTERLLPCPANMAAPATAGMPVHELIHRQLFCEL
                     RASLREAPLQRIAGEVSRLPWWVARRAHAEVSGDGTSPSTSWVEPLLLREIGAKRLPV
                     TERATTAAAAPSAASCSSTSHHSFELFEWALLPFYAKLEARQHDANAAATTADKAATA
                     PSQPHSTAAPMMDSFLCLEDAYHDSAAGLAAHRWSPQSSLHGLSTGLSSGATTDATSV
                     NGDGSTTAFQTSGRSSAPHMATLEAALNALPAQCDSFHILLHVVRQLFLSHPVLLSTA
                     PDAALYYELRAARTAPDHEKSIASAASSASAPEHVLGAAVGRQAWATLPTQRVDLPHD
                     LRQRYVDALFRCFKRLVPHHSCTAEELVELLHLLWLADPNASRVASSAPSSSTKASTS
                     QWPSLFARCSAFVKGSLAELDAAVEMQDTNPSLKDGKDVGASPWLLRSVPDVLQTVYR
                     TVHYGLTKSIVFKPREMHWLSVNAMALHPRSMVLFLHCLNIVRGLEEQRQQHASTPQP
                     LSKPPLPQRQQRAHHSLNRLHKSTLELFQPFVVYASITGEATSGVAKMRYMPLMLGPL
                     SDMDPQLVLVLIQATFAGAMWSSDAGKDPHGRGGGSSRRERANAGNAVFYRKMLAASQ
                     TGVGPMRMGQNGHLQPTRTLGDGGVQNARRLPESIAATMAALLMVASHVQASSTVWAS
                     NGGVGGHGDAYSAMGTRAAPRRAPSAHIGRAHHSALIFLRNSLYELLLLARSRRPLQC
                     ASAVTVVQVMQLAVVQESPRMARLLDWLFLSLLIPPVQIVEKAIVPAATNASFHRGSG
                     FAAAPLELLSSPATANTATAATLTQGGSGNACESSDKYSLVIPVDTLGGTRFPAAHEA
                     VLLLRLLPVQYWRSLLHRDVCWPRYRGYALQMLNRRWRSLGVTRSDTHTADTMRHPTL
                     NKWNQLRGSLSSLLLSLDVESIACLVAEAMGPMVLLVVTTELLRVLARQRACSGDSPT
                     TARKEAEGMPRAVCAAMRTAPHTGGCQHAQADEWPAGIAAPSDAGDDTLSPAALTSFE
                     VVRLYASPRSVLADEAVQPWLEAACNVIDQLASTRHTDFVAVLEREAEWQRRVTEASS
                     YRGAAAEEMPLGVFHRTAVEAMAAARAATKGGACETAAPVLDIGEDGVTEASGVGDGA
                     EARDKAALDSDTGAPTAGDDVSALVGSDGCGAPTTDLFATTAAALDDAAGEWSEDSDA
                     AAERPLVLDWRPIAEFVRAVREVDPGISQRQVRLECWMRQPELAAGAPAEAQALPAAR
                     TRPFSPATTPTAPSASFAEAAVAGDMDDARDVLHNAAGAILQHARAYWQAADRAHGVR
                     PLLMMNLRDALNFYSLDTQQVCHTGDGAAGGQLVSPTYEGDTAKAPSSTASSAARDST
                     RDSAEIVEQARWLEYVTGGSDFDRSNDPAASWNSLSTTMVLGLVRPCPALSVPSIRAP
                     RATGEATTVGEHKRRRIALLRRAGVLASAQEMAERCRAYGLSCAMRRDGARTWLVTYA
                     TDFWRRKSRRLQREIFECVVGDDDVAAAARARLHASASGVSANRHAGAARQETAAAAS
                     VAGRPVMDGRMSDVERRARHRLQLLRCDDLAQLLLLMTSKTSAALPLPSAKGGANTGT
                     EASLSLLQLKMRVVMETMAELLPSASTNELMQVVLALLKLSISAAATDASSTDATASQ
                     LLHYVCLEARRLLANVAVLVANDVERFTFGELLWLITRLHTPCIRAAAPPRAQSAQQA
                     EGGAAARGETFPRPTHGKTSGDESLDVSMSYVSAAVARAIRVVIEGSNDPTGGERGDC
                     ADPHDEIGDDTDVSTNRTAAFDDEVPVNSQSASPVTVAQWAKAVAAAEQLQGKSQMQY
                     LLQLVERSAV"
     gene            <358899..>360137
                     /locus_tag="LDBPK_060850"
                     /db_xref="GeneID:13391677"
     mRNA            <358899..>360137
                     /locus_tag="LDBPK_060850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858343.1"
                     /db_xref="GeneID:13391677"
     CDS             358899..360137
                     /locus_tag="LDBPK_060850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858391.1"
                     /db_xref="GeneID:13391677"
                     /db_xref="UniProtKB/TrEMBL:E9B8U5"
                     /translation="MKRSIRTLEQLQLRLTSDAATTGGGSSRTGTTVEQRRAAEAAKQ
                     KRLATLTPYKQAEYRCVECVAELRQALRDVEEFEVALGRRTSAGVGRSREEEEAGDAV
                     DADDDESTRLLRRQEGRQGPSSSTETALLEQELARSRQQARRAHQRLQQLQREAARLA
                     SRAAAKAPAVTSSAAVAPVADASAPSAALEALEWQRALPHVERAKQWYRDVFGIRVVS
                     SLDDPVLQLNRPAQPQQSAGSMAHFGRGANPVPSCVTAAAACSFSSSAQARGSESAAG
                     WVSPQEGSEARAGGAVASTVSPLLMLQSAREDAEFREFFASVQANDELIDAAMDRISD
                     GVHRLLENARGMQDELAVQEALLQQAEVSAEAAEAQLTQMNRRLRRAIREMEDSSICM
                     YVVCLLVLLLVLGLLLRVAS"
     gap             361758..361841
                     /estimated_length=84
     gene            <362525..>366682
                     /locus_tag="LDBPK_060860"
                     /db_xref="GeneID:13391678"
     mRNA            <362525..>366682
                     /locus_tag="LDBPK_060860"
                     /product="lipin, putative"
                     /transcript_id="XM_003858344.1"
                     /db_xref="GeneID:13391678"
     CDS             362525..366682
                     /locus_tag="LDBPK_060860"
                     /codon_start=1
                     /product="lipin, putative"
                     /protein_id="XP_003858392.1"
                     /db_xref="GeneID:13391678"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9B8U6"
                     /translation="MISTLGGLFNLNHFDQSSCANDVIVIRHKDGSLRSTPFNVRFGR
                     AQMWSYVGRAVQVEVNGELTAAVMKIGKGGKAYWLQPTYGAFGEASHGTAAAKQSEKA
                     GGGMLPAAAAVAGVSGAGCAAKGDEEELDTVGSLVSAVEEVETLVLNTAELQHLPIRP
                     ESPPELPSFSAAGCDAWETGEYAAAEVSPPSAALPPGQRHSPTGAPCPAKESDAKPFS
                     SDAGRQRRPGDHHSRCQGPGSRLPLLHTADDGHLTIETRAIHSAGDAQEARLALRAMA
                     AAEKSRKRLSKMGFGDDPYLLKTAREEGHLGDDEGDDEGSDVGDDDGHLGGNRPEPPA
                     VEIVVDAADVSPSSREATVRAAGDGSFAQASLIVTPVAAGDGTDTQTIDQLVARPATR
                     TEEGESAGLAPAPSSPPQPPVEAATAASSATSVTGSTDSYKVVDEDAYFLDPMDTDPD
                     YAALYGEEEVALLKGASFESSVTSGVSPPDISIMLGNIAADAATTHRGSASASEGESC
                     SAVEGSRVSRISASLLLEPQTVGAATSFIKQPPLPSLPSPSQPTAENQVSSSAKDADK
                     VAVPHASTGVLHAPEEVTDAEGRPVRLTPTAGGAGGGPYFTRTIIPVEADLWKLHLKE
                     GCNTVRYLARKDKGDIVSISCNIFLWNWTDRLVVSDVDGTITKSDLLGHFYAMLGKGA
                     DWTHPGICNLYSKIERNGYRMVYLTARSVSQINQTKSYLFTLQQDGVRLPMGPVLTAP
                     QRFFTALTQEVSKQSHVFKIACLTSVRAAFPPSTKPFFAGFGNRYNDVISYDAAGIPT
                     HKIFIIDPSSVLHVCLVRQTYRDLGHLVDVTFPPVRRHPVVLRAPRHLQRTHGTGTST
                     SPAKDAAPGGRDRHAYTRSLLHRSSSASSSSATSLSSAASSSSDSLDLREEASGGASD
                     CGAEGAPHHTSGSGASPGGGSLAGCHASAAFSLVDSERVDMVAASALSGSAASPGEPP
                     ELDKGGGPTLTGLLPGAAAELWAPPVPTAASSAVISSRPPGAEKTGAPSTASALPAVK
                     ASTSAASAHRPKYNYGHRATFAELNDDDDDVFQDEEEVPADPEFSSFVYWRMDPRDLI
                     TVPAATSKPSASATRANTKETSEKEKPGAVASGTDAPKKVATTTAAAAASTEDNGHTK
                     SAAAAAPSAPTQTGGAAFDTASAGAASPSGVSAASDAAAPRPGGGDGSRLSLFSLTVS
                     NSGTGPPMQGATNSLDKGRAGGSATGAAAMTGLTSHDTLSEMQKPQPRTPGRPGSPYN
                     DSEGAAETNVDAVRLSLLPQSLPPPPPPTTQPAAILPSTSGGGGSRGFFSAFSFGRSR
                     VVESPLSPTSQRAAQLREDAKQRALSHPDAQYYYVAQQQPAPQLAPFPGDGTSSAKAS
                     APAPPPK"
     gene            <368118..>368816
                     /locus_tag="LDBPK_060870"
                     /db_xref="GeneID:13391679"
     mRNA            <368118..>368816
                     /locus_tag="LDBPK_060870"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858345.1"
                     /db_xref="GeneID:13391679"
     CDS             368118..368816
                     /locus_tag="LDBPK_060870"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858393.1"
                     /db_xref="GeneID:13391679"
                     /db_xref="UniProtKB/TrEMBL:E9B8U7"
                     /translation="MDVDSEVEPLLREMSKRLAVVRADLLPALRRLDEDTLLSHYSVD
                     EQARLYLSAAFTLTLSLYSLDKITHRQVASGGGAAASAMAASTSLSSASTDTQLALKI
                     ERITEYIKKLQELVKLERQRRSAATAAASAADAPAGIAAATTPGAKRSRKGASADTAS
                     IAAIAAEQPAKKARNENGASVATVPSRDEEDAFGDAQMFSVVSRVAGETGTLVSRLVK
                     QAMPSSALAASKAE"
     gene            <370990..>381747
                     /locus_tag="LDBPK_060880"
                     /db_xref="GeneID:13391680"
     mRNA            <370990..>381747
                     /locus_tag="LDBPK_060880"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858346.1"
                     /db_xref="GeneID:13391680"
     CDS             370990..381747
                     /locus_tag="LDBPK_060880"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858394.1"
                     /db_xref="GeneID:13391680"
                     /db_xref="UniProtKB/TrEMBL:E9B8U8"
                     /translation="MATTASMASASPESLMSAPVTTSSSSTRLRTYLAIGCGVGLLLC
                     AGVVLRRRLARPRPPPRGPCPMADNTIALLRDLHDGPFRFGDPTPFAVAARAEATRRI
                     RRQQRERRRLRRRMRPQLCRARSSQQLPSWRAAATAAASAPVSNVLGAGGQQTFLRTT
                     ENAPAPQDPLQQRRDAPGNELTSGGAATATAKEREGRAKAEASSQREGALLPSANSAT
                     SLYAVDSDADDDDPRDNDGYDEGVYSTNGPLMTRTGGLRKMTSSEVSLISSTTTMSSS
                     YDSDYSRSPSTSARTTTSGSSYYSRIITPSLMQSTGSSADSQGGASSLLAMTTGSVTS
                     PDGIPWVKATLDGGSVTWGGLHGSHDAPQQAQQHSQHHNHQPPPNDPAGSFSNIAQNM
                     VPRSMSNPQSSSSPHSMSGAMAAQGGRYPAQLLWCGASSPAPSIHACGGTPRPGANTT
                     SPWTFGGGDGGGGDSSGSPEVAYTATFASVPGPAPSLLASGRWGGVAEDEEPYQYTAP
                     ALMYGPPLFATEMDVTDALAELRSSVCCSGDRQGSSCLAGGASSTINTTPSPFMNSSV
                     TGSGSAIMARINSSNNATSLHQQQLGMSLSSVHYRSQQQHQSTHQHTWSHPRSQGYFS
                     GTPMSTASASVAFPTYARHTAHYPGGGSGSSSGKPPKHQHHHHRSSSGYHRLSSRTSV
                     RRSANWSPASSQWLPETLSTVQPVYGYDSAPRGWGSGGSEGATGESTASGGNGSFTHA
                     PTETPISQASSALRRFMTTGGRAHHTSAHGNINGNAHRSFRSVNSTLRHLCQHGRHCC
                     SGRLRRCWRRCRRLVRRRVIASCAVAQLLVMRILCAVRRGSSVLGGACARGWRWVIRQ
                     WRESACAASGKVLAWLRRTRWSLLKTGAMAADETSCTVATSVPSSEAAKRHPGHTSTV
                     VDTAAEAAAEAKRGGLLMTDTADEAINKIVQLLEPTPGRVPTVVVIRAPLGYDVSTDA
                     ASLWKALHLDSTSSEEGLIDIIIMEELKTGPLPPAQARAAAAATGTSSQVVSFPANPA
                     APPLMPPYTGTSDGERTTTTAAPAKPPTSPLQRRRPPPEPSKASAATAATTAARAQTQ
                     LRISFEIYPAHLFYSLIFRAAVLQEKDWALRRAAAELFGGSAESDGSGKGLGVSAGAN
                     ASAGGGVSVTPGSPLSLARALSFTFGVQAPAGDCGNNNAMDPFSHHPHHVTAAVGGSA
                     TGLENYCLSPLSPGHFCRMPVSPKLTAPSPHVGLSGGGGAAAAAAGVGVANASPGTAG
                     GTATSPVTLPASAFSSVAVTTSPQVVVRLSESYSFPAQPPQMVMSPPLGTQPGFKAPL
                     GALPADSRCSAYGGGGSAFSGAGAAGGASGIGVLPSGSAGRIISDNELLFYIHVLRTA
                     VGDGVNTTALPSSRASEVDDDDADANSAGAKAAGVQRDGADPGKRSPRTPSGISDAAL
                     VSREGPDAVEDNDDDSEDLTLLDLRQREIEPQVLLRYRFRVFQQGCRSRKALDAVVLY
                     TQDHVEPWYEEAKAMLQALPATESCQALSSLSTPSLRVNGSSPALRPSDSVGRMTSLS
                     GGGEATTGVASGRPQRRSCPRPAGLPLLSIGTVALASTPELDQVDCRHTVANSGPLQL
                     PAWAMEVLIRRESMRETLVRDLKEKAFRVCAVPLPDMRVHRILPPAVPRYVTAHARGF
                     PLSRTFAEEVLSQQRALQFILLQREQENQRAIAARIRQEQRRQERRDRKRRERRAREE
                     ASRRAQQGRQQQKRSLNSRRRESGDGDSLKKRLTGTLNPATVVSRAVSMVKRFSVGSA
                     GRDFGHLFVRVLPLRSDSVRKTRTSANAAYRQESRAPAPLGEPDVPKTSPPSLPPPPY
                     RHGYPAASGGFYSASSPTRRQSTAPEGNARVGGVLSQGESDRAGYGAAECRDATSAAA
                     PTVGNARQHQRSTDEPSSASQVYAVQPPRGLQGMRDPPTAAVSATSVQTSPTLTEVDI
                     HVLGGSSGSVSVEVSADVSLTANATGVSALSCAADAAPRSSERGAGGDTGGSGRGRAP
                     ASAGAPSPSPTSPPPYTATSPIMLLAVPQSLSGSPPPQPHSPASANGSLGSPPPQSQS
                     CQGDHSGGGGSSSAPKPVSLASASSTRSSHWTAVHTATNANTCVTPPPPPATASAAGS
                     PAVQVSSSGSNGGCAANAVGHGHAQMTPASVSGALQNHFGSSPASTATTSSSVSGASN
                     TTPGFSGTGAAGFHSGTTSMSERGFPLMPLPPPPLPLPALSSSSPPALGAGTIPSSCV
                     FSVPDAPTATLLTTRDASLDVSAGGHRHHQDTTVLLLLPQQPSNTSQPQRSVQNPASP
                     VPATSPLNAEGATHLTVSGGTAQNHMSSRSNYSFQLPDGDGVPAASMTPMPLAVPNNS
                     MYGTFDAYYGHSVVTPQAVLLRQQAQVAAAASVAPLSAMRALTSPRHRATANTAAPLS
                     ATVTLAAERDTRKGELHNGGCAGDLDVRGPAGILSSATSTPAAGAAAAAAAAAGGNAQ
                     QLPPPPPHLQAPRSGPRRTSSGLLPYTYSADSVSSMYGTTHYPLYQYPDDSNGAAAAA
                     YTGVSPPTSSMPGAAVMGGGSSATTAALAGSAHAGASMVYTYKSSGCSSSHVLGVSAT
                     GVTQVYTSPGNSAALFGIGGAGRPENWSSHSQSPRVPDSPMDVNASAIAPLSLPLAQD
                     THMNRLKQYNKLLSDLLGVAGGPMRSGISFYYTYGDATALLYNASIRAPCDENILELL
                     DRQQWEKQQELRQLPRTDGGSGGAFSDSGGASDSSTSVGDKIPMHTSSGSYSLSSSAT
                     DNTGACRVPVTLAGIGASPPAAAQPAPQLQATLHGSGSAAVGDANAAGQGVRNAREDS
                     SAARAAAAAATEDEGCSYLEYGGLAGLQDTMDALESEQIEAQRARNTRFYSIFEHLHH
                     AYHDTVLEAIGSGSAQPAGLSPVTAATGSLYAELTGGVGTEYFFPSAASAAGAAGAER
                     HAASPHCVGHATAPGSVTPPPGLVCGGAGAADTVGLPRWRRRLWSRVCALVAWVGSLV
                     GLGCKPRGDSAAVGAHTAGGATDSGVGMPWRSSQLAPDGAKCGFDPAKLAEYFPGERI
                     VTFGNEWCIASRLDMHNGHFGLSPLQVWMATRYSRRFAGEVYLMDVIAAGGDPYYPAV
                     RVLDEIVAHAVLYYHNHSLRDFVEDLEAELGLVYVPQTLWGRRALGLPDDDAEVQELE
                     GLLYTATRRRQDRRRRQRAQEKYRQRRRCSDGAGGGFEKGRAAVSQIPLPTTAGASRS
                     AAADRHCHTDGAPAPPPPPFPSLAANAAREGERQGGPTAGSRRDRYRSSSPQAPTISG
                     TATRGSVGGASIACPLLPSPVSNRDDLPSVAAIAATAPANLPPPLQQHHRPRRHDNDR
                     LEDEEMAEYTWIQLQGKDQEEDEEVFYGATAAAAAGLGGGDINIAPHVYDAVMEREVY
                     DERMLLRELDHLKEFLVDNRNVLSSAMLTTAGSNSLEAVFGVPATVFPFLLCARESVP
                     FVASIFESLSYHYGPLTYDNFSKYTYDVYHRDRPDVLRHTPRMFRMVNKSRRGCITYE
                     ELCRWMARKLSCGNNVQPNGHLLATSMSLRLPLALVAESRDEWDAYRCVLKSLSDGDD
                     EEY"
     gene            <382839..>384401
                     /locus_tag="LDBPK_060890"
                     /db_xref="GeneID:13391751"
     mRNA            <382839..>384401
                     /locus_tag="LDBPK_060890"
                     /product="dihydrofolate reductase-thymidylate synthase"
                     /transcript_id="XM_003858347.1"
                     /db_xref="GeneID:13391751"
     CDS             382839..384401
                     /locus_tag="LDBPK_060890"
                     /codon_start=1
                     /product="dihydrofolate reductase-thymidylate synthase"
                     /protein_id="XP_003858395.1"
                     /db_xref="GeneID:13391751"
                     /db_xref="GOA:E9B8U9"
                     /db_xref="InterPro:IPR000398"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012262"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR020940"
                     /db_xref="InterPro:IPR023451"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:E9B8U9"
                     /translation="MSRAAARFKIPMPATKADFAFPSLRAFSIVVALDKQHGIGDGES
                     IPWRVPEDMAFFKDQTTLLRNKKPPTEKKRNAVVMGRKTWESVPVKFRPLKGRLNIVL
                     SSKATVEELLAPLPEGKRAAAAQDVVVVNDGLAEALRLLARPPYCSSIETAYCVGGAQ
                     VYADAMLSPCVEKLQEVYLTRIYTTAPACTRFFPFPPENTTTAWDLASSQGRRKSEAD
                     GLEFEICKYVPRNHEERQYLELIDRIMKTGIVKEDRTGVGTISLFGAQMRFSLRDNRL
                     PLLTTKRVFWRGVCEELLWFLRGETNAQLLADKDIHIWDGNGSREFLDSRGLTENKEM
                     DLGPVYGFQWRHFGADYKGFEANYDGEGVDQIRSIVETIKANPNDRRLLFTAWNPCAL
                     QKMALPPCHLLAQFYVNTDTSELSCMLYQRSCDMGLGVPFNIASYALLTILIAKATGL
                     RPGELVHTLGDAHVYRNHVGALKSQLERVPHAFPTLVFKEERQFLEDYELTDMEVIDY
                     VPHPPIKMEMAV"
     gene            <386131..>387447
                     /locus_tag="LDBPK_060900"
                     /db_xref="GeneID:13391752"
     mRNA            <386131..>387447
                     /locus_tag="LDBPK_060900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858348.1"
                     /db_xref="GeneID:13391752"
     CDS             386131..387447
                     /locus_tag="LDBPK_060900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858396.1"
                     /db_xref="GeneID:13391752"
                     /db_xref="GOA:E9B8V0"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9B8V0"
                     /translation="MPSKKTSAGGAKKNTSTAATRSNRHAHPQADIGFLPPGAKYPAE
                     ASWNHHEHQQRNSASYGKQEGHDRNNDFDYRFEQHIFVPSRLRRVPAALVEAVNDFHY
                     AMMNDLPRNEFYYNMLKKHIVPGESGVLEIGAGSGLLSMMAAKLNAKWVVAVEGSSEM
                     ASLARSNIATNGLQDKVKVLNMLSTELTPRDLPEPPSILVSEIFGTLLLGESALDYIA
                     DARQRLLPKTAKILPQHGVQYAVPIECETLGQICAVSSWNGIDLSHVMALQDTTSVVF
                     TKQYGFRMSSVPFRRLADPIPLLTIDFAETKRSTFKKVFPVEVPATASGTAHAWLFYW
                     ISTDGEEVMSTAPEDTLHNFSRDMQWGQALQLIDAGTNSHTPTALSMSTGESYKFECA
                     LSSDRVVMSLKYTGSSSAAALLKADANEAEKRRETESEQQRRPPSE"
     gap             388923..388936
                     /estimated_length=14
     gene            <389008..>390258
                     /locus_tag="LDBPK_060910"
                     /db_xref="GeneID:13391753"
     mRNA            <389008..>390258
                     /locus_tag="LDBPK_060910"
                     /product="acyl-coenzyme a dehydrogenase, putative"
                     /transcript_id="XM_003858349.1"
                     /db_xref="GeneID:13391753"
     CDS             389008..390258
                     /locus_tag="LDBPK_060910"
                     /codon_start=1
                     /product="acyl-coenzyme a dehydrogenase, putative"
                     /protein_id="XP_003858397.1"
                     /db_xref="GeneID:13391753"
                     /db_xref="GOA:E9B8V1"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="UniProtKB/TrEMBL:E9B8V1"
                     /translation="MRTTLKGMMTRCTAPLRNAKSADLGTFFGASMPAAQSAAGFSFG
                     LTEQQLQYQETARNFAKEKMIPVAAEYDRSMKYPHDVYKQAWELGLTNMHIPTKYGGL
                     GASVMDGLVVQEELAYACSGMATAFEGNSLAEAPLLIAGTDAQNAKYLSRMVEEPLLA
                     AYCVTEPTGGSDVAGMKTVAKKEGDKWVINGSKMWITNGGVANWYFVLARSEGGFTGF
                     IVDADTPGVTLGQKEVMLGQRCSDTRGIMFENVVVPEENVVGEAGKGFQVAMKVFDFT
                     RSAVAISAVGLARRATDEATKYARERVTMGKPIAQHQAVAFMLAEMAAGVEACRLMTY
                     RAGWETDQGRRNTYYASCAKMMASNLAEKCSTNAVQIFGGNGYNTGYPVEKLYRDCKI
                     FSIYEGTTQIQHAIIGRYVTGMRC"
     gap             391612..391710
                     /estimated_length=99
     gap             392663..392761
                     /estimated_length=99
     gene            <393589..>395925
                     /locus_tag="LDBPK_060920"
                     /db_xref="GeneID:13391754"
     mRNA            <393589..>395925
                     /locus_tag="LDBPK_060920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858350.1"
                     /db_xref="GeneID:13391754"
     CDS             393589..395925
                     /locus_tag="LDBPK_060920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858398.1"
                     /db_xref="GeneID:13391754"
                     /db_xref="UniProtKB/TrEMBL:E9B8V2"
                     /translation="MDVKLGTIISRFAFTFPSLYDDGRDGHDAAVSSPEDADAEESCG
                     VAFTSGARCDESRKTAKTTQTGSRSHATRLGAPASPTEKLDITGAYAFVSDGGAASSV
                     SLTASPPPILGRAAARGDRGNSTVAPPQHGVGDRGDGAVRCGTPLHLPDLVQLAAHAW
                     NVELHRGSTGAASHCVLRLPPFALGRTLYRGPVVYVLASGVVRMATHGSVAATELLAR
                     RVRDALHEACKPLAVRRAAREELLLMRAVLEDSLSDMLEDEGGEEGRARHLCTAVLKA
                     EAKLPSRGMPLATALAGDTATSSQHGRRAAFGSSSTAARVGSLAHDKAGHGPLTLVST
                     PLVPSARACKIDFLQAVATPRWDEIAGLRASLFAPASAAPGSEHINSGGGVAKVDRDA
                     EGAPRVSVRRASVNVRGDAPMEWWRWYLGVQADDHGVGGGDGSGVARRGGGATSAAAA
                     NSEKPFLANRSGVPRLGPGLSGDASEGGNADARSSNKTTGFWTCAGYTDASPENAAKF
                     VRFLQRRRALLAQHVASFKLRRQATQNSLQILLDWRTATPPSPPAPPPPLSAAAAPLV
                     GRPPLARALVGHLTAVAQPLMDSGTPSVPAAPARTSTSGNAWVTEASAANFFMESTFI
                     AESTAPYGLESVRMPTDRISSADPALPASMVLGDGNVENPCGSTALTPDSGRGSMSAL
                     LEPNVGHSALRYGSSSNKDDRTATKAAPENRKRGVAAAQASAAKRDEAAAAAMEHVTC
                     LIHRTGRVQMTAASELALRQVCAMLLIPFLVATAEVEL"
     gene            <397076..>402613
                     /locus_tag="LDBPK_060930"
                     /db_xref="GeneID:13391681"
     mRNA            <397076..>402613
                     /locus_tag="LDBPK_060930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858351.1"
                     /db_xref="GeneID:13391681"
     CDS             397076..402613
                     /locus_tag="LDBPK_060930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858399.1"
                     /db_xref="GeneID:13391681"
                     /db_xref="GOA:E9B8V3"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:E9B8V3"
                     /translation="MRETAPLAAPSSPPNNGDASAGIAGAPLSDELAGAVVTAHKRCG
                     LRAASPTAAPADAIAATSAAGSLAFPLPLSRSTAPQRLDGGAPETPSWRISSEESRGS
                     AQKAEGGNLLELPIRVSSTHEDLDDVSTGVVAPPSPGMFTCAQKKEPAARSQSLDAPL
                     GDALSVIDSPKVGDLARGGVAERADADEHTHIPLFRVLSLPRGLIGDDAAPRTRRAEV
                     WQPAVEGSESKSSIATALASSGRALQETDSDDKDAPPLKLHGLVAPRLSPGDIRSGGR
                     GVEDCGAPAASAASTPLLPLCASVSSGSSVFVSRQLRTEPLSTALTTPTDAAMAASAA
                     ARSRSVTSGTPLLDSFRIVLSPCPSSIAPSFSLVPCPTASRALSSVSVSAPIVQQRWR
                     DQVRARTRVGVGSGSGTSPLTSATCALDPVGGHALWIQPPPHPTHAAARSRCGSAGGD
                     GDGDAASVTPLHEGAPPPSRRPGGRGGASEIAAPMPLSFSCLGAAASLSKDGPGVRRG
                     RASPPLCDASLCSGPGSGRDHAATLSLRLSLPQPSCTSLDAAPPPAPQLQQHPGSAHN
                     PPASANATTQSLSRDSPAAHASSPPSLPRQTEPPRSLRPDHGQRDSAGSSGLPPWPSP
                     PVTTAHHHDSGFCTSPTDAGSHSSNGRRLPAQPFVFSASASQRRLQPSAVTDSVTSPS
                     ACAEWQSRARLYHESRYFEPLCVPGEAAPMRRSPPLQADSLADLAGRCVADGSTLLAA
                     TSLAQTKGEGLVSTCSTPPPSPMVAPPRPSLSLTSQHVPGRTSSVGGEDVCLWNATPD
                     SSRRMALTSTSLPRGSPLARAARASAASSWAPSLCSSPTAMADIGGLGSKGGMALTCG
                     GGRRPHGSAALHASPADGDGLVHFGVESELCGLQRIRDANSSSLTGVSSAVPASTGVV
                     FGGSQRAVPSILRVDSESGGAGSNDLGSFSDYVPSALLLAPLPPLVALPAGQCPSSRA
                     SLRSSDSAPPAAVTSTAVTRATASAQYTSPLQWPSPVLCTRERNTVLAAAAATSEALA
                     EGSDVVAALEEGDVQADISAALDASLDVTAAAAEGVTALSPATQFRCAFSSLRGCRSR
                     QEDSVMMVADLPVRVRRSTTAAPTTATAAASPTSTGAASGASARREAGAVREDTEWAD
                     ADSMPTQEVTATARHATNVRDEVVFACFGVFDGHCGDTVASLASQFFPEHFEHALQAY
                     QRQLEQDPRNGRGASRGTDSSAQRRKGDLGSCNVCPEGPRAERLRGHHETAPMEAVEF
                     QRVVSAALVQALLHLDLTLYDLLHHATHGLSAQRRDAGSTASVATFFKLPTTSAPCHG
                     GARAVVGSCTSCTPPLATGAGDAPSNSGGSAAACTPATLDEPMKQGVPGEASTPLMPA
                     ARTEDTYRLCIANLGDSRAIIGNLQTGELLLSTTDHRISAYPSEAARIQAAGGVVELG
                     RVDGSLDVTRGLGDYRYKVAPARWWSSAAPASATAASASVSLTSLAASAVATNAATTA
                     TLTAMGRSSSATATATSSSSPVKVVAGSVPPASTPRHSDASEGGSAVRGLRWQSCSST
                     PLRSPTGDNMDGGAASRANFPRASNARCADGEAKQVPASPSQGPLLSSAAESGAYAHA
                     VQEQRRQQVPSPSPSSPISPPSLFSSWSPLASASTVTLTHNAVSNIADVYEWEVRRGE
                     VLIMASDGVWDRMTSEDVLAFVCHELTAAQQQSKGGATRMMRSDGAAVKASDDAGMGA
                     RESPGVGEADAEASNTAEVPLLFLREALERTPLRQPSPFDEQECASARFSPAAPLCTP
                     GGNGAAVCDQHDDEAADSLSSTTGSAPCFFAVQAAARRLTEHVVNNLSGSDNTSAVVI
                     TFD"
     gene            <403805..>404200
                     /locus_tag="LDBPK_060940"
                     /db_xref="GeneID:13391682"
     mRNA            <403805..>404200
                     /locus_tag="LDBPK_060940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858352.1"
                     /db_xref="GeneID:13391682"
     CDS             403805..404200
                     /locus_tag="LDBPK_060940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858400.1"
                     /db_xref="GeneID:13391682"
                     /db_xref="GOA:E9B8V4"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:E9B8V4"
                     /translation="MALVVRKDLKMSNGKIAAQCAHAAVAIVEEILAFKSTTTTSPRS
                     ALNPASALWVQWYDAWNASGSSKVALQCPDEAAMMALAKHARQMNLPHYVIRDAGRTQ
                     VAPGSKTVVAVGPGPKSLVDEVTGQLKLL"
     gene            <404890..>406239
                     /locus_tag="LDBPK_060950"
                     /db_xref="GeneID:13391755"
     mRNA            <404890..>406239
                     /locus_tag="LDBPK_060950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858353.1"
                     /db_xref="GeneID:13391755"
     CDS             404890..406239
                     /locus_tag="LDBPK_060950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858401.1"
                     /db_xref="GeneID:13391755"
                     /db_xref="UniProtKB/TrEMBL:E9B8V5"
                     /translation="MTQKLLLAEGLDLLRQCEQREYDVDRTKLRISSSSRYRSELGRL
                     LQSYDTVYHQYVRGIQILNYVRHTALADKNPQNAQYSKNLSEFCAAKITAYMTRCSNI
                     IRKTDSILVPIEQIDLITKEGYTPEDTVYLQDGITYPLSRKEKIIAKEFTLTAGTYVL
                     TLKNRDDYTLAAPEVDVTLVVLPQRGSGLEPSRVEMKLPCQCGWRKVVGVVDVATVQL
                     EIRYSGIRDAHIDVLFQKWCAIEDIGRSGGAASGPGPALSPSTFDSGDCNSVCKPPPN
                     RGGNGGAAGGVSHHSCTPTNVSASDAGAPAHQQPQQWVNSLPQLPDDELATLANYNVP
                     SASLPRVSDRPANDSEAASSAAPSSAEDPWTTLANLNVPYAPTTRNAPSAASVMRVPE
                     PVEVNPAGMTCRQRLDKIHQLMDAWPSIGVVACALPAEPQSFMQGVHALPFPRELSA"
     gene            <408293..>410485
                     /locus_tag="LDBPK_060960"
                     /db_xref="GeneID:13391683"
     mRNA            <408293..>410485
                     /locus_tag="LDBPK_060960"
                     /product="2,4-dienoyl-coa reductase-like protein"
                     /transcript_id="XM_003858354.1"
                     /db_xref="GeneID:13391683"
     CDS             408293..410485
                     /locus_tag="LDBPK_060960"
                     /codon_start=1
                     /product="2,4-dienoyl-coa reductase-like protein"
                     /protein_id="XP_003858402.1"
                     /db_xref="GeneID:13391683"
                     /db_xref="GOA:E9B8V6"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:E9B8V6"
                     /translation="MAASFTSSTGSSAVGPAAASRLFTPIRIGRHIQLPNRFYMQPIY
                     LNMESELKCYGDEHMAAMAAFFGERAHYGAKLIVVGGLGTSRLGRWKKDALMLGTFDA
                     AKALSRVTQAVHSEGGYVLAQAFHAGRAARKRHFVSATSTPSPVQPIRNTHPYRVPGC
                     MVDYVVSEYERFARLAEEAGFDGVEIPVSEGSLLHNFLSSAVNTRQDAFGGSLERRLE
                     ITVRVLETIKNSLANPDHFLVALRLCLHDLKVGGTPMTETLRVAEVLAKSGRIDLLNT
                     SVGMHDSPVQTLSAYVPHGTFARSCQLLKERLTEVGAADVPVVASHRLHTIELSEKLL
                     EKGVCDMVGVARPLLADPQYITNAAAGRSEDSIPCIGCNHCVNRLYKHQRITCALNPI
                     SGYELQRGWRPATYRKSVAVVGAGAAGVTCALTLWRRGHDVTLFEKESVIGGQLNLAK
                     RVPGKENYQAMLEYWTRQLRQSSINVRLNTEFTREEVARNHQFFHAVVMAHGSVPRRI
                     SSHVIAGASECPLIVPFSRILDGSVTAGRRVVIVGNGAISHDVASFLLHDPRVSREVS
                     LYLDEWGVNLEDGSLLGSPEPRMPRNNRVVTIFNKADKDADLSRGWGWAQKLWIKQHA
                     STVVSHGMLENFDADGVHISTLPPDSRKFFVPCDTIVWCIGMLPNITYGTWIYEWMKD
                     GAKVRGEMMGDFSIYTAGSCRDSYTGDGHGEEDLLQCVHEGYEIGYKI"
     gene            <412148..>413914
                     /locus_tag="LDBPK_060970"
                     /db_xref="GeneID:13391684"
     mRNA            <412148..>413914
                     /locus_tag="LDBPK_060970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858355.1"
                     /db_xref="GeneID:13391684"
     CDS             412148..413914
                     /locus_tag="LDBPK_060970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858403.1"
                     /db_xref="GeneID:13391684"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:E9B8V7"
                     /translation="MYDAYRNCFQYRPDVQRKLVEAVQRERHLRHQAALHAGDAATLS
                     AAVLRKEAVAMDSTSCCCALDAAQLFATPEDMPTPPLPLSRCELHEVLLALSPRWQSY
                     PWRLCFDTASDGFSLSSLYRRMEAVDAKQSQVKTVAFGLFFVHSGEDAALSNAQAASP
                     ADSLSASSMNVSYAVSPPAAGASHSFLEAHRSSSRRYGAAHGALQHSVLGCFTPEVPC
                     LGRHAANIYFGSPDTFVFRLDQLSCAPSRGAWMATDVEKKQKPQGAQQQEKQQHGKAA
                     EPHTCAPATSTTAAGAAPAYGYARLVLADDDIAGVPVPMPSRMTIEHSVGSKHTVDKS
                     MVHSSPLLRPSEVPPLLNLSPLRATVVLSSNAAAMSGVRGAPDIVVPAPRGRRHRLLR
                     PVHPARVVPQAPLLEKFTWCGNTHNRKFIVCNPHFFAIGGGQSGAALYVDEALQYGTS
                     STWCETFSAPCLFGPRMGSADVSPVSSLMQSYISGKDSPRGGPARQASGLPHVEFAIS
                     RVVWFSITEDKRNLRIMSVADASLPSAEAHRCGCGRYSCASGSHTTTLDTMSAGKSTT
                     PSPPPASTFLHRCDLLPFAAPI"
     gene            <415019..>417031
                     /locus_tag="LDBPK_060980"
                     /db_xref="GeneID:13391685"
     mRNA            <415019..>417031
                     /locus_tag="LDBPK_060980"
                     /product="glucosamine-fructose-6-phosphate
                     aminotransferase, putative"
                     /transcript_id="XM_003858356.1"
                     /db_xref="GeneID:13391685"
     CDS             415019..417031
                     /locus_tag="LDBPK_060980"
                     /codon_start=1
                     /product="glucosamine-fructose-6-phosphate
                     aminotransferase, putative"
                     /protein_id="XP_003858404.1"
                     /db_xref="GeneID:13391685"
                     /db_xref="GOA:E9B8V8"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:E9B8V8"
                     /translation="MCGILGYANSNVPRTVEQILDILLCCIQKVEYRGYDSAGLAIDA
                     NIGSGKEDGTAASAPTPRPCVVRSVGNINQLREKVFSEAVAATLPPMDATTSHHVGIV
                     HTRWATHGGVCERNCHPQQSNNGEFTIVHNGIVTNYSALKELLKGEGYVFYSDTDTEV
                     ISVLSEYLYTRKGVHNFADLLLELSNMVEGSYALLVKSVYFPGQVAASRQGSPLMVGI
                     RHTDNRGSVMKLQTYDFTDPSGPLEVFFSSDPNAFAEYTRDVVYLEDNDIVHYCDGAL
                     RFYNAAERQRSIIKREVQHLETKLESLSKGNYAHFMLKEIYDQAESVISSMHGRIDFS
                     SGTVQLGGFTQQSIRAILTSRRILFIACGSSLNSCIAVRPLFEELVPLPISVENASDF
                     IDRRPQMQRNDTCFFISQSGETADTLMALKLCSEAGAMCIGITNVVESSISRLTHCGI
                     HLKAGVEVGVASTKAYTSQVIVMTLVALLLSSDSVWLQERRNEILRGLSEVSAKIAEV
                     LRITHDPVKALAARLKESHSVIVLGRGYDLATAMEAALKVKELSYVHAEGIHSGELKH
                     GPLALIDETVPVLAMCTNDKHFGLSKAAVQQVNARNGAVVVFATVVDAELKAAASEIV
                     LVPKTVDCLQCVINVIPFQLLAYYMALLRGNNVDCPRNLAKSVTVQ"
     gene            <418445..>419116
                     /locus_tag="LDBPK_060990"
                     /db_xref="GeneID:13391686"
     mRNA            <418445..>419116
                     /locus_tag="LDBPK_060990"
                     /product="cell cycle associated protein MOB1, putative"
                     /transcript_id="XM_003858357.1"
                     /db_xref="GeneID:13391686"
     CDS             418445..419116
                     /locus_tag="LDBPK_060990"
                     /codon_start=1
                     /product="cell cycle associated protein MOB1, putative"
                     /protein_id="XP_003858405.1"
                     /db_xref="GeneID:13391686"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:E9B8V9"
                     /translation="MKLFGSSLFDSDKTYRPKKKHKEGTERYRLHNFARSLVKSGDLR
                     QAVQLPPGVDINNWLSVHTVDFYNITNVIYGSLTDYCSDMSCPVMSSGPRYEYLWRNP
                     PEYPKATRVSAPQYLDLLMKWIERQINDERIFPSEDYNPYPADFKSYVKNIFRRMFRV
                     YAHIYYSHFTKIAELQEEAHMNTAFKHFMYFAWEFDLIPREELTPLQELLKNLMGDYA
                     KERLE"
     gene            <420404..>425374
                     /locus_tag="LDBPK_061000"
                     /db_xref="GeneID:13391756"
     mRNA            <420404..>425374
                     /locus_tag="LDBPK_061000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858358.1"
                     /db_xref="GeneID:13391756"
     CDS             420404..425374
                     /locus_tag="LDBPK_061000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858406.1"
                     /db_xref="GeneID:13391756"
                     /db_xref="InterPro:IPR024975"
                     /db_xref="UniProtKB/TrEMBL:E9B8W0"
                     /translation="MQGADNGAQLQMLLRVNEYVQEQRQVYMTLSFGEQRRRGPLLLE
                     DLLTMVMHNLLREAEGNEGDDDGGVRRPRARAGMASGAHTLEMLISSTNSLPFALRDV
                     PALANVAALQLRLTSTVMAAISTRAIVTVHELEEWVCAQEGVEHFAELGLGVGLQVLP
                     VVQEYFQLRANSVVFPVRARDVIAFLLNDTTARDMLLYGGGDTRDLLYRFAAFYERHV
                     LRNASPSSASATVRGQGRLLNVRQLGIHVQDYTALLAALTQELASAHRLEQQQYQRWI
                     ESCVTAETAVTQTASTRDSAGVAAAKDSAAGEDALVRDASFEAAARRERNRALYERVL
                     HSFDSACAHAELVEGMRRTHKKALCASLGSDADAVPCARSAGARAIKFAVAFTEAEAR
                     NYSLPLSLWRTVPLDDEACSSLAGGNGWGGGVELRFHVGALTATEVSRAAQGPAQGSS
                     ASTTLRAAPLNSQWTTNAAKGEKQTPGQRISNDSISVVPPPPSSAMRRRRGTVVSDRP
                     SAISMGTPIAAAGAAAATETRRVTSPDAAPALVDATSTIPAVTATSAIPLLSSLLAPA
                     GSLGLAVTSSSTTADAPPSVSPRSADTAVERAPSVEGKLSAADVVGSSVETPTEPKTA
                     LEKLGDLLMQHRRWSAANKRRGKPASEQPMVLSTGDTWLDLAVSAFETFAVGDVVPVK
                     LLYEAWATCADCRGPAQPPPLPHSARAHGATSGRFTHRRCIPLFHPFVTSLGLSNAAP
                     LSPLALLRRQLGAGDTSGAPPATASAPGAEGGAADERKEIVYMATPVEVCWLSWWGPA
                     LSDERASREAAILTCACLERHYPSYLQGVFCGQLRVRARPTVAAWCTAAAAFARRLCP
                     LSALTPSFTDAYVESFACCVDADVAARVAEVQQEGTPTPGSDSVELPFLQRQQRTAQM
                     ALRRVLANLQESLAGASPWRAGLFPCDHAWRCGLDGLLYATPQWCGYGGVLLTASSPS
                     LPAHTSVAAYLSKGGSANGAGAAPPLRVLCFRAHEPSWAVCSVLHYLGIRPLSQLAET
                     RVSFHTTVATDVSGVLHDKIAAIVPYVQAFCRASLPLWYGVVYVQMRERLRRLRVVLT
                     ASASPVQTLRLHLNGHVYAHVRQLRLGYVAAHNVVYGAAEATSVPMLAEVLLPLFMPV
                     GMSAEADVRQLRDVILRLLGALSSLDSSVEWRDGADTSPQQQQWRREEIEHVLRPVAV
                     HYGLNPFTGVFSEAPPPASGVLAGAVGSAHESDAHGAQAEAPFTLSSRAFIRYMPNYP
                     PGTDAMRQPRGSEQAHTAHRTGETSGTQSLTQANVQELVAHARPFSSRTASVARAGGG
                     LMQRLGANGRLSATLSLGGSTAVVTSTPAWSNFPMELDVDAVVAASVVVGATDGSGRG
                     GNASAAARDHQRDGDDDSSSTLGSDREGGNSAAVGGDEEEEQDSFLTFQYHRRSGTAS
                     SALRGSGGGAESRKRLRAGNNHAAGQVRGRLRDDSAGRDVRAAGMWLRPPAASAMTGT
                     SGDTPDYAIAAERYVYELLREEYAKQAHQGGVRVIWMNESCEAGSPFDILVIKPRRLG
                     SSGSSSSGNAKVNRSSSVDNSRWDVVQYVEVKSTCTTNREDFEMSVAELLFAARFGAA
                     YCVYRVFGASTDALHRMRHRVYTDILQLWHTARLTITSDIRVTPST"
     gene            <426444..>429533
                     /locus_tag="LDBPK_061010"
                     /db_xref="GeneID:13391757"
     mRNA            <426444..>429533
                     /locus_tag="LDBPK_061010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858359.1"
                     /db_xref="GeneID:13391757"
     CDS             426444..429533
                     /locus_tag="LDBPK_061010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858407.1"
                     /db_xref="GeneID:13391757"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:E9B8W1"
                     /translation="MGCKNSSHTMSGSSSVAGTAPGAIEDAGSSSPVFGSGVHVGRSG
                     NVDLSGRDLDVLGPQMVHMINEDELHRTATSLRLSNNRLYALAKELPLLSNLRELDID
                     HNRFQRFPEVLVRLPRLWRINASFNPIDSVRGFDVLPRLLSLRSLTVRDCSLKEIPMA
                     VIQCEVLEELDVGNNPEIKITGVALHRLKRLKKLGVANCNLGGRTLPNAIKRMRLTSL
                     DISGNAFTFTDPNFFGRSMPHSLIELHLVGMNLTAPPAVVALLKKLKFLDLAENPIET
                     LDVLAGRVVKRLHHVASNGTVATAGTNGFSDAPAEEEDDFEEDETSTHASGGVASAVT
                     SRVSLSKASREGIVSHVTQPIPLKRLSLRACNFRMVPKYFHKLDQLEELDLSENENLD
                     DPNMTLFSLQSLVTLNIVGCPFAEDPSQSRNEWFDIGKLRNLRNIQWEVWKSEHNMSP
                     YRTKIPIELCALRLRTLNEVQLRRNLFTGDIIETVINLLSDGYFKVDLSVDEMILHTH
                     VAAVKAFTEGERFFFPKTITEVPNLKCGVDPASLGQVHLKIALSRYIFFLAIQAANYD
                     AVIIPPLDVMIIHYAQLTVHPLKYRTDCEAVCGRILDCNYRTFFAEQKKHQAEAKSVV
                     DASRRIWNLMVRSAQRDLAWLRYDFWDKRLRASAADGAAGAAFSGEHTAIPKTLPLLV
                     GKTTAEVTQDWQSMMSIDSAHDLAGVLDQAITSHFSEKGVEDFGASIQQFYEINRCFL
                     CHEDSLWKADLDWNRYVKFLTLYAYRCAVLEGDTAYVVEPVADEEGNLVAPDRTTSML
                     GKHYDSMNNRSFDDAGKYLPKPQDGGQKGPPNIVSENQAESSGVPQTRTASGFARRSL
                     STLQKASKSNKRLTMVRQLEGNPVPTIGIIFMLHAHRTSHLKYYQSMSLFAIENVDVV
                     WGAAGYGILKQMQGAWMALYDEAYVSENKEMLFSYLVQNGVLMPTSDPCDAANTVAGD
                     GSATAKKSGGTSKQKHRYAYVSDVAPHRSCIKARPRNADNFGRRVTFCSADTEFGVF"
     gene            <431878..>435516
                     /locus_tag="LDBPK_061020"
                     /db_xref="GeneID:13391758"
     mRNA            <431878..>435516
                     /locus_tag="LDBPK_061020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858360.1"
                     /db_xref="GeneID:13391758"
     CDS             431878..435516
                     /locus_tag="LDBPK_061020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858408.1"
                     /db_xref="GeneID:13391758"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9B8W2"
                     /translation="MRSSVSVTPSRRPKRPNAGASISPSRTSLSRGASPAKSPAVLRE
                     RGRSVSPSVKKGIRPGIADDAAAVHKGSGAAYPNAGHATSSTASPSVTGGSLSHFAQD
                     GRRLEPNTCETTFSFHGQYEHIAVAHRTATLWCANTATGAMDLYSCVTGQFVTSLLPL
                     HEEVVARRAELSELPLSAPSAKGTNGSAKGATGGLLGSHWGSTALTPRSRGLVPTGGG
                     RRLSTLSSTSAAAHHHRTASNSLSASSLASAWARVPEGDLRATALCATATHMWVGYTN
                     GTVAVYDALLLKLVTFGRLHTDRIVSIVALFNGQTVSASTDGLLILWDTEQGGFEAVT
                     RVTVLLDAVREGAGALCAMASISPATRVCCGFESGVIYNVRIASRPQEQTAPQSVRGH
                     HGRVNDMAVVRDVLFTAAEDNTVCAWHCGGAAGARGAQRLDGGDGGGSAPSNPFLRAA
                     RDAGHARFGPHMGGSVRMLKRIPVRPCVRCLLAEEQTRSVWVAYADGLVERWSANPDD
                     DYGVEEVVENALAASLSAGNGGVRALLSLSVVQTMQWLALSSNGVNKVWYGHRNTLEI
                     DLAHSISTLAQVVEQDTVDAAAWRERVNLLKQKELERKQKYVCILEQLSEQRVLLRHY
                     DMWKRSVLFFGTRRRRVAAIADTLEKKSRLQLARRFFNKWGSFYDAQQRHMRVYVLSM
                     ALSRATEQQQLQGYFLRWQSYLVHRQVRRKAAKSAQVLARMVNAAIMGSCFHRWRAAA
                     AATTRRQRDRISAEQLALLANKAQRQVLQRVLRQWVAHHDTQKTLPRQVPTAAAEGAP
                     RDGLPVPETSALSRFAAHYAQQQQQRRGRQALQVWRRWTRWRARQASLAAVAALREQQ
                     LLHEARQRFFLRWRQRVHARHVDENTQQLKMLEVELRRAEAEHGDIFEKLQLQRQLDL
                     VLERQSAEEARLAQIKEQLASAEHTCSELRARQLQRTIVGSNGAAHAGSCGSSLTTSS
                     GAATGASAAVAPADASRRSSVARFAGTDTDLSLSTTSEGLPLAQQQQVVLSALSRGHM
                     ASNAAWYRSMVDQQRLSPIVLSHMPTEEAVHHVMGQLKGNVVNLYTDLALFRQVKDRR
                     RAGTSAVGILLEAFGEVKRLIVTTVRGTSANAASAAAARMGGKATRWPLSMEALDCIP
                     VHHCATVLSAIKTLVVAYDLLQPEDMISVQTTCEEVVVNADWIFLIARACYLRRKPVP
                     PANNRQLI"
     gene            <436418..>436885
                     /locus_tag="LDBPK_061030"
                     /db_xref="GeneID:13391759"
     mRNA            <436418..>436885
                     /locus_tag="LDBPK_061030"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858361.1"
                     /db_xref="GeneID:13391759"
     CDS             436418..436885
                     /locus_tag="LDBPK_061030"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858409.1"
                     /db_xref="GeneID:13391759"
                     /db_xref="UniProtKB/TrEMBL:E9B8W3"
                     /translation="MHYTTVLAVAAPLASIALCVCAGVKDGAAHSLFLAAATFFSGVV
                     MWLRSRYIAALYLNELQARRQHFTDSLRRRFGDGGAAAAVREASAQRDDARAAEAYAA
                     PSPLSRPPRTVARVSPVLPAFLACCLFLISILSTISAALHAILYVRSLETEQP"
     gene            <437431..>438936
                     /locus_tag="LDBPK_061040"
                     /db_xref="GeneID:13391760"
     mRNA            <437431..>438936
                     /locus_tag="LDBPK_061040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858362.1"
                     /db_xref="GeneID:13391760"
     CDS             437431..438936
                     /locus_tag="LDBPK_061040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858410.1"
                     /db_xref="GeneID:13391760"
                     /db_xref="GOA:E9B8W4"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:E9B8W4"
                     /translation="MPRLRAARAAWYAGQELDTYLRQRAWHWTVKRNYALAADYCIRL
                     LNRHPQDTLGLVLGEVSGRYTSQDTFVSKCAQALQESCQRKGVASVTELVQCTLVTRA
                     ANPPSLSTTASASLTQLPSADAVLALQADEAKREADARDTGAHTGGLKGESLYVHNSE
                     PPDSINQAVRRSCLRSATPPLAELLEPVQSTYGRGLYATRHIQPRSSILCESPLLVQR
                     CDDTKCAHCLAPLSARRGSSITDTGASDPLASGVACPHCQHETYCSEDCRDAAWEQYH
                     VCSCASRNPELAQWTEGMRELLHRGGAGAASAASDEAGVVNSGSEARAALSCLTVAKI
                     CAMATVQQVHPLSLPGISCLRGIADYEPATALSEIGALAVALSAALRQPNLYMEEVLS
                     LFALLHMNEFFAGSGIAVYSVLSMLNHSCDPNCALVSAANSPVAGTHGSRRHKSAMEK
                     HLVALRPIRDGEQLFIDYNAALTTRLDYEERKALCAQRHFECYCSRCIRRE"
     gene            <439849..>442152
                     /locus_tag="LDBPK_061050"
                     /db_xref="GeneID:13391761"
     mRNA            <439849..>442152
                     /locus_tag="LDBPK_061050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858363.1"
                     /db_xref="GeneID:13391761"
     CDS             439849..442152
                     /locus_tag="LDBPK_061050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858411.1"
                     /db_xref="GeneID:13391761"
                     /db_xref="UniProtKB/TrEMBL:E9B8W5"
                     /translation="MLRYAPMRRCSAAAMQTLSSWLTDLAEESMAVPSATDAVLHTRQ
                     NDGQGPTRKTPAQLWRELEDAAAHANALRETDTLFSILRCLLLKQQYPTDVHAWARLA
                     KQLLPYSGIEQRSVLHYPGRPDASYRRDGHPRGSSLANLSSSSDPVLTGADGGIGDDG
                     ASRRGGGGARRGGEHAVPYSLYPSRETLLLSGGVVPLSARVPFGDGRAIALFVRGFTR
                     FVEGQLGVQPHTQLTSELLQVVKDVSDAVTEALAANADSLQLELLLPALLDYMELLHV
                     LDLCTATATGRGPLAMKDERRAAAGATGRDDEPSGHGRSSPPRSSRPTRFLQNMANDL
                     AQNVMAGAARGARVVLYYLSERFAAVVEAYQADAPATFTDKMYWAQQRYLLTLTRACM
                     WSISQHYTPATTAALSAAPGSVASSPSPHVQGLRSTVAPTDLVATAPMNAHIQALYDH
                     IDVLFQRNTHADNPLHLTDEEVAQLKEIHTAALLRALRIEEAAPDAYLRRALEVVDRV
                     PASMAIEGELIAGKVRLLELDSDTVDEEGRAAIYDDLLTSLRSLVEMRPRFSRHDGAH
                     HAAGGGVAAAASASTPADGGGGEEDEGDGEQLRLDAATQAILQRAHADVITAFCAAHK
                     EEWSNEAYNILVAHKYHGVKITNDLIRPVLEVFSRRGDCRVFSLVDLCVLYSNEPIDM
                     HTIALLFRTCAAAGDHYRARTFLQLVNEIIHGFLVKCPASVKESLQELKLLDPPPRHL
                     FVSTEDDLVQSALGEQQRTVRRLPTGS"
     gene            <442802..>443494
                     /locus_tag="LDBPK_061060"
                     /db_xref="GeneID:13391687"
     mRNA            <442802..>443494
                     /locus_tag="LDBPK_061060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858364.1"
                     /db_xref="GeneID:13391687"
     CDS             442802..443494
                     /locus_tag="LDBPK_061060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858412.1"
                     /db_xref="GeneID:13391687"
                     /db_xref="GOA:E9B8W6"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:E9B8W6"
                     /translation="MSTDPNGTRWSNSEKNFGKALLKKSGWTEGAGLGRGQDGVVDHI
                     KVTRKDGVMGLGYQAGVQETWTTQSLGFADVLTRIKASTTAAISDSDDDGEASRSSSP
                     TTNGEAKKIGMSRHYKMYARRNALKTELIHGGDSAETEAKRLEILGSAAMKRRRDADS
                     DDDNDGAGRNCSQSTSSASTLKSPLLLRLMARSSKDEPKPTAGDMTPAQLITVTKPHP
                     RPPKCTDTPFLA"
     gene            <444764..>447439
                     /locus_tag="LDBPK_061070"
                     /db_xref="GeneID:13391688"
     mRNA            <444764..>447439
                     /locus_tag="LDBPK_061070"
                     /product="kinesin, putative"
                     /transcript_id="XM_003858365.1"
                     /db_xref="GeneID:13391688"
     CDS             444764..447439
                     /locus_tag="LDBPK_061070"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003858413.1"
                     /db_xref="GeneID:13391688"
                     /db_xref="GOA:E9B8W7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9B8W7"
                     /translation="MSERVHVVVRIRPFIASDPPDAELNTLVLDPTHVSVGNNRVFKA
                     DRVYMMEDATEVIYAESIAPLISRFLRGFNTSVLAYGQTGTGKTFTVQSLLPLLLTDI
                     MADKGLRSGAAGVPNAQTSTSLTAKAPLLYLQYVEVYGETIRDLLEGPAAAALRSDGE
                     EPSKIRLVTTTAPGARATSPSSERADRQLSPIDERDAAASPTAGCVLVGATIVPIFTL
                     AQAAELIARGGTRRATGSTNVHAHSSRSHAILTLFHARYACRLDVVDLAGSEREKKTG
                     NVGVRFQESIAINTGLLALGNVMRALSRIHRAANGKEAGRGGGAGHQRAQHVPYRSSR
                     LTRLLQDTLGGNSATVLIACVAPDTYNRDETLRTLQYCSLALRILNEPLQQYERLRRA
                     QSPLCRRGSPSAAAAVSPLSLREGSYTATAATRACRDSEEADEPKMTQLKVLELQSAY
                     ASLQQQYDEQAEVIANMCASHATTKERLALCERELRKDEGIFTQQIRAMQELVCENRK
                     LRRRLAKVFAPPTTTTNTTAAATAGRDKAAMAHDPLFRGGDGLPESTCTETDSHHGDK
                     DLTDAVRHLLLAGDRDAAGRMGVSLQLAPSHSQGHRQQHSAPVAAAAATRPPLSAHSP
                     HRSQDVRDGVTGGTQYVPLEELPLAVAHQAGVRVDDGRGGAETPTYPGAGGRTEASHA
                     LDGMTPGGAAAPTPAEPAQSFIRYILGLHGIDPEAEQAGDVDGGDGRGRAGAGAVAVA
                     ATSLQSSIRKSAATSVGGVALEPAEVSETTAGSSRHDHARQEGAPSPLNYALSRRSGR
                     FAASFPPQTMGALSEGEHSSWERQVDRRGGGADAAQLDSSAVLLLAKEVLRYQGTNAE
                     LRNQVQVLQAELDGKQREAALLRLELQEMKELFTT"
     gene            <447892..>450066
                     /locus_tag="LDBPK_061080"
                     /db_xref="GeneID:13391689"
     mRNA            <447892..>450066
                     /locus_tag="LDBPK_061080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858366.1"
                     /db_xref="GeneID:13391689"
     CDS             447892..450066
                     /locus_tag="LDBPK_061080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858414.1"
                     /db_xref="GeneID:13391689"
                     /db_xref="GOA:E9B8W8"
                     /db_xref="InterPro:IPR029652"
                     /db_xref="UniProtKB/TrEMBL:E9B8W8"
                     /translation="MTTAAPPFHAPRPPLTARSDPNSTAVSRGGTAAVAAMPETQVRR
                     RLAEVETRLRDMEEEARRTRVLQEQEIANLEHDNVKLRERLEAIRMEECMSLAEARAL
                     QDHTSYQLTGGAPASHAESKLLGSTTIKYQNAKAEVQRRRRECAQAERQLAEARTRLA
                     DVRKARKELKGRSLAAEMSASMRVAAADNYRTLIHERLRGLEEQVAREQERFNSIATE
                     AKQARIEIDALLVSQTSNEKMYRHWYDALLAKRREMAFLMEVCNLLCEERQQVVAELT
                     EVQARMAEQSHQYEAAFDELTGVQDENAKTQAANCEQLEELRRLIAQTRAEREALEEE
                     NRCTKTAMERQRRRTVGRRLKEEANTTTTSAASRGSSAIDGECGIVAAGEAERVGDDG
                     GAELRTPESESSLDGNQQQIRMFDDYYRKLSAIVQSDAIEDVAGFMDAAADERYKVFD
                     EMNAIERNMVALETEKAALVAQLSRVGGIRPATVPKSAQQPFTPTALATLAGADTLED
                     LTAVTTAVAAGKSSGTGALGASTDGTQERCNRMADLLDDLGATRDLVFEQQEEQETSA
                     AVLEQVVAQVNQVFRGLGCSVDELRALTGMEGVQQTTLLQCLAMVEQRASEYLIAYSR
                     RQRKRSSQATGARASPPSRDAARTILRRPDLLPKTQKNAVEATVMQQALPRSTDVTTR
                     MPTVAALAIGGSLTLDDLVEERPLSTTELKEVVEARRILAQP"
     gene            <451097..>451498
                     /locus_tag="LDBPK_061090"
                     /db_xref="GeneID:13391690"
     mRNA            <451097..>451498
                     /locus_tag="LDBPK_061090"
                     /product="protein disulfide isomerase"
                     /transcript_id="XM_003858367.1"
                     /db_xref="GeneID:13391690"
     CDS             451097..451498
                     /locus_tag="LDBPK_061090"
                     /codon_start=1
                     /product="protein disulfide isomerase"
                     /protein_id="XP_003858415.1"
                     /db_xref="GeneID:13391690"
                     /db_xref="GOA:E9B8W9"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:E9B8W9"
                     /translation="MSLVRKTLAVLLAVALLAVCAKAEVVELNPANFHNVVKDPSKNV
                     FVMFYAPWCGHCNNMKPTWLELADKYPIVGDVIIARIDASEYRGIAKEFDIHGFPTLK
                     FFSKRDKSGKMEYEGPRELSAFVAYVAANKQ"
     gene            <453618..>454652
                     /locus_tag="LDBPK_061100"
                     /db_xref="GeneID:13391691"
     mRNA            <453618..>454652
                     /locus_tag="LDBPK_061100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858368.1"
                     /db_xref="GeneID:13391691"
     CDS             453618..454652
                     /locus_tag="LDBPK_061100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858416.1"
                     /db_xref="GeneID:13391691"
                     /db_xref="GOA:E9B8X0"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:E9B8X0"
                     /translation="MWTAVVASGGGSKGNPPTALSAAVCDGKPMTTAGPQAPTTRDGL
                     WQSSLLRQRVAAGASFKNVALSHAADILRSESARVDAQLIDDFSSILRGNVVYIHNFI
                     CHEKDMRLYNSLKEELVAATGAKMLGSGGLIDWSKHQVFDNPSYISQTFNDIIDMLAE
                     YFDVDVYATRLNYYRDGTQWKPQHHDSHAYGGRALREDFTVGLSLGATRSLLFVHEAS
                     QRDFNFPQVNGDCFAFTGEVNNLFTHGVPRVHTPTGDRFSIIAWGRRRTLNERNGGVP
                     SSAVAQVKGHHINTMEDAVEVAKQLVAAQPGAAVAKKAMPPPCTSGDASSNGVAAATR
                     PAKRHKRRLQ"
     gene            <456024..>456869
                     /locus_tag="LDBPK_061110"
                     /db_xref="GeneID:13391692"
     mRNA            <456024..>456869
                     /locus_tag="LDBPK_061110"
                     /product="deoxyribose-phosphate aldolase, putative"
                     /transcript_id="XM_003858369.1"
                     /db_xref="GeneID:13391692"
     CDS             456024..456869
                     /locus_tag="LDBPK_061110"
                     /codon_start=1
                     /product="deoxyribose-phosphate aldolase, putative"
                     /protein_id="XP_003858417.1"
                     /db_xref="GeneID:13391692"
                     /db_xref="GOA:E9B8X1"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="InterPro:IPR011343"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR028581"
                     /db_xref="UniProtKB/TrEMBL:E9B8X1"
                     /translation="MCDQQSTAKVDLEMLFRPGRKGELNGKILDRVRFLAAELGLPEL
                     EEKFAHLKERDGAWRTSSVSDNVNLSAYIDHTLLKADASHAAIVQLCEEAKTHHFKAI
                     CVNGCHVARCAQLLAGSEVRLGCTCGFPLGQMTPSMKVAEAAEGISSGAHEVDMVINV
                     GALKSKCYLDVFKDIKGVCDVCASAAVVSKVILETCLLSEEEIMDVCIMSVAAGATFV
                     KTSTGFSTKGATPEAVDIMLAVVGNAASVKVSGGVRDRATAMQYVQAGVKRIGTSSGI
                     AIVSP"
     gene            <458623..>459297
                     /locus_tag="LDBPK_061120"
                     /db_xref="GeneID:13391693"
     mRNA            <458623..>459297
                     /locus_tag="LDBPK_061120"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858370.1"
                     /db_xref="GeneID:13391693"
     CDS             458623..459297
                     /locus_tag="LDBPK_061120"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858418.1"
                     /db_xref="GeneID:13391693"
                     /db_xref="GOA:E9B8X2"
                     /db_xref="InterPro:IPR004026"
                     /db_xref="InterPro:IPR016071"
                     /db_xref="UniProtKB/TrEMBL:E9B8X2"
                     /translation="MGNSCCRDEHQTAGKSAAVVQASLAFFDALPPDAQEATVDHVYD
                     GDTLTIREHNRMRVRLLGIDAPELKEREPYAKEAADYVKRLCPENSKVWLKTPHGGEK
                     DRYNRMLSLVFVSSPSGGPGFVCVNIAIVEQGLGTFYSPAGSQVDFRGQLLKAQQSAM
                     QRKVNMWKKQNLRKKVFCTPKGIAFHTSDCLTIQQTSPRNLQTLSAAQALSRGYSPCR
                     VCKPQR"
     gap             459615..459713
                     /estimated_length=99
     gap             460678..460776
                     /estimated_length=99
     gene            <461706..>463493
                     /locus_tag="LDBPK_061130"
                     /db_xref="GeneID:13391694"
     mRNA            <461706..>463493
                     /locus_tag="LDBPK_061130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858371.1"
                     /db_xref="GeneID:13391694"
     CDS             461706..463493
                     /locus_tag="LDBPK_061130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858419.1"
                     /db_xref="GeneID:13391694"
                     /db_xref="InterPro:IPR026205"
                     /db_xref="UniProtKB/TrEMBL:E9B8X3"
                     /translation="MPLERMQVRRPPRGVEAPGDGRGLPAAAVRGATAQATTTTESSR
                     SHSPTGTATSTASSSSALLQQGTLAQQARRYEDENIRSLLHQLPSSPKQLMRRLEQQQ
                     QEINMLKETNMLLKSREVEISSLTLRLQERINATQSQVDHIKTQVHLQLSNPITEEEY
                     QRIESLTEAQRDLVDVMKLGIYRQLGSLRASQQAATKRAAELSTSLAQLQQENSDMKV
                     RLAECESQGGTEKEKAERMARQIENQQARIAELEGHIASLEAKNRSMYVDQEQFLSAK
                     LTAQIKTDEVARLSVRLEESEMDTQRYRANAECTEQKLDILKSEYYELKLRNGQRVLE
                     LENALKASEEKLKTLGDLEMESQLFISNLATSSQGDVAFSTDPADTSAGRPTDAYEGW
                     LALPRSRKLAHTLVVTKRCLHLENKVAALEHDLNFKQAQVARLQVALDGARDALHNIN
                     SPYVLVEKAMTELTDENEALKQKVNILEQDKKELQLKVQQYGSSLRTLTHHRQELLRI
                     KKLLRQLGLREGFVLPTVDEETRQMESQQPETGKTRHTRSRSASGGDFTSSTQPRASM
                     GSSASEARRAFGKESPGSFGALRPIEMTF"
     gene            <464633..>465541
                     /locus_tag="LDBPK_061140"
                     /db_xref="GeneID:13391695"
     mRNA            <464633..>465541
                     /locus_tag="LDBPK_061140"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858372.1"
                     /db_xref="GeneID:13391695"
     CDS             464633..465541
                     /locus_tag="LDBPK_061140"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858420.1"
                     /db_xref="GeneID:13391695"
                     /db_xref="UniProtKB/TrEMBL:E9B8X4"
                     /translation="MLQAATNSNVLPLSGGRSALNHGYSMHTLARKRFRENTSALAVT
                     VGFVLPALNGVNKQLDKHVDAGTDVSMDELMQIFAKSGKDAAALYADRMARIACQTGL
                     ACALIESKSAYCNAAVYLWDLYPRLHQRYVGAVLSWLRIPVFVSSLLGPHPTTQDVAF
                     LQARVSGVCAFEDSLRRDTITLFGDLLVDTARILIRRDVDNPSEAVARQAVLRVTVTV
                     VGAVGAGLGRAAAGERGEYWGNIAGVMAGPAVAVQLWTAVRKMRMLRPRRAVDATKSH
                     RHRHSTSEGSRAAAATAGGAPATAKA"
     gap             466135..466233
                     /estimated_length=99
     gap             467371..467469
                     /estimated_length=99
     gene            <468690..>472013
                     /locus_tag="LDBPK_061150"
                     /db_xref="GeneID:13391762"
     mRNA            <468690..>472013
                     /locus_tag="LDBPK_061150"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858373.1"
                     /db_xref="GeneID:13391762"
     CDS             468690..472013
                     /locus_tag="LDBPK_061150"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858421.1"
                     /db_xref="GeneID:13391762"
                     /db_xref="UniProtKB/TrEMBL:E9B8X5"
                     /translation="MPSRSQGTASLGGSVADEEHSLRGRHGAGCRGCVGEDFHGRPAS
                     RPLSPSAAPERPRPLSHGVDSSRNLSFNFGEDARFSGSEPYSGRATAAPAATGKGGGS
                     ADAGAALAGGCTAGAECPSRGGGNAAMASFVSELHVTHNGIAIPPIHGIPRPGGLPSE
                     KPAEYAKVKDCRAPQRLRMPAKGAFSNATSLAVLQRVQSLVNERQVEPAGWTPIEPSP
                     MRVGAVGDDDTAEEGSVAQMHRRAASPDGKWPEVEWAARDPRVSAARSPSLAPHGFSE
                     ALLMPSDAMMVAEKSEGDAAAMATTHAMQYAEDRGGVEEKAARVRSFMPVRQHLRQQQ
                     QQQYHHEGRTTLAHARAPTRSASPPKLPCNEGNIQNDSDNEQSPHRQRTAAPIASARC
                     GDSMDDIAPCAIRTAASAQRSLACKLTSGRSQDPPSAYRPDRAPAPAAAKVTASADRK
                     PSARMPRGFELFIEKGQQRRAEAERAQHARAAEAAGEPLAAASAQHHSNGDTAPSTGD
                     RATTRLRMMSVMPLPRGYEMHARQGQSRRAKAVREEEERRTGDIVSCTHHPRVSRHRI
                     VSSSSAHSARAIRRSPHPQPHTSAAAEEDGAPTAETLPLSVFERLTRKAEGRDHRPLQ
                     LEERCAPSHQSHSFKFAAAAAAAAEDEHGGSMKGGAAAAYKHRAARQTREGGAQRHKA
                     RGAGRNVFDDLHAQARKGAQAAPAASASPRSLGSQVHGRGAASGRASAMAPNKTETGS
                     AAAGEAGAEVTSHRRSQAEIEQHLAHMMSREAEHRAKWEKHLVAQAAEEEQTRNGHVV
                     LNPKTDELAERARTRYRIREEREKQQREREEVQKAAAAAKRAPQRSASQRQAPRFPKP
                     AEEGEQAAHKAVWGTEPTPTAAAPVSCAATDYFYKRQLHAKERKQRHLEQLRLERAEE
                     ELSECTFHPRINEAAGKMAQRLVVESFQGDYVVNVPDRFAPATTPWKQVVGSDGRAGS
                     VPQLAEYCDAHGHSLLASSRSGSFFGDLSRASPPAHYDVPCPSETPRPRSAERGLDSC
                     AGMDYDDDYIHRNTESSTYGVHAVASLEREVTTLPCHPSGPLAEQLRSLEEMLREWKE
                     IERECSPIAKQPRKAGIVE"
     gene            <474628..>475449
                     /locus_tag="LDBPK_061160"
                     /db_xref="GeneID:13391763"
     mRNA            <474628..>475449
                     /locus_tag="LDBPK_061160"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858374.1"
                     /db_xref="GeneID:13391763"
     CDS             474628..475449
                     /locus_tag="LDBPK_061160"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858422.1"
                     /db_xref="GeneID:13391763"
                     /db_xref="UniProtKB/TrEMBL:E9B8X6"
                     /translation="MSRVVVMALALSFAMAAALAVTAVQSGSCIFLTSPPSYTFIGGG
                     FHMQLALEYPLPAKDVRLSFDLPKSFFVDEAEAEQLYRMEVLSADPMTQGTAAVVVAD
                     VTRAYSPLRMSSRYAFDIEAPVFKVNYTTNHVELTFQQLGGDGAGSALDAYLAEDGAQ
                     AQVPFRARLVIPIHSRYEVLDTKTPFSLLRFITGEGAYVRRCLTRVDVAGRADSRCLT
                     GAYRSSATVAKSEEKPHYKHCLDLPVGLLADLPYVYHALMGLLVAGAALVILAIR"
     gene            <476273..>477262
                     /locus_tag="LDBPK_061170"
                     /db_xref="GeneID:13391764"
     mRNA            <476273..>477262
                     /locus_tag="LDBPK_061170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858375.1"
                     /db_xref="GeneID:13391764"
     CDS             476273..477262
                     /locus_tag="LDBPK_061170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858423.1"
                     /db_xref="GeneID:13391764"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:E9B8X7"
                     /translation="MNGALTPRQEVQLPHAPALLYNNLQPHGGGAYVSYATDSAVYTV
                     RASTGAPCFKPLRFPCGQVQHLAALQDDAEQNIIVVVVLSACMAVIVVNGRQVHVLPE
                     KGGDTALTCAAVARVAGKDEMVVAVGASNGIPLCCRCTLDGHPVASAEVTAPVQAHAQ
                     RSITALDLEAVGKASRVEMASGDAGGHVVLWADSNPTHTIPPESDTDAVTCVRLVSVS
                     NTVAVAYGGGQIKLIQRSSGAVTIAIQAHSRWINAMVYSAARHWLASAAEDGQISVWD
                     VTSVDPNRVCIASGTVTNELPTGLAFLSNMGDLLAASYDVVKLRCFPLPGKGR"
     gene            <477687..>479945
                     /locus_tag="LDBPK_061180"
                     /db_xref="GeneID:13391765"
     mRNA            <477687..>479945
                     /locus_tag="LDBPK_061180"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858376.1"
                     /db_xref="GeneID:13391765"
     CDS             477687..479945
                     /locus_tag="LDBPK_061180"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858424.1"
                     /db_xref="GeneID:13391765"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:E9B8X8"
                     /translation="MSLTDIEEAETVELLSEDSCSTMSASSQDVGATTADTSLPLTAN
                     ANEEQLRRRTLHECACIPELGPQTAWLEESGAAGNGPSASTTEMNWDVAHADHIIVAV
                     RWRVALTSPGTGSPSLHTTPWVPYAVPLAKMIASRTTAAADTASTVTSTASSSGGGSS
                     AILQPLGSVQLPLGRSMFLLAAQLSPLVPCVWDSGVAAESLVSVAASISRAQCTLHLH
                     YAAAKTPQAPSSLRARPVCRSFDVFAISPTTALLGVALQPHQRYHIKRKRGTGKSAHT
                     SEDQPCDAKGVLTLRVGPYCHVDVALDGLPSEPHVSGSAGTCPSITINTYNGRHAHAT
                     RSGQTQDSPAVHRTSACRSGVAREHPAAVTQLQRGSTTSLITGDSTAVLATMSDMSDH
                     VALSEASGHEHDGPVVAGSQEVAAAPSRTTITGSLKRQRSTAARGRAAEAVVRQVDNA
                     KAVEGGDDDEADAAASHSVATTPSAIVLFTTGMRLSDVEEKTLKELGALVNPHLRLAR
                     YARVLVAQRPLARSVKLLTVLPYVQDVVHQSWLDAVLRTRTLDLPLEGFAYKERKIAG
                     SIESENSFDLRETMSKAPTERQRLFAQQRFWVHKSAAPQEPPMNDLKTVVAASGGIIT
                     RCVLDADVLVLPKHKPTLSCWRGIAQQLGGTGGASASSASAAPTLAQRKQAGVLFVVP
                     DDIFKCVLQQRRLSASSITLPRQLLTEAAATRGTTGAARVGRRPSQPTRKTPRASTTQ
                     RSPHRKSCKRSQ"
     gene            <480391..>481956
                     /locus_tag="LDBPK_061190"
                     /db_xref="GeneID:13391696"
     mRNA            <480391..>481956
                     /locus_tag="LDBPK_061190"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858377.1"
                     /db_xref="GeneID:13391696"
     CDS             480391..481956
                     /locus_tag="LDBPK_061190"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858425.1"
                     /db_xref="GeneID:13391696"
                     /db_xref="InterPro:IPR025487"
                     /db_xref="UniProtKB/TrEMBL:E9B8X9"
                     /translation="MALRQLSLAPHGVRRGLSFALCTSITLGCTMSVRHGCCIHRLCE
                     APVAPSSTNTNFAVASAVGGAASRSTSTACSSPLFWFELDRLPPQLQREFDVDANQRA
                     LRHLWRPTRAGTDSDGASAVPFNLPVTPSSVHPVVWRCTHCQSQWSARPSDRTNPQLA
                     DAHRCPRCYGGQRLPAGSPDTPTSPDAGAQPGPSSRPSTAATGVGLLCDSYPFLAAQW
                     DPLRNQLLQNQVLQSVTEVRTSSASMVWWRCPLCLSPWLESVSSRVARYGLAMQRHSV
                     PSKPSLSRTGTTPGNDPSRPAGELVLLCPSCERRGASSSGAISPASPRRWLADDALLL
                     GEALLRPHQDPQRVSLTSETMLQWRCRSCQFEYAATVANRFLRHERCPQCSGRTKSMH
                     NLLVVQRPDVVREVSKHISRTRLRYITIHDDVELPFVCRTCYAPYRMTARARCAVPRG
                     VPACSKCFLTSSQVLTEAQHQHQHGGAKALSARARRRVRQRALQLSRSHRHRERLAAT
                     LNELSHHDNALKD"
     gene            <482511..>485792
                     /locus_tag="LDBPK_061200"
                     /db_xref="GeneID:13391697"
     mRNA            <482511..>485792
                     /locus_tag="LDBPK_061200"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858378.1"
                     /db_xref="GeneID:13391697"
     CDS             482511..485792
                     /locus_tag="LDBPK_061200"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858426.1"
                     /db_xref="GeneID:13391697"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y0"
                     /translation="MDVDVAYTESVPRYVDLALFLCGEALRLIKGELRQHAAAAAPLY
                     AWHLHKVCFLHALPNDGDACVDGAAADDDANPAAAAAARSGCTGLSSAAPSLGQIDEE
                     TTWDVAPALSAQSSKEVSFRRAYAQLRRPCGVDSWMGAKEKPDAHVAPTAAGAPTRED
                     ASSSQVAGQVHPRSPREGEHRCGRAHAPQPLHRPSATPTDVGFALLCDFLRTAAQAGG
                     TPLMQRLAAVLCSLVTRPTKRGSAPDAHLSRIRELPPSPTITVAQLSDLFDENLFDDE
                     LSAEAGNATRSFHIWVNYEWASASFARQTQLAAAVTKWLASLRHCRDGSPPAWLPALK
                     QRSAASTLPRPLASAVPINVRRMQAALEGVFEGHACTRAMLMELSLTQRTPHLTDNAL
                     AKLLALQGPPTSSMMARSELSNRGTQPILMCITSGMLLYAQYYLSFRSLEVARQCARV
                     ALQVAQEVKSNAILALAHYTAHVVATHQGRPADAANSISIALQLTLPNGSSRGSGQKG
                     GPADESLSSLAPTLSGMDAQMASLAFAGAAQLLLFFPGAVGPALRSILSTGQRCDRGG
                     VGDGGAEAQHTRGAEDGRSEEPSDLVTKQSGAVTVQNVAQSIRHALLRAHVALLQAPP
                     VEGRWIGVVASLQRETLLLIGAMYGMVSSPLVITTTSLRQLLEEVKEETSTASPVYSH
                     YPSRTLLWEVLRHAAHHALALQEGFLAPVKRAVNDAGAGAAASDALHCLHSALTAVGD
                     HYCASASATANEIVFFASVVRYCAGCQLYADGYVAAAYDVWSRLAGALNPSACTGDMD
                     GGQDRRHRADEKPADADASVNLSGFLKETGAAHFWPPDHLLLYALVQRRRAQAAVFLD
                     YIAVPHRLQKELLAVSSRYAFSFGVLTAQLMQAQVHQQHGRFSASLNVARDVERAATR
                     IGYPSLCEAARALQVTAYSNSGCWREAQRTLARCRPTTAAQRSVLLLQQYTAHLEPLL
                     LRKPVSTGKVECLTRSWVALLMREGLVTAQTVHDDGDLRVCATAFGISAVDELCLYSS
                     LQRACALLGHRTSAIAKRTATCLETLIARQQRPTPDVCIHGSCEEICRSGLCGGRPCD
                     VRKDL"
     gene            <486454..>486861
                     /locus_tag="LDBPK_061210"
                     /db_xref="GeneID:13391766"
     mRNA            <486454..>486861
                     /locus_tag="LDBPK_061210"
                     /product="nuclear transport factor 2 protein(NFT2),
                     putative"
                     /transcript_id="XM_003858379.1"
                     /db_xref="GeneID:13391766"
     CDS             486454..486861
                     /locus_tag="LDBPK_061210"
                     /codon_start=1
                     /product="nuclear transport factor 2 protein(NFT2),
                     putative"
                     /protein_id="XP_003858427.1"
                     /db_xref="GeneID:13391766"
                     /db_xref="GOA:E9B8Y1"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y1"
                     /translation="MEQGAFNDVAKKALEFRNRYYKMLDDPQDRLNVAGLYAPDVPMV
                     CEWNGHPLSTVDDVRNYISALPKTSHQIDMVDAQPLPDNQDGDSFLLTVHGIVTYNDE
                     HRREFYQRMVIRRFEQRYYILNDYYRWLSERSQ"
     gene            <487991..>489358
                     /locus_tag="LDBPK_061220"
                     /db_xref="GeneID:13391698"
     mRNA            <487991..>489358
                     /locus_tag="LDBPK_061220"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003858380.1"
                     /db_xref="GeneID:13391698"
     CDS             487991..489358
                     /locus_tag="LDBPK_061220"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003858428.1"
                     /db_xref="GeneID:13391698"
                     /db_xref="GOA:E9B8Y2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y2"
                     /translation="MNQNPAAQAGDKVPNMSNSRRGETSDDYARHKAAASRAFLENHY
                     QSLLANTRNGVGRAVGPRQKEPSFSDFHLFKCIGRGAFGEVFVCKYKSDKTDTLYALK
                     RLRKSDMITKKQVVHVRSEKDVLAEAAASNPWVVHLYRSFQDSLYLYMVMEYMPGGDM
                     ISWLCDKGIFDVESTRFYIAELCAAVASVHDMGFVHRDIKPDNILFGESGHIKLSDFG
                     LSKRFVEKRGNLLDYDDPSSSSNGAEASADEKSAYESRTDAPSGSPSGDGAGTGIAHG
                     RVREMFQSIVGSPGYIAPEILLRKPYGVGCDWWSVGVIMYEMLYGIPPFFSQNPNSTC
                     HKIKNWREHLVFPPQRHIPDDAVDFMKRLICEPEKRMTYDEICHHDFLKPMDMNGLLK
                     LQAPYVPALSNRLDTKYFPEIKEPSAPMQQSEEQKVREVDPRGVMFADFRFNYSGDQA
                     GPASA"
     gene            <490354..>490797
                     /locus_tag="LDBPK_061240"
                     /db_xref="GeneID:13391767"
     mRNA            <490354..>490797
                     /locus_tag="LDBPK_061240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858381.1"
                     /db_xref="GeneID:13391767"
     CDS             490354..490797
                     /locus_tag="LDBPK_061240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858429.1"
                     /db_xref="GeneID:13391767"
                     /db_xref="GOA:E9B8Y3"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y3"
                     /translation="MRCTHHAKTTAVPLLAVALLLLLGGAAHTAAAAEASRVVELTRD
                     TFDAYVGGPDTYTFVLYCVTWSRQCKTAIQLWDRLSISQSQKELRDVFTAAYVDGDKY
                     PDLVKRMNVKGFPTMLFYTPLHTEGLEYNGPRESYLLDSFVFQFS"
     gene            <494093..>495277
                     /locus_tag="LDBPK_061250"
                     /db_xref="GeneID:13391768"
     mRNA            <494093..>495277
                     /locus_tag="LDBPK_061250"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858382.1"
                     /db_xref="GeneID:13391768"
     CDS             494093..495277
                     /locus_tag="LDBPK_061250"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858430.1"
                     /db_xref="GeneID:13391768"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y4"
                     /translation="MFAYPYGDPDDQNAQVECTLLRQAGDGARILVPDSDNEDSLGLP
                     ISQESSPSVCVPAARAFSKRAARCAAALLQRHDATASAVHKHKCMQQLGRLGGAYRSL
                     AHGQPFTIWVRYQDLNARVIRETEAFFEGHMADHLAHPHVTRKNGVLAAAPKAAFGFN
                     PQRRSPEASLGCRAPLPSSPSPAHAAHAMLSSNGVVEAHASPPQTGYFLSRGEQCAFS
                     LLFMEDTVDPNYTSSPLPTFPTHHTSDDRSQRMGLSESLCNALSHGSCLSDTHAAMPF
                     WMYGEDADSVRCSPAPAAHRGDSPRAARQHCKRGRGDTTGAEPQHLKGRRGELGTARA
                     LVFDELSTSSSSQHTTPREESATARRGTPAPPSLSATVIELQNQRVQWDLLRRQSLFS
                     LL"
     gene            <495866..>497632
                     /locus_tag="LDBPK_061260"
                     /db_xref="GeneID:13391769"
     mRNA            <495866..>497632
                     /locus_tag="LDBPK_061260"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858383.1"
                     /db_xref="GeneID:13391769"
     CDS             495866..497632
                     /locus_tag="LDBPK_061260"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858431.1"
                     /db_xref="GeneID:13391769"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y5"
                     /translation="MLVSEKAQPLRLFNCLLLHAHKDDESDDEACTMHKSAASTSPVT
                     DPIAAATAVGATRLYFTEGGPSASLAALQRYLKVEEAHITCPLLRVLQLAPQAPTGNM
                     QPLVYVEQDTQNAVSLSDETQGRREAVLTTCSGVCTQETMPSRWYHAPVKAALCVFQE
                     LMRAPTTSAASEPAFWAFLERVVLYHARDFYRGAVQVELQCVFVPTFEDTQSTAYSVD
                     VFGDYVDEEDQAQKCGAAAGKGRTAMKVCVKSTEAFEHVMAYLKTQCPLLEADFGSSH
                     LVVYAKWSSRLSAARGSSHSQPPAADATGAVEQAACFVWLQDDAEGAGRDGVYADAAL
                     EALLDELTLAAASISTPSRAAAVLQEEGVSAFFEACCLTHTLKRVIRKNFQAVVRRQR
                     PLFHWVISLPPYSRLSMSTTSAAVTAMRFRNNAAVSRAVWSVTEMLVHWQQLSDSAHA
                     LANEALKRSFGRASGPSRQIVSAPARVPRQRRAIQQSALYGDTFSGGSALDRQRGKVN
                     VPHLYGADEGHGASISLSSTQRGSVLAASGLFHNLRSIKEDSFNSTSVLDAEDVFGSY
                     PKLTTRVVKRLVQSQTSVHAAQ"
     gap             498058..498130
                     /estimated_length=73
     gene            <499357..>501732
                     /locus_tag="LDBPK_061270"
                     /db_xref="GeneID:13391770"
     mRNA            <499357..>501732
                     /locus_tag="LDBPK_061270"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858384.1"
                     /db_xref="GeneID:13391770"
     CDS             499357..501732
                     /locus_tag="LDBPK_061270"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858432.1"
                     /db_xref="GeneID:13391770"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y6"
                     /translation="MKLFLTVVRRHNSTSSSDATPTDDVALFDPGVWSRTTTSEMARR
                     NVSASYVAQQVYRHAALTQLAKAALEGAVCFRYGPRPPTHLDSFLFHKRSRLTEHGRS
                     GTLPAAAAAPPVCTSSPLISSSCSSFSVSMTATSPRTGQKRSTAAGASGSATEYDSLL
                     ALWLRELLSGTGISVTVTALLLFVDGTAIDMATGSEVHKPLNVGSGTARQLRTHEDAM
                     AFLHACESTIRHSAAEFPRCPYHVCVAVLVGAHGGSHRRNTVTFLDVAAAAPESAGAE
                     EEVRLREQVALFGRQLGAEAATATPHACQRTRKAEDEQWLSLLQSCQLSRASLVGLVY
                     IACEAGHDSFGHFRVEENGCDPFTLVSVLRQRALLEAVNNGVLHLQLRKPSHAQKRAN
                     ARSVKLPTGDATTTSRAPDSPPKGRPSRGRQRPQQHRSRLPYLTRGSVPPRRAQEHSI
                     VFCGFPRCSRSVDPLARIGREERHARVALSSAEQRARKLAELRWILRAHPPGKSIDAM
                     LRRLAHNVNRVSRPEQQHPHSVPPRFSPPPLNEAQLATAISRSSTTATRWSSFTSPMR
                     TPESTSPGGTVRKRVAASMLPTSPSCPALASPYFTRRITTPLFFREAGSPPQNQDDPR
                     AHSVSSRAAVRGHTAAGLERRRLNSGASFSLATGSPNTHTYTSARRLSAIETALLARA
                     HSSNQRSLPSHSPRMGEVERLYPLVHAFHVEMCEQDTLMAEELMMRSRIEHKEKNCRK
                     TLSFARAESVRRPSVLWPSETGTQPQREPQVPHSPRWRPAKPRPLRIFFQH"
     gene            <502814..>503695
                     /locus_tag="LDBPK_061280"
                     /db_xref="GeneID:13391771"
     mRNA            <502814..>503695
                     /locus_tag="LDBPK_061280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858385.1"
                     /db_xref="GeneID:13391771"
     CDS             502814..503695
                     /locus_tag="LDBPK_061280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858433.1"
                     /db_xref="GeneID:13391771"
                     /db_xref="GOA:E9B8Y7"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012864"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y7"
                     /translation="MKSPGRCVRFARTPLTTCRPRMKRLIKSLQHFSVTSSEHVESFS
                     KMTLRDFGFYVSDADAMRYVADEAYPIAERAFQLENALHQCRLSASTAQVSPMAWKSS
                     SSDTLGCSTLYQDEAVTLCWFVLPPGKALPLHDHPGMTVWQRAMHGRLHLCSITREAD
                     SQTGTGASTAPINGTVVFDGELDGVGDAIPASDVLGFTPTDGDGGGMLHEIRNIDATQ
                     PALFVDIISPPYNQAPSNIVCGYYTAEPLDATATLLPALAADCGVRHQLKAGDKVRLH
                     PRINYSGPAMNAFLHVV"
     gene            <504311..>505795
                     /locus_tag="LDBPK_061290"
                     /db_xref="GeneID:13391772"
     mRNA            <504311..>505795
                     /locus_tag="LDBPK_061290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858386.1"
                     /db_xref="GeneID:13391772"
     CDS             504311..505795
                     /locus_tag="LDBPK_061290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858434.1"
                     /db_xref="GeneID:13391772"
                     /db_xref="GOA:E9B8Y8"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR018168"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y8"
                     /translation="MLRRSLRMPAPSPAGAQANEVIVSGGGLVGAAMMASLQQLRSHL
                     HRSSAAPPLASHLARLMLVDSGKRPVYNAANMMHTLRTVSITPVSSKIIDNLGAWDQL
                     TTKHPYYRIAVRHEQANSPSLGAGGRSSSFFMTSVLGNRTSCEPLLEFTDLRKPVGFI
                     CFNAELNSCMMDVVEARQRALVDTPGAHDTLCFGTHLEGVQIPSQGTLEGSWGSARLV
                     SGETSTDVAFGLLLGCEGRGSSLRDVLSTPSLQQDYAQTAFVCSVRLEKADDGNVCSF
                     QNFFRDGKIIALLPTSEDTANIVFSTTQQHAKELLASTPEDLVAELNRRLWSFAPNDI
                     PRIRDVPQTTTPDGKVCRAQGSFPLKLNLATMPYAPRAILLGDAAHSIHPLAGQGLNL
                     GIYDLCALTSVLEQAIRSGQDIGSSVAVGQVFAGHMLSHTAPIITGMEIIKKLTHWTP
                     GLASVGMRALNSVPFVSTLAKDAILQVSSGALFAAQHKCCFLLQ"
     gap             506076..506174
                     /estimated_length=99
     gap             506509..506607
                     /estimated_length=99
     gene            <507181..>507552
                     /locus_tag="LDBPK_061300"
                     /db_xref="GeneID:13391773"
     mRNA            <507181..>507552
                     /locus_tag="LDBPK_061300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858387.1"
                     /db_xref="GeneID:13391773"
     CDS             507181..507552
                     /locus_tag="LDBPK_061300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858435.1"
                     /db_xref="GeneID:13391773"
                     /db_xref="GOA:E9B8Y9"
                     /db_xref="InterPro:IPR018783"
                     /db_xref="UniProtKB/TrEMBL:E9B8Y9"
                     /translation="MVLAATPTRLHAHTHTHAEILTYAHAMATSAEDGHVAYEALTNA
                     QKAELAAWVRNQLDSTNGASQWRRHTQAMIRQAMARRAASGAPLDAGDILEEIMPHVR
                     SAIPPEVREGLFRRVTAQLHL"
     gene            <508252..>508968
                     /locus_tag="LDBPK_061310"
                     /db_xref="GeneID:13391699"
     mRNA            <508252..>508968
                     /locus_tag="LDBPK_061310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858388.1"
                     /db_xref="GeneID:13391699"
     CDS             508252..508968
                     /locus_tag="LDBPK_061310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858436.1"
                     /db_xref="GeneID:13391699"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z0"
                     /translation="MSSVSNSEIAKRIREGNQKRREEERKKQQLEQEYLEVVTKKLNE
                     ERQSRSPTRFLPSILICLLFVSFPLSEQVVDWYLVGIFCVLNTLLAFAFTNPSEWLSI
                     ASTVLINFLLVRFSSEIYNIPQRLVQVPLILLVNYVAINLLIVAAAYFLYVSPRFLRF
                     SRSYGGKRGRQTSAKHRGHHSNEYDVLEAFAMQKEEAERLDLLLCLLLLLNVAALIYF
                     GVIPFHLVLQNGLNVFRLLK"
     gene            complement(<511761..>513722)
                     /locus_tag="LDBPK_061320"
                     /db_xref="GeneID:13391700"
     mRNA            complement(<511761..>513722)
                     /locus_tag="LDBPK_061320"
                     /product="pteridine transporter, putative"
                     /transcript_id="XM_003858389.1"
                     /db_xref="GeneID:13391700"
     CDS             complement(511761..513722)
                     /locus_tag="LDBPK_061320"
                     /codon_start=1
                     /product="pteridine transporter, putative"
                     /protein_id="XP_003858437.1"
                     /db_xref="GeneID:13391700"
                     /db_xref="InterPro:IPR004324"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z1"
                     /translation="MASAHPIQEMRNGGAADHREDGATEVTHAEYEHPTATKWFNAAP
                     CLRYIPLFGEVTAAFGPKFSLSLGLCYTLSKGAASRIINVSRQPMFIVHYGLNVARYQ
                     RLATMYSLGWSLKPFIASIADVIALFGYTKRWYMALSAVLGTAAALAYALLPAKESSA
                     NAAAAFVFLTCFGKSNIDILSQGHFSRSMRENPEAGPSVVSWVWAMTFVGTILASCMM
                     GPLSDAKLTYVGIILSAALQLATIFFFVFNMYGEKKNRTNRRKDALMQFWELKRLEKQ
                     QAAKAVDGRVVESIVDSGDVKGLAVAEVAGDSREDDDADFVEPDIGSCLGGAVEVNVD
                     VAVRNWRLIVYALIMTCGIITQACVMVLGTRRHLLYACIGIATVFMAGAFLSLPLIVA
                     KAAVFIYLNSLLYLQIPGALSNFYLAKPKCLPDGPHFSYTFYQTVGALITDAGGVTGA
                     VLFTRFFSKHRYAFVFIATTLLQALGSIFDLIIVKRWNVHIGIPDHAMYILGDAIVYE
                     ICFVMSLMPGQILMSRLCPRGTETIAFALLAGFNSAGNSMSLAVGSLLMENFWPVSAK
                     PPCNFKNVPYLIITGHLCTPLLVIPLAFLLLPKARICDRIDIDGNVIAEDAKTVQERR
                     CPVVKPHAAFEGEGQGPETKQGDSREPKA"
     gene            complement(<515448..>516353)
                     /locus_tag="LDBPK_061330"
                     /db_xref="GeneID:13391701"
     mRNA            complement(<515448..>516353)
                     /locus_tag="LDBPK_061330"
                     /product="coproporphyrinogen III oxidase"
                     /transcript_id="XM_003858390.1"
                     /db_xref="GeneID:13391701"
     CDS             complement(515448..516353)
                     /locus_tag="LDBPK_061330"
                     /codon_start=1
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="XP_003858438.1"
                     /db_xref="GeneID:13391701"
                     /db_xref="GOA:E9B8Z2"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="InterPro:IPR018375"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z2"
                     /translation="MSLAIEAVKDFLVKLQDDICEALEAEDGQATFMEDKWTREGGGG
                     GRTRVMVNGAVIEKGGVNFSHVYGKGLPGSSTERHPDMTGCNFQAMGVSLVIHPKNPH
                     VPTSHANVRLFVAEREGKEPVWWFGGGFDLTPYYAVEEDCRYFHQVAQDLCKPFGADV
                     YTRFKVWCDEYFFIPYRNEARGIGGLFFDDLNEWPFEKCFEFVQAVGKGYIDAYIPIV
                     NRRKNTPYTEQQVEFQEFRRGRYAEFNLVIDRGTKFGLQSGGRTESILISLPPRARWG
                     YDWQPEPGTPEARLTEYFLTKRQWV"
     gene            complement(<517379..>518074)
                     /locus_tag="LDBPK_061340"
                     /db_xref="GeneID:13391702"
     mRNA            complement(<517379..>518074)
                     /locus_tag="LDBPK_061340"
                     /product="protoporphyrinogen oxidase-like protein"
                     /transcript_id="XM_003858391.1"
                     /db_xref="GeneID:13391702"
     CDS             complement(517379..518074)
                     /locus_tag="LDBPK_061340"
                     /codon_start=1
                     /product="protoporphyrinogen oxidase-like protein"
                     /protein_id="XP_003858439.1"
                     /db_xref="GeneID:13391702"
                     /db_xref="InterPro:IPR026816"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z3"
                     /translation="MASQSPKYLMLYSTTDGHTKTIVDTIATLLTDETKARCDVVDIK
                     DGNSYVLADYEKVLLGASIRYGHFSAAFIKYVKQHHSELNAMPSAFVSVNLTARKSDK
                     NTATTNVYTRKFLNQSSWFPQLVGVFAGALRYPRYNFFDRVLIQFIMMVTGGETDSTK
                     EIVYTDWGAVRVFASDFAALPLAVPPRPKANAAEKPDGILRSGNGARCLLAIVGMSAA
                     VVVGIRIIVAKRG"
     gap             518779..518877
                     /estimated_length=99
     gap             519889..519987
                     /estimated_length=99
     gene            complement(<519989..>520153)
                     /locus_tag="LDBPK_061350"
                     /old_locus_tag="LDBPK_220002"
                     /db_xref="GeneID:13391703"
     mRNA            complement(<519989..>520153)
                     /locus_tag="LDBPK_061350"
                     /old_locus_tag="LDBPK_220002"
                     /product="hypothetical protein"
                     /transcript_id="XM_003858392.1"
                     /db_xref="GeneID:13391703"
     CDS             complement(<519989..520153)
                     /locus_tag="LDBPK_061350"
                     /old_locus_tag="LDBPK_220002"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003858440.1"
                     /db_xref="GeneID:13391703"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z4"
                     /translation="MSGWLTAIISLKSTGLLHPARVEKRTGISRKRSLISRSAGTAWP
                     SPSELPRLLLR"
     mRNA            complement(<519992..>520153)
                     /locus_tag="LDBPK_061350"
                     /old_locus_tag="LDBPK_220002"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003858393.1"
                     /db_xref="GeneID:13391703"
     CDS             complement(<519992..520153)
                     /locus_tag="LDBPK_061350"
                     /old_locus_tag="LDBPK_220002"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003858441.1"
                     /db_xref="GeneID:13391703"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z5"
                     /translation="MSGWLTAIISLKSTGLLHPARVEKRTGISRKRSLISRSAGTAWP
                     SPSELPRLLL"
     gene            <525112..>527040
                     /locus_tag="LDBPK_061360"
                     /db_xref="GeneID:13391706"
     mRNA            <525112..>527040
                     /locus_tag="LDBPK_061360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003858394.1"
                     /db_xref="GeneID:13391706"
     CDS             525112..527040
                     /locus_tag="LDBPK_061360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003858442.1"
                     /db_xref="GeneID:13391706"
                     /db_xref="GOA:E9B8Z6"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:E9B8Z6"
                     /translation="MRGIDGKGEPSREGVEVDAATRMTTEDWGKDGVVDNQSILLAQN
                     EPSSVEEGERYKRDATTVHRLFKRTIIRNSVFLWLVGFINSFHYCLVMSAAASLAEGY
                     GLKKLVALITWANIFFGIFARILNMFIANRVSYNLRITAMALSSLLGIFFVSFATPMG
                     GHNNVAAFVVMLIGVVLLGTASTYGESVMLTFVQRYPDSIVGAWSSGTGISGVAASLI
                     FLGLTSARLTQQQTFLVSTPLCIIYWLCFMLGMVSPRKVLVATRTNGKREDIIIYCLE
                     GEEDAHICLLRERALARQDVVSVSEDYEIKMIMNIRAVSWHRSPVVHKPEPIAEEGDG
                     LYYPCCRVICGCCSPSNGLRRWWRDVGPDLIFMHNTMIWFFFNLAVVYIAEYAAQLMA
                     PFSFYCEPEWKDNFWVKNSYVVCQFCYQLGVLISRSSLLIVKIPYVGIISIIQVVNAV
                     CWIVQARVMYIKSNTKSRQVGLSFILFAWMIFIGLMGGASYVNVLYLILKRSTTLRER
                     EEREAVEAYLTSKGHDVSQCRYAEDSEPRKKAADERAAPVVAKLERKPMNEIMPQPSQ
                     CDTASAAPQAQILGLPLTQEERDAIKAIHCNLNDVWATRREMGMNIGALYATVGITLG
                     TVVDLIFTNTMLKHSTSC"
CONTIG      join(FR799593.1:1..529559)
//
DBGET integrated database retrieval system