GenomeNet

Database: RefSeq
Entry: NC_018244
LinkDB: NC_018244
Original site: NC_018244 
LOCUS       NC_018244             671483 bp    DNA     linear   CON 30-MAR-2018
DEFINITION  Leishmania donovani BPK282A1 complete genome, chromosome 17.
ACCESSION   NC_018244
VERSION     NC_018244.1
DBLINK      BioProject: PRJNA171503
            BioSample: SAMEA2271930
            Assembly: GCF_000227135.1
KEYWORDS    RefSeq; complete genome; complete replicon.
SOURCE      Leishmania donovani
  ORGANISM  Leishmania donovani
            Eukaryota; Discoba; Euglenozoa; Kinetoplastea; Metakinetoplastina;
            Trypanosomatida; Trypanosomatidae; Leishmaniinae; Leishmania.
REFERENCE   1
  AUTHORS   Downing,T., Imamura,H., Decuypere,S., Clark,T.G., Coombs,G.H.,
            Cotton,J.A., Hilley,J.D., de Doncker,S., Maes,I., Mottram,J.C.,
            Quail,M.A., Rijal,S., Sanders,M., Schonian,G., Stark,O., Sundar,S.,
            Vanaerschot,M., Hertz-Fowler,C., Dujardin,J.C. and Berriman,M.
  TITLE     Whole genome sequencing of multiple Leishmania donovani clinical
            isolates provides insights into population structure and mechanisms
            of drug resistance
  JOURNAL   Genome Res. 21 (12), 2143-2156 (2011)
   PUBMED   22038251
REFERENCE   2  (bases 1 to 671483)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 671483)
  AUTHORS   Aslett,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JAN-2011) Aslett M., Pathogen Sequencing Unit,
            Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus,
            Hinxton, Cambridge, Cambridgeshire CB10 1SA, UNITED KINGDOM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FR799604.
            Data release policy http://www.sanger.ac.uk/legal/#t_2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..671483
                     /organism="Leishmania donovani"
                     /mol_type="genomic DNA"
                     /strain="BPK282A1"
                     /db_xref="taxon:5661"
                     /chromosome="17"
     gene            complement(<3196..>5520)
                     /locus_tag="LDBPK_170010"
                     /db_xref="GeneID:13393298"
     mRNA            complement(<3196..>5520)
                     /locus_tag="LDBPK_170010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859813.1"
                     /db_xref="GeneID:13393298"
     CDS             complement(3196..5520)
                     /locus_tag="LDBPK_170010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859861.1"
                     /db_xref="GeneID:13393298"
                     /db_xref="UniProtKB/TrEMBL:E9BD28"
                     /translation="MDRAATSDARARSSLSKAQEHLKNNDVKEAIDALSSHLRFNQVT
                     PIGFECLELLADLCLTQEKLEPVKLIEVLRRCRSGLRGSQHVEESVQRIVDSVMIRIR
                     QMCAKAKERTEAMQINATEGDRMLAALNGISLAALAEKRHIIPCHAALRRLIRHFCGN
                     NTIGFAKKLTFIYNKTVRQFLSMCKEFNAPACVLDISSAVSRAVSHMALDHLHDHDDA
                     ASRNAVQELLKERAAFLTSTSAVTETVETLCCLLNDICSLRQYGGAFDVLSCLKRVCD
                     KVQRNEEFVDVVSGAYETMSDIFWTCSVYNYHAYCLSVAASMKRQEKRGPLAARAVLA
                     SLCVADGDMELDPFGRYREKNARIDELFESPITTKTSLIANLKTKGVYTLASPEIVKI
                     AANLEDPDFSDFTGLHKSVTALTAANSDLARYGNELHKMILRYQLEVLSGTCNYVEVL
                     SLAAYNGNLTAAEYVNNIEPVILGDESVSVDIDTRTNTLSFRDSSKAKMLSYFNKIVA
                     NVDTVPASSLATTSGRYSDFTHVAASSSKRQVMPSAADLDAARARSTSIYALQKACMN
                     SKAERIEEAKKSEDKKRERAVAERREQEEAKKEETQKAYIRKLYAEYNERQRQERGKE
                     VLRKLRIKYPGFKVDESIVYRSAAGFEDELTRLLAAFKRRGVDNDRKEILQANLYERA
                     LRALEIPKRKEYEAQNAERTRAERAAARENYLAEHRREYDRRQNEKAVLSKFLHDADE
                     FERTWRKRANIDKPSKRDEQQRLLEEEMRRLGGE"
     gene            complement(<7801..>8466)
                     /locus_tag="LDBPK_170020"
                     /db_xref="GeneID:13393324"
     mRNA            complement(<7801..>8466)
                     /locus_tag="LDBPK_170020"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859814.1"
                     /db_xref="GeneID:13393324"
     CDS             complement(7801..8466)
                     /locus_tag="LDBPK_170020"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859862.1"
                     /db_xref="GeneID:13393324"
                     /db_xref="InterPro:IPR021910"
                     /db_xref="UniProtKB/TrEMBL:E9BD29"
                     /translation="MRVGESPAILFITTVLSHVALLPTLHFFYRRKYIFELCCASFGF
                     LASFMYHTTENFGTSIFLTEVEWHRLDNVGVISIMGIWYVYLCCFQNPYVDMSCKCFC
                     IFFTLVVQQKNPWDVRFTISPILFFTLFPVVKHCLVEQRLPPFSARHLGCGVFLFFFA
                     IIFFFLGLNKRADRYRMYHGAWHFFGGLSSFFLWEMVKTPGCTGSYGIQRRDCPLRGD
                     TMV"
     gene            complement(<9226..>9903)
                     /locus_tag="LDBPK_170030"
                     /db_xref="GeneID:13393323"
     mRNA            complement(<9226..>9903)
                     /locus_tag="LDBPK_170030"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859815.1"
                     /db_xref="GeneID:13393323"
     CDS             complement(9226..9903)
                     /locus_tag="LDBPK_170030"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859863.1"
                     /db_xref="GeneID:13393323"
                     /db_xref="InterPro:IPR021910"
                     /db_xref="UniProtKB/TrEMBL:E9BD30"
                     /translation="MAHRPDDSKYALFFTCVLSHLPMVAVVAFLVRRDLRFEGVVGAY
                     SVTVSFMYHTCECFETSLFMSEGRWHRLDNIGAIVSVGCSCIQLACFENRILLEYLQY
                     IILFIVIILQEAAPWDVRYTIVPVAVCIAVPIVSHLLNPRRRHGFVLPRVLNGLVALV
                     LGGIFFAMGLDESNDPVRIYHGFFHICITITIFFFFYALRPSAERKRRSLHLPSCDDA
                     VGVMVNL"
     gene            complement(<11591..>12226)
                     /locus_tag="LDBPK_170040"
                     /db_xref="GeneID:13393322"
     mRNA            complement(<11591..>12226)
                     /locus_tag="LDBPK_170040"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859816.1"
                     /db_xref="GeneID:13393322"
     CDS             complement(11591..12226)
                     /locus_tag="LDBPK_170040"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859864.1"
                     /db_xref="GeneID:13393322"
                     /db_xref="GOA:E9BD31"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BD31"
                     /translation="MYFVSPVPTRAHLLQREAITRGSVMQGNPHTKAAAAASAASVPA
                     GSHDASCSNLSDYLNEDSVVGDLETYDVGEYHLTTCPICLEHFTLDNPAILLKCEHGF
                     HLQCLESWRQRSSMCPMCFAPVVGDEGRLMSSCDVRRRRRMQLKPPSAPHHAPERNAL
                     ITPTAAQQTPQSNCEVEHASEQDEEIEVIEVTSRKGSVHWVWSWLRECCAF"
     gene            complement(<13056..>13844)
                     /locus_tag="LDBPK_170050"
                     /db_xref="GeneID:13393325"
     mRNA            complement(<13056..>13844)
                     /locus_tag="LDBPK_170050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859817.1"
                     /db_xref="GeneID:13393325"
     CDS             complement(13056..13844)
                     /locus_tag="LDBPK_170050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859865.1"
                     /db_xref="GeneID:13393325"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:E9BD32"
                     /translation="MRRWTASAAPAAVQRQSCLLALRCATTGVQHSYKPGCFVLALRS
                     LFVTLTPTSLKRRIAIRMQTGMERTEELERQLQWLQKHGSPLQVMGLPNHAELAEVRA
                     RYRSLVLETHPDTAKNTTGESEYAILQTAYKMSVNPASLWHQNGASPALHRQLLQTSK
                     KSLRRLDRVHVFATFSYAVMLAIGVFFSTVVVSNGLEAALKFFDPEFYHFMVQQEKEE
                     DRKRAAGEVVNTDPKRLAPTAVRRLLFPGQFIHEGDEGKARRGE"
     gene            complement(<14622..>15335)
                     /locus_tag="LDBPK_170060"
                     /db_xref="GeneID:13393326"
     mRNA            complement(<14622..>15335)
                     /locus_tag="LDBPK_170060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859818.1"
                     /db_xref="GeneID:13393326"
     CDS             complement(14622..15335)
                     /locus_tag="LDBPK_170060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859866.1"
                     /db_xref="GeneID:13393326"
                     /db_xref="UniProtKB/TrEMBL:E9BD33"
                     /translation="MGQAVMEDQGNSLVVWGSTGRRLQFSMQDLKLPASLRDNPHFHF
                     YEKQWDAVASFWFNRVLKESALQHLSVEAIIELIREDISKRWERRRQEQSIYKKRKRL
                     LQRSGPAGTPSSSVLLTNVTTLEGYHAATEMEQKDLVTALVERVEDVAKDKVESWRVL
                     IDDASEQRPAKAARVEGTTATSGEHSENDADAAGDFDDRVAVILKLSSKEKAATTIAH
                     LHGSRFDDRRVLCRFWSES"
     gene            complement(<16899..>18560)
                     /locus_tag="LDBPK_170070"
                     /db_xref="GeneID:13393327"
     mRNA            complement(<16899..>18560)
                     /locus_tag="LDBPK_170070"
                     /product="mitogen-activated protein kinase kinase 3,
                     putative"
                     /transcript_id="XM_003859819.1"
                     /db_xref="GeneID:13393327"
     CDS             complement(16899..18560)
                     /locus_tag="LDBPK_170070"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase 3,
                     putative"
                     /protein_id="XP_003859867.1"
                     /db_xref="GeneID:13393327"
                     /db_xref="GOA:E9BD34"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:E9BD34"
                     /translation="MDFYALQDTLLRNAKSGGSSDTVDVESRYVLMEKIGAGSYGDVW
                     SATRRTGTKDIYAVKRIDKRQAGTKGLRSVMGEVETMSLLSHPNIVKLEETYQDEACL
                     SIVMEYLPGGSLQHRIDRQNVSELETRRFITQLLMAVEYIHEKGIVHRDLKPSNCLLS
                     QNDLVVKISDFGLSVFAGNKQCLTTCCGTLHFMAPEILLEKNYGKPVDMWAMGVMAHV
                     MFLGRYPFQARTEAALTKDICRGYRPREEGGGGLRCPPLLQDFISQLLLYDPLRRMSA
                     KDALKHPWIKEGLDANRRTSLYPSQAPSATAMKPSARWRAAALAVMGVQRLLYLQKIQ
                     RLVRLGYDGFPILRDYRYLVTGKYVPASTSVECSHMFHARPMALLELISMIDTCPFLK
                     HVDLSWNNIHSLSVIQALLKVVTRHPSLQSIDLSHNPIPAVAGRSIVRLIRNPLSQVT
                     CINVGDTGISADTIGQINSFLKEKLTPAALSYSVSTGDMQSRLTQGSGDDTLMTSSST
                     TMSSLQQKRSICSGPPKQPAKKESRGVRLPPISRPPVARRHGKMP"
     gene            complement(<19664..>20227)
                     /locus_tag="LDBPK_170080"
                     /db_xref="GeneID:13393328"
     mRNA            complement(<19664..>20227)
                     /locus_tag="LDBPK_170080"
                     /product="ADP-ribosylation factor, putative"
                     /transcript_id="XM_003859820.1"
                     /db_xref="GeneID:13393328"
     CDS             complement(19664..20227)
                     /locus_tag="LDBPK_170080"
                     /codon_start=1
                     /product="ADP-ribosylation factor, putative"
                     /protein_id="XP_003859868.1"
                     /db_xref="GeneID:13393328"
                     /db_xref="GOA:E9BD35"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BD35"
                     /translation="MGAWLTSLKQTLGLLPADRKIRVLMLGLDNAGKTSILYRLHLGD
                     VVTTVPTVGVNLETLQYKNISFEVWDLGGQTGVRPYWRCYFSDTDAVIYVVDSTDRDR
                     MGVAKHELYALLDEDELRKSLLLIFANKQDLPDAASEVEIAEQLGVSSIMNRTWTIVK
                     SSSKTGDGLVEGMDWLVERLREQGIGA"
     gap             22211..28014
                     /estimated_length=5804
     gap             33014..33382
                     /estimated_length=369
     gene            complement(<33385..>36414)
                     /locus_tag="LDBPK_170120"
                     /db_xref="GeneID:13393331"
     mRNA            complement(<33385..>36414)
                     /locus_tag="LDBPK_170120"
                     /product="receptor-type adenylate cyclase a"
                     /transcript_id="XM_003859821.1"
                     /db_xref="GeneID:13393331"
     CDS             complement(<33385..36414)
                     /locus_tag="LDBPK_170120"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase a"
                     /protein_id="XP_003859869.1"
                     /db_xref="GeneID:13393331"
                     /db_xref="GOA:E9BD36"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9BD36"
                     /translation="MQIRPSLGGCLRHGGAGDHAARRLSRLRAAKVFVPTAVVCVVLC
                     CAPWVMAEITNDAEREPVYILNAMYSTEAYTNEDAKALWTGMDMAFYNSRYTAAGGRP
                     IKILHPDPDQDNLYDIAEVILHSLARQEKLLAVLGPYLDGRLTAALSNADVVQSGLML
                     IAPFTGSSGVRTWSDSVYFTRAEPMVELKVVLTHIVNRLRARRVAFMRLTGMHFGGEE
                     LTYVQDTLTSLLRDPAVLYTVPYSESSVEVDEEAFDAMADTNPQVIIVWAAPVQQVIY
                     FLEKVLTDPRTSSAYVISCSMIQRVVFDVYKRLLSAGSIKPQDGRILASATTSPVSGE
                     GLKYMEVFKAQMSNYIENSGSFDYYPDDDSTGTLGQKARSEAPLSRKYTVDEFFQAHP
                     SIAKLMALGWLSGTLVQQTLEQTDWIVNRSTYKAGLFNQNRFVIGGDYVLGDYGGPCE
                     PLAQFLGASCYCNQGGHSSILTVLQNASWDIVPDSSFKYPQSECNSSKSQIVKAVSVL
                     ALLHQGYPKLIDAGMQLNEVLPHAFDDNLCKGYKVSSIFLRVETAKAQQLFDAEVSNY
                     SVDIIAGPIFQALDVGKIFVLNPLYNHPQPRTEKRNYVYLMPTLEQQIYVMYSKIDAL
                     RTRTDVFEDTAVVLRGYSAQEVVEISEILFKTAGTFNLPDPSIATISFTDSLRGLLSP
                     RAINVVIGMKDGDIVHFADFLAKYTDVMVVVCFDELTMYYEELRATFSVQPTSVQARL
                     MSFSSLPLWTDASAEAEARWPILGHFHKIFPDPINHTPSLLRDVIIAGFIQELVSTTT
                     VAETKLLTNAVYINGGVTTYGFTLGNFEWGCTATTSGDSCVYKNYGASNIEILSIQRM
                     LDPTVPQLSSPSTPTMEYRPRQRSHALTPAQRNGLIAGCVVGAVVLIATCTLLLYCCM
                     DNRNNDAAPKDGDEPVTLLFTDIESSTALWAALPQLMSDAIAAHHRVIRQLVKKYGCY
                     EVKTIGDSFMIACRSAHSAVSLACEIQTKLLKHDWGTE"
     gap             39800..39898
                     /estimated_length=99
     gap             41351..41449
                     /estimated_length=99
     gap             41854..42131
                     /estimated_length=278
     gap             45186..45236
                     /estimated_length=51
     gap             46747..46845
                     /estimated_length=99
     gene            complement(<46846..>49704)
                     /locus_tag="LDBPK_170130"
                     /db_xref="GeneID:13393330"
     mRNA            complement(<46846..>49704)
                     /locus_tag="LDBPK_170130"
                     /product="receptor-type adenylate cyclase, putative"
                     /transcript_id="XM_003859822.1"
                     /db_xref="GeneID:13393330"
     CDS             complement(<46846..49704)
                     /locus_tag="LDBPK_170130"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase, putative"
                     /protein_id="XP_003859870.1"
                     /db_xref="GeneID:13393330"
                     /db_xref="GOA:E9BD37"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:E9BD37"
                     /translation="MADDAKALWLGIDSALHASGYKTANGRPVEIVNPDPSIKKSDII
                     AVVQKALEKYPTLLGVIGPFMDPLMSTVMKSDALKGKDLMFMAPFTGSNAVRMWDNDV
                     YFTRGDPWTEMTIILTHMLKRIRARRTAFMYLTGAQFGDSEYKMVVSVLSSFSLDPPA
                     VYSAPYSTKNTAVNMTAFDAMADTRPQVIIVWGIPGEQVVKFLQAVLTDPRTSSAYIM
                     TCFPLQRIVFQVYYDLAMAGKLTPVDGQIMSSATSLPISHIEIEHVRLFRTEMGEYMV
                     KTGRVDASLWADEAKAVQKYGPRGREASSSDSAAYADKFYNEHPSTGQLMIAGWLSGK
                     LIDQTLHEPLWTIDRKTYKAGLFDQIRYVIGGDIVLGDYGGPCTPIAEFLGAVCYCNQ
                     GGRASVLQGLNKAAWELLPDAIFHYAQSACYLNKIVLSKPLNVVTLNVSDLPKLRKAA
                     ADMAKVIPLAISEERLDFSAFNPATLNATQTTAQGVLDWEFLNYSVDVVTGPLLRSID
                     LSGLLVISPVFNRPNVLVEKENYLFLMPTLEQEMYVMYSELSSVRALTSIGEDVNLVL
                     HEYTSANVKDISAVALRTAATFNAPDPTVKAVSSGTSLKSSLEPSMINFVLGITDDDV
                     DAIAAFLSTHPLAIVVISFGDLAHEYESLTDTFAKLPNAEQARLLTFTNLPLWSDMSP
                     SSLESYPLLKLFNAIFPKPADHTPSLLRDLLSIVFIQAVAYGDGGFEKPTSLQESAYK
                     KGVINAYSVTLGRFTWNCTNTTSGLECLYRNYGAQGIVMLSVQRILDPTVPQVSSPMT
                     PTMEYRPRQKVDKMTSAQRNGLIAGLVMFTIILLTAAPLILYWCTEGRDNDAAPKDGD
                     EPVTLLFTDIESSTALWAALPQLMADAIAAHHRVIRQLVKKYGCYEVKTIGDSFMIAC
                     RSAHSAVSLACEIQTKLLKHDWGTEALDRAYREFELARV"
     gap             54714..54788
                     /estimated_length=75
     gap             55909..56007
                     /estimated_length=99
     gap             57079..57177
                     /estimated_length=99
     gene            complement(<57178..>59232)
                     /locus_tag="LDBPK_170140"
                     /db_xref="GeneID:13393329"
     mRNA            complement(<57178..>59232)
                     /locus_tag="LDBPK_170140"
                     /product="receptor-type adenylate cyclase b"
                     /transcript_id="XM_003859823.1"
                     /db_xref="GeneID:13393329"
     CDS             complement(<57178..59232)
                     /locus_tag="LDBPK_170140"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase b"
                     /protein_id="XP_003859871.1"
                     /db_xref="GeneID:13393329"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:E9BD38"
                     /translation="MYADATHPRRACWCGAGGVSGCVRQRHAYRCSRLLAGVLLIVGA
                     LTLAVSTVPAAWAAGALASSDEPVYLLNAMYSLSDYNAKHAKALWLGIDSALHAVGYT
                     AARGRPIKIIEPDPKDDLSDIVAVVLKALKDYPTLLGVIGPYSDTRLGAVPSSPEIQN
                     SGLMFLGPFTGSSVMRVWNENLYFMRAEPRLEIMAMVKHIANTFRARRTAFMYLTGEQ
                     YGSFEHKSLVELMTSLSLDPPAVYSASYSTSTAVNMTAFDAMADTRPQVIIIWGIPAG
                     QVEELLKVVLTDPRTSSAYIMSSFALQQMTFQVYYDLAMAGKLTPVDGQIISSATSFP
                     LTEPASVHLRVFRAQMGEYMVKTGRVDASLWADEAKAVRQYGPWEHEASSSDSAAYVN
                     NFFNEHPCVTQLMIAGWISGSLIAQTLAEENRIANRTAYRQYMFSQQRYIVGEDFVLG
                     DYGGPCNGVAEFLGAVCYCNQGGHSAVLSRLDRAVWTVITESGVSFTQKNCYSDGTTL
                     PRSLNFLTLIFAEHPLLAQVGLTFKTSISTLVAYLQYNASPVNGATLNVTDTTPQALH
                     DAVTTNYTTDVVVGVTVKGMNVDGYLVPSPIHPRPHLVELLRNYVYLMPTLEQQMFVL
                     YAKLSAVRGVTLIDSAVHMILHGYASDEVANITAVLRKSAATFNYDNPTVTAVPSTKT
                     VGS"
     gap             59924..60022
                     /estimated_length=99
     gap             61117..61215
                     /estimated_length=99
     gene            complement(<61864..>62145)
                     /locus_tag="LDBPK_170150"
                     /db_xref="GeneID:13393333"
     mRNA            complement(<61864..>62145)
                     /locus_tag="LDBPK_170150"
                     /product="receptor-type adenylate cyclase b"
                     /transcript_id="XM_003859824.1"
                     /db_xref="GeneID:13393333"
     CDS             complement(61864..62145)
                     /locus_tag="LDBPK_170150"
                     /codon_start=1
                     /product="receptor-type adenylate cyclase b"
                     /protein_id="XP_003859872.1"
                     /db_xref="GeneID:13393333"
                     /db_xref="UniProtKB/TrEMBL:E9BD39"
                     /translation="MNRLAIRIATVSQARCPVGNNGAAVDLDVQHAGTAEVMNPLLGE
                     GSCISDGARARHSGLTAVPPSAEPPAMRMRRVGRKVPERPTVCNVRGAH"
     gap             62356..63688
                     /estimated_length=1333
     gap             64564..67508
                     /estimated_length=2945
     gene            complement(<68123..>69472)
                     /locus_tag="LDBPK_170170"
                     /db_xref="GeneID:13393332"
     mRNA            complement(<68123..>69472)
                     /locus_tag="LDBPK_170170"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_003859825.1"
                     /db_xref="GeneID:13393332"
     CDS             complement(68123..69472)
                     /locus_tag="LDBPK_170170"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_003859873.1"
                     /db_xref="GeneID:13393332"
                     /db_xref="GOA:E9BD40"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BD40"
                     /translation="MGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEK
                     EAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNM
                     ITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTV
                     TYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIERSDNMPWYKGPTLLD
                     ALDMLEPPVRPVDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTE
                     VKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNSKNDPPKEAADFTAQVIV
                     LNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM
                     VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKAAKK"
     gap             69724..76966
                     /estimated_length=7243
     gene            complement(<76968..>77081)
                     /locus_tag="LDBPK_170200"
                     /db_xref="GeneID:13393334"
     mRNA            complement(<76968..>77081)
                     /locus_tag="LDBPK_170200"
                     /product="elongation factor 1-alpha"
                     /transcript_id="XM_003859826.1"
                     /db_xref="GeneID:13393334"
     CDS             complement(<76968..77081)
                     /locus_tag="LDBPK_170200"
                     /codon_start=1
                     /product="elongation factor 1-alpha"
                     /protein_id="XP_003859874.1"
                     /db_xref="GeneID:13393334"
                     /db_xref="GOA:E9BD41"
                     /db_xref="UniProtKB/TrEMBL:E9BD41"
                     /translation="MWPAPLAAQWRRVFCSACECAFLLPYGPRTGDSDHTAP"
     gap             77922..78020
                     /estimated_length=99
     gene            complement(<79143..>81068)
                     /locus_tag="LDBPK_170210"
                     /db_xref="GeneID:13393339"
     mRNA            complement(<79143..>81068)
                     /locus_tag="LDBPK_170210"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859827.1"
                     /db_xref="GeneID:13393339"
     CDS             complement(79143..81068)
                     /locus_tag="LDBPK_170210"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859875.1"
                     /db_xref="GeneID:13393339"
                     /db_xref="UniProtKB/TrEMBL:E9BD42"
                     /translation="MRYPILAPAPGDSDTQTSLSYGIGASAAAKQSTDLPALLAAAQQ
                     TRPIAAKSGQSTFPSVPYYGILSRCEVRMDVSVERSARAPGWPISDAAGASAGMLLRN
                     PTTTMARMAHIQRRLYDVAERFGSVYYLSNGATLSESVTAPLLPNQGSASSAASFHTQ
                     LTYGAYVQALHDAFRRFSALRQACVTMEKAASGARAATIGDDMVTHHTFYVRLLGHPS
                     WKDLSALLCVEKGGLLVCLISSSRITQKHLTAACADAGVSLDWLGGAALVAEPLQLIP
                     GDVNPVWVVWDALVNLPLLPPSSIDREGNKEGLTSGADDAADTLDSVSAGAREVLNRV
                     TQTGSTLSGFHISLISSMPFQGSTRFHQVGRIADEAPVFAQEDHPPSSSLSATAVARQ
                     PTREAVVACRYIWRLIPSPPSCFTVAPKSSSASALSLSCCAVLPFFMSKLLQCLVEEC
                     GLIAFAVHCGGPAELTTHLCAPSVSTGSTASGAVGVRLVHSNAPSLLTLQQGPSSSSC
                     LAFSRLSGAFWVDAETRESLSLGGLTAAFGEPDKDVMGDEEEDTEMEFEVVSIRYERR
                     GELKTMEKEPNKVSVCATAAVESSGSCPVKRARFDAADIHEEDHDDAFVRPAQWGPSF
                     AFTVSVKRLIAVDDIDA"
     gap             81764..81862
                     /estimated_length=99
     gene            complement(<82084..>83664)
                     /locus_tag="LDBPK_170220"
                     /db_xref="GeneID:13393335"
     mRNA            complement(<82084..>83664)
                     /locus_tag="LDBPK_170220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859828.1"
                     /db_xref="GeneID:13393335"
     CDS             complement(82084..83664)
                     /locus_tag="LDBPK_170220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859876.1"
                     /db_xref="GeneID:13393335"
                     /db_xref="UniProtKB/TrEMBL:E9BD43"
                     /translation="MSGSAKNGSDGSRRASSGMMGSGSSNGGSSRGSDDDSDRTGVRR
                     RGSSRHVLLPDGGFHGQTTSTHTNRRSREPSLTVTGRSSSPPDTPLKKGSAAAASGVK
                     SFSRPAAARLVATENTPSLSAESTIPAAAAAHDVRDTVEYRAAWDLELWKAVQADRFR
                     KELEKQRNVAFADLDRLVKRREREARVALQQRTTAVALREEAVQAEETRLAERQQRVS
                     DMEKDVRRMRQQLLDAQQRVEDEVRAQVRLANDTIAHRARLLEERVKAAEAQARRADE
                     RQRLAQQEYLSLYEAFSRYRTQQLTSPGSASGITTANAMGGTASSSFSVERLRAQWET
                     EHQLQLDRQAQRHASDMAAVQQRCRELEEQNRRLTAALARRREQLRRHADSASPPPLP
                     TSVSQRPPSHAGREDREGPSGSGTAASSSSTPSSNVEAATTALLQPARNKEILRDFVQ
                     RTSRELHRLETERSLLVEGSSGALRETDTVIVRMDARIRELREHLSFLASRREAGWRD
                     RVDGTERWERARLETGPL"
     gene            complement(<85512..>86465)
                     /locus_tag="LDBPK_170230"
                     /db_xref="GeneID:13393338"
     mRNA            complement(<85512..>86465)
                     /locus_tag="LDBPK_170230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859829.1"
                     /db_xref="GeneID:13393338"
     CDS             complement(85512..86465)
                     /locus_tag="LDBPK_170230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859877.1"
                     /db_xref="GeneID:13393338"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BD44"
                     /translation="MSDAESHLSLQSLTPVDLKQLSRQQKIILLQDYRSSGARNANKM
                     LFLATDLLAGGSSGLSSSELYDVYEQVLIASLECGRIENATMYLNLLESRFGKKSIRV
                     SHLRGLCLEAQGKIPEAKKLYEQVLKDMPTNDFCVQRLSAIYKSNGHYKEAIRVLEED
                     LVYTDEDDKQHTYVEVHRGDALPTYRELSNLHYLLGNNDKAIFYAEECLLFDNESYFA
                     HVRLGELYYMKRDLPRCVIEYSQSLLFNSQQNNSRAAYGLWQVTNEMLRQHQSGIKKI
                     EDEAVLTQTQDLRTYAAETLRRMYAGTAMLSALDAYLQREA"
     gap             86859..86948
                     /estimated_length=90
     gene            complement(<88146..>90749)
                     /locus_tag="LDBPK_170240"
                     /db_xref="GeneID:13393337"
     mRNA            complement(<88146..>90749)
                     /locus_tag="LDBPK_170240"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859830.1"
                     /db_xref="GeneID:13393337"
     CDS             complement(88146..90749)
                     /locus_tag="LDBPK_170240"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859878.1"
                     /db_xref="GeneID:13393337"
                     /db_xref="UniProtKB/TrEMBL:E9BD45"
                     /translation="MHAPLSPGSVLGAPFFVVAAMLLLHGVPVRGFDGDAVTAPPSAS
                     TAFTEHPFTLPTAASLLDVLASDFCTRTGEGEESSCTPSVSRLPTHPVLILFTESNAG
                     HSSTLAALRAKVRQIATDVPSSVLRVHEYVIPMSATERRLIELLLIGASHVPTLALFH
                     GRVAKVQVAPGSIVSASPFQTPVLYSTTPLASASYLELRSWALSELPARYVDPVTFHL
                     IPSLQFVFSPAEVHETLQLVRDALEASESRSVLPAFVSMAYMRLTRHGSEEVLAALSS
                     IATQAGNAVLTLVTESAEVAAAWGLRAEHTFTMAPWSSTVAAYLNSSASDGFAASVSD
                     LSPPQSIGTVTELAEATAGSAAWRAACAASVRAEIAQLQNWRQAMNAFNTTSPLRRID
                     SAAHLLHELKALQNALKIVFVLRESDEMWFHHHLEVAAALARRLQSTTVFYNTTTLAK
                     GSKARSRVERSWTPIMRCDVFWLDAEQLPAVADGLHVSQVPSVLILVPLQSRFGEGGD
                     GDRADAAAAAGDDDQAAAGASEEAGLRRRDPFIGIHTINRYDLLKAAYMDDAQMTHEP
                     VSGKEALPLFPSDSDALLRFLASGSFLGAMQYTMSSTQLSTLRAKVTELPDAVQAATA
                     SGGTSNRHYLQLDRRYYPLRGAEEPMEGPVYVRQILNGSSPLPVLGSDDSDTELGRQP
                     VGGRSGTHPRGTTSASPDEADERLRQRRAREEAAALKRKAAWEANLAKRRREKADRMR
                     RKAAEDAAERERQQEAFQQEVNAALKAEQEGAGGGAGGTWASQPEGLLVRRPTLEDAS
                     EGLVEEGRRKGRPQRPFGEEVDSQDAAQILRRRRRHREYREWLADRQLMVNRCVTVTE
                     KGKLSLMTRWE"
     gene            complement(<92479..>93747)
                     /locus_tag="LDBPK_170250"
                     /db_xref="GeneID:13393336"
     mRNA            complement(<92479..>93747)
                     /locus_tag="LDBPK_170250"
                     /product="peptidase t, putative"
                     /transcript_id="XM_003859831.1"
                     /db_xref="GeneID:13393336"
     CDS             complement(92479..93747)
                     /locus_tag="LDBPK_170250"
                     /codon_start=1
                     /product="peptidase t, putative"
                     /protein_id="XP_003859879.1"
                     /db_xref="GeneID:13393336"
                     /db_xref="GOA:E9BD46"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010161"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:E9BD46"
                     /translation="MSLAPIEHRLEQRFRRYSAITTQSDPRNLGKCIPSTPGQQVLAE
                     LLAKELQAMELQNVICDKYATVTAVKPGNVPGAPRIGFICHLDTFDCGLCPHVKAQKI
                     RYTGGDVCLNKEKNIWMRLREHAVLNKYVGQDILFSDGTSVLGADDKAAIASVMEMVA
                     NLDSSKEKHGDIVICFVPDEEIGLVGAKHLDVKGRFNVDFAYTLDCCELGEMVYECFN
                     AASATIKFTGVSAHPMSAKGVMVNPLLMAVDFISQFNREETPECTELREGYWWFAKMD
                     ANSTQARLEAMVREHDLAKYTARKTYMLDVAKKVQAKYPTGKVEIEIEDVYANIANSL
                     KDDFTAIDLLEAMRKASVKPNIIPMRGGTDGAALSVKGLLTPNFFTGAHNFHSCFEFL
                     PIPSFVKAYEVCHNIVLLGADKRKRTPSLL"
     gene            complement(<95303..>96511)
                     /locus_tag="LDBPK_170260"
                     /db_xref="GeneID:13393340"
     mRNA            complement(<95303..>96511)
                     /locus_tag="LDBPK_170260"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859832.1"
                     /db_xref="GeneID:13393340"
     CDS             complement(95303..96511)
                     /locus_tag="LDBPK_170260"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859880.1"
                     /db_xref="GeneID:13393340"
                     /db_xref="UniProtKB/TrEMBL:E9BD47"
                     /translation="MQPYASLLAELRQLMPASKAAAAAQAASSAATSASSPAAAAAAP
                     GGAAPKKVVFPKFMELADAYEAGMRCAGELALWSTLLRVATESAAGYDSTLPRTAAEE
                     ALALAGAAPAPPVTSASALAAEVGALLDSDATRQRLPPGVHVRYRADLPLHTVDPTVA
                     RVYPESLCAMRGYCPVQLLAGRPTAGLLIPGQVPSEPSSSSPSKTSLGCMEVSGSARR
                     VAMARPLYFIFADATAMRAFAADPWRYVEGCLHLFHAADPCLTLVMGRADELPRELYL
                     EGARVVERLTSDLTSAQHEQENRQSCGTQTGQIDSYIDHNYFWNEWDLRRHALKLANL
                     MQMRTHSSQTAALHFRREAATQADPRKESEAQTLHNAATQPPHVAQYLKGLRGTYTSA
                     IEQVRKVIEH"
     gene            complement(<98792..>102097)
                     /locus_tag="LDBPK_170270"
                     /db_xref="GeneID:13393341"
     mRNA            complement(<98792..>102097)
                     /locus_tag="LDBPK_170270"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859833.1"
                     /db_xref="GeneID:13393341"
     CDS             complement(98792..102097)
                     /locus_tag="LDBPK_170270"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859881.1"
                     /db_xref="GeneID:13393341"
                     /db_xref="GOA:E9BD48"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BD48"
                     /translation="MAALLPSAAPLRMPCQVADRIHVYGRVRPPASPDAPLWITVDSR
                     NTTLHCGSAEEVLPKTETVSKRRPPTTVHVTQSSSFTLDGVVGDARGVAAQTFFDSTA
                     RSCVEDSLLKGTNATVLCCGEKGTGKTTTMFGDVAVPGLCQRILASLFAVVEAHSEPS
                     TSTFLSGVAMTAPSTYDLASLCSSGAEEEEARRGCRTRFLVKLSCLALRGEHVVDLLA
                     EAAHDMPSNGASASVPRRTAPPPLPASSSLSLSARPNITMDPRGRVLVRNVSKVTCCS
                     AADAIALIHQSRRAPSSAASPWSPGHVVVIVDVTCEEGEEASASHHIIRTAKLYLVDL
                     AAAEQPRRRSQRPQPPPSSTSPSLPAAESVVTSRGARSEDSAIRHSLAILQQVITGLS
                     SSSTVVDDAPPTRPPYKQSKLSMLLKGHLGGGCRTLVIAHVRSEEAHRQETLATLQLA
                     RRLLCVPEHPTSRVVEDPVVRVRQLQRQVAALQAELRLQMELNQHAASSTTALAAAAA
                     PVDAPTAKNAKDAKKRFGDASATDAQARSSKSFTGRVSDRCTSPSQTPAGAASDCHPL
                     LRRAASSSATPVSAALTTGVMNFVAGRIAVLPVSTVLEMNTCFELLRQCVTERDIQLR
                     AAITDLRKAEAATAAAFTALAASSARSSVSERYSGRSICSGGAGRRRMRSIRGTASLA
                     RDTPTAEGKCHSSMDSVLPTSITPLPRCNSLRTTLLHEPSPTVPATAGVKAGKGYGSA
                     PSAAGLSRGETKDTAPLSPLPGLSVFPSTGPNAAAATANAPLAAAAGAARSANEGIIS
                     PENEVVFAPNYNEAASFKPFAPSSSLQCARVVSSAPVSLIRPLSASKSTASASRKASA
                     ARQPSTLWGRAPTDSLGPSSSIEVNSTAQVRRSHSAADSALQASPGESSAFHIYTTQT
                     AEGVQQVQQVRHEEEALTSLRLRLVAEVTGDSCHSDTALADECRYHEGQLTRRREALL
                     RNFESWYRARVPAEDDTAAAANSLQKPAENSKQLTLGTMRRRLRRPATAGSAGSGGGG
                     GDVGELSAIAINGVGGNGAYKVWGGVRPVLRSAASFSSATQKESADEAAAIAMSSDIF
                     SAAGASSAAYYSM"
     gap             103381..103479
                     /estimated_length=99
     gene            complement(<105928..>107772)
                     /locus_tag="LDBPK_170280"
                     /db_xref="GeneID:13393299"
     mRNA            complement(<105928..>107772)
                     /locus_tag="LDBPK_170280"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859834.1"
                     /db_xref="GeneID:13393299"
     CDS             complement(105928..107772)
                     /locus_tag="LDBPK_170280"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859882.1"
                     /db_xref="GeneID:13393299"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:E9BD49"
                     /translation="MPEFKRGKTWRLHRSSPESVKAALISNAADAANPFAPMSSVYSS
                     NAASSREDAPLSLLPQLATSSAADASPSAAMRSPRGAGYPSRRLRSSSIVSVSAAPHD
                     MQLARQPLDPQHLKMPSTGFADMHATRESLLSDISATLSTESTPTHSLQDCHSPNCGG
                     TMSAFLRKAEALEAKYQQVSLSIEEDLFVYDDIVISKVEARAKQWRLAGRKPQPANIE
                     PSSDSGTSRTLKKFFSFNDFDVCVDEVDFMPLSPATVEAAATLARDTVLETPKQGLKH
                     ITVTNTTAKAPNTVAHFLAQSRSKEPRANRPLRSFQVNALLGHATRVKCIALSPAETD
                     FASCSNEDASITLNNFGVGSEVGIFTGHHDTIISATFSPDGKYLATASKDETMILWDV
                     TTTKILLTFAHPKVVICCCFGPDSKHLVSGCQDRVCRLWDTKRGREWMNYTEHEGIII
                     AIAFSPDGNYVCSASADRSLRVWSATTAKTRFHLLGHVGIILSCSYTSDGRHIISNDE
                     SLLRVWSAEDGSCKLSLSPVEVAGTLQPSHRAPKLGWTLSSAAPGSFTRFVLVACNNR
                     FVYVIDIDTGREVASTFCKAPVYCLTAGSHEKMAFGDSFGNIYILHLM"
     gap             108963..109061
                     /estimated_length=99
     gene            complement(<110362..>113880)
                     /locus_tag="LDBPK_170290"
                     /db_xref="GeneID:13393303"
     mRNA            complement(<110362..>113880)
                     /locus_tag="LDBPK_170290"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859835.1"
                     /db_xref="GeneID:13393303"
     CDS             complement(110362..113880)
                     /locus_tag="LDBPK_170290"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859883.1"
                     /db_xref="GeneID:13393303"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:E9BD50"
                     /translation="MRHTTSSGGFYRFAATASSPPPQLPARWLRQPETSSTGWPLQPH
                     DQRQQQTATTRSPTQACDSTSTAAVASRHARPAPASPSPRSDGDIAAAATGTAASGRS
                     CASPLPRRSHTAAEERLSAPSAALPRSFYFQPVRTTESVCVATTASSSEWVLLNVGGR
                     LITTTVGTLMADPDSVLASLCACLVPPPGRGDIAAGKKSGARRSAAMTTQEASGRCGA
                     VADATPPGEEAPEGGIRCDPLGRDNRTHTANLAEGRNADGLRNSAAESGGGDAQTLPP
                     SAASDAEVSPAAEDGPQHAPQHDNDSAQLDGDRSSLFSEIYTCHRPLHHSIASTASTS
                     AAPPPALQRVSHQHSLLSVMRESRPDYVAAHTPPAVSLPVGASVGEGGDGEAVSPQQT
                     ASAIPLDTDGANAILLDLDADYFLPILNYLRHGAVMIPHYLSVAGVLAMAEYLNVMGL
                     VRLLRGPPKPRRVMLFSWGSGGNGELGTHATRDEPTPTMAQVTPFGVRVCEIALGANY
                     SCALSDTGSIYTFGNGEWGQLGLGGSGCAVRGGSSPPGGGVGGGNGTGQDGVDVPVEL
                     LIPRRIPLFEQLPAVHVAAGYAFAMAIVEGHHVYFWGNNNHGQSGRGRAHFDLPTKKV
                     DAPVLVDTLEGKRIIQLSCGSFFALALSDDGFLYSWGLVDCVGLGTPEEVERRYRDVL
                     GESLSNERRAVVLTPQLVTVKGRRRVAPGGAAVTAPERIVRIRAGQWHSGAINEHGEL
                     FTWGVGYQGRLGHGSKAPAYVPTLVRGALEGHRVVDVACGSFHTVALTAAGAVFCWGD
                     NASGQCGTTAGSPDAFTAPYRVVGLEYVAGGVARSIACGRQHTVVVMEGPQPWCPQPC
                     CRADAAESGCHSHAQVYCFGEATRTANATGSTASAVAAAAVSGATRGTVSSSHIGVSV
                     AAMNAGALPASPGHGPYMTGGAAGGYQPALAPGGAAAAFPTRLPLPCTGGHHHPHYQL
                     VPGLQNVDVRGVVSGLHHTFAYVEELCADALRVADGFGETLPTATRGWEHRPSYPPYP
                     PPLLPPQAASAAESHVSHSAFTWGSRGCSSGGTNISWARSFMPPTPASQRPPSAYRDP
                     WTDAPVESSTDSVGGRIMPLTRTRTMHPTSWSSDRVTTPFTGAASSQQHHRLASPLTG
                     REEGAYLEMSRGNGDNGRLAGSADAV"
     gene            complement(<117974..>119053)
                     /locus_tag="LDBPK_170300"
                     /db_xref="GeneID:13393302"
     mRNA            complement(<117974..>119053)
                     /locus_tag="LDBPK_170300"
                     /product="cystathionine beta-synthase"
                     /transcript_id="XM_003859836.1"
                     /db_xref="GeneID:13393302"
     CDS             complement(117974..119053)
                     /locus_tag="LDBPK_170300"
                     /codon_start=1
                     /product="cystathionine beta-synthase"
                     /protein_id="XP_003859884.1"
                     /db_xref="GeneID:13393302"
                     /db_xref="GOA:E9BD51"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:E9BD51"
                     /translation="MTSATPRGQILANALEAVGNTPCIRLNRVPQKHGIQCEVVAKCE
                     FFNPGGSVKDRIGKQMILDAEKNGTLKPGSVIVEATSGNTGIGLSMAAAIRGYHMVIT
                     MPKKMSHEKETTLQSLGAEVIRTETSLPHDHPDSLIGVARRLRDEKGYVLLDQYTNLS
                     NPGAHYEFTGQEIYDQCGGKVDMVVICAGTGGTITGVAKKLKELIPEVIVVGVDPVGS
                     IIADPEHPGEPVMYHVEGIGYDFVPDVCERKYVDRWVKTRDQESFDLALELHREEGLL
                     VGGSSGSAMAGVVEAAKDLRSDQRCVVLMADGIRNYMGKFADVNWMIEHGFRQGEVTR
                     PTYDTLKKELEEVKAKLAKYESGAQ"
     gene            complement(<121144..>123501)
                     /locus_tag="LDBPK_170310"
                     /db_xref="GeneID:13393301"
     mRNA            complement(<121144..>123501)
                     /locus_tag="LDBPK_170310"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859837.1"
                     /db_xref="GeneID:13393301"
     CDS             complement(121144..123501)
                     /locus_tag="LDBPK_170310"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859885.1"
                     /db_xref="GeneID:13393301"
                     /db_xref="UniProtKB/TrEMBL:E9BD52"
                     /translation="MAAIQSVLVEHNVKDARFILELPSTPAAASTVVTAVHADAPGTW
                     GAGNASSVTAPVDSSAPSTEGGVTTATLLMGMQTTPAAVPTPPPEHQRPPPRARSPSE
                     RQRSPASYHSESLQGHALPAPSALHSGSPPLNDSISSLGATARPAPVAAVGDASGTQM
                     TPSAAAEEGPVNTILAQPPAQPHPPPPRSAVDAITSDGSADVLTGEAAAEICRVSNQL
                     AHDIAVAEAQMSRKEILQKFVGRSVILEDRRQREAQQLAQASTMPWNGIPHPAVPFKA
                     DAASAHTKASSQPRRGIPTAATKPPAQKLSADPTIPSGSVASAFSPAVLSPPPPEPQQ
                     PQRRSIVRLTPPSRTPVHSGDNGARGSVLSDSSSLPSLVSAKKSAVPGKTPVFSILNK
                     DGSRLLDQGGAAMTLRTSLSGALAKAGGACVAAAGAATNGGDATEASRSSSNSNSNNT
                     SISHIRQSRPSSVSLLADDRAPPSPVHEPLLGVAAEEEANRQRSILMQTQPRSPTPEP
                     QPVESAINRDDGEVLRKMLSEQSKNNTRRALQLQNQSRLSHTTQMAATPVIGKNQPSA
                     SGTFSTASTPRSPSRPSTSAAAASSQPSLRAMLQEQRQLQDASRRSMEEHNRLMQAAR
                     AARTPASASSNAFETSKIPAVRLATPPAHATPAATGAAAAAPVTVQEDDAAHRKPGIA
                     TLARASSPGRNTNGTFTPSTSGIQVVKFTLPHEEEARQAAVQQLCRSSSGTQHLDTKD
                     RYRALLAEQQNEFTAQEAKAQDYKVLLNRAVEFNRFQQQQRTKPS"
     gene            complement(<124334..>125155)
                     /locus_tag="LDBPK_170320"
                     /db_xref="GeneID:13393300"
     mRNA            complement(<124334..>125155)
                     /locus_tag="LDBPK_170320"
                     /product="NADH-ubiquinone oxidoreductase, mitochondrial,
                     putative"
                     /transcript_id="XM_003859838.1"
                     /db_xref="GeneID:13393300"
     CDS             complement(124334..125155)
                     /locus_tag="LDBPK_170320"
                     /codon_start=1
                     /product="NADH-ubiquinone oxidoreductase, mitochondrial,
                     putative"
                     /protein_id="XP_003859886.1"
                     /db_xref="GeneID:13393300"
                     /db_xref="GOA:E9BD53"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:E9BD53"
                     /translation="MRWVAAASASAAAVAPTTSYPSTNAALLANTRAIHGEVRHQNTD
                     YDNTRIPWDFTTASYEKIHNEILPKFPRGRRISATIPLLHLAQQQQGGYIPVTAMYKI
                     AKICEVPPMHVFETVTFYSMFNRHPVGKYHIQFCRTTPCMLCGADELMERTMHYLNVR
                     MHGTTSDGLITIGEMECLGACVNAPMLVVSDYSNPPNFSYDYMEDLTWESIKTLVESL
                     RGGKPFKIGSQRPDRRYAEPAGGRTSLLFKEPPGPYCRDFDAEPDEKADAAPPKK"
     gene            complement(<128084..>128617)
                     /locus_tag="LDBPK_170330"
                     /db_xref="GeneID:13393304"
     mRNA            complement(<128084..>128617)
                     /locus_tag="LDBPK_170330"
                     /product="histone H2A, putative"
                     /transcript_id="XM_003859839.1"
                     /db_xref="GeneID:13393304"
     CDS             complement(128084..128617)
                     /locus_tag="LDBPK_170330"
                     /codon_start=1
                     /product="histone H2A, putative"
                     /protein_id="XP_003859887.1"
                     /db_xref="GeneID:13393304"
                     /db_xref="GOA:E9BD54"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BD54"
                     /translation="MSYTGEESTGMPPQPPMMGPGSATADQTSIVSGGKLGGKGKGKG
                     KGKGKRGGKTGGKAGRRDRMSRAARAELNFPVGRIHSRLKDGLYRKQRCGASAAIYCA
                     ALLEYLTTEVIELSGAAAKAQKTERIKPRHLLLAIRGDEELNQVVKATISRGGVVPNV
                     HKALEKKSKKKSAKRAA"
     gene            complement(<129661..>131838)
                     /locus_tag="LDBPK_170340"
                     /db_xref="GeneID:13393305"
     mRNA            complement(<129661..>131838)
                     /locus_tag="LDBPK_170340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859840.1"
                     /db_xref="GeneID:13393305"
     CDS             complement(129661..131838)
                     /locus_tag="LDBPK_170340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859888.1"
                     /db_xref="GeneID:13393305"
                     /db_xref="GOA:E9BD55"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:E9BD55"
                     /translation="MGMSVTMIDAIPLLKSTHANCVCPVCLDVFKKPVCFPCGHILCR
                     ACASRCIAARPRCPLCNQAVPNLRHCSPLPQLSLLCVLTREVGLRASGRQLRSSVQNA
                     ATPLSHSDHDSSMKRRRGATGYDAVEGAQGENQAPRPRRSSLSPPPEQHPFLSLREPR
                     ASHRVASAVAATEGSTANHAQHSSLPGLLRAAAGETQRLQSESPSPPPLMAGVGDDVL
                     SDEAPHRSIIAQATTSLPSAVARRVGDSGALGRDQDRPPTTTPSPALSPSPAPFSTPL
                     QLMRNHITDHADQLDSTPRLSPPPFIAFAVAEAASVTAAASTAHRSGEASASVLAAEH
                     ALNSKKASAWSLWRRGRGVIHCTLTPPAARLLARQAGVADGAGREKTEAVSKTASSWS
                     VASADTAASFWHRFGCCALCGLDVVQRTAVRQRLQRLLRSPTAHCDPAELAMQTEESL
                     SLLLGPLWGVCCEVQEHSTNITQSPAPTCEGEYTTTELDAVQGSYCCPCRGEVTAHHF
                     TGVAHHNCLAWAGLLDVFTNTSLEDLPAAAAAGVYFIPSTTALLHMTVPLQDPLEVLT
                     ARTSGRVARWQLLAATLCHMHQRDADEESELWQRFKTSDGSGAEGPLMTVRCALCEDG
                     APLLVPNSPSFPFGAGLRTCEGTERGESSCGQQYHYPCALLAGASACIIFGLEDEHNV
                     LDASANTPVRDRSAGGKRGGLELPVEVWCGPCHERHEVRRRRV"
     gene            complement(<132867..>133478)
                     /locus_tag="LDBPK_170350"
                     /db_xref="GeneID:13393306"
     mRNA            complement(<132867..>133478)
                     /locus_tag="LDBPK_170350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859841.1"
                     /db_xref="GeneID:13393306"
     CDS             complement(132867..133478)
                     /locus_tag="LDBPK_170350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859889.1"
                     /db_xref="GeneID:13393306"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:E9BD56"
                     /translation="MRALGLAVEASDGTGDKGECNSALLTSSLSCDPSRSMEVEVETR
                     QGYVYTGKLVHIDDHYNVMLNEALVRRARSFDVERAILREKSQQEARLIASSLQGMVT
                     EDADVMQSTSELMPRPRYIGATYIRSNSIFLMRFVDAAGGTGTTAVSAASSNSALGQL
                     KSDFSMMAASIKAHLQREKMRNRAARRKRLEAKKSAGGGGGGR"
     gene            complement(<134742..>138878)
                     /locus_tag="LDBPK_170360"
                     /db_xref="GeneID:13393307"
     mRNA            complement(<134742..>138878)
                     /locus_tag="LDBPK_170360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859842.1"
                     /db_xref="GeneID:13393307"
     CDS             complement(134742..138878)
                     /locus_tag="LDBPK_170360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859890.1"
                     /db_xref="GeneID:13393307"
                     /db_xref="UniProtKB/TrEMBL:E9BD57"
                     /translation="MCNAATPRAALRAEPAAIGSKPRPNATHTSSSLRSTSPAESPVA
                     APPHRTVPCLVLFSPQGPRPLEGLKTVTLERPGNVAAAAPRGGYLRARGASLNRLSAG
                     GPPLSASAAAASSTAARRRNTKHAAASAAARASHQSSSGIRCVYDRDTRSQLLHIIPG
                     TEVDFSSCMRLPALAATPAPASGTAAAPLLFAATAVHTIVVVQFCVAAPTLSTAAQHQ
                     AGASRPQLPGSPIPPPGSFYIELVLRTGTSSDSARGRISTNGGGSSGNSGGYRLRFTN
                     TGHAVQRHTHHTKIPLQCVRTAQWVQLFVDLEALLQSCKAAGAVVAGGTHCRLKQLRI
                     GSGGSAASTGGVYVRRIIAGHGLPLPYPAMDHLVTADGVPGTVPLMATPIGGTQEIVR
                     DADGEGHSDRRGSGTLQQRSSGSGSCWVPPEALRLPAEAGESLCVFVRTGDEHILSEA
                     PAPLAPAEEPSREGEAHTRDSDNSIEATQVRWKANNCAGDVGRSAVEWAGDATQDTAR
                     RRAAQAATTAASKPLTLPSSATLPPHQLQRRQPNPDQQKNPALLNSYRHQPESEAAAA
                     RVCKRQPEPSKVLHHTALELLRMRDHQQQSQPQPAHQFTGSGAAAHAPTSAAPPSASF
                     PSSASPRSSPVDGASLSASDDAEMFVVREVSAAEQLAPATPPQYPANQLMTGKPPLRR
                     APSQPPVANKATHHALNAGHTGEGVAQQVGEDVAIEDAGQEGFSAPAAVGAAGFLFST
                     TSSATTTTATTSETSVLSVTSYSSAVELMDAMSERVRRIHMVLAGVEEEAAAAAAAAA
                     SIFAQPLGRRPPSRHVTPPPTAQGARPAVSTVTPTVLPLLVPPPPLTGAASTHSSPSP
                     PSAPGPTAPAEIIEAVLRDTPRDAVVNTAAVPSLPPTPPAAAMATQACDSVARVAVAE
                     CAATASAAANDANAILELWSSAERPLCLSASLQRPATAAVKRAPLAERLRAHQAALSS
                     SSSAASFSLVDGSDNDGVGDAPSAEIPPPTSAATSWTFRSTSLTPQTPSMLRVPTDSG
                     AVGEALPRAGGAPSSYMAGAEKSEAAALLQQAPRLLSESQTPAPEVVAAVVPQLKSSS
                     GQVTKAVVWRRPVTEPGHSPSAGDATQRALQDEVRLTDTPLPGRVRSPGAESGAAGRL
                     ATWSARQNAGPTSSGMHTPLSAAAASKLGVASQQESLQGFIEGAQLCVGVQAPPPPPS
                     GRSFSTVSSFQMWLPSSSMPTLSASRGRYPSTITPFSGGGDRHCDPLSDSSSGAGGGP
                     RPPRLGIAAAYPSAHPSMPPPSAVHMPQAATAATLPTYHAGAAVGPSPLAQQQTLGFP
                     AAASTRDPVQHTPVSHHEALANDVPLSAERGNGEGRYMYDCVLQCYLDLETNAYVDRT
                     "
     gene            complement(<140492..>141484)
                     /locus_tag="LDBPK_170370"
                     /db_xref="GeneID:13393310"
     mRNA            complement(<140492..>141484)
                     /locus_tag="LDBPK_170370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859843.1"
                     /db_xref="GeneID:13393310"
     CDS             complement(140492..141484)
                     /locus_tag="LDBPK_170370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859891.1"
                     /db_xref="GeneID:13393310"
                     /db_xref="UniProtKB/TrEMBL:E9BD58"
                     /translation="MMGGRRGPPLDARPQALFAYAQTVTDTPMPRWQPPQTAAMGAGD
                     KGSCHATPLTKAGASRFNVVFRRSSGSRQQRAKREGALSVAHDVSYLYDKDNRECVLR
                     CKAVGQAPNKIFMCMQRAHRGADWVVGTELNLCGFDILVEEVMELHCIPYEEAVDAAD
                     AADNSSEAGAGGDLITCCGTSAHTASAASYAQTLSTAASVDPGRGHTTHAQPRFSFLP
                     RQTSQHFVTTTPSRATRDNGPSSPTPLEDEEASSICAPQKWPTLKMDSVPVGTALTAH
                     HPTDPPPPAPRDERGVDGSVCPNSCPPHERRQRRRRRSVASLARELERCYPEYF"
     gene            complement(<141992..>147199)
                     /locus_tag="LDBPK_170380"
                     /db_xref="GeneID:13393309"
     mRNA            complement(<141992..>147199)
                     /locus_tag="LDBPK_170380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859844.1"
                     /db_xref="GeneID:13393309"
     CDS             complement(141992..147199)
                     /locus_tag="LDBPK_170380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859892.1"
                     /db_xref="GeneID:13393309"
                     /db_xref="UniProtKB/TrEMBL:E9BD59"
                     /translation="MPLASKINANRELKRIAAENRHLYARLLSNIEAQSSSRRVAAPC
                     SGLYVSRTPPNRKYLFTGKGEEHNPLYQTSVCIPLHHRCRLTVAEASAASREEAELGA
                     IIDALAVAPSSTEWARIMRVLDSDLFVSFAALLTNLNAYALVRVVRAQPARAGPATLR
                     APFALETRPQFRATVAAELASIDDAEVVSRNQSDKIADGNVPLTRGSAVGPQAQTLES
                     RQHARHYDVGVTGDWAPSARDAIKLALFKSLDVLQDHAVDEWREAGREGALLLNELAR
                     GGCCTSEMDVCVLNSALRCGSVSQNPSCTAVTEDVALRFRCVAGSDSISITTTSVERA
                     PKESHIRPSCAPLGSVKESGLAAASSAPSGEAAGLVVSDEICLPFPISAVTIRRPFVD
                     EDACRSRPTLKELRWPRQCMTGAALLLLAAAKASLYRSATPTCSALMSDSNAALEGVS
                     AVSVCCKSPVVSAFEWPRAPFFSTFCNSTALQRGLFSHGEPWGVESNTAQDTTGSPAQ
                     NQWHCPDVVAMIASMRAALHLPLRSYPKITFEQTALHDPARRMQELAQGLYGDVDVLT
                     RVHVWWETPRDCFVACAVSDPALHHRNAIRSGSEASSRAWLSCADTGYPRGPLLLLVA
                     AVCSLYDQIVSRVATAAAECYPMVPVKNSFARGGLDFLLFSWFEASPQVRCFTIGSTP
                     PSYAQQPRSEATSLLNGSTHHELGPSMTRAMLFYDVLGQRVLFAETHATNAEDAVARM
                     NFLSVEQNIPSRDLYAPPSTVAQRPFRSVPRQRRWQRSRQLLERSLQRSIDAADGTGA
                     DHLARSSQCAGHQTHNRMLVAAAVRACIGACASEAGALWTVLQVVAKVTATRAGAASE
                     SGGINGEGGVRARQLLSARLLEDSSPTAEPFAGQAGSEEDRGWWTGGHDVAWNCRPLG
                     KEAAPPRAGVMEAQLCMGTSLGAAATTDGKPAAAASVEVLILRCRVDAMRSASEVAAA
                     EWLCEKRVTESLSLCRLGTVTLTTAQAVSGIFPALALLCRRALEYIYSEARYAPLVSI
                     LPPMSDVLAWCAAAAPMFAGTGGGYLPYEARFYAAPKLLGELLQGAAGKYRCSYNIPS
                     PRGRVKSAASGADRGEGCAEVERERGEAAQPSTIFYTSKPIHVDTAANGDATRQQHGS
                     RLAKPPAVACTLYLESLLGNGASPSAAAVSPTCPSPVAIPFILGHGVGRTKREAWRSA
                     AWQAVRLQFPAVLAQLEAYRDVSELLQRPAQLNQLVRSSGLDRNSVWGGVAPVVYKLN
                     FDCSVLFPSSVRNAATEVAASASVQAVRQSQCGVTAVRTDGSKLCVVPGCRATAASSG
                     EAYTAAVAVVLRAVRGAAQEAAAHMTSATMGTTASRTGWAAMPPSSPGSVSGAARSPD
                     SCPYAAWRDTTHYGKSIWHAYAGALSAYLDSDVVVHPVAAEDISVDELGSLSRGAGSG
                     RRLSRRVVLSKVQVRMRDGRIGAATAAGNVSLGFTDQQSRASRRITSFGAFSVAAGCG
                     AIDANVGDGADGILFECTAASLFTRRWLPLDTAANGTRVGAVAAAAPLPRENPSRLLQ
                     EITRWLSDITQECGLPLAVREELRGLLCARACDLARIQDSYRSTPAERVEALLMRWVG
                     RRAQVRIRRINSSVVAYPSLANQMVWVAEALVEIQAERRRSGSPSSSHAGLPLDGNVL
                     QLLDQDGELKSCAGTREHLDRPWVAARAVGVTSNEAAWQLYRHVCDALRDVVATEPSP
                     RSVEKRWRQ"
     gene            complement(<148033..>148443)
                     /locus_tag="LDBPK_170390"
                     /db_xref="GeneID:13393308"
     mRNA            complement(<148033..>148443)
                     /locus_tag="LDBPK_170390"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859845.1"
                     /db_xref="GeneID:13393308"
     CDS             complement(148033..148443)
                     /locus_tag="LDBPK_170390"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859893.1"
                     /db_xref="GeneID:13393308"
                     /db_xref="UniProtKB/TrEMBL:E9BD60"
                     /translation="MPRTIKCILCAVALVAAFAAALAITMTVRERVPNGLYCGNYASG
                     LVVGNLTVTYATHLFDLALRGLGMNLKCKNEVFTYDPKSHMLTAVSAKDPSDCIGSVI
                     AASGLNLSVIYKPTADLITLDFGIAKIDCKKCSA"
     gap             149988..150086
                     /estimated_length=99
     gene            complement(<150625..>152412)
                     /locus_tag="LDBPK_170400"
                     /db_xref="GeneID:13393311"
     mRNA            complement(<150625..>152412)
                     /locus_tag="LDBPK_170400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859846.1"
                     /db_xref="GeneID:13393311"
     CDS             complement(150625..152412)
                     /locus_tag="LDBPK_170400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859894.1"
                     /db_xref="GeneID:13393311"
                     /db_xref="GOA:E9BD61"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:E9BD61"
                     /translation="MSEPRQPEAAPAMPVASEHTTTCGVATSLLEKPALVAIPAPEPT
                     ARPPITTEKGVCPVKAEYLRPAPARVSLDAEGRTRGMNKGAAREHSEFVQGTQRPAWE
                     GEQNFFLGPTLQRIKRAVREAKQRQPKQQQQGREQQQSPDSKEGAASADAITTETSEK
                     TTAATAAEASEPLPVIGQKRERSASAEEAPITEAPTPDATTKLSSDEPTARPTQTEES
                     LREVIARQSSLRGLFSEKLVLAPLTTVGNLPFRRICKSFGADVTLSEMAVVFNLNRLQ
                     KSEWSLLRRHESEDIFGIQLAVSRPQEAATFAQALEASGFSYDFLDINCGCPVEKIVK
                     SGCGCGLWKRTGRLRDVVESLAIHQSRPVAIKCRIGLDEDTPTLHQQIHRYSTWGAAA
                     VTVHGRSRKQRYTKFANWDYVDQCAQLTSLPVIGNGDIMSLEDVLEHRERQPHITSHM
                     IGRGALIKPWLFEEIKSGQVKDISSSERLDMLKEFCACGMAHWGADERGVMTTRRFLC
                     EWLSFLHRYVPVGLLERLPQRINERPPFYEGRDELETLMSSDSVKDWMRISELLLGPV
                     EKQFRFTPKHKSNSYTNATELDGSIDVEG"
     gene            complement(<153208..>153756)
                     /locus_tag="LDBPK_170410"
                     /db_xref="GeneID:13393312"
     mRNA            complement(<153208..>153756)
                     /locus_tag="LDBPK_170410"
                     /product="cytidine deaminase-like protein"
                     /transcript_id="XM_003859847.1"
                     /db_xref="GeneID:13393312"
     CDS             complement(153208..153756)
                     /locus_tag="LDBPK_170410"
                     /codon_start=1
                     /product="cytidine deaminase-like protein"
                     /protein_id="XP_003859895.1"
                     /db_xref="GeneID:13393312"
                     /db_xref="GOA:E9BD62"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:E9BD62"
                     /translation="MPAIKWSSPVVRNELMSLTRLPAEMQRAAAAAVAAHKNAYSPYS
                     NFSVGAALLHDDGSVTAGCNYENCTLQSCCAERCAIVRANMEGHRRANAVAVYGRSYG
                     AATPTNPPPADALCPPCGLCRQLLVEVADLSQNFEEFMVVLVALDAQRAKVVRLADLV
                     PAKFGPADMGMDVTRLGCHPSA"
     gene            complement(<155264..>157666)
                     /locus_tag="LDBPK_170420"
                     /db_xref="GeneID:13393342"
     mRNA            complement(<155264..>157666)
                     /locus_tag="LDBPK_170420"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859848.1"
                     /db_xref="GeneID:13393342"
     CDS             complement(155264..157666)
                     /locus_tag="LDBPK_170420"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859896.1"
                     /db_xref="GeneID:13393342"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BD63"
                     /translation="MGQAASYAESSVQRALLRLKEEEQADEDELLCACGYRRASLASS
                     TEESAAVAARSSRDAEQSGSSPLSATRSADVQLPPPPESLGPLVSLTPEYYTLDELRH
                     VLQYLPDPLWVSLYRVSLLYMLDNDRDGRINSTDISFFMDWGIKTVGRDVQPDQLAEV
                     LQTYAALHCWHCCLHVGERIEAIKAAAAAQPHPGHGGNTGAGGAVRTRRHHILSPSAV
                     GPLPLHQHHEQHHSQSVPSFMLFHFREAFLNAPAGGPVPLPGKMDITATKSSESTVSP
                     TQSPPSLASSPSVFSQSITDNVRHAAAAHFAEWMLRLVQHQERDRRHERQRFERRVRS
                     MATASDVRLGATARLRHSSYVAQQSLRLRLSATLLPTEAASADPSADGDDLVVSVSRN
                     STPGQHRSMPCATLSADAGAVAALWDVEDGAPELEVVAPAPSPQLATSLPFSKSPTVT
                     PKSRPPYSHSTPVTSLTCVKTPPQPSSPSSSVTPLSVPIALGGGNGSPKGNSSPLLSS
                     AIGTPPTSAGSLPDGRRRTAVGGALITNTSPPHQPSRQHPSAVALTTRWKSLGGPPYA
                     ACLNTAVSPEDLAAGTSASANGAGATEGDLNGSDFSNVNGWVSASSIASATGAGGAAA
                     AATAPSGGSAASLLAHQVSVLLMDAEVFYAELEANGWCTIGAVEEVYLDFAVEESYCL
                     PFWSFCRLLNKASADEVQAALELPTDQAVAVLTSAVAVEEYRRAAAVRQLQRHATMQR
                     DGGHRNGNHCYSSSRGDGWARNLQVIPMFVVSEYTFVAFVAAFIHAYWAMLESMGVDP
                     VT"
     gene            complement(<158818..>159645)
                     /locus_tag="LDBPK_170430"
                     /db_xref="GeneID:13393346"
     mRNA            complement(<158818..>159645)
                     /locus_tag="LDBPK_170430"
                     /product="Qa-SNARE protein, putative"
                     /transcript_id="XM_003859849.1"
                     /db_xref="GeneID:13393346"
     CDS             complement(158818..159645)
                     /locus_tag="LDBPK_170430"
                     /codon_start=1
                     /product="Qa-SNARE protein, putative"
                     /protein_id="XP_003859897.1"
                     /db_xref="GeneID:13393346"
                     /db_xref="UniProtKB/TrEMBL:E9BD64"
                     /translation="MTDAALYHEELLDLEQQVEALPLDVHAPRQQATVGVGNSSSSGA
                     GRRGGGNVNASSARAATFAKAQDILRRLNRLLQQLRVEMRLLDGEERGVYEAHASEHA
                     RKIASLREWVQQSKERAVQSTAASIEVATAAPSSQGQRSTSVHWPPREGDNDEAEGGD
                     GPVMPNRAEARQAATRINEVQHSTLQSLGRSEKLLNETETLGNEAATTLRAQTEQIKQ
                     TTVELDEMRSELGRASTELKCFMRRMARDRLIICFVIVIVVCIIITVVLAVLKHKWR"
     gap             162831..162929
                     /estimated_length=99
     gene            complement(<163095..>166547)
                     /locus_tag="LDBPK_170440"
                     /db_xref="GeneID:13393345"
     mRNA            complement(<163095..>166547)
                     /locus_tag="LDBPK_170440"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859850.1"
                     /db_xref="GeneID:13393345"
     CDS             complement(163095..166547)
                     /locus_tag="LDBPK_170440"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859898.1"
                     /db_xref="GeneID:13393345"
                     /db_xref="GOA:E9BD65"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BD65"
                     /translation="MQHLEAAAAAAAANSDGTCSLTGCVCPGKNNKELFSCRPDGVAS
                     VYDNHEEDLIDGDAGESGSRTGGLSRERTGTDLLSVKSAGASVRRGKDEVDVAAKGIP
                     LEVRRFQCTKSILAFKEATKNDATPVPAKLVDFIVSLTSSKNGLCTEKEMCDWLVAQM
                     CDRMETGQVWVIGKTSNLLFALLWRGSRNFIESVHASGASLFQVSHLADVIKQTPQGN
                     ISGDRLPGSLQPIKHGSAGRKSARSRRKSANIVGGNGAVKPLTACFLEQLKLKGMCSS
                     GAASWLSQGNEALPVHIDPTFDIPEREICFFITNTAYMEALCEYRFRHPALDLVRGEI
                     LCDSDDCSVSDSAGQASDFSSCRTTPASWKGLLDDTLELIKTVAATDPSILICPTGVA
                     IATIRLRNAVLLYEVACRALVRLVHSIFTSLRTLVNSVQTESGAPLKRTQTTRAEQPP
                     TAITSSGCGDSSRLADIGARVDLTLSPEAALGLVNMHYSAMYQFNCAVRTFKTYCESA
                     QHVSAEVSKKAAAALKLIPEDDFAAFRETLKQLQGNGCAKTADASHTATQPLPHQATS
                     SSGVLSPSAAGATEGRAAEMCGPLSTVAVDGASLPTPATSSLESGAHSTTLLDAGVRD
                     ALLMLYEFNSAQEGEQPPMWSRQVDAVCALFDEKEAAILHRIFQDGLDGLWSQWRDFT
                     NNALAAAEKALTTPCESTSPAAKRENSSVQGFLSSDGSAPESGGHHGSYGDATARNPA
                     HAFRSLPSGPQCLQATGFGSSDDKTDFVSPSSSSANNSSLSVAGAEKSAERSIEALLQ
                     AEDVVVICNEECSCNDTLKLIDRFQILMDVPLGQGSYGKVFRAWDEVTGCYLAAKELP
                     LDSSKAHSVAVREVLQEYTVLTELSHPNIVRVVAFMVMKETARIYMEWMPSGSLQDVL
                     RHHPRGVLRESVVRRYARDVVSGLAYLHSRGVIHRDVKPANMLLSSDGTVKLTDFGTS
                     LVLSDNNRTLKSNALAGTAAYMAPECVQGTYSSASDIWSFGCSVVQLITGHLPWYNAQ
                     TGTSPEPIALLFKIGCLDDTTHLERPHDPLVTTVAAANTAAEASASFDATLSNSNTAS
                     MTGSFASTSSKSFRAALPATTVTSPPEISQELIHMLNAIFVVDRKKRPSARELMHHPF
                     FKFM"
     gene            complement(<170702..>173875)
                     /locus_tag="LDBPK_170450"
                     /db_xref="GeneID:13393344"
     mRNA            complement(<170702..>173875)
                     /locus_tag="LDBPK_170450"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859851.1"
                     /db_xref="GeneID:13393344"
     CDS             complement(170702..173875)
                     /locus_tag="LDBPK_170450"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859899.1"
                     /db_xref="GeneID:13393344"
                     /db_xref="GOA:E9BD66"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:E9BD66"
                     /translation="MNFAEVFRDAVDGISYTGDELINALRAARALLASLPDDIHLEQK
                     KRFDRQNRRLSGEVIDIPVSEGELSEEDKDDDDEERAERSRRTGAGKGTAADAGAISA
                     ADEVAAPPSQFSTPVAPPPAAAASEGATDDGAVQSVAVTPPAGQASNLAASRGGLRDG
                     SGFLSPASLQSRNPLLRSEATSCDASGEPAKTHGRRRYRGTSSKQRHRASPKPWDDCD
                     ARHTSSASSTTASSLACDVDDEKRERVRQLELYDQAPSEWLHQFICIGAKLFGEQMED
                     YFRAVHTLIYYMAVRRKRVEQRCQYLRNRAAQEGTGGVDAPPSDAAARAFAYTSHGSC
                     ETAVTAAHEDGATAYASEGEVKNMENSDDNDDEDDELEGFYISREVKRSIRVGLPDNA
                     FRLRDSVHKFFFSCYASVIIQGSVSVAQIKQAGAEVVRICSCVLTWPRYPLNLRAQWA
                     DDREEQLRQFLDKWLGEANGHLVTLMMVPPEAPATVRRRAGAQGEVDVDNSTTAPSSP
                     SSVDAESIMADDGNSRHEGNDDSEDEDSEAAVGPNSANVPQQKVFLGPQTRGEDAVKM
                     AYEFARSPAPCSTPLARLVADTVPEKNVGTLLPCIEQPERRTFNDGFCRLAPSLSQKE
                     LELITELMQLPLTEMPVVNEDDKGNHDQRALHAAEKAIVKHWASPTYDPCGGELTVLI
                     NPTNAFRLQLSNPIIFSLGGVQCDMCCVTERRVSFQAVLDSGVRSEVVLEYEGCIGYD
                     VCVACSYYYYKSSEMRLLRAVHPIPHLRAPFAFGRFSKVRVHSVLASACEESEGDMTV
                     EVVMGVSPYGVMPVGWALPVDRLAELSAACPMLAEETELTADVHASLPVPPQDWKQRC
                     SIANISSLLTETDGRCDTAAAGDAATMASRHALATGMANDHLIDEADVCPICLQLLHS
                     PLPVLRTLCGHCFHVECIGSHYHYKPAVVDGEVNENNGCPVCRCSDYMPPLTDADAMV
                     RTNVYKLMLRVPADEVAKGRGARAREWGGGCAIAVGTILTDDGAYHNATNIASCEAFY
                     GVMPGFAFTRHATAGAREMEAASPAVS"
     gene            complement(<179329..>181638)
                     /locus_tag="LDBPK_170460"
                     /db_xref="GeneID:13393343"
     mRNA            complement(<179329..>181638)
                     /locus_tag="LDBPK_170460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859852.1"
                     /db_xref="GeneID:13393343"
     CDS             complement(179329..181638)
                     /locus_tag="LDBPK_170460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859900.1"
                     /db_xref="GeneID:13393343"
                     /db_xref="UniProtKB/TrEMBL:E9BD67"
                     /translation="MTNRSRADLFANRVFFFFTDASATRYWRAVECCGGAVYGPGDVE
                     AAKEAIHALVESQREAGAPANCLPENFYIIIDNTSEAVLLNSGLEAASPELMAFIEEA
                     CATSGATHLPVMGDHSLFTALLSNKFYEEPVPLTAEPPTAAGVGYSTAHSDPGDAFVM
                     PLFSLHTDDGEEGAGTTSAGAPRSGYASGGAASSRVRSASRVSERRASSLHRTTAHTL
                     SWSRMRSRSRQRARSLSASTPGQNDGGLFFANSGQHCAGGTTAGHHRRRRLVPFAVQG
                     ELRAFIEYFDVLRIRIYAFLVREEPKLDKAITVYHRNYFVDRDTMDYALEVKAQAVDF
                     MERVEDLLASNVCHGPYTESLHRFWADCSDINTKAEHLLHCWDRSMSAAVLPRRILSR
                     RPSSTDSRRATSSRSVTSRGAARAANSPASAACKAEPATSDTNDGADDDHAAAAFVDA
                     QQPNDSEGACEYQSEHAGPEASQPLEAVSHIHEQPMTAQDAAAAESPATAPNAPSIST
                     STRTSHRRSSASSPSHSRSGAAAAKPRSIPLAARPPWVSDWNDENSSQQQPQQKQQKQ
                     HKQQKRAGTRKPASHTPAPTPVPYPPLRVPLAILQPECAADSPTVVRARSARRAGSAH
                     ACHPPSQQEPEQQTHREGFGEGSTRPEETEDATGALTTTTQVPVEAPEMNVTEEGDAS
                     QVPSAPAPVPEPAPAKKTRASTSRHHTGPLKQRNNSGTTPLRSNGQGAAAHAAANGNG
                     YHQRDASAVVAANGNRNTQQQRARPTRKY"
     gene            complement(<183578..>185209)
                     /locus_tag="LDBPK_170470"
                     /db_xref="GeneID:13393347"
     mRNA            complement(<183578..>185209)
                     /locus_tag="LDBPK_170470"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859853.1"
                     /db_xref="GeneID:13393347"
     CDS             complement(183578..185209)
                     /locus_tag="LDBPK_170470"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859901.1"
                     /db_xref="GeneID:13393347"
                     /db_xref="GOA:E9BD68"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BD68"
                     /translation="MPNSQGNPSLSGAASAAVGGASGASRSTFNAAHIKAEFNQYWYS
                     RNTIHHLVREVCHHATACAFLSTPSLFFALDERRGDETAEDEAQMTQLRRCSRVFEYD
                     AQWASDPCYVQYDFHQPEQVPIQYMAAFDYVVADPPFITADVWARYVTTAKLLLKEGG
                     KLLFTTVLENHTMLENLLDRPLFIATFYPLVEHLTYQYVCFLSYEPTCLAQPNAELPE
                     VDAKMAAAIRVANDLRSSEREFALQMAQRKREGEERLPTAAFERDNELAQNPEAKQRA
                     EAERNAVNWDTIPIEKMEWGHIPEGLTMYPEGNVPPAEVQQRAVSGTSDDPAAAAPVA
                     AESFGLEYDACLRLRANLDAFKSSIDAMQRHMDAQMKLRHQRVKLSKELTVLKEASKH
                     HDDTAGSSASAIEAQVADATNAIAMNERERAERLDEMELLARQIEKGEAELVALALQQ
                     PSSASPATDMAAAGDVDTNAADASGQQSPSAATLYYAPYAAAMKECIQAYRTVEAKKV
                     PLQELSADATRRFKFPVFARMKELLQRMKELKQQR"
     gene            complement(<187355..>191308)
                     /locus_tag="LDBPK_170480"
                     /db_xref="GeneID:13393313"
     mRNA            complement(<187355..>191308)
                     /locus_tag="LDBPK_170480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859854.1"
                     /db_xref="GeneID:13393313"
     CDS             complement(187355..191308)
                     /locus_tag="LDBPK_170480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859902.1"
                     /db_xref="GeneID:13393313"
                     /db_xref="UniProtKB/TrEMBL:E9BD69"
                     /translation="MMSRLPHFRSDSDFHRDEESSQSMSQVRARPAIRLDTSLSFIST
                     TSIRAGTASGPASPLLGALGGDSINDVSSSGAAVSSPTPFHMRDVNVEASGPYCLQSL
                     KASHIRAVSDSRSVHSSSRLYSQQQQPSQHQHRPLSLSLSSCSPSVRRDCDVQSRPRR
                     DGQARCLASEADGDKLEVLESEATVMTRPSDPRPYGIDADGEPEVRNQRVMSSTVSPA
                     PRHAVTLPSDFEDGLSMPASKGAQRHDEETPRGRGSKYAARADGCGRLNLDHDAQGDG
                     QEDDAKSMSSPTPPPRRAFVLSRRYSSADVESDARVDDTEPPRSAAEEAERCTPTRMP
                     HVDFAADAPRGSTILVVDNGDEDEASAFTDGRSTAAVIAHANAHPPTVAHAPLAEEPA
                     VSLTLPDGRLVPGVVVEEAEKDAQHRAPLTAHPATAAERESASSHSRSLSSAGSSSMM
                     SPLPRPVPHVTQTAATSKRSSPAHVRETVGAVCDDAGDVTEQQQQQQQRAGTKTVLTS
                     KAANAPVSLTTATAATAANTQPASSTLKSKLQATAMIPAQLDAAASLPTAADDGPASV
                     TPLHSFMALNSISGPSLSATTTAMSSLWLVSGSTPTPLRRRRDRDREVSAALHTQEGE
                     AEETSKDSDTARAQTERALKLADEASTSAVTAPEAGVELQESTHQCTAPADTSVEAAQ
                     LIASAEGAHHHCSFSAPRHTAANSAASPAVSAPSFSPEPARPQAEAYCLSSPPLAAGS
                     ATSASVQLNFLSAEDDAVTPVDLPPLPAPEAATTQHRYSTATPPPFAAAGTLRRPSEA
                     APSMSRPSSAESARVSEEVKELVRRAQAEVCRTRESLLSALRDHRASFHLPETSPTAE
                     NTLSATAPTPVAQLTATVSTTACASLSVSPTLKRSLPLSTVTVAAVEPSAPPSAALKT
                     ASVSPTRTSREWRSAAIALRPQLRAAADAILRRLQGYDARDHGVLPMETVVRVTYFVI
                     TRRQMPPATWSLRTAEGALAATPMRASMVASGGGADTRSDSAHLPSHHVEGRRAVLLS
                     GTPLSRQLSSSEAGEPRHRAATASHKLFKTPRQQRLSLDAHDTTTRVGGSGSPFSSSH
                     LIGVAQPPDCSKSDADADGDDKAAKPECCGRPATCISPSRTLEHVMMLQQRRAEEELY
                     LQFYFTVLEAFKQVFGERYAWRHLGATNASRHDCAINVAQPAQKRRRTSSAAPSECSD
                     LRGHAHVTATEADAEQTQLDVANELNDVTGPLETLFPRLRQQYALLQRERRDPAAAAP
                     KSIVASTGNSLMVPRTTSELVRTEAAAAAVGLAHRPPPLDVLVYYRKFIESLREL"
     gene            complement(<193248..>198839)
                     /locus_tag="LDBPK_170490"
                     /db_xref="GeneID:13393314"
     mRNA            complement(<193248..>198839)
                     /locus_tag="LDBPK_170490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859855.1"
                     /db_xref="GeneID:13393314"
     CDS             complement(193248..198839)
                     /locus_tag="LDBPK_170490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859903.1"
                     /db_xref="GeneID:13393314"
                     /db_xref="UniProtKB/TrEMBL:E9BD70"
                     /translation="MIQVSFELFEAVQNRFAATKQALERTKADLLTRNQHYSLLHQDM
                     LRLKDEYAVLQNRNKEAEERNTQLHQQRAKLEVAVEQLGREVGQGRTALDTLRGKLLR
                     REEELQLSQSRVAESLVTLSQKEAVIGTLRRELGKCGQLRYGPTAGQRDGFREGEEDA
                     LQDGGDGANSHAYTADMLGRIAADVEGRSQEARMKLNMADLEGRLSRLSEEKDSVLAQ
                     HAQYRQHVQLALQTYEAEAMLREDTLARHACVYTPYFAGEQEKLYAKLVNLQTGEDLA
                     TDQRGDDDEMGVAAGAEAPPPLRSFGALTLEIRRAMDRLSRTHIDAASRQQQELSLCV
                     DAQCMLLQASAELVGFLSAMEDEVLRRRLTLPEVREEWHKARIPEFAQGIAQSLQEGA
                     SRFGRGLVGLLQQENSFVEELQQARALQQQQQRVPAAGRDISAVAAAASAADGKGQRL
                     QRGSLPDDTSLQDRSGSALASRLGGRGSYSSKQRSGEAEWRKGSLMGAGAARVPPASA
                     STGNGQGGGKAEGEHVTASTTSNRSSITSGAQRPLASAESSLVGPTDGAAGRAAAPTS
                     RHTKIGGPFDMSEAQESSATGAANMRGSPESQWQSTPNAQTRGGTNDGKDAAASAGQS
                     MQYTPTYPATPPAAIPATTSNTDQRNHASSCAAVAEQVAGELASLPLMPSVVVCPHCA
                     HDVLVHAATGESLPMPADGSDGGSARGLLSVPDTAACASPETSNSTSSALTSPAGGRA
                     VLRAKSSEWTRAAPGSGAAETTDTQRDGTRLTNSSTAVTKSKDKKKPGSTSGTTGASS
                     KRPKKEPSTGSRGASSSPVSSRTTSAGHSRAHGTRTWSKRSMSVSTSHALTHDEQRLG
                     MNSPSFYIASNTSQAVSHSRRSEDNDGAALPAAADVSAAELALALSDCQDRLAHATQE
                     LQDMQLANAALQAQLTAALAAAAATAPALGPSMPADPDSTTTPNSSAGATGPAAGSAA
                     TQKAAGGQQTTPHSPVSPGKKVHEHGKPTTTIFQTASNSPHSGPGGAEEAAYAPGEVV
                     EIDQVATSVEGKPHHRSGSASPTTQHQSTLAGVHRGGAANGDGFARVSTAGAASGGKE
                     GLADESGGAVPNHYTHGLPSTASSPTSTSFPGRYSGTARPVAHTVEEPGTTDNTLMPG
                     IAAARGSQSTTELQQSSGTAARVKRDPAANAEAIDDGAEQSRGGSTAGGAASIHNSNT
                     NAFRHEQPSPFVSPPPHRHYSKRAGGGLAAASATPSQHGNTSTLKPVWCSAYLPVLNR
                     RLHALTGATASSTGATGSAALHRGIASAVSIPHKTHTLGLVITNSRVTGAAAIQPERV
                     DPGAHVSSAAKGKGYNHANSAGDHTVAFKLRSASPHSLTRGLRKCALPSLPPLSSSQV
                     PLQQHLWNTHAPSSKSGHPPTSSPSRSSPVPISALPTAVEAGAEYPHQTLTTVAATTS
                     APASWMSVLGSNIVSPSPPNVSPSTMPQHSVPAWMPSPISPAAATSVAATINIGSDGS
                     AQLPTNATYPPAATTALSKHQQLKIAYQQLRFCLGQGVSPLYSGRGGAQQPFAAVGAV
                     SDVQVAGWPRGCAWYAKRNTGTRGRLRQVLSRPVHGTWVRGHLYETPTLASPASVPLS
                     DTNTAFGIIVGGHSVNSHLSSPYTASGHPAARTWHDASAQFLPSISGASIPQALAYLA
                     TPAETQRQWSSKRFGRSRYGPFSLPASSTTDTMARRLCQRTLRTWQQQKRWHLRQSRD
                     AAAAGKLGRVPCAPATERVAGSAEGLNVQQLPLTLAQRCAAQLSQFQFAVPYATTIQP
                     VSAARQLAASDFVSPFLYTRRQRRNACSVPHLAKRDSMQQAVKRTVYTVSVASSRSSL
                     SDALNSTLPQEALAPLLPSYH"
     gene            complement(<201697..>206454)
                     /locus_tag="LDBPK_170500"
                     /db_xref="GeneID:13393317"
     mRNA            complement(<201697..>206454)
                     /locus_tag="LDBPK_170500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859856.1"
                     /db_xref="GeneID:13393317"
     CDS             complement(201697..206454)
                     /locus_tag="LDBPK_170500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859904.1"
                     /db_xref="GeneID:13393317"
                     /db_xref="UniProtKB/TrEMBL:E9BD71"
                     /translation="MLAEHSYADGDADAPSLIYLSEPLPSSVKPLGLSLAASPLNATA
                     ATPAAAPSASPSFRVRAMHLDDVAEDVILVCEDSITLCVPLTWSAAAAAPASLERPSK
                     SEKDRIETAHGNAACLAQDAASTTVMHRRNCPPDARGTLLCLPSPHTPPAAQSSTPTA
                     SAEAAAACLRMANPSQVWTAPLSASCCTTASTSGLCLPRRLPMPHEELRRSASVLMAV
                     PLPPPEALPSPASSTGRSETPGLTSGPLAVSGYGALTAPPPVMAVYIMECPVLREGVD
                     CIAASAVPLARPLAKVVCSPNTLRFREAWYPMQFFCWCDRNRAPAAASTTTTAAAYVD
                     HHLLCVSSIAVDLVQVRCRVSLALAPQPPQPPQASTKPSPLLSFGGGGTQEDGHIERE
                     PVHIPPASPVSAATAASMTYSSSMASSATADSVCDGAALVSISVLQRYVTRSDWCTYD
                     ARSRVLLSLNHARPSVVKPIKVYVGRRASSVYREPRAKSSRAAEASSAPLELRTLTEL
                     TLPESLCATLHMHCTAGHGTATGAAPASLSELPLPLLRCPQASQQLSSVLGVLTIYGQ
                     SFLYHVSSGRGTIGGRQDPVMNLYMHVPSKEHGRQPLSGMSQTERALSSGVAGAGASA
                     SAAEAAHSDSLLSRLTAAASFATASAPPSKLCGGVFVHVARLSLTAVISRASRDSQAS
                     AQDPLSGAVGADALAAPFPQLPGLVPFCVQVVDNLIVIHSPDTARSAVYDLADCGSSS
                     VSRMSAATASRNARNSTLARSYVWKAVTSGTIGAGVRARKPAAASAHYSSEPAPSLGA
                     GGGATSGSQGMANSGFGHSRLSRPHHHSGSSITDNVDDASASTPRSPLLPSPTASHPP
                     TAASSAAQAAAADSLAAEHQHRRDRSRHRKVALQHQSPSADFTSMLSVLSSSMLAMTA
                     SDPTTDAAAAASAVPLMYPLYCCGAAAAVEGCEEGDADGSGGAPRDSEPVVYSDYQWL
                     AGPRLPLVMKASDGTLRVCRVDAARVAAWRLLVDFSDESDRASQDPCSPQQEQGLDVN
                     TLNGEAAAWLVRSYVSFLCRRYQVFSARSTNDRSTSSVHALVGLLGELTVQAVGLEGD
                     DGDGNGAGVSRTGPSEYSKVDALRHLLCMATASTPGVAGKQLYTLWTCMLENLTLETA
                     FSARCVAVERERSLALAGGADGADVARATRSVASGELLISSAELQQLILQKVFAPTWL
                     ALQSSLLCHPQQQQQPQRRRQLEGLLCDYVRLLHSAAIPVEPPLQHLLLEMVLSDVGD
                     TPASLFMASQSPSACSAARRVQELLRQGVLEQNEATARLLLDWWGASQEVRASMRRID
                     AADARARRLNAGEPSAERRAEPSGAVASAPTSPAAATPTAQQSEDVPFSPFCPGEDAE
                     ETEILFGEAVRLLEAHGFLLEVAEAYSCRSHFTAAAAVLQRVPQQSKLAEVPAVALSS
                     VLSHRRQTRVLSWDSLALSVLDGAWRCVRWAEEALFNAGGAAVVSQHQLTASDFASNP
                     LKSWRTRSLERQVQAAHRVYITVARKLLVSLTASALSPSSASKAAHPSQGSLAATTSP
                     NVDGRFHVHEIHYEQLLRQMEQGWHELKQRGGA"
     gene            complement(<207901..>208869)
                     /locus_tag="LDBPK_170510"
                     /db_xref="GeneID:13393316"
     mRNA            complement(<207901..>208869)
                     /locus_tag="LDBPK_170510"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859857.1"
                     /db_xref="GeneID:13393316"
     CDS             complement(207901..208869)
                     /locus_tag="LDBPK_170510"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859905.1"
                     /db_xref="GeneID:13393316"
                     /db_xref="GOA:E9BD72"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:E9BD72"
                     /translation="MLLRATAASTLASALLHRRGRAPRPVTAGVTASLASRCCCSPPS
                     AALSSSYQPTSSLVLLRAATLCAPTTGSSSAWATARRWQSSGGPGYGTVPADIDSPRG
                     AAKPTEEELHREQRRRTHGPAATAEDANKEAVSTHVSGYNPWEVLGLKPGASTQTIRL
                     RYHELMKQVHPDMAADGTGDIPRLNQINKAYELITKSPTLDRRYRNLVSDTQYFYYKF
                     LPEWMARNVDEMPRYWSWVKWRTPSGFHIFLLLCGFYVLGRFYAAFPMLTSVFFVSVA
                     LDVLLHTMLAPAALCMLFLYSIMAYRSYDMAWLTSPKGFLRRELGY"
     gene            complement(<209755..>220857)
                     /locus_tag="LDBPK_170520"
                     /old_locus_tag="LDBPK_170530"
                     /db_xref="GeneID:13393315"
     mRNA            complement(<209755..>220857)
                     /locus_tag="LDBPK_170520"
                     /old_locus_tag="LDBPK_170530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_024473457.1"
                     /db_xref="GeneID:13393315"
     mRNA            complement(<209755..>220857)
                     /locus_tag="LDBPK_170520"
                     /old_locus_tag="LDBPK_170530"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859858.1"
                     /db_xref="GeneID:13393315"
     CDS             complement(209755..220857)
                     /locus_tag="LDBPK_170520"
                     /old_locus_tag="LDBPK_170530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_024329229.1"
                     /db_xref="GeneID:13393315"
                     /db_xref="UniProtKB/TrEMBL:E9BD73"
                     /translation="MLVMHSSTSGGVAAQRRRRLPALFFSLLICVYLSSGSIGSRWGL
                     LPAHAAAPQHSSSQVRSTQSSDGASHVYASLKELNELVLGAPHTFEAVTSDLRDVAVT
                     VPTDEEVAAAVQHARDEGRRAGLSAQAQYPASAGEGITDAASAEATASMCATDFTCPR
                     SSVAWASGSFTAGELLTPHSLSLPVGLTLKLSLCCQYRFDGTLLRSAELYDIFLQELL
                     RASPFQVLSAAEKRELFPQALIFAVDTWGRRRVYNTSYVLTDADVAEHNDGDGDVLVL
                     TTGALSPAALLKLIASSPSLSAGRRSGLGPNHEASSADPAIAARTGARAVPTRGKVEA
                     ESSETLDTALLAADTDMQLHITSRVVKCKCPHILTVMPPLHMQRDALPPINIVGLGSH
                     CGVPTSSNNTDGADVPQSAHPPFSASQRIRRVRGADGTVAFAVSFEVTPPVPPTSLVT
                     WTVRSVVAEGVEAGSAAPQGDRSWTDRHHSGSSISGPGTSPTYSPLILRHSRLLPVPH
                     YSASSTGGDIGPFAVSTSTDSRLLRSSATSPFFAVEPNVRYEVSVRISRQPLDPALLA
                     RGARASGGDQGQGEPAVGFRAAETASWPSAATSSAERVAHGHFVLRLPLNRTWALPSV
                     HPAPHFGFRRSMRLTNRTMARAAVMAALDPFYPLHSASPTSSLESAGSASAEASGAGW
                     FGGAGHRLVGGGSSGAVLGRRRPLAYYGYWENAPLRDQPLPQHPTRVLANPYTNTSAP
                     ARKADDTDGDGEAGSALVPLFLGRNLVAYLVRDVDDVCDPVVLERREVWAVQAHITTP
                     GPATACGEHQDVSALILRQLLLRMRVEPKLEVTVPNTTWLADPQQLAEAAPEGSYRCE
                     ARSSPPATSMTAKDTGAASLAVCVAAPDAQRDASEVHASVRMSHRGVYEVVWVARVAV
                     REERLIGTANLDPLYTRVIPVTASAKAAASGLFIVEVYSRPLLVVRRLASYPRVVAVE
                     LPMHARRWVVSAPRALADLTSPLAASSTSPAAPQQRQSVPRGGGSSGADVLSNNAPTG
                     YWRSSPPLRVLSVDEQLTAELDTNSVPNVQRMLPNGTLEFVAQDTGEALSLTVVIDGA
                     VHSFAYTSQCPDTHVEYQIYVVPLPPPPIVPAFAPIYTEEGCVLLVAPREVRKDEVAE
                     WLVPPCVSARHPPYLVQRTIPVEEQEETQIITTAVDGGSPLALTTAAAASRPVTALMA
                     CGVEAYHHCDVVWSVRNLVAAVEKTYSLRRCQRPPDVVFHEKDRHQRISYPHAKVFAL
                     PSLTEVAYTRVNASVLASVGAASASTDAAKVVSRHRRHRRVIPVVGFAADIGYSFNYT
                     GQQNYFEMVLRPVQDAVAHQLWNTQHDYVAGDDGPMVLRRRTGMSVQQEQEDTPTGGA
                     GTEELDVDAATAGSETVEAEDAFWGEYHANKASESRKALTSLAERAAELAEQQARRRR
                     RRQLDEQLDTKLEETYTLLHEAEARRLRVAGVGNASLFLMDYVVRSSPERLSAEVEAE
                     KHEFVRRGMCVEKPGSAAVLAVNPRGVVREDERYGTVLPPPPPPAVAVLPFCAPQYTF
                     ARYPELFSVYGYEFTWACPDAAVMTVEKHHPTHSVLYHTPERYGRAAAAPPANASEAL
                     CQLTVANHITHTEQRDWFLVRRVYPSPLPATALVVLSHNAADSLQVVPPPSSATPKSR
                     PSRTSSSRGTVSRSDTAQRQAAAAPPVIITMERLYTTPANTYPFARARHIVGKSAVLH
                     VDAPSDPAMARWAVTSVVPAASITVGLQVLMDNVEFQPLPLHPAAVARDRGGSTVLIK
                     GLHTPGLYTITHSLPDPENPNVCPPVALTEMLDVFHAQVVEKELYVCGDTAALQAVPI
                     PREIAHEFVGQWEVMSLATDENTVWTADANFTGIHFDQGTQAETLVHGLPFGVVTVRW
                     AVYRLLPLPTDAASPPPSLTASGEYVSGLGTSERTASAASEAQHRVLVDHDTVEVFVL
                     TENLPSHRLVTLADRATILTTSSTQNWHLEAEMTGPGATAAVDGATQARMSLRSIHNY
                     SNGEAAAFFFPSDGSTADAPAHAAFHTYFGLHPRPGGGVLVLEQLPVGTVYLHYDLVP
                     SRSIFGRMEGHMCTLKGHYEVERVSAYLTATTSMDHECDGYTGKGRITLCLHTEGAPA
                     TESDGLKEKSRKPPRPPPRTKRQPQSSREDVQFWQSQVRLIDPATLEDTVKRGAREVE
                     RLSGGRCVTPWWVSPTTRWFNPSYTSASTASLPGRCISFTVKAGRHLSPREVSQPLFM
                     AVPRASSPSTPTLAVAAGVYTDRAGDGSSTGGAMHTTGVCPFHGDFISTRIIDGAPGA
                     EAGLTAGTSAARGRKKGIGHDGADAATSPFGLSQLFQLGLPHTLGDAAFAFASTLLGR
                     DGSAEADDGSDEGGVWGIRYLPVLQPATLRRANATMRPMVGLRGVQDDVTYEVNISGR
                     TATFGRPAQDSAEQASEAIVLLRLDLSHPRQLGGFIVSASAATELNATWRPAMATVSG
                     EGAHDASQGEADTASSSSRPAPATGSPHHSLLHKCVDGTVRGADVLQYWTETNRPDGR
                     VDRTAQEWLDYAFAVRDATVPCDVLFGSLDHLISDVHGDGSSAAASASPSASGGWYSK
                     RARRGRQRIELRHGASPLHQQQQYISLAEMERQVERIRRQWKWTADGIDVTGLPADLQ
                     HALSHRRVTSTQLRAIEAARKARQEAEEAALAEETRQQQLHQRKLQNSPSHLSPAQRL
                     ENALRAYQGIAQGSEVAVLRMRLPLKESFAVPYDIFLRTALHKDVLCGTAIDPPPVIT
                     GPTVQPTVTNPHSLVPLGRVEVRDMAPVLSVYPPVVKQCEVEGGMPVLTFELTGANFA
                     RAAFEADAVTLEEIPNPALATAEHGAPNHPNVGLTACIEQMRRGLKAAVETGSRKRLY
                     LQLRACPTFKMLTLEEYNEHQDSEALLRRLQLPRYLRVTVRDAIYPDGFLAPSSRTAG
                     RGASNASAWRWMPGRELPTSVAATSTDASFVVEVRPTLARLHLRSSADMTPPDAAAEG
                     RAGSVHRRRESGRWWGRRGSTAVSSKPDPATTAAATEMAQQTGPSFDPTPDRPLLLCE
                     ADLRRYGFQLGIELIGDTWTPTVGEDGPSAGSYARAAADDGTIVFDDHQRQANLPRQR
                     APPNVALINSFSVVEHHSLDSSHHLYMKGGGVYRSHFINYLFSELLSDPAVLQGHRFV
                     YRYNDTFAGITIPPLSADPAAATSRQGHRDGGWLSGHSRDAGAAEAEEYSDLRAAQVR
                     RSASKHLPTRGSAGDATATATGSGETTAATFSRAFPAVRQFCKVEEILFAVPGIATEC
                     RGCLLADTTFYVAGDLTGMWTASPLSGTASAATGTISALVSAASTTTSGTPAGEATMA
                     LFSWTGEAYTRPLLLPWDSATRVPRRWQFDWLCPAAAHRALERLALQLTGSSDGAALS
                     IVMDVVLYRIRGVDGEALPAAQRPMVLLSSTPVELADVLRQNHAHTRRVGASAGQTTL
                     AAPLLLGVNQTAVDAAYTQLADDTLRRRRRAQTTLEYHRDDRYAAGQLVVNASVFLKL
                     CTNEASEAGDGAASCMVVAITDALLTVEAPRVAMPSASWARRLFGRGGVGIGAGSTAR
                     NASREAAPSPVSPTVLLYHAFMAFLVHELLPLLGIVVVVAPPGTASALSDSLLEDQRR
                     AHVAFTIMAFLSFVFVYAYGPTTAWLGLSMAVWCLSLYYSRRAELVLVFIASAVYTHY
                     LM"
     CDS             complement(209755..220857)
                     /locus_tag="LDBPK_170520"
                     /old_locus_tag="LDBPK_170530"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859906.1"
                     /db_xref="GeneID:13393315"
                     /db_xref="UniProtKB/TrEMBL:E9BD73"
                     /translation="MLVMHSSTSGGVAAQRRRRLPALFFSLLICVYLSSGSIGSRWGL
                     LPAHAAAPQHSSSQVRSTQSSDGASHVYASLKELNELVLGAPHTFEAVTSDLRDVAVT
                     VPTDEEVAAAVQHARDEGRRAGLSAQAQYPASAGEGITDAASAEATASMCATDFTCPR
                     SSVAWASGSFTAGELLTPHSLSLPVGLTLKLSLCCQYRFDGTLLRSAELYDIFLQELL
                     RASPFQVLSAAEKRELFPQALIFAVDTWGRRRVYNTSYVLTDADVAEHNDGDGDVLVL
                     TTGALSPAALLKLIASSPSLSAGRRSGLGPNHEASSADPAIAARTGARAVPTRGKVEA
                     ESSETLDTALLAADTDMQLHITSRVVKCKCPHILTVMPPLHMQRDALPPINIVGLGSH
                     CGVPTSSNNTDGADVPQSAHPPFSASQRIRRVRGADGTVAFAVSFEVTPPVPPTSLVT
                     WTVRSVVAEGVEAGSAAPQGDRSWTDRHHSGSSISGPGTSPTYSPLILRHSRLLPVPH
                     YSASSTGGDIGPFAVSTSTDSRLLRSSATSPFFAVEPNVRYEVSVRISRQPLDPALLA
                     RGARASGGDQGQGEPAVGFRAAETASWPSAATSSAERVAHGHFVLRLPLNRTWALPSV
                     HPAPHFGFRRSMRLTNRTMARAAVMAALDPFYPLHSASPTSSLESAGSASAEASGAGW
                     FGGAGHRLVGGGSSGAVLGRRRPLAYYGYWENAPLRDQPLPQHPTRVLANPYTNTSAP
                     ARKADDTDGDGEAGSALVPLFLGRNLVAYLVRDVDDVCDPVVLERREVWAVQAHITTP
                     GPATACGEHQDVSALILRQLLLRMRVEPKLEVTVPNTTWLADPQQLAEAAPEGSYRCE
                     ARSSPPATSMTAKDTGAASLAVCVAAPDAQRDASEVHASVRMSHRGVYEVVWVARVAV
                     REERLIGTANLDPLYTRVIPVTASAKAAASGLFIVEVYSRPLLVVRRLASYPRVVAVE
                     LPMHARRWVVSAPRALADLTSPLAASSTSPAAPQQRQSVPRGGGSSGADVLSNNAPTG
                     YWRSSPPLRVLSVDEQLTAELDTNSVPNVQRMLPNGTLEFVAQDTGEALSLTVVIDGA
                     VHSFAYTSQCPDTHVEYQIYVVPLPPPPIVPAFAPIYTEEGCVLLVAPREVRKDEVAE
                     WLVPPCVSARHPPYLVQRTIPVEEQEETQIITTAVDGGSPLALTTAAAASRPVTALMA
                     CGVEAYHHCDVVWSVRNLVAAVEKTYSLRRCQRPPDVVFHEKDRHQRISYPHAKVFAL
                     PSLTEVAYTRVNASVLASVGAASASTDAAKVVSRHRRHRRVIPVVGFAADIGYSFNYT
                     GQQNYFEMVLRPVQDAVAHQLWNTQHDYVAGDDGPMVLRRRTGMSVQQEQEDTPTGGA
                     GTEELDVDAATAGSETVEAEDAFWGEYHANKASESRKALTSLAERAAELAEQQARRRR
                     RRQLDEQLDTKLEETYTLLHEAEARRLRVAGVGNASLFLMDYVVRSSPERLSAEVEAE
                     KHEFVRRGMCVEKPGSAAVLAVNPRGVVREDERYGTVLPPPPPPAVAVLPFCAPQYTF
                     ARYPELFSVYGYEFTWACPDAAVMTVEKHHPTHSVLYHTPERYGRAAAAPPANASEAL
                     CQLTVANHITHTEQRDWFLVRRVYPSPLPATALVVLSHNAADSLQVVPPPSSATPKSR
                     PSRTSSSRGTVSRSDTAQRQAAAAPPVIITMERLYTTPANTYPFARARHIVGKSAVLH
                     VDAPSDPAMARWAVTSVVPAASITVGLQVLMDNVEFQPLPLHPAAVARDRGGSTVLIK
                     GLHTPGLYTITHSLPDPENPNVCPPVALTEMLDVFHAQVVEKELYVCGDTAALQAVPI
                     PREIAHEFVGQWEVMSLATDENTVWTADANFTGIHFDQGTQAETLVHGLPFGVVTVRW
                     AVYRLLPLPTDAASPPPSLTASGEYVSGLGTSERTASAASEAQHRVLVDHDTVEVFVL
                     TENLPSHRLVTLADRATILTTSSTQNWHLEAEMTGPGATAAVDGATQARMSLRSIHNY
                     SNGEAAAFFFPSDGSTADAPAHAAFHTYFGLHPRPGGGVLVLEQLPVGTVYLHYDLVP
                     SRSIFGRMEGHMCTLKGHYEVERVSAYLTATTSMDHECDGYTGKGRITLCLHTEGAPA
                     TESDGLKEKSRKPPRPPPRTKRQPQSSREDVQFWQSQVRLIDPATLEDTVKRGAREVE
                     RLSGGRCVTPWWVSPTTRWFNPSYTSASTASLPGRCISFTVKAGRHLSPREVSQPLFM
                     AVPRASSPSTPTLAVAAGVYTDRAGDGSSTGGAMHTTGVCPFHGDFISTRIIDGAPGA
                     EAGLTAGTSAARGRKKGIGHDGADAATSPFGLSQLFQLGLPHTLGDAAFAFASTLLGR
                     DGSAEADDGSDEGGVWGIRYLPVLQPATLRRANATMRPMVGLRGVQDDVTYEVNISGR
                     TATFGRPAQDSAEQASEAIVLLRLDLSHPRQLGGFIVSASAATELNATWRPAMATVSG
                     EGAHDASQGEADTASSSSRPAPATGSPHHSLLHKCVDGTVRGADVLQYWTETNRPDGR
                     VDRTAQEWLDYAFAVRDATVPCDVLFGSLDHLISDVHGDGSSAAASASPSASGGWYSK
                     RARRGRQRIELRHGASPLHQQQQYISLAEMERQVERIRRQWKWTADGIDVTGLPADLQ
                     HALSHRRVTSTQLRAIEAARKARQEAEEAALAEETRQQQLHQRKLQNSPSHLSPAQRL
                     ENALRAYQGIAQGSEVAVLRMRLPLKESFAVPYDIFLRTALHKDVLCGTAIDPPPVIT
                     GPTVQPTVTNPHSLVPLGRVEVRDMAPVLSVYPPVVKQCEVEGGMPVLTFELTGANFA
                     RAAFEADAVTLEEIPNPALATAEHGAPNHPNVGLTACIEQMRRGLKAAVETGSRKRLY
                     LQLRACPTFKMLTLEEYNEHQDSEALLRRLQLPRYLRVTVRDAIYPDGFLAPSSRTAG
                     RGASNASAWRWMPGRELPTSVAATSTDASFVVEVRPTLARLHLRSSADMTPPDAAAEG
                     RAGSVHRRRESGRWWGRRGSTAVSSKPDPATTAAATEMAQQTGPSFDPTPDRPLLLCE
                     ADLRRYGFQLGIELIGDTWTPTVGEDGPSAGSYARAAADDGTIVFDDHQRQANLPRQR
                     APPNVALINSFSVVEHHSLDSSHHLYMKGGGVYRSHFINYLFSELLSDPAVLQGHRFV
                     YRYNDTFAGITIPPLSADPAAATSRQGHRDGGWLSGHSRDAGAAEAEEYSDLRAAQVR
                     RSASKHLPTRGSAGDATATATGSGETTAATFSRAFPAVRQFCKVEEILFAVPGIATEC
                     RGCLLADTTFYVAGDLTGMWTASPLSGTASAATGTISALVSAASTTTSGTPAGEATMA
                     LFSWTGEAYTRPLLLPWDSATRVPRRWQFDWLCPAAAHRALERLALQLTGSSDGAALS
                     IVMDVVLYRIRGVDGEALPAAQRPMVLLSSTPVELADVLRQNHAHTRRVGASAGQTTL
                     AAPLLLGVNQTAVDAAYTQLADDTLRRRRRAQTTLEYHRDDRYAAGQLVVNASVFLKL
                     CTNEASEAGDGAASCMVVAITDALLTVEAPRVAMPSASWARRLFGRGGVGIGAGSTAR
                     NASREAAPSPVSPTVLLYHAFMAFLVHELLPLLGIVVVVAPPGTASALSDSLLEDQRR
                     AHVAFTIMAFLSFVFVYAYGPTTAWLGLSMAVWCLSLYYSRRAELVLVFIASAVYTHY
                     LM"
     gene            complement(<228104..>229705)
                     /locus_tag="LDBPK_170540"
                     /db_xref="GeneID:13393319"
     mRNA            complement(<228104..>229705)
                     /locus_tag="LDBPK_170540"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859860.1"
                     /db_xref="GeneID:13393319"
     CDS             complement(228104..229705)
                     /locus_tag="LDBPK_170540"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859908.1"
                     /db_xref="GeneID:13393319"
                     /db_xref="GOA:E9BD75"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="UniProtKB/TrEMBL:E9BD75"
                     /translation="MEPHSVAVSTPMMVCDAFAKDRFKGNPAAVCLVPTSVYCMEWSA
                     VSSLEASLGRGEPESQERKMTEKDRQAAAEKYSVERNIKMGRAFQQVAKEMNLSETAF
                     VYRLPASRIRTIHEQIMHKCKEFENEYEEKVKHDNEERRRMSAAVTEDDEAPGLPAPD
                     RQQVSVAHTMESSQNPTHSAKLPGSMAWPPSPGLLPSSSFSMANSGLSFLYTRASNSM
                     MTSSETGRRPRRMHTQWFGLRWFTPIKEVPLCGHATFAAAHAIFEISRLVQSESTRHL
                     VSHIPMEFFVPAQTDVICFVTESGIISVRRKSDSIARAGSLMLQSYTCSPDTYEVHFP
                     MTEALSIKEQVPQELFGDVAAALGLAYGAECIEDIAYSKLTGYYVARLSTPHNVLECR
                     PDWEALRRAFSSTHFMDALKEQSAVMGPIKGLGVTAQNEGHIMVGPAANAQVISRFFA
                     PWMGVDEDPVTGSLCTTILPYWLRFLQNGRFKVGDHLHFYQASKRGGSMTGIVIGRKA
                     ERVALIGPVVTFMRGNCTFEVEEEH"
     gene            complement(<232379..>235111)
                     /locus_tag="LDBPK_170550"
                     /db_xref="GeneID:13393318"
     mRNA            complement(<232379..>235111)
                     /locus_tag="LDBPK_170550"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859861.1"
                     /db_xref="GeneID:13393318"
     CDS             complement(232379..235111)
                     /locus_tag="LDBPK_170550"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859909.1"
                     /db_xref="GeneID:13393318"
                     /db_xref="GOA:E9BD76"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BD76"
                     /translation="MPLHKTRINADPQRSPPPAPANHIRSPVGSVSSQSLAISPLSTK
                     PVDIPSPERKPNSGVVTGVSISDGGAVWDRRAQCRAPTPPPSSITVERREEAGYGAMV
                     AKGGKASSSLSKATAGRVGSQEDDVEGGDETSSEDEEDEEEDSDEEDDEGEEGGYYDG
                     ATSDQEEEDDDVDTGDSTSDDEEDEDDASTSASSSSSGSSTAPVEIGSRRTRRKMQSG
                     KKSTQRSLKAAKNTAVPSSASSGAQWCGGPGPAAQPIRTKVSREGDVNVKVIFAARSR
                     HCFRRYVKEVMTRFGFRKATDFDMYCIDQYGDRVDIDTEEDFEQLLDAFTEAMGVVGK
                     DSLVGSPDTHASPPPPSLEPLHHLYGANQSTGSCGMPAAGDGSSMSRHARERAMSFSA
                     SQNHTSSFYAAKSFSLSPRLDATIASSISAGSLVEDDGKSSGSVLRLYVRYSNAYYTE
                     HRREFEQQMNHSLLYPQAMLSNGGSGAHPPPPPPQQQQLSLGSPSSKWRLQTDQLPSG
                     HVSPGAVGSPLARNLLAFTTCSVGSGGGDGGAISSHDELNAVHGKSSDWAAASADSMS
                     MQFNETLNSNLAKTLRLDEAEPLDWRRMSVLGKGSFGTVYEGITQDGKMLAVKVQELS
                     LDDGEDAEAVKAVKAEINLMRSLKHKNIVTYYGCQTRVLPTGNQQMEVFLELCHGGSL
                     ASLRRKFVKAKEPFSISLVRSYTRQVLEGLAYLHAQNVVHRDIKSDNVLISAMGEAKL
                     ADFGCSKRLGPATLQGMPGTLPPGAAPAAAAPSPQEAAVARAAMHQTVVGSPFFMAPE
                     VLREDGSYTGAADIWSVGCLVLELLGREPWDITGKNIFQIMFRISKEKGMPTGVPKKC
                     PAILLDFFERCFQRDTKRRATAVELLEHEWLTCPDKALEEVPPSPLSQKESPAE"
     gene            complement(<237905..>242185)
                     /locus_tag="LDBPK_170560"
                     /db_xref="GeneID:13393371"
     mRNA            complement(<237905..>242185)
                     /locus_tag="LDBPK_170560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859862.1"
                     /db_xref="GeneID:13393371"
     CDS             complement(237905..242185)
                     /locus_tag="LDBPK_170560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859910.1"
                     /db_xref="GeneID:13393371"
                     /db_xref="UniProtKB/TrEMBL:E9BD77"
                     /translation="MPAPETPLLGEEAASPPPRPPPRSCMREGNHPHDKSSAGDSQRA
                     TTSDGHPAPPERMLELHSEDAVTPKRFASRSHQNDEALATFGHSEADRDADGGAEEAR
                     AATNLDHKAMLATAQLHNATNMILPPSVLQPGATEGLVTMAAAKSPRGRDNRAGGDDL
                     WDRGPSNRLGAAKAAAEATRTATQADLDGAIQVDTTAAADKKEEESEDEDENGLFQET
                     VLFMNNNFHSLSSMLCTPAKTPQQPSQETVVGSAIQTPHMPRSLEVTPVKTLSTGREM
                     SGEGDAAGHLNQAEAGAASSDSRRFPAADTTASACCTVCVSPATTVNTHVPAAPASPL
                     PTPQQCCCPDPCASTFAAAATTTAPTTPAASEYFFIDNHDGTAYLADASLQLDGSYVL
                     GQTILLARSSATSEASPISAARRNAAGAESPVVRLQSNADLPQQRAKLAHRPLRSARL
                     TEVLSASMAAPFSPNSPAPHPIQSAAASPVSPSIARVLCRSAAPSRDNSSRPVASAPA
                     CRLLPSSFGDSFCFDQTLLVPLDESADAGRSAVIADASLVTDRSYRSSAPARWEACAS
                     PTVVTPALSSAAVSFRTFQAGTERRERGVPRFSPSCPAASLSVSRASPVPDAPIAAEQ
                     LASQQARATREKRTLRSDQDVIYLIPPDAVTETVTPDDITSQGWIPVQVVDVLPSAAA
                     TTATAAGDDGRSRSCIVGGGAESPLPKNPSTTTAAARVSSQGACADEFEREQSLSRRS
                     YDGHGGGALPIFTPASTLSASTLECINRRLTYSISRWASVRQHFDAASQSDADGASGA
                     NLAGNMALPLATPLCFAGHPHEQHHSNTGGSIQREASSLCWGNEKAFSGSFGAFATEP
                     TSDSHSPVPVPPELSETPQRAQSPSRCTAASIPIAPLQRGRPVGAAGADEDDTGDAAY
                     VDWSSLLTSMRYHRPSTVGAATSESHANEGSLSIPLTSSASAILGTGALPPASGGRHA
                     GGAATRAVAVHHATQQAPQHLRAPHPRRMSATAFSYGTASSSVSVQAFGEHSQRMPTG
                     AVLPLSNAAGAAGNSSFRTTYCCNRTSTTSTETASLNPGFGGGDCPGSSSVSAAGLPL
                     SRGALPHHHPHHQHSYSQQRAGMVRIHSTGSLPAERFTAEAAAMSVSGAAPRSGAVSR
                     NSILHRNRYASPHQQQYLRWTEATALAGAGPATVCGRRAAATAGFLVPDTSVFLPWAP
                     LTITPEGSVNLGGSDATGRRSGAAATTAAPASYVPMTLMPFTSSAETSTTTTTNSTTC
                     DAVSTREVVHQIADDLTRGDTVLSPETLRTLNTAVAAAMEMTVNQLQESLYAASTATE
                     SEPVPLAPNADATTPAVPSFPHAFKQDDEAHKENCAARFRISCNPARAAVAADSVQRS
                     RSASATRPLGCQEGSATNIAVRLSSKARSPSNPAQPGGAPLLGQQLPQ"
     gene            complement(<244471..>247563)
                     /locus_tag="LDBPK_170570"
                     /db_xref="GeneID:13393367"
     mRNA            complement(<244471..>247563)
                     /locus_tag="LDBPK_170570"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859863.1"
                     /db_xref="GeneID:13393367"
     CDS             complement(244471..247563)
                     /locus_tag="LDBPK_170570"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859911.1"
                     /db_xref="GeneID:13393367"
                     /db_xref="UniProtKB/TrEMBL:E9BD78"
                     /translation="MQPLRSGALASLPLRPSLTSTVAAEQLDARLRPGNEPTSQIFLL
                     RDRKRVTAAASSGDAGDDVDSDEALMSASVSSFRCSAAPSAHSVAEVGTHPAMSAEGS
                     APLPSAAQPKEPFLLDHPPPQRHRRQWTPRRGSLCSGTPVGGNGGAVESAVTTVRDWV
                     RSAGCSPSKEPRSASISRRDSLASSFASALVPRDGRWELPRQWTTGADDDDGEERERR
                     AGLGARAAKACSSSSGGSAVNSGRGWDGVDSWSSSEAQLQRPEGFELACAPTSHQRTP
                     SWRQLHSHPATTATITSSNSSVPASRGNGDGAAAPACSSAYTFSAHSRSGHSTGTSSL
                     SGGSSASAATDCGTAATLLSGWGPNRRGGDGDDGSYGDQPSLSGVSSPSLVTPPPSRR
                     TSAPVASTLQANTRMLSPSPVLTARELAQLGEWRSVAEAQRSDLVSTAAPTVLSPLLQ
                     RPAPERPDSGGPASWCLESLSCASFNTSLPNGLWSGRDSTAQTPLNWERGGAAVGTGG
                     AHGSSRASPACWSTSEPAAGGDSALLECRSGGWCSRISSPMSVSLADMNGPACAQQGM
                     PHCSPLTSPPTSPSFAHRVRGTARGCGSDGDDSTMEDIEMRHTKRKCVESPRGSPSAT
                     PLSGSFALSLADALAAAPTCMTTSLETHLWQQQQRRRRTVSPSVARPDEEPLPCDGAD
                     TYASTHYRDRSTFSPPSPIRTTAPSMVPVHPPPSLDISISSSLLATGAQGRPHDMSGG
                     SLHITVDAAAAVLETADSITGVVVEVDAQHAASLSSCGSGGSGEEPEVDTFSLERAQA
                     AMEDADAEAASALRARQHRLYLLSTSQFAQDVERHGGHVDPMQLEMEAEAESEEAEQE
                     WRREGCARRPATSEGFPGNSCGISAGLRGGRATRLRWEKDDGPRSRPNGIAANEEGEV
                     SSAPTAACIPHLHSPHPPRPSFSTVPCATPSAHPAAPVASGRVGSQESFATPLRRGAC
                     VSATAAHVRWGEPEESEDGHSPGSVATTTGSRSRRDMSPPVRERSMAPAELQKEREGY
                     "
     gene            complement(<249328..>251868)
                     /locus_tag="LDBPK_170580"
                     /db_xref="GeneID:13393370"
     mRNA            complement(<249328..>251868)
                     /locus_tag="LDBPK_170580"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859864.1"
                     /db_xref="GeneID:13393370"
     CDS             complement(249328..251868)
                     /locus_tag="LDBPK_170580"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859912.1"
                     /db_xref="GeneID:13393370"
                     /db_xref="UniProtKB/TrEMBL:E9BD79"
                     /translation="MNAVSLPLRRDSDTATTGDGASLTPPAASPLGLSAPAASTSPQP
                     TQLTSSRRDVEGGVLARKTSATDELLQCDKVVSLHPPPLDDALPSGAAHSTAALAYID
                     SSSLPPQHSLSSVAYKTHLAEQPSSASPQSVSDTHAAASRELRRGANINEGGSVLTWT
                     LGDTDTTRTSFLQTAGSTQPPSLQASRSSSCQPVVLPVAQQASPSPSQSPATVVETTA
                     AATETAPASQPRSVLTAEAQRDLQLASASRLSGSGGPVARRCHSALASLARRSPCAEV
                     KATLRNAVDASEPMDATAGTPARPSYESARDAGASPFGEASDGCRESGSGVIPTARLT
                     QPPQAVAAARQHSRSESLLPSTSGRQQQLTVALMPTFRPPHDSTSPSPRTPAPQQTSP
                     RTSAPATTAPVNVTASAISDAPDDVPLPQHLDLFTALPASNTASAGTAGGYSNFGDGD
                     AGGVLHPRLPMPNSANIRGMGTHTNSESLCAASSSATTTGTETPTKTRTSRLELGSWN
                     THHFASSNSSWLLSSMKSTDGGSGGLAVGSRWNDGSCTSTPPPTNSELFRQLRQPNTR
                     VKSILRKSGSSAAVAYGATVMNDGDQANTNRSCVLSPSVHGGGVGGRAETTACTTPRI
                     PASSGAAGGGDGRTSAMPSPIDEPALQMDFIVLRHTTSDADCVNGSATPADASPSPAG
                     LRSRTHRGFPTGTWPQPNPDNINSVANSNVSCVLCTGFENGKGAFADGVHGSDDAGTD
                     NTPISLAVQRSLASPCRLSRSPSTPGYPSPHRTQQCRSSGMRRGGDANVGNISNGETQ
                     VLPPPSTATELPILFARETVAAAGCTSDEPPPDIMLASPPPKRVRVVV"
     gene            complement(<255466..>258660)
                     /locus_tag="LDBPK_170590"
                     /db_xref="GeneID:13393368"
     mRNA            complement(<255466..>258660)
                     /locus_tag="LDBPK_170590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859865.1"
                     /db_xref="GeneID:13393368"
     CDS             complement(255466..258660)
                     /locus_tag="LDBPK_170590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859913.1"
                     /db_xref="GeneID:13393368"
                     /db_xref="UniProtKB/TrEMBL:E9BD80"
                     /translation="MAHLLDSVASPSSTSPSRTPTRSSSSLQSHKAAHPSSRQRHPPQ
                     QQRWSSSAQVAAHPMRRANVERAGGSPEWDRRTPTRQQQSHRSAQRRDPLPASWRAQQ
                     GPAATTEGAAATYTSSISVDDEVSSRFSATQLTEMRERHDSDWASPSEVLQLRTLFQD
                     LTSRYMREVQALKGELAKAQEECAAYAREREKVLELQQVYQDGVAACGRAKEREAQWV
                     EERALLHVQMEKMMVENQWLQLYIAKKQQPHIHHMPPRGSATGSRERVRAAVQAVASA
                     ATATSSASPSPSASWPPLPPTATATTTNTTGYLAPPQPLDGPDTKIFASLPGAAEAAV
                     TGTVQTEATSPYTFLSASSSPEELQYRAPQRGGGVAAETPLPPMPSPTSHQSALARPA
                     SPISAAASAGAQPPHSTPLQRTFPTDIGDDAGADLPGGDGDHGDTLHQQQRGRSRRHP
                     RGGANHDEEPHNSSLMTPSVSTSDEGRLGAGKAVRLPRQQRVRLDGGDNEVDNTTGEG
                     EFNPSYARGVTDLSSTSGGSSSPSPATNIRSMLAGSGLAQVHEQRSGGHSDDGGRRAA
                     EQWGGELVADRAAAVAAAAELPATATATATTTTTPSLGSTAMTTAPSSLSLQYLYQLP
                     RTPAEALQEEVQMLKELRRLGEENQVLKARLDYMQVTKEIFTNQCEQQHLRLAQAHDQ
                     SRHSAAQWELSSRQLASEVRQLEAKCAELQGALEDVLQQAKRQQELSQARLVELEASS
                     RAALVATRDEAIGKVGALRSSLREIAASLAATSASKSSPAAGHEVAQLREEAGQCQRI
                     VENLRNELHALRTAHSELQDEHSALQAEAQMHRTRLEGDLASSRELLAAACSDQRSAE
                     SRIAELEAEVERLRSAVVSSEGLMHTMEERLRLATDELASQQEQLDEASTWQARALSA
                     ESELSTQRSYYEKEISVYKTAACAMQDRHHAEVEGLLKRYEKLQVRHEAAKVRLAAAV
                     SRSGAAAVFAAAGGHARRRHSRHAKSEDRGAPVISGNPTDTASHSPPAAVKTEASSTD
                     CAAAAYDSLQALRISGQVTEKLIRSLNRATSPYH"
     gene            complement(<260408..>264289)
                     /locus_tag="LDBPK_170600"
                     /db_xref="GeneID:13393369"
     mRNA            complement(<260408..>264289)
                     /locus_tag="LDBPK_170600"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859866.1"
                     /db_xref="GeneID:13393369"
     CDS             complement(260408..264289)
                     /locus_tag="LDBPK_170600"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859914.1"
                     /db_xref="GeneID:13393369"
                     /db_xref="GOA:E9BD81"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BD81"
                     /translation="MDFEEAWREAMGEEQPPPPQQARGGHDGGGGGDDAYDEFSDEDL
                     LRSVPCANDAAVAPAFGPVCPMAPVAPAMTSVATAVPKSSSPRPAAASAVAAAMPSLP
                     PSSASQRGALEFPPVGVASFLLRGDNGRVRWVTTTGGAAASAAQRPGVRKISQTVGHS
                     HRREVVDVEAMEADDGVVTVRGDEEAAALCSSGAAMQLSDREDEDDEDDEEDVPDAAP
                     SSMHRRASDPAGFLRDGLNARAMLRDIYAEEVKRQQQRVKQQEDTERQSVQRTAAGRD
                     HCELEALGDRDEVLDGEERERRRLMEPARQCRAATAGTLARPRPHRAPSNGELWVTKY
                     SPKLFHEVLSDETVNLRLLQWLKSWDAYVFPDDAPSAAKGAQASAAGATAAASPPAER
                     IAVLTGPPGVGKTTLVHVLAAHCGYEVIEVNASVERTTSRLEALIKTAVAAAGPATGG
                     RVRRPTAASAAAGLAVPAIDHRANLGLETGHSGDASGAEMAAAAALSSPRASSSLVQH
                     LLRPKCLVIDEMDGIANSSVAAYLIQQQLHRPVFCLCNDFYVPSLRPLRQHCSHVYHM
                     PPIRPQRLLSRLEEIARREGATMFDSMALSELIKTSGGDVRSCLNAMQLISSAVHQQQ
                     QQQRLDAGTGAPSSATAAPAVTTPSRHTVTELIRRMQGKDTRVALRDSWQLLFTRPER
                     SKAVQLLKQECGIDYEAFVEAAAAQHNRNVVPARRALERERAVGAPAGGGYAPTRTAE
                     SRGGGSASARAAMQPVAMGFRVDPGYLYAAQKLSRCPDSGSLVDGLQENYLNRAYTDY
                     SFSRTSATADSFSQQDVVVAAAFQHPELMGTAERLCHVSALTCYVHCSTAARGSRIEF
                     PREQVTLRRLQSELKHAAQQFREGCRPHASAFLGDDEVVSTDVVPMLLRCLFDRSLRL
                     PAHSISSFSRLPPAEKRLLQASVARHVEYGLDYQRDRQYTPSPAAAAAGAAGASLSSF
                     GSLATANVEDEAPWRLTPELDRLLAGVVRPVERALAGSGGGDYRGYSFSSRSSRFGGS
                     GAGPRDGSGLHTSPSPSDAKGSTGSPAFATKSGGGDSREPSRTPSVASVMMPMRNEVR
                     QILSGEIRQHRIMQSMELLKRQSQQSTPEALERGVKRQRADSVASTATASSNPAHKAD
                     STVKGDVREAEHATAADGAEGVDAPANKWPRSDGTMTASVTVTTTTTVRRDFFGRPLP
                     STDSAGAAAASTVSTTRSGPRAVGDRLSASATAAASPSSLVSPSSGDAGKGRFPRPHS
                     PYPPTANACVRYVYQDGSTNAVKMPATFADF"
     gene            complement(<265898..>266794)
                     /locus_tag="LDBPK_170610"
                     /db_xref="GeneID:13393372"
     mRNA            complement(<265898..>266794)
                     /locus_tag="LDBPK_170610"
                     /product="RNA-binding protein, putative"
                     /transcript_id="XM_003859867.1"
                     /db_xref="GeneID:13393372"
     CDS             complement(265898..266794)
                     /locus_tag="LDBPK_170610"
                     /codon_start=1
                     /product="RNA-binding protein, putative"
                     /protein_id="XP_003859915.1"
                     /db_xref="GeneID:13393372"
                     /db_xref="GOA:E9BD82"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:E9BD82"
                     /translation="MDGRLVQTSCRTTHFSAVEATLRDWPEVEAVGSFREKKNNKRDI
                     TTVFVTFRDEAAAKAARAKLDAIPGIAEAATALSTSPEQEKGTTSGSRSKRSQTKKGN
                     AGSDKKSLAAEFLNFESYEDQKQRKAHTRRSNGVPEVTGAETTRRGRGGRGMGRGNNN
                     NSRGAGGSHRGMRGRGGAHLQPPQNFQQPQQYQQHQLHPPPPPPPPPPRLPPFEANVA
                     FIDNVPFGTTNRYLMEHFSAFGRILDVNRLELMVMICFDNPESVQQCIQHMNGTKIHD
                     NVITVSSGTVRIPGSVAIQMGV"
     gene            complement(<267792..>268457)
                     /locus_tag="LDBPK_170620"
                     /db_xref="GeneID:13393373"
     mRNA            complement(<267792..>268457)
                     /locus_tag="LDBPK_170620"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859868.1"
                     /db_xref="GeneID:13393373"
     CDS             complement(267792..268457)
                     /locus_tag="LDBPK_170620"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859916.1"
                     /db_xref="GeneID:13393373"
                     /db_xref="UniProtKB/TrEMBL:E9BD83"
                     /translation="MHVSPLTAPRRAQSSLQKLLDDPNDPYLAALQQFDILRIADIVA
                     EGPAKSGVPAAFLRRAALRVDTDGFAAARAQLASPTPLTQRPAQSSGEAVLQSLHAAG
                     IMHRNKTEAVAAAELKSAQAAYDALPQEEKTALQMERVVSHLFDGLCAMSAAMRMQAE
                     EGAASVEERDAAFSIYERILSAYRDGVITADRWSADFLPELEELQVIWQHLSDPRAMP
                     LEK"
     gene            complement(<269575..>273210)
                     /locus_tag="LDBPK_170630"
                     /db_xref="GeneID:13393374"
     mRNA            complement(<269575..>273210)
                     /locus_tag="LDBPK_170630"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859869.1"
                     /db_xref="GeneID:13393374"
     CDS             complement(269575..273210)
                     /locus_tag="LDBPK_170630"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859917.1"
                     /db_xref="GeneID:13393374"
                     /db_xref="UniProtKB/TrEMBL:E9BD84"
                     /translation="MASYCEVCQGLYDIPHPHLRLQRSPLSPPPWKRGIWNPVCSPSS
                     PPKRGGSGGGRGSRGMSWPRVASRHCETPHGLPSPFLEARSSGHDCVSPYVCPCEQRR
                     SASMPAVPNSYAASASHAASHSSPSLGRRVSPGADGGAGCGDEQEDHHRCTTSFPLPM
                     SAFAAAGRRGFPFIERYCEDTYCSQRRADGNPPQLDYLRRGAGHVCTYVSPYDDCEGD
                     GERIRLTPDGGDTAFPSSSFSPCAPVDAREAAGRHHRCASAGRPLHVRCASSPFPCDD
                     LGRGGELGSRIPHHSSSPRSLEDATRYASERDARPRSSRNTSADHPSRRISPAVDGGG
                     CRGTHMPSVHNGTGSGEPSSSQRPPLLPSVASMTPASSFAGLTLDAEQRAQPSASFEA
                     PLHFTRHGDSARQPAVSDGPLPSRASDSLANLVAKIRAEVSKDVTSWATRAPSSDPLL
                     NPADAKPRTTAEGKRQKHRRAEKPQAQGYAPVTTSHAEQTSATQATASSLLSSSDVST
                     GAEGTAAFHALAARRSSSAGDNSGSHAYRPSAAPPAASGQARSARSHRRRSSTAEYRH
                     PSRPRHSSSSSLSAGSTRSSSSSVHLRYTVRRAEAVLGRLRDRSGGNGGSRAPSPAVK
                     KTREFVGNLLADDAAAAGAANAHGRRNTSAHSSAHGKDCTKLQSGRGRRRHSAPPLPS
                     RPHATRAPSRRSSLPAPTDTFSTESPGAPQRVHPPDRAAREATRDVGQKRDDAPAATE
                     TVAELRRQQEMWRTTQEHRIERLREGLSALCAAVRKDLQKVREEVGRVRAEAIGTAED
                     AQKRMREALATAFRSNSPDERVTHAKRREVDFDPNSVVAAVTQCTPAEQRRLAMLLLP
                     HFRPLLAEMVQGEVQCQLRQHRDEQQEAQHRLEQRLHTYVGEAVVSHQRRTHADETLG
                     SEGIATAPLWATFSSADAFDAHLRAATRAVLLEEDDRRYGLANENERRHERRVQKLKQ
                     GWQETLKTAQAEWKAEWKAILEKEANAWTCCVRAPLQQQADMLQDIVKALTRDVTNLQ
                     EQQEALSARLSTSLRHEREVRVQEQTQLTERVEQHLRQLLPREVESACVRFHALREQR
                     LAAAASRGTFTELTTPGASRRSATPTISAAAAATAPSSAEELRLSIVQPAMEHMRRLL
                     VLHQEMIDAMVEARCRRAEHTVEGNRHVWSQNVAELRSKLSALRADVRGALGELCENI
                     NVASPAL"
     gene            complement(<274084..>275040)
                     /locus_tag="LDBPK_170640"
                     /db_xref="GeneID:13393378"
     mRNA            complement(<274084..>275040)
                     /locus_tag="LDBPK_170640"
                     /product="bis(5'-nucleosyl)-tetraphosphatase,
                     symmetrical-likeprotein"
                     /transcript_id="XM_003859870.1"
                     /db_xref="GeneID:13393378"
     CDS             complement(274084..275040)
                     /locus_tag="LDBPK_170640"
                     /codon_start=1
                     /product="bis(5'-nucleosyl)-tetraphosphatase,
                     symmetrical-likeprotein"
                     /protein_id="XP_003859918.1"
                     /db_xref="GeneID:13393378"
                     /db_xref="GOA:E9BD85"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BD85"
                     /translation="MCIPAALNPGPLGESASPSAEDGAVEDVCVFVGDLVNKGPDSYG
                     VVRFLRDIGAIGVLGNHDAALLQLAEKLRADVPLTDKEASSSLYPLALQCPDDVFAFM
                     VSVPHILCFHAYRLIVVHAGIDPSISLAAQSVEAVTRMRNLVKAKKYWRQPTDEATGQ
                     PAHVALSVSAAFATLERPRLGANWGVKWSELARKLQGSVAGEEASDGGRSDSSSDRSR
                     DHSRSGASGTVDGADDSGKKKPKKADEDAPKWRRRIHRDYTDFTVVYGHDAKRRLQVY
                     PYAYGLDSGCVYGGELTGLVWPSTLVSVPGWTDPSPPRKSKV"
     gene            complement(<276013..>280926)
                     /locus_tag="LDBPK_170650"
                     /db_xref="GeneID:13393377"
     mRNA            complement(<276013..>280926)
                     /locus_tag="LDBPK_170650"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859871.1"
                     /db_xref="GeneID:13393377"
     CDS             complement(276013..280926)
                     /locus_tag="LDBPK_170650"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859919.1"
                     /db_xref="GeneID:13393377"
                     /db_xref="UniProtKB/TrEMBL:E9BD86"
                     /translation="MRDSDRSAAFPSSPSASARPATMEVVVQTPFIAVEGLGADAAAA
                     ASDYAQKRPVRPQHHADGPDSACLTYTDSCLTARLAEVIAEELLQGHALQRHGGVGSH
                     RIRSASATTAAATGENREVLTFTMGPQGAANSSFLFGGTLGWPSRQRAAPTTVSQSSQ
                     ALSGLFAAVLNRLFAPANAPADTRVVAAMSVTEVRDAAPLRHPSVLQRPRSTVDLLSG
                     TVLRTEIDEVEGLDDSVDHPSDIPAACYVRVESIHDAMAVLYAALSCSAGWRHTHLLT
                     GEAGHPEANALSSSPTAFAFLQPACEPLEERMCHVCVTLIVSCEPLRPLQHQEVQQQP
                     PWTTQRAMDNFSDEAGHKRGSSGPAALLSAAPEVPAPVGIWKLWDVAGPSVSCGYRPL
                     KTSSPKSAEGQGGRSAVGRTTTAPAAERRAAPAQLPTPRLPWSSRYSLAALTHTCLAE
                     VGATLSTFALPLSRGPVDSLIPVLRHDTSTSLQIASSAVSSCSLVVPICAVVAEATVD
                     DVNSEVLAAAAGWAALGREHQQEGQQHHQGLPRVRGLDNEDAARRVLHEYAVLLRDFV
                     AERYGAADEGGTASPPFATARSPSASLMASQLPASNDEEGRSARQEAARVLRAPPMQA
                     SLPTSVAADSSRVAAASECGAALCVGAAPMRRMSMNTVAVGTHAAVTAPLSINVTGDA
                     EDSPGFSLRPRVEADVRSTKLVDVLQRVHHQAHADTRAVGAVRSTDEAALSTAPPATA
                     PASVADTCATAATHAEEARLQRFHALFESESFDVGEKAEATAAMEAVRQDEEPSLFDT
                     RGVMAHKGHHKQQTPLPQHTPQVGNSGSPPSVLRTGRRPGAGAHRREPSSLEGQRAPL
                     PSAPSHIGVESAVHDSMADVDTTAASLCPPQALLYDTTIASQGEGSCAAEVVASAACD
                     AAPHACEGPTHTPAPSLPPPDGALAAFLGPYCDEFVRLCGQMRTDVQAWRAHEAATLD
                     QLSALAERHTRDIQEVATLQRRLAANFGTVDAMPGSSGASTLAGARDRRADVGALLRS
                     ALTGGNPDLAASHSATFASTSTLIFEQLVRSEEKVTWLERQLVDWRRRAREASILDTR
                     STNADAAPLIASEGDGESALELSSSPPAVASRVSATVGSVLSGPREDPAAPHMREAEA
                     LLRRLLQRCTRAYAAAQQQGDRWHAQLAQEQAAKSVLQDRVMELEAELAGLRRQRSGA
                     AASPYLHRLPAPARDRAWNGAHASAASRPPTDSPPSCFAAPPSPVAALGSHSLYCTLD
                     GVDAERSLLTAAPVSPIASDVASSLPSSSASRGLQRRCDDVAEPATLWDRMNAQRLAT
                     RGRNSAGDRAGTDSFGAVSTQLAVLLSRAVQGGDACAPSARTHPHVGTAAASSTSVAA
                     PASLFEIHVGASSTVSSRGPDSPFRRDASRHSASASFSLAGNAPEVAARAGDRASDVE
                     SRERRQRRPPPSRSQHERHVEAATTPPSTTHRSARGIDEGTCGGEVLHHHVGTGTMKI
                     GGGALVCAASHPPPSQCHATSAGELEVYPSAALEALERAATQLEAEAVRLCGAAHNTS
                     STAPCSQCHVAAIERRQLNGGDEVAVRRDEDIRAVHSSSPSSLCQSMGQLRSATQAVQ
                     REARDAAERERAYLSAILFSSTAAGSE"
     gene            complement(<284384..>287788)
                     /locus_tag="LDBPK_170660"
                     /db_xref="GeneID:13393376"
     mRNA            complement(<284384..>287788)
                     /locus_tag="LDBPK_170660"
                     /product="P-type ATPase, putative"
                     /transcript_id="XM_003859872.1"
                     /db_xref="GeneID:13393376"
     CDS             complement(284384..287788)
                     /locus_tag="LDBPK_170660"
                     /codon_start=1
                     /product="P-type ATPase, putative"
                     /protein_id="XP_003859920.1"
                     /db_xref="GeneID:13393376"
                     /db_xref="GOA:E9BD87"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:E9BD87"
                     /translation="MSSAVKLSVGERCARQPAPSSRGSSKAGSESAFAISPETLHELI
                     SDGGHDATKRLASIGGLKGLASQLKTDLAHGIDNNDKKAITQRREWFSANELPEAEET
                     SFMDMVWESLEDRMIQILIVSAVVSLVLGLTVPDQDTGLVDYAHGWIEGTAILLSVTI
                     VTLVSSINNYQKEQKFKELSKATPPVKVQVVRSGTTLDITDKELLSGDLLNVAAGDVL
                     TVDGLVLRSTSLKVDESAATGENDDVAKSAHGDFVLRSGSNVTEGEGTILVMGVGVHS
                     FAGHIAMHVREAKEETPLQHKLEELANLIGYMGMVAAGLMLVLLSGKELLDTVVYRKH
                     PFGYKKYLDNLMTAVTIVVVAVPEGLPLSVTIALAYSMKQMFKENNLVRHLAACETMG
                     GATTICTDKTGTITQNDMSVTDGVTAYGVAYVVPRKPSTFAGEDEKVNSGTLASPSPL
                     LQTSTPMDVSAALGGAQAAGVRRLLMECIAMNTKATWVRVESLEAKQATVRLTGSKTE
                     QALLNFVDALGEDPMQLRSERLSRLNEEAMRTPSSPFSLVPWPTGLAGTSSNVVAAAA
                     TFTKDLRIYPFTSARKRMATALVLRPEKLVRYYVKGASELILAECTHTYDAQGERVGL
                     SHEVRVRLEEAIMAMARRQLRTLAIAYADYPLSADYSATPQDSSNSDEGGAAPSSPFL
                     ADDTQLAGLTLVGIVGIRDPVRLEVPRAVAQCRRAGVVVRMITGDNKATAVSIAKEVG
                     IYGKVWFGPAEGEQGLALEGPQFRELAKSARKLNAILPRLQVISRASPMDKHILVSAL
                     MKRGEVVAVTGDGTNDAPALKGANVGFSMNSGTEVAKLASDVVILDDNFSTIVTAMKW
                     GRNVHDNICKFLQFQMTVNVAAVVVSFTGALLDRNGDSPLKPVQLLWVNLIMDTLAAL
                     ALATETPSDEVLLRPPKPKAAPLITRRMWLNIAGQSLYQILIQQYLLLGGANTLGLAV
                     RDSEELHTLIFNVFVLMQLSNEFNARILDDSVAFWHNLGNAPMFITVVGTMFVIQIVS
                     VQYGGTLMQCVPLPLASWVTSLALGVVPLLLGFVLRRIGVVEREIPPPLPVVDTEEEA
                     ALQLALKQHVCPTLRDTVGKVRMQLRVLKAFRENAQEQKAARNRSS"
     gene            complement(<290711..>292210)
                     /locus_tag="LDBPK_170670"
                     /db_xref="GeneID:13393375"
     mRNA            complement(<290711..>292210)
                     /locus_tag="LDBPK_170670"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859873.1"
                     /db_xref="GeneID:13393375"
     CDS             complement(290711..292210)
                     /locus_tag="LDBPK_170670"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859921.1"
                     /db_xref="GeneID:13393375"
                     /db_xref="GOA:E9BD88"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:E9BD88"
                     /translation="MLATFFGRRAEPEFKVVCDPESIVFPVDFDAPDYPYEQAFEEAD
                     AYVRKLPMRGVVPVSDVLRLQFYSLFKQATEGDINEDVKQPSMLRDWEGYWKVYGWRK
                     CRGMTRERARDLYIDLLDVQIRKHCSFVWGAPSGEDRWVAFHDGVKIIRNLPKGGYYL
                     PDSLRAHFYALYKQALVGNLSDFQKTPAAFSEKKYKWLRSRPSKAGFGQMRYDEWAAV
                     KGMSCENAKRMYCKDIFKSAAMCGYVWAPPGTEDHLKVIGDQTSAKTLKKRTDADERA
                     ERIAGATHLTMEEAMDAVGVHLSMVERLAMHSFTKKEQAAAAKAPEEVAGRKKREEKA
                     EMKRRGVAGSYVDLNKGVAVARPKSEKSTEATVTEKMEEADVKEDAERCLEAQDTDKD
                     LQSVCNICRSFAKDIASDSAAPEKVKESGAAAAAAKDCTVDSTSPTPVPKLEASAKVA
                     EASKILPSKSEPVLKKEPAVKVTSKGAASSHQAKNGAKKGPAEKRMKAK"
     gene            complement(<293347..>293658)
                     /locus_tag="LDBPK_170680"
                     /db_xref="GeneID:13393379"
     mRNA            complement(<293347..>293658)
                     /locus_tag="LDBPK_170680"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859874.1"
                     /db_xref="GeneID:13393379"
     CDS             complement(293347..293658)
                     /locus_tag="LDBPK_170680"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859922.1"
                     /db_xref="GeneID:13393379"
                     /db_xref="GOA:E9BD89"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:E9BD89"
                     /translation="MSAADFEAAVAYVRSLPKDGPVQLDNAAKLQFYSLYKQATEGDV
                     TGNQPWAVQVEARAKWDAWNSRKGMRSEDAKAAYVQRLVTLLRSQGIEWKPGAKVQSK
                     L"
     gene            complement(<297009..>298175)
                     /locus_tag="LDBPK_170690"
                     /db_xref="GeneID:13393380"
     mRNA            complement(<297009..>298175)
                     /locus_tag="LDBPK_170690"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859875.1"
                     /db_xref="GeneID:13393380"
     CDS             complement(297009..298175)
                     /locus_tag="LDBPK_170690"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859923.1"
                     /db_xref="GeneID:13393380"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="UniProtKB/TrEMBL:E9BD90"
                     /translation="MASEDIIIFLDALENTVNSIRGDGSAKKTLFTTGCVCPDGVGLD
                     LSAYKDSKNPDDIVAWWGNMGAMKPCPGQKDGADWHDADGFLVRAPLFGGDAAVKRVE
                     MTAPRSLIRGTAAFQAPGYPPLVTTVKQVALSRNGRAVFFCDREGHGVKKYNVDTKEV
                     VPLLSSDVLAALADGLTEEEARASLVEPNSDEDKCRFCVGITLDEKHNQIFFTLKGPS
                     KGGKGRILAAPYYFQRRHLASITAANTSTSEGVIDPKTVVTLLDHLPEPIDLLLDSEE
                     NYLYWTDRGDDAAGGNSLNRAPVTYDPCSGQPQLGERELLIRGFNEAIGLAWAANLVD
                     CMRLPKNKETLRQYMYVTDMRHLWRCDLKARTKEVVYKCGPRNVLTGVEVLRFF"
     gap             299042..299115
                     /estimated_length=74
     gene            complement(<300029..>300319)
                     /locus_tag="LDBPK_170700"
                     /db_xref="GeneID:13393385"
     mRNA            complement(<300029..>300319)
                     /locus_tag="LDBPK_170700"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859876.1"
                     /db_xref="GeneID:13393385"
     CDS             complement(300029..300319)
                     /locus_tag="LDBPK_170700"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859924.1"
                     /db_xref="GeneID:13393385"
                     /db_xref="GOA:E9BD91"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:E9BD91"
                     /translation="MSAADFEAAVAYVRSLPKDGPVQLDNAAKLQFYSLYKQATEGDV
                     TGNQPWAVQVEARAKWDAWNSRKGMRSEDAKAAYVQCLIEVTSQKGHPWNPA"
     gap             300414..300512
                     /estimated_length=99
     gene            complement(<304581..>305921)
                     /locus_tag="LDBPK_170710"
                     /db_xref="GeneID:13393384"
     mRNA            complement(<304581..>305921)
                     /locus_tag="LDBPK_170710"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859877.1"
                     /db_xref="GeneID:13393384"
     CDS             complement(304581..305921)
                     /locus_tag="LDBPK_170710"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859925.1"
                     /db_xref="GeneID:13393384"
                     /db_xref="UniProtKB/TrEMBL:E9BD92"
                     /translation="MQVRRADAAQSSELASYSAAGGEQQPYSIATAAGAAWTVREFVG
                     NLAMLSVVRNRAAVMKDYIKNSNLRPASVATPQRERDWADPAAQPFVRRRRELSLGPT
                     VTCCASKEHRDRVSTPMELAARSARNMHTSRAVREPVAPLPFELLSASRPVPELPAEL
                     KGAITSYYLSRLRQLSVAHQVHIVHAMALKKDRKTVIKCLKQQERAFAQAAQPAAPLP
                     SSITGRSVKGRPQTGAAHPVPKNVPRPTLNEKSRRRVIREYGASPWRRQGANAAESQA
                     MDRFCQHFAVEACAAFLEKAMDVCMARRTRFYLEQPPIARQLGVVLPEEQLTPLYVMA
                     VDDLLYNMTGWTQRKARKFSRAVVAIVCRGILTVVSSATAEKAAAVHERPHTTLAGIP
                     FALEPSPSPGTHRPLADSHPTTAATATAGLKDMNKQRAGRLLGAPLWVPAEGTR"
     gene            complement(<307331..>308299)
                     /locus_tag="LDBPK_170720"
                     /db_xref="GeneID:13393383"
     mRNA            complement(<307331..>308299)
                     /locus_tag="LDBPK_170720"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859878.1"
                     /db_xref="GeneID:13393383"
     CDS             complement(307331..308299)
                     /locus_tag="LDBPK_170720"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859926.1"
                     /db_xref="GeneID:13393383"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BD93"
                     /translation="MPTTVLYHGDQLGPRPLVILDHSVARLEQSATAVLDACQEAAKR
                     YEAMLSSLAWDHGAVFVPLQVSIGEINVMEQSCRHVCAVLDAMDVQWSHVLAHSYGAL
                     VAARMAASTAYPHRIGSLLLLDTPLVTEQLVRNTKQREEIAKARKDVNVPPAELSFAI
                     ESLRSALETTLPYPAAADKSLYEDHLFSASVFREKGLVRDEHRYVPVRHLAQVHHPLQ
                     LLVPVKQPITDVAIHKEFFGLRRPTVIKTADNHEDLLSAKCADEVADVVRAWMQRFEP
                     DVVMKRRFEKAAKEMAQLMGSSAPFGEKDDGNTKKSEKKEKKKGRQ"
     gap             309521..309619
                     /estimated_length=99
     gene            complement(<311145..>314393)
                     /locus_tag="LDBPK_170730"
                     /db_xref="GeneID:13393381"
     mRNA            complement(<311145..>314393)
                     /locus_tag="LDBPK_170730"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859879.1"
                     /db_xref="GeneID:13393381"
     CDS             complement(311145..314393)
                     /locus_tag="LDBPK_170730"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859927.1"
                     /db_xref="GeneID:13393381"
                     /db_xref="GOA:E9BD94"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:E9BD94"
                     /translation="MLRGYNGDHFFQMDDVEGAPALMDEKDCPVKEFDRQTRYRYPVL
                     WRAASSPSAPSIANESSSSRHQHQQLSPRLHLHSSPPVSSSAEEIARTASPELGTHRD
                     GKDNGEEAKGPRHYSRHAGVSTSLAVESPPQDSAASSPATLSARFAGFTAAQQQRFES
                     LQERGPPGHEIARWKMLELMRHWMSMPSTRAGLDAVIRDVLVDAGIAKAKEAWGGSDA
                     CTAASRDSASSLQLQQRGGTIQPVATCANPPSTKAPPKKVSPKNKLITTSVALESDGE
                     PPSSTAHGEEDKRKLECSKEGPRPLADEAPAPSVDQATPASTPTPHAVAIAFSSPALA
                     VRGTTLPPDEATPSANGARVRSTSARRRRRKSRKGAVSAQERRVPPADGSRSPTPQDV
                     KGDTDEFAALPVASLTPEKHVAPLTPRSGVSLGTAASRERTDAASDARASPHRYTESP
                     SLHHSSSEEALPDSSHNSPSPRQRSRSNNLRAAPSRREATYEEIPRFYFPLGRPTTRE
                     MMISGPLSSKHENPHLKIADGVSMSAPMYDGGESSRVGANAGALVGTSKDSVLFPESR
                     RAQKVAPMSQLHALDDRQVAHYIQREFGRLPPLPRHSQRVWLLGGRLRSGSHNHTNLP
                     FAKQELLYRQQFIQCVQRLCSQCFGVPRYFAFVILRLIQWEMHNGNADAAEHRSPPQT
                     RHGNGRLGSSSSLMSHTANGGGSGATGLPSVFLITAQHMKNFYEAYLKNKDMVRRIFD
                     LLILSSRLPTSPAAAASLAAMSAATETNDQAAATPGPSFSASPLRSFLLPKDFVAYIN
                     VLLTYHPGLAFLRQTPDFQTKYLDTVIYRIFYELDRFDRGCISYSELAASRLIDAFRQ
                     VDSAEDINMVLLFFSYEHFYVLYCRFWELDEDRDMLLAPEDLMRYAPEDVMNPCIVQR
                     VFAGVGRRRRCNVPHRIGYEDFVWFCLSEEDKSTPQAIRYWFRVLDLDGDGVLSVYEL
                     RQFYNATCDKIAQYVQEGLVTFEDVVCQVFDMMRCSEYRGLFLSDLMREPEAAAVALN
                     LLTNVVKFLQFEQRDPFVAHEERLLGGPEQSTWDRFARLEYDRMALEADGED"
     gene            complement(<317336..>317635)
                     /locus_tag="LDBPK_170740"
                     /db_xref="GeneID:13393382"
     mRNA            complement(<317336..>317635)
                     /locus_tag="LDBPK_170740"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859880.1"
                     /db_xref="GeneID:13393382"
     CDS             complement(<317336..317635)
                     /locus_tag="LDBPK_170740"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859928.1"
                     /db_xref="GeneID:13393382"
                     /db_xref="UniProtKB/TrEMBL:E9BD95"
                     /translation="MAFKTTTSENDEGKMPAVASMDAFSQVETDYGSALSDFSCFGKE
                     LMTPVKLCTGKGVLDVFGVCFDDGTAVLEDYHTERKDTDQKWEPWRPTKDGGAFRG"
     gap             319339..319437
                     /estimated_length=99
     gene            complement(<319438..>320727)
                     /locus_tag="LDBPK_170750"
                     /db_xref="GeneID:13393386"
     mRNA            complement(<319438..>320727)
                     /locus_tag="LDBPK_170750"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859881.1"
                     /db_xref="GeneID:13393386"
     CDS             complement(<319438..320727)
                     /locus_tag="LDBPK_170750"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859929.1"
                     /db_xref="GeneID:13393386"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:E9BD96"
                     /translation="MYVTPLRICFFFFFFFFFFIILLENVLTLERKTSFVCDTIVLVT
                     KARVEHDFTAFISTGVTQMYNLLKTLWSVREKYAADRAASLYPEPESDASSSAGLVSR
                     PTSRTSSVANRGGAEARDNQSQDSQPLSPINHQYTNGKQDSDVCTERDRVTASLSASQ
                     VGTPAVVEKQITSGLSQERSSLQIRKNRLQEVSNDVRLVTISEFRRFFPSLPQTETVK
                     DSFTCCYQFGASRLGKMWVTQNFILFVSPMMDSRIEIKFCDVEKIEKEQKLVLLDGFY
                     VQLKSGVSMSFSNFTSRDAALNVIESTFQASKAQQKETAEDSGVSGPLVFKTTTSEND
                     EGKMPAVASMDAFSQVETDYGSALSDFSCFGKELMTPVKLCTGKGVLDVFGVCFDDGT
                     AVLEDYHTERKDTDQKWEPWRPTKDGGAFRGQRQFTCT"
     gap             321288..322733
                     /estimated_length=1446
     gene            complement(<322820..>324139)
                     /locus_tag="LDBPK_170760"
                     /db_xref="GeneID:13393348"
     mRNA            complement(<322820..>324139)
                     /locus_tag="LDBPK_170760"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859882.1"
                     /db_xref="GeneID:13393348"
     CDS             complement(322820..324139)
                     /locus_tag="LDBPK_170760"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859930.1"
                     /db_xref="GeneID:13393348"
                     /db_xref="UniProtKB/TrEMBL:E9BD97"
                     /translation="MSDSAAGAEKLEEAVVESAKAETAATEGLTATDAQEENTVVKTV
                     PVETALVQDATEESLERKIPPAEESIANAASEEVKEEHPVIVGSEAARIPAEAFAEAP
                     TAATAKVPDESPDQEASTSGAVLTAESPKTETTSPSTPRKPQKAAFNIDAKPFSPVSL
                     SDPALQATLVGKANGLSIKIGQWSPQPFVPIAHLSPTAPVNVGHIPYVSPALPPAPAV
                     KKETATGKDSLSAYAKPWSPHPEVTVTPVVAGENEVAIHPGSWSATTVDGKEVITPSP
                     MVPRKSSTNLFAHSFSIYPKGLKSVELELFNYACARCTLRTLYGRLSSRQPDVTMRNV
                     SVDVPPLCIAHLIEQITKAKVTALHLNESEGPHYDIWLDKPNLSTQLVEFISGSLWAT
                     PMHHGYAVMGKNEEGKRYLRNYVERLRDSKPPGPNVYDVALVEVKEH"
     gene            complement(328838..328909)
                     /locus_tag="LDBPK_17tRNA1"
                     /db_xref="GeneID:13393352"
     tRNA            complement(328838..328909)
                     /locus_tag="LDBPK_17tRNA1"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:13393352"
     gene            328986..329066
                     /locus_tag="LDBPK_17tRNA2"
                     /db_xref="GeneID:13393293"
     tRNA            328986..329066
                     /locus_tag="LDBPK_17tRNA2"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:13393293"
     gene            329127..329199
                     /locus_tag="LDBPK_17tRNA3"
                     /db_xref="GeneID:13393294"
     tRNA            329127..329199
                     /locus_tag="LDBPK_17tRNA3"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:13393294"
     gap             329526..329624
                     /estimated_length=99
     gap             330141..330239
                     /estimated_length=99
     gap             331561..331659
                     /estimated_length=99
     gene            complement(<331662..>333083)
                     /locus_tag="LDBPK_170770"
                     /db_xref="GeneID:13393297"
     mRNA            complement(<331662..>333083)
                     /locus_tag="LDBPK_170770"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859883.1"
                     /db_xref="GeneID:13393297"
     CDS             complement(<331662..333083)
                     /locus_tag="LDBPK_170770"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859931.1"
                     /db_xref="GeneID:13393297"
                     /db_xref="GOA:E9BD98"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BD98"
                     /translation="MERLQRVGVRTGPTFADAPASTSELPKPTFQPGSSIYEMDSSGR
                     LHRFQCGRVLGRGGFAKCYEVSDETGTYALKAVNRASLEKPKTLQKLHSEISIHRRMK
                     HKHVVEFLRTFRDRYYVYMLLEKCDHGTLMDLLKVRRFSVAETQYVMLQCLSALQYMH
                     SECVIHRDLKPGNIMLDRELNVKIGDFGLAAELQYDGERKRTICGTPNYIAPEIIDHK
                     SHGHSYEVDTWSLGVILYTLLVGQPPFQMEDVESTYKRIRQCRYDFPASVPDNARDLI
                     TQILQSSPAHRPTLMDIRQHSFFSSSPPPPLTPPASFASFGLPVPGAAAPATTATASA
                     AAATTITRSARRGPAVDMHHPPPAPYGKELLGAPAQREVLRPINANVPPPPGAPTSPR
                     HLANLRQQQQPTPAPTLPGTCARARSDTPRSAPATAAVPLSGRCPASSPQQLRNDDNA
                     DEDEKQQLTALHDRLHQTLCGDAA"
     gene            complement(<335351..>337024)
                     /locus_tag="LDBPK_170780"
                     /db_xref="GeneID:13393351"
     mRNA            complement(<335351..>337024)
                     /locus_tag="LDBPK_170780"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859884.1"
                     /db_xref="GeneID:13393351"
     CDS             complement(335351..337024)
                     /locus_tag="LDBPK_170780"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859932.1"
                     /db_xref="GeneID:13393351"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:E9BD99"
                     /translation="MSASTTELFTNQGTLYQYAGEEGEHPYYKPLGDVDCFTISLLKH
                     KKTAGAASSNNSSVEYLIAVAEDGEKVFEQPIGVDLQLSYSAPTASVHWPAIIDEELE
                     TVAFRFTAPAAHVAQVTAQLRMQQFVELYNRCTYSLLTGYDEVDPEDEWYKYLGAATT
                     REVCNEDATEPVFEFDPSQLTKASTGAGNICAAESLQFNRVLVVKKSNEEASLELQAL
                     PQTERGFDRAAMEKLVVHGVDGTSTGTLLENGDVTMLLFGGCSAAVQQLDLARGTVVQ
                     EYKPADLPVQSVAYANHTAANSGSVYTCLGRNVAFNIDVRMDPRSCVVMEDGKQPTDY
                     ALPSLRKDFTCHATSQNGYLVIGDGSGNIRLYTGPPGARKPAGGYFPKTAKTLLDTKV
                     PIVDIDVTADGQYIVATSTSFLLFIETKYVDSNDKESTGFQTRMGARKPQPIILQPSP
                     EQTLRMGGASMVHFQSAKFDRFPGTKELCVTASCGDYLLTWSLRAIESSQQSGRAVVN
                     SAVAVGQTVLSTSANRASHVGFLTSNDVGVVPVHEAKKEVSRTWTWGTE"
     gene            complement(<337803..>341423)
                     /locus_tag="LDBPK_170790"
                     /db_xref="GeneID:13393349"
     mRNA            complement(<337803..>341423)
                     /locus_tag="LDBPK_170790"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859885.1"
                     /db_xref="GeneID:13393349"
     CDS             complement(337803..341423)
                     /locus_tag="LDBPK_170790"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859933.1"
                     /db_xref="GeneID:13393349"
                     /db_xref="UniProtKB/TrEMBL:E9BDA0"
                     /translation="MDTASAAEPSPPPRLRDAVKAEPSTENERGQQLQQLSRHQDVAS
                     SASALDFLALWRPSAVSSSRHAAALTNAKQVEVQRAKSSSSPPPSSELTTPTHVYDPR
                     LGTLSIGSVVFAPYRVCSERPARGGLSACVAGGTVSGSPVTAAAPHQLMPPPRSPYRL
                     HYALAEVTGIQVMAGTVTVSFLFTDPGIDDEAVSMYECVPCPPACLSRWLLEESSPAP
                     QRCSLLERVLHVTPPEGPLPVNDVYRALHAASPKFASAPGLSPLLVQRQRQRERCVAR
                     LRRLYCLSDDDDEQPHTTMARNSRGVAQSASGEDMAAKPVALEPTAATATPSSAAWRF
                     LSTATTEKAALTVGSAGTTTLAASAATMFARYVAPTSVHVFFSSIFQEVNVYMEHHCS
                     RHRRHSLTDPTAEPLSSPSRRLRRGVAAVNAASPPPLVLVIFDSYATLRRFHVFMSVR
                     GHVVQLLDGAHVDRALPSPQTSHAFGAQCKIWLCMLRDDTGEESVEEEAKKEDGFSIA
                     RASAGEESAEVAQAVALMEAQLRCLLAAAPPVDALVSFREHVTQQQVTKSRQSATLHQ
                     HVTAEAVLQRLMPHLGAYRLECVLQDVPAPPPRPTPVGNNAAASSSGTTQPPPSTAPA
                     TTVVKVSGAVFGDNKILVPCSPEQLTLLSTVLASTPVAVSQKTGDGGAAEGGGETAGQ
                     RKCSPTKKANRKRPRVMETADSSSATAVARAQALTPALLERIALGSFTDAAAATLFDV
                     FADATAVVMKSPDPSSADLPATAGDVHRGSSDGRGAAEVLSSIEDLYEKWCVDPSRFG
                     EAFPVFAAVYALVADVFASVSRFRPGRPRSASEWDASIGDEGPRRLSSGPLESAPSLE
                     QAAEKASAVTQRRLPTQSPPNELPRGRLGALIGALPRIAIVLPRGNPTQHPNLGTQQY
                     LRTLRAFFSPWAVHEVTSPAASVAVSCAAPVLWHQRGGLLLLFCDEATTQLGALQDEA
                     DVVIACGKAAAAWVAANSATKASSGDSCKVAAAGPLLFAVISEAEVVAPTDQLTHLWL
                     PITLASPTCMGGGDAPADVSTSADGLERCSEWPAMSKEETSRTELEEMWRLLVATVSA
                     DGSVDVPARPSSPLLRQDQQQHGQTLRSTGVAARRLHQVEVLPRTLRQAVVLWRHLQT
                     AEATVCGGQRQSRASPSELDNEGPWGTLQAVVKEMALSCVTATPVRMTDVTLLRGSDD
                     SA"
     gene            complement(<342186..>346040)
                     /locus_tag="LDBPK_170800"
                     /db_xref="GeneID:13393350"
     mRNA            complement(<342186..>346040)
                     /locus_tag="LDBPK_170800"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859886.1"
                     /db_xref="GeneID:13393350"
     CDS             complement(342186..346040)
                     /locus_tag="LDBPK_170800"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859934.1"
                     /db_xref="GeneID:13393350"
                     /db_xref="GOA:E9BDA1"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="UniProtKB/TrEMBL:E9BDA1"
                     /translation="MHQEHIQRLTSHDAAVLRASHEFPTFTDAFARVVQVGLPELEAE
                     VGRIPSSYRVNDALHGVAVSLCLPALAWDITRTCVLPVTDELRRRTEAEVAGDVAISG
                     AEGGTEKRNHAALRPDGLELFGRLAAICADVSVSVCLEVVESAAVQGDGGVAARPSDE
                     SPLCLLVPETRWHCGQQIPLAEKHVCGHPYTSRNPSCRDGGVFSSRDRLPDISGRARE
                     RCNLVRLITVCRVRGLFHNLPVRQTPYVGLVGTCSYGVLIGRSSGGDDVSWKTASERD
                     RGGLFRRRTLWACKSASAMRARREEQQHLVAVVFQTAVCALLAPLYLAGRPLDASGGR
                     DASLARCSFLAQGASTFSAKLIVEYDFCGDAGAPRRAPAETLPLRPLSLSTSLRCASA
                     PRTGRASSGIHPDSVAAAGLRVDRHGLYSGALRVRQASREVDIGGRAGRRLTRGEATA
                     RRLCHAFGISVPDPSSVSSPSATRADARARRLCPSSAAAASREGGAWTPEETTAEGVL
                     TEVVVRPGHFAVLFATPPPLSASAFPARQAPSAAESLSFSPLPEHHMTFFMILVRDGQ
                     AHPPEDDGCRGRSVPPSSALCPTHCRVLEPTHWAYGIVATNAHRHHHGAHPLPGGPIS
                     AAAATAVPVFVFVDSAYVPARISEARQRARHGVSAQQSFVQLYDEALRRLTSSLRGSE
                     SQNGPLRDGEKILPAQATPPHTTTPDPQQQQPSCVSHHVLAKQEAAEVQLRVRYLCQR
                     VLEAAAVPGTQSYVPALPSKRRRVLAASSEGVAGRTGALHHVQLNPASLLWLSATDRG
                     VNPTATAPRRTPVTLDRNLHRITREEEEEQAALRSRPPLETAPSSREASATAHHSPAV
                     QASNTVEGLTRMRHLLDTGRGSALRRLPRACAPPCPWMPERGSNRGDESSGFDAAEGA
                     TTTASAGAIPPITTAFSARVSVLQWARKFLIIASPTTPQRASKPSCGPAAVLPQGPVC
                     RPQPHALQWWVADQHAVHERVRLEFFLCFADTYVCHPELPRGVERAASECLIAGSGTV
                     SECVPRTSLPLTPHARKALERRHRVAQLLWSHAVTGAACSPSASSAAASFSVSLPAEW
                     RLRVTAVEAHLRQWGWRFHHEAVAAVHRGEMQCSRAVAWASGVRVGQSAYSRTWPALA
                     TAIVAWPCLKVEGVVRHVTSMQALRQTVEELEAVGAAATAAFDSAFVPPQSALTDPVS
                     LCCRGPGPSQVPCSSSPCPLLIPSVFLEFFISRSCRGAIMFGDVLRPTAARSMVAALD
                     CVEQYYVCSHGRPSFAHLTPAH"
     gene            complement(<347361..>352877)
                     /locus_tag="LDBPK_170810"
                     /db_xref="GeneID:13393353"
     mRNA            complement(<347361..>352877)
                     /locus_tag="LDBPK_170810"
                     /product="protein kinase, putative"
                     /transcript_id="XM_003859887.1"
                     /db_xref="GeneID:13393353"
     CDS             complement(347361..352877)
                     /locus_tag="LDBPK_170810"
                     /codon_start=1
                     /product="protein kinase, putative"
                     /protein_id="XP_003859935.1"
                     /db_xref="GeneID:13393353"
                     /db_xref="GOA:E9BDA2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:E9BDA2"
                     /translation="MLSSTDSPRAHTSPTESRAAPNGLTEADTASPTRRESLVPQLAP
                     SCVITPLQGSAASPRTLSCSRGSSETHLNEADASHLQHPLSPNALSTQLTPSTPAKQR
                     LLCRGAPPPSLQQQLSPALPSLARRLWNQFPVREHPSPPRGKNASDVGAEERAAAQFS
                     MLDVFNVGNDASPQLSTLLGSSTRRSENSPALERVGSSQSSLFSTPMTRRLQGCMTKE
                     SPDYRALPAPHTSPPPLTFSTADLASVDSDKRMRNVHRRQDGWVRSPKADCRASACRQ
                     PHPGGHYSTPVASLAPPPVPQHGKISPHEPTRAASGRTASRSIGRKRDGYTRSIARFP
                     SVSAAATPFRDLDQHLPSESAVFPTSSSEGRPHRYTVSPAKPMSPMRESKSRSTGRSP
                     SSDAVGGARHFSSSVEKASVFKELLALDHDVVCASGEATASSRRCGRRRYSANTSPPH
                     DGDYIGDALTASADQRMFLQIKRQSKFWPSDNTSCRFSNAVIGSTARRGVRRSSSSHT
                     ADQGGRSASSMPLSAVMGVIPREDFVHRLGGDSMQSLSSLPQLHQQQLQQLPASPSAP
                     PLPRARTLMASIMRDHAPCSSLRPPELTPAAMEWRESAEMLVDSCCYTPSIVVEQQQQ
                     QQLLLTPLMDQPAEHSTASVQERGSLGHRVSLCSRHRRSVANGSISTARSSSSSNASR
                     RCSCSSAPPAPAHANAESSMSLKVPALVPPPPWTPRDALYWMRNRLTLQEQEEILGYD
                     VVYYCGPPGQPRTACGVTDRATPPPSSHHTSKETASVSSLPKNKEEVVSFTAPSSSYF
                     PITLGMHICFRYEVLEVLGIGTFSIVVRAVDHAASPLSPERHCALKLIRRELLYQNAA
                     QAEWAICERLKECCAAMHPCSGSNFREDASGAAADYRAGASVHRRPSASLPSALPWLS
                     MADQRTLLFGSVLTPRSRFEYRGYHVIVFPLLGFSVRDVVELRRESREAKAGHAVSAS
                     SSLLLASAPPSQAGGQAAGTLPTEVVGSVLAQLAHALHFMHHCAHVLHGDIKPENIVF
                     VDRSVSGRSSSINGHLAESGGAASQQPPPRPPSQQPLLQAPLPHNGDAGALPTSLSMH
                     PFHRVCLGFPSSSLSNTAAPPPPVTHTGTVPRRSHATEHLERRFGADVGDRESPSSST
                     STCSSSLPCLRAPHPPPRNIEIVDGPDRGATIMSCGHSVQHPGGEVASSSQRCPSGGD
                     LHDQCITDGASVSLAGRSLCMTGSRTGVLTPSPHSTSTGAGLVEGSVGYVAACTTLSE
                     APRCSSGSSREVSPSYTTRSGHDSGGGDEASSTVTPSALTRLTYALPHAMAASTAATT
                     SSRIALIDLGHAHHILPGTTATAFPLQSPSYRCPEMSLRLPYTTAIDMWSVGCVLYEL
                     HTGHALFPDVCDDATMLQSAVRVLGMPDAAFLTTVKTCWRKYKQHKASTVRASARAQG
                     DVTSSDTGSQKVQLHLCQAHPQERRLAVDGEDANQDEEAIIVERCWREFIQVLNDAAG
                     HQREHERRLKGQQESSTPPVMENSQRSPRGAALPLPNGSGCTTTWETAEQLALLKVMF
                     PGGQVHESDQCFFLPSKCDWHRYAWVDFLLGCLYWDAGERLTATEAQVHPYLASSFSP
                     EVAAATAVTANNAAASSGMDRKDAVDDTTMSASGVSAASSDAVPRRVVAPTIRPTHCS
                     GLHYLRRHPLTARLLNSAAEAASQPSSPHGSDSTASDDAAPLLAPLLMNPSAIVLFEL
                     PSSNRAAPSARMWKEHQQHLSHCYDSALDIHSMLQTPAERLALSPYHNSDHRRNLFDR
                     TGSYPFRVVFSESDQGTESSVVVSAESSVRGNLAGTQKPRNDDQTSAVMVLPLN"
     gene            complement(<355031..>356365)
                     /locus_tag="LDBPK_170820"
                     /db_xref="GeneID:13393387"
     mRNA            complement(<355031..>356365)
                     /locus_tag="LDBPK_170820"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859888.1"
                     /db_xref="GeneID:13393387"
     CDS             complement(355031..356365)
                     /locus_tag="LDBPK_170820"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859936.1"
                     /db_xref="GeneID:13393387"
                     /db_xref="UniProtKB/TrEMBL:E9BDA3"
                     /translation="MLSTTPVHRAGLLSTLIANGALHAAHLASMQTPAGALILSGCVF
                     RCLAMPFTIYGDQCLHRVACALPELHDAHKEYLDIVDHPRAIAWEKRVAAQKLKNDRD
                     RIFRSFRTNNVKMTAPYAVSSALSLYCLGVPAQQIGTFFVQDAGMAIVSPLAVSCMAG
                     GQLSLASTATTSAATLFTVDPTLALAAGLTCFNVLRHLSQRVGFNDRLDGWIKKTKQA
                     VCLGLGLVAASSLLAGPLTYALALPALHFFPPYLAPVWFGMSATTALKTILVNGTAPG
                     QAMFRLPSYPPQHGTYGGESTAAGHEYRLAFTGVDVEETRSVWQTQKRILDYECDVRL
                     HRFLKQIGLFSDVDELEYEADKLKRKRAVARERRLAHTVANEDVSSKTQAPIRRRTMH
                     DSSGEAPQEADEYSSTSSREMVAVQMEHAQLEELRGRQARKAAREAAWKQRH"
     gene            complement(<357100..>358617)
                     /locus_tag="LDBPK_170830"
                     /db_xref="GeneID:13393354"
     mRNA            complement(<357100..>358617)
                     /locus_tag="LDBPK_170830"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859889.1"
                     /db_xref="GeneID:13393354"
     CDS             complement(357100..358617)
                     /locus_tag="LDBPK_170830"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859937.1"
                     /db_xref="GeneID:13393354"
                     /db_xref="UniProtKB/TrEMBL:E9BDA4"
                     /translation="MPAALLREAREVVQEAEESFTKPWRVQDQQREDTLLHLLNLRRS
                     KLAAVAQLIAELRQVDRQLLHITEAKALDVANWRYQQRELHRKIEKLHRGATALASCF
                     ASASSSSTASGATDLAAGKSQAAATACPSLSHTQCVAQKELAKVRETLQIQLAQLEEE
                     ERASAQRLETWHRLLSEVPWGGNASGDFSCTAETTGGEKDGTQHVRPSAAAPSAAAAG
                     MIHTPEHDPPPQPCSYYSELWRVSEAAAGVPLQQEQQQTPSLSASPGTNTAVADRGSP
                     HPSDAEVVLLQHALHNINGALRQRLLHAAAASLASSSSSQSPTTSHHTSGREEAAATS
                     VTISGLPPLPVATPLRSMQDFMKSPSGNSGAVAPCAQQSAAHPSERLPGSANVAKAAY
                     ASQSGKGQQQETSPLPRCTEATVLVAPAEAVAAGVALDAAEEAQRRVWWQSLQAREQA
                     MKDSLNQLLQSATTTSSPPSSRERGSVDSADGAGRPAGSAIFSSISAYQRSLESR"
     gene            complement(<359705..>361135)
                     /locus_tag="LDBPK_170840"
                     /db_xref="GeneID:13393358"
     mRNA            complement(<359705..>361135)
                     /locus_tag="LDBPK_170840"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859890.1"
                     /db_xref="GeneID:13393358"
     CDS             complement(359705..361135)
                     /locus_tag="LDBPK_170840"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859938.1"
                     /db_xref="GeneID:13393358"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BDA5"
                     /translation="MLAWRVKEVESPYGDVATLHWAVPDAEADALNSTALQVELESAE
                     DQLGAVLWNSNSAALRHLHTHVFNLLPSSSSSAALAPPAIPLAGKNIVELGAGVGCLG
                     IALAMAGARVFITDLKELLPLMEHNVRLNENRVQARSRGVGHCTAFQWKWGPTVSTMV
                     HKQLQKEVAAVKIADQQRWQHSPRGNATLSTKFVLSHSVDRVVSSMVSSLLAPSASLA
                     KCEEALRSIVAVSSSTTAVATDTPLKTPFHYVILCDALYGNPKDWPALLYTLTELMAT
                     NPDECEVVNFCEQRVNDVEGAFLKLLDAENEKKFVPMENRQRDGDAMWTEVLDCATRC
                     CKSSSRSAVEQHKQREEAANSLLSYVLVQRRGAYRWVYKTKVLQDAQSELNMVIRVTR
                     IRWTCAEVLKGEKAKQRHSGGVGHHATASSAIFGVPEPPRRRRSRDDGIGENDAATAT
                     DAQAPSESVAPNVNKKKCRRGDAHPR"
     gene            complement(<361860..>364286)
                     /locus_tag="LDBPK_170850"
                     /db_xref="GeneID:13393357"
     mRNA            complement(<361860..>364286)
                     /locus_tag="LDBPK_170850"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859891.1"
                     /db_xref="GeneID:13393357"
     CDS             complement(361860..364286)
                     /locus_tag="LDBPK_170850"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859939.1"
                     /db_xref="GeneID:13393357"
                     /db_xref="GOA:E9BDA6"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:E9BDA6"
                     /translation="MSRLHFKGGAWTNAEDEVMKAALAQYGLRDWERVASMLTKKTAM
                     QCRERWENYLDPRLNIHEAWSLEEEEKLVELQALFPHKWRLISEQLTRRTPNHYIRPA
                     WLCEQRYLELKDEQEYYLKQQQQQLKDAPGGAAGEKQSLESFMAERRRRRIARKTHEE
                     RASRADTVSGERCEREMIDMATSRLANQDQKKGLRKERQQQLAEAAFLAKLESNREGI
                     ESGTLSLRQTRKMKKALEEDRQKPGLVDEIEEADEEDYASGEARDSGEDDDNDEQFEA
                     IDMYEDQKQAGLVKKQRVLMKDLTEQQRHIQQRQMSSAAGAGGDEEATASSIGSSRAR
                     AALTGVNQDLLRQLTSAPTSASPSLLESNAFGTRAITAAGKPVTGANSIAAAAAAEAK
                     EELKSTLDNLFATLPSAARAAPGPTLTSFSADMPPPLPLPPLKRPREALKPVSVTGEE
                     DRDASYPREVAQQRAPEPPSRPAGSSSSAEARRSDNGVPAHLFGALDIPAPRKMPKTD
                     AAATAAVYSNSGASRSDEARAPIHTNAGPSDAVANSTSAADAQYGITFTESEAEMYML
                     DARRWVAVECERATAAAETSKAPEDEQPTPAEIHAAQSLIEQELCSTDRTATDGASMA
                     NGGGTKGATQLQHSSSMAAAVRAYTSVGGLQAYGAHVNVQQALHQLSQRVAAQVQEAN
                     AILQPLRQEWEQVMSTAMLSPQDRHVLYGYVRDDGQLKGSPAVGNSAEDDEGEGLPPP
                     SVAAYVCERIISQLQRARLASRFTKELRDREVLKMRRDLDEAEHDLQQLQSRERTLQD
                     MYRHQRAQQL"
     gene            complement(<365075..>367018)
                     /locus_tag="LDBPK_170860"
                     /db_xref="GeneID:13393355"
     mRNA            complement(<365075..>367018)
                     /locus_tag="LDBPK_170860"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859892.1"
                     /db_xref="GeneID:13393355"
     CDS             complement(365075..367018)
                     /locus_tag="LDBPK_170860"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859940.1"
                     /db_xref="GeneID:13393355"
                     /db_xref="UniProtKB/TrEMBL:E9BDA7"
                     /translation="MQRGLSFSDLQLPPSVSSSRGAESGSTASPEKTAAAADPRAPSD
                     IPVRPPQQRQQGTAVDAEEEDLYGVVTPSIASREGNSASVATAALARAPLGAAATAAA
                     AAAPTSSLSITPAVPAMLFLSDIRSTKAHGIGFWSGAIRQAIDVLFVGPTLPRSVGGA
                     SASFRKLRQQDGLALVMENKISSEVLHRFFPLQEIRSPSSSAASDSSATFCVHSFGHL
                     DPLPPTLHPSRLGVDDWRDEYRGLSFTVAPDAPYNTPEEAPRYVFEVPRHTLRPAVAA
                     ALKESRNAHQELLPARDARGRAHGKAATPIHDCDATGSKLCEQADDDVSIDLVVNLSQ
                     QLRADLFAKAQLCVEYVSLLEEAVAHYTRTLSTGTAAAAEVPLDERPPNHADAGAGAG
                     AGSGRRMKVWLSEHEFRWMTPEELKQASEAEAATKQQAQTSSSMHVDEESVFQESRKE
                     AAAMTQMKDNGVAVVGAAAEATLRGNAASAVAAQPARPEAVSAARSISLQSPILRDEE
                     EGRPSYLAPSFVGRHEAPVLQSSAVVLSADKLARYPRTHSHMQELPPVDYELYELCMR
                     LGVGQQSVLYHYHERILHEWRRELHRLRQQQTCGAPEPPHVTAPSRLAKEDVQRMVGL
                     VRDRSLQLPSDMVSLVEAVAAAM"
     gap             368347..368590
                     /estimated_length=244
     gap             369701..369799
                     /estimated_length=99
     gene            complement(<370516..>371994)
                     /locus_tag="LDBPK_170870"
                     /db_xref="GeneID:13393356"
     mRNA            complement(<370516..>371994)
                     /locus_tag="LDBPK_170870"
                     /product="guanosine monophosphate reductase, putative"
                     /transcript_id="XM_003859893.1"
                     /db_xref="GeneID:13393356"
     CDS             complement(370516..371994)
                     /locus_tag="LDBPK_170870"
                     /codon_start=1
                     /product="guanosine monophosphate reductase, putative"
                     /protein_id="XP_003859941.1"
                     /db_xref="GeneID:13393356"
                     /db_xref="GOA:E9BDA8"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:E9BDA8"
                     /translation="MAALGSLPTLPEGLTYDDVLLIPQRSPVRSRKAVNTSTRLSRNI
                     HLKIPIVASNMDTVCEDKTAVTMAREGGIGILHRFCSIEEQCAMVRKVKRAQSFLIED
                     PRMILPSATKAEALEELNWSGRKGGVSCLMVVDDFTSRRLCGVLSKSDLIFATDSALV
                     ETLMTPVSRTVVSTNTAITLEEAREVMRTKRTSNIPLLGPKGELLYLITQSDILKLTG
                     NRNATLDSRGRLIVGAAIGVKKEDHKRAAALVDAGADVLVVDIAHGHSDLCIDMVKAL
                     KVNPLTNKVDIIAGNIATAEAAQDLIDAGADGLKIGVGPGSICITRLVAGSGVPQLSA
                     VMDCARVAKKHGVPCIADGGVKTAGDICKAIAAGADTVMLGNMLAGTDEAPGRVLVKD
                     GKKVKIIRGMAGFGANISKAEREKRLDEDVFNDLVPEGVEGSVPCKGPLAPILKQLVG
                     GLRSGISYCGSHSIADMQQRARFVRMSGAGLRESGSHDISKL"
     gene            complement(<372737..>373705)
                     /locus_tag="LDBPK_170880"
                     /db_xref="GeneID:13393359"
     mRNA            complement(<372737..>373705)
                     /locus_tag="LDBPK_170880"
                     /product="ysine decarboxylase-like protein"
                     /transcript_id="XM_003859894.1"
                     /db_xref="GeneID:13393359"
     CDS             complement(372737..373705)
                     /locus_tag="LDBPK_170880"
                     /codon_start=1
                     /product="ysine decarboxylase-like protein"
                     /protein_id="XP_003859942.1"
                     /db_xref="GeneID:13393359"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:E9BDA9"
                     /translation="MVVAAVFTIKLRDGEAEQQFLDAFAPLQQHSVRNEPGTLTYELH
                     QVFENGQPVPLQYLVLERYSSMRDFEEIHLKSAPLQNLFKVVAGIAVEEQKLTVYSNV
                     ASQPAMDSRPQVWSDKDTEDPLLQKGVLVFAGARSGSKPAYTQEAKALAKYIVEEAKQ
                     PVVYGGGTVGVMGELAKEAHALNGKIISIIPNALSESEVSGPMIGDRIYTTATMSERK
                     SIMFAHANTVVALPGGVGTFDELLEVITLFQLNAYRPKIGIVNVEGFFDPFVALLRHL
                     MAEGFLEEKVFDFLVIAPTAIEVMETLKSFVPPPSPASTLIWTSRP"
     gene            complement(<377567..>380389)
                     /locus_tag="LDBPK_170890"
                     /db_xref="GeneID:13393360"
     mRNA            complement(<377567..>380389)
                     /locus_tag="LDBPK_170890"
                     /product="OSM3-like kinesin, putative"
                     /transcript_id="XM_003859895.1"
                     /db_xref="GeneID:13393360"
     CDS             complement(377567..380389)
                     /locus_tag="LDBPK_170890"
                     /codon_start=1
                     /product="OSM3-like kinesin, putative"
                     /protein_id="XP_003859943.1"
                     /db_xref="GeneID:13393360"
                     /db_xref="GOA:E9BDB0"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BDB0"
                     /translation="MGKKDQAAAAENIKVLVRCRPFSEKENAMGHKSCVDLDMVQNTV
                     TVKSIIGEPDRWTFDAVINNSFSQEDIFTQFIMPLTESVLGGFNATVFAYGQSGSGKT
                     HTMTGVMGNSTLEGVIPRCVKHIFDSVQKMRDEAPSTTVSMYVSFMELYNGKVRDLLA
                     KQQVSLDIRENKDHTFFVKGAVVAQVKFPEDVIRHLEEGTDRRRVASTELNADSSRSH
                     SVFSLILECTETLEDGSTRAVSSKLNLVDLAGSERQGKTGASGDTLKEGCNINLSLSA
                     LGTVIDTIVKGGAHVPFRSSPLTMLLKDSLGGNSKTVMFANINPSERNMSETVSTLRF
                     ADRAKQIKNKPVVNMDSKDQKIAELTEIVKELREKLAKYENEGTAGLEEEVVQLQEKI
                     GQLEVQLDNATKSREADLVDYETAKATLAAERQTLNTRLLSMEDEISQLQNQLQISES
                     SGAAMQSQLNEVWTLCYNYFLTPTEKAAQTLEQLQVTRTLEEVLRNAKKKAEGGGESS
                     LQEKIQSLTADLKASQAEHMATKKELKTSKAQLERHLAEVKEELAEWKRASVAPGSSI
                     GDGQVAVAMGQQQDYTMQEEKLLAAIKLDDNGAAAIKLLREENEKLRRQLMAAASALP
                     RSTAAVAAPQQKSASISKNAAADSAVPLELQSSTSAAAQNAAAISSLQAELEEAKAKV
                     EHVTASRESLYAELEAQRTELAKLESTVAQHDRQLAKVQQEYEAKLAAATHSEDEVTR
                     LETRLRERSDQLEQVRALLEKQKAIIIKNNEKAEYFQISVREKTEALVALEQQFREQL
                     ENKDAQMQQLINKRVAEFSEQRSAELNEKSLRQKKLKKKVHKLQEELNKWEERFDTKV
                     CECEDLRKALEEKKVEQMRLLRRIELSDDEAEALEQKEQIQNALERAKQERRRKDDLF
                     AMGEVRSAKSVVRRSTTDPSDDAECS"
     gene            complement(<383103..>383621)
                     /locus_tag="LDBPK_170900"
                     /db_xref="GeneID:13393365"
     mRNA            complement(<383103..>383621)
                     /locus_tag="LDBPK_170900"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859896.1"
                     /db_xref="GeneID:13393365"
     CDS             complement(383103..383621)
                     /locus_tag="LDBPK_170900"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859944.1"
                     /db_xref="GeneID:13393365"
                     /db_xref="UniProtKB/TrEMBL:E9BDB1"
                     /translation="MKSQIARHLPPLPSPRSPILLPLACERRCLYPVCALQHSSLSSK
                     DQRDTQGAHATPLERAAVDTCTLFCPLPASHSLPQAVHAARANEKEGERGARREEGRG
                     GAVPSTYIAHASFSFFLTTIDTRSPPLCLTHTHVATPFAVMVVVASPLCFFFRSPVHA
                     YTCGTKLRAGAG"
     gene            complement(<384179..>384802)
                     /locus_tag="LDBPK_170910"
                     /db_xref="GeneID:13393361"
     mRNA            complement(<384179..>384802)
                     /locus_tag="LDBPK_170910"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859897.1"
                     /db_xref="GeneID:13393361"
     CDS             complement(384179..384802)
                     /locus_tag="LDBPK_170910"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859945.1"
                     /db_xref="GeneID:13393361"
                     /db_xref="GOA:E9BDB2"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:E9BDB2"
                     /translation="MSALAKKMMEKYGWKEGEGLGKERSGIKSYVKVARRDPHIATGL
                     GHAADPAQGGSLASKHAVELDAIYSQLHKETRKRQRQSNKARVDQGDTSEDEVDNGGE
                     LSDVSSTSSGASSSSSADRKSEGKMAVAARAAVKRQHRTPSSSPSNSGNDGDDRTDSK
                     RSKGEHIGDVTRMSDKELFQRCGGVRLGRAGRHRLFDGKLKRIQDSS"
     gene            complement(<389475..>391112)
                     /locus_tag="LDBPK_170920"
                     /db_xref="GeneID:13393364"
     mRNA            complement(<389475..>391112)
                     /locus_tag="LDBPK_170920"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859898.1"
                     /db_xref="GeneID:13393364"
     CDS             complement(389475..391112)
                     /locus_tag="LDBPK_170920"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859946.1"
                     /db_xref="GeneID:13393364"
                     /db_xref="UniProtKB/TrEMBL:E9BDB3"
                     /translation="MTSPRPPAPPHATASSIAAVEEPTLHDAANAHAGMIPGIASEEG
                     ELDQFDIVLQQDAAASSGNTQVPFRNRSPSNTGTHSPSGATPPLAVGGYAASTGSSGL
                     VVSSTAHYSGGAGSNQRCSPSVLFQGAARRLPSVAGACQASAITQDRDQCARLIHQMA
                     SACRGELHLHGYSGSAGGSTTSVASPGGDPRATSSPAAQQPSTASAAAAVSGLDPHIF
                     EEELSLLTGIILEANMAHNPQWQPQFAHRSNHHASSNSNGGYISPPHGMLRASPRSGG
                     GGAQSLATAPAAATVTTAASLLGASAGVAARSHSRGSPAGGVPGAHLASNYLTSVTAS
                     NINNDGRSTIDTEVSDSLCRISHLGGVGSNYHMYMMEHGVRPMNPCQGAAPLSGATGG
                     GVRSISQLQQHQQAWTALMHESVSNPGHLDRAAIASLTGQASRRPSGSAARSTSATVK
                     HPRAVKPEVSSDGGRIRGPRSRTGKNVAPSNHSAFSECSGGETRSCRSTLTGAHRVLS
                     SSANATTNTSLSSSVFHQIQVDHGMSMNGGNGRTNNA"
     gene            complement(<393812..>395674)
                     /locus_tag="LDBPK_170930"
                     /db_xref="GeneID:13393363"
     mRNA            complement(<393812..>395674)
                     /locus_tag="LDBPK_170930"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859899.1"
                     /db_xref="GeneID:13393363"
     CDS             complement(393812..395674)
                     /locus_tag="LDBPK_170930"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859947.1"
                     /db_xref="GeneID:13393363"
                     /db_xref="GOA:E9BDB4"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:E9BDB4"
                     /translation="MSLAHKIFATLKASGDGTFPSPAAPTSGQSETATTTSASPSGSW
                     NERFYHIAVQGCCHGELDRIYDSCSEHERQTGKRIDVLLCCGDFQAVRTARDMDSMAV
                     PDKYKVLGDFHKYYADVSGAFTGHKAQTLAPYLTIFVGGNHENSDLLAQESYGGFVAP
                     NVFYLGHSSVVTVDDCLTIAGLSGIFKDPDYDRPYPPRPYAVNPVAKKSAYHVRRIEV
                     AKLHAYLRATQKIRSNSTIEAAKTTSATSPAASPPMVDLFLSHDWPVGITGYGDEAQL
                     LRFKPYFKDDIRRHALGNPYTMRLLQEAKAPYWFAAHLHCYFEATVEHPSAGATETMA
                     ATAAASTKFVALDKCAKGHGFLTFIDLPRVRRGGVRAAPPSESHPHGTATVLGTSRIR
                     RDPVWLEVLRVSHQFVAANRTVEAGLGGGGFDVDEAVKEVVASYRSATRPSAAALLAP
                     TTETLLAALQLSPALPLQQMAPAAASPESPTKGADGRASPSATRRDETVWQNRNSTRC
                     IGGSLQPHHPRARTEATRASSVSTAAPKSSTPLWYTAGTQPLQQPPTSALRIFEDVGP
                     TGCSSAPSSTSGMVAGHVSSSFACTDGDGGAPPREPAATTLSWFEDTTQQQQQS"
     gene            complement(<396563..>398107)
                     /locus_tag="LDBPK_170940"
                     /db_xref="GeneID:13393362"
     mRNA            complement(<396563..>398107)
                     /locus_tag="LDBPK_170940"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859900.1"
                     /db_xref="GeneID:13393362"
     CDS             complement(396563..398107)
                     /locus_tag="LDBPK_170940"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859948.1"
                     /db_xref="GeneID:13393362"
                     /db_xref="UniProtKB/TrEMBL:E9BDB5"
                     /translation="MRKRALAEEKEAPPALPRRPGKTNFFEEPNPSSNGSEKQGDGSA
                     STTDLAGKKVNTKFDVSGKANFESQCDAKEGASNPFLQKLSKMESDSRLPSFPTYNAA
                     AEERRKRIEAKIKAERSKMLIFRDVGMDLDKPILSRDVFLVLKYFRYGMDFAVDNELE
                     RMLRYFNEHATNELKIIQDSKLMRGPPFLSRKRRTASRQRPSTSSSIKPAPSVGASAQ
                     GDLAERGGSTVALNQQGLQFQISSTFPHVRCAHMRQFCSPNTFSAAATSKLATLLSVS
                     HSSWPFASYFPSMTVQEARGSAGKSYNAKASELFTTMTPSMFRRPAVVIFSQLGQKFG
                     SQADIHWRRLAYATTCPGLLPYIFPSAQEAGTATSGVSRSGPTGKDGSVARAASSSRS
                     MPIDVISLRSADVYKYRWVQRLYVSRFAKSLSQTTVSESGEQPSIDEIKNALIASSTF
                     VGSQLLEPFYATLGLRNYLLPHVMLVDHEGVVRWLSGGLPDADEKAVFPSLLRQLESE
                     YLKAPK"
     gene            complement(<398869..>399222)
                     /locus_tag="LDBPK_170950"
                     /db_xref="GeneID:13393366"
     mRNA            complement(<398869..>399222)
                     /locus_tag="LDBPK_170950"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859901.1"
                     /db_xref="GeneID:13393366"
     CDS             complement(398869..399222)
                     /locus_tag="LDBPK_170950"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859949.1"
                     /db_xref="GeneID:13393366"
                     /db_xref="UniProtKB/TrEMBL:E9BDB6"
                     /translation="MGRGFGRGAKSVAIVTHAQAGNAGKKTPKGLRGTRQRKRQKFLN
                     RNSEQAQLEESLGLAKPEKHAPKNLAQEIASIQFAHVVNKREKGLKHLRKQIMGAVKN
                     VRRLHADKARRKSEK"
     gene            complement(<400188..>400622)
                     /locus_tag="LDBPK_170960"
                     /db_xref="GeneID:13393235"
     mRNA            complement(<400188..>400622)
                     /locus_tag="LDBPK_170960"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859902.1"
                     /db_xref="GeneID:13393235"
     CDS             complement(400188..400622)
                     /locus_tag="LDBPK_170960"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859950.1"
                     /db_xref="GeneID:13393235"
                     /db_xref="UniProtKB/TrEMBL:E9BDB7"
                     /translation="MSFSTKFAMWWGSVTTKTEKLFNKEKERLVTHEYYDNPNPKYAR
                     PKSIHSIRGSMRASASLQNSNGNAKRSRSFRQQEANESGNDADQMPMGSDPGYGGVRQ
                     APYTQNYNDMQQHPQGQQYTPGPQYIHQQHQGHSNRGYGQVY"
     gene            <402227..>403561
                     /locus_tag="LDBPK_170970"
                     /db_xref="GeneID:13393388"
     mRNA            <402227..>403561
                     /locus_tag="LDBPK_170970"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859903.1"
                     /db_xref="GeneID:13393388"
     CDS             402227..403561
                     /locus_tag="LDBPK_170970"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859951.1"
                     /db_xref="GeneID:13393388"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR015232"
                     /db_xref="UniProtKB/TrEMBL:E9BDB8"
                     /translation="MTTADDVCGAYTLSHCDGRVAPTKAILTIHRCGETLTAHATVAN
                     DLRGTVQYENCHIVGSLHSTGNEASPAEESVEQALSKGFADGFNVVVEINQVLLKNAN
                     SSFVFARLSKLSDLNGEHAIIAINDQPPNQEMTMTFTPDGNGGSFVTANIANSLRGNC
                     QIDAGLLRGDLATTQSEADESLMQVEKLISEGFHQGFHVCTNESGILLQSSEANIQLC
                     RIVSHNDLEGEYMLKSFNGAAVPTRNQPSIVFKPVNTNEVEISIVVTNRIRGTAALNQ
                     NVLSSEEPLMSTRMMGTEEESQLENAFNVGFQYGLETISHGNELTLKNQDCKFVLVKA
                     AAPAAQHGGPTYKGTYCNKCFKTEGNGLLFRIVNEHEKKWAFYNDTEDLRIRVRATFG
                     ARSKIEALGNANMCKDDDGRYVVEVTVDPQATEMFIQGDVNGFRVLYDAQPI"
     gene            <406167..>407852
                     /locus_tag="LDBPK_170980"
                     /db_xref="GeneID:13393234"
     mRNA            <406167..>407852
                     /locus_tag="LDBPK_170980"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859904.1"
                     /db_xref="GeneID:13393234"
     CDS             406167..407852
                     /locus_tag="LDBPK_170980"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859952.1"
                     /db_xref="GeneID:13393234"
                     /db_xref="UniProtKB/TrEMBL:E9BDB9"
                     /translation="MAAPSSENNAGASLSCTDSAVEAFVADATDIRDLLYKYRADAEL
                     LRHELSSFVHREIDEQAQFSHLRASVNQTELASLHDPRFIEYLARREAEEKRVAPSAF
                     SAGDATISDQTDGVGAANASADFQWWAQRMKEEGSPWLRCWTPDAALPLAAFRRLSDV
                     WKGWKHTSAAYDTEFDRMLEEVYASTPPSSCSADMRYCCFGNGALCILPIKDDVAIMD
                     GLEKRVSLMAGASSEPFSRSPSSLSTDNAGYAVASVLDSYFAELTSAVAMTRDELHEK
                     VSTLMQKKKLANADSHATVADSFRLTGDAWDTLSFAHPDRLKHAVMVRGFFFKGRLSL
                     VEQLGAEVDVVPLFFAHEKRSSMLEERGQRVQRLFSQTLSTLYRELERACNGATMLGE
                     TALPPNAALTVTVKVPSSERDVVKGVLLDVHPVSPQLPFDGHVTWMDVCAVGRQRACA
                     PPGTQGPLGAAAVSRGSSDEECSVLFRLTRLPVASLQPYDAVSRRVFPLLNRQLTADQ
                     RRKHERTDEDVEVPTGGVASVSYSVPSMTVPICVGAVACVAAALSVACWVRRS"
     gene            <409418..>409756
                     /locus_tag="LDBPK_170990"
                     /db_xref="GeneID:13393232"
     mRNA            <409418..>409756
                     /locus_tag="LDBPK_170990"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859905.1"
                     /db_xref="GeneID:13393232"
     CDS             409418..409756
                     /locus_tag="LDBPK_170990"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859953.1"
                     /db_xref="GeneID:13393232"
                     /db_xref="InterPro:IPR005184"
                     /db_xref="UniProtKB/TrEMBL:E9BDC0"
                     /translation="MEMKNLLGKHKVVLVNGRPAPAGVTVEFKAGENSGSVHMHARVA
                     NIMNGQLRLENRKLSGALVSTMMLGSDDLMNIENALSQGFMEGMTYTVKDGGKLTLQS
                     KTHIIKLVPA"
     gene            <411535..>413559
                     /locus_tag="LDBPK_171000"
                     /db_xref="GeneID:13393233"
     mRNA            <411535..>413559
                     /locus_tag="LDBPK_171000"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859906.1"
                     /db_xref="GeneID:13393233"
     CDS             411535..413559
                     /locus_tag="LDBPK_171000"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859954.1"
                     /db_xref="GeneID:13393233"
                     /db_xref="UniProtKB/TrEMBL:E9BDC1"
                     /translation="MLNAALRTKRNGAAPPAPAPAESEFHQMRMQEQLRNHAIKDFDA
                     TEQQVSPSYFVASLQELCAQRLADSFAECAEVDALREEQPDLYAMVLERLPTQPDTML
                     PLRITVPRIIDEKYWQRCCKARWPLGQLSRMAKGQRLLEKEYGWKRLFLEQVLSDFLM
                     ALGSGSNAGDGNGSLLPPGVMTVVTGEALAVSQKGITSLASAAATCTPRDADTSLFDL
                     SLDDEAIAALRELCAICRDYVHTVDLPCQLVHFRPYEHLFAHVPGILSFRLTFGVANR
                     GVRVSVTDMIGFRDEDAQLIQQLLRHYAALESLRLPLNRLENRHVQMIAAGLASSTTL
                     RVLDFSQNSLTDAAVVEAVSLLLCRPDFPLEELYLADNQLADKAAAALAEALRFNKTL
                     HVLHLQQNCIGDAAGGALLVRSLAVHPTLADVNLGSNRFGTSTAEALSEVLPQLTQLR
                     MLCLSGNSQLAGEEVSSLPFPSEGAAAAAPVAPTGSTTSIPSVYSTSLLAVSAKDSDA
                     EAAEIGTADSQKADEEGDEDEADASLTHAETAEGESYRFTTTARPSVATVAGEDVSTL
                     QHRGPRASRKQKDTSQLLPTAAPPPPLAQTAGGRLIAAAVKANASLVELDVRFCGLTP
                     AEEQEIMRAVQERVYQHQMDTSVTLREAERRRALQRRAKERVARMTGRSA"
     gene            <414830..>416263
                     /locus_tag="LDBPK_171010"
                     /db_xref="GeneID:13393236"
     mRNA            <414830..>416263
                     /locus_tag="LDBPK_171010"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859907.1"
                     /db_xref="GeneID:13393236"
     CDS             414830..416263
                     /locus_tag="LDBPK_171010"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859955.1"
                     /db_xref="GeneID:13393236"
                     /db_xref="GOA:E9BDC2"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:E9BDC2"
                     /translation="MKLTLRGGIALAGAMLLAIAGFSLFETCVILVLYLAKYVFGDGA
                     LMPLYRLSNMHHDFMQRTYLCWVGGLVENVLGTSIAYTVVDGDGQEHLEQHYMTSVRN
                     EEGAVERYLDLDKVLRPPSQPGKAKIIIMNHHCRVDWIYTFMYFARTRGIISHIRYVL
                     KEDLKHLPVLGWSMELFRYLFLSRHWEADKMYMRRMVDFYKATGDTPVILIYPEGTDL
                     SPSNIQRSQEYAAKVGLPKFRHVLNPRTTGIVALMDMLGGADRVEEVVHLTIAYTYHA
                     PGERPNELSLANGHHPKKVHLLIQSYRVAGTAAAAAQKNPKHVCPTEEAALTAWIHEC
                     FAEKELLLSRFLMTNPIGFDAADVRAVLGEGVGIASYDDDEERLRHPNRPWWRRYYQQ
                     VGFFGAVIAPVYWIASPIYYVFFTRWWLSTLWVLAVLVVFMKGVKAIGGIQQSLYLKV
                     VTPEATLMQRLRRMLKGRQMRKDKKSD"
     gene            <418077..>424238
                     /locus_tag="LDBPK_171020"
                     /old_locus_tag="LDBPK_171030"
                     /db_xref="GeneID:13393237"
     mRNA            <418077..>424238
                     /locus_tag="LDBPK_171020"
                     /old_locus_tag="LDBPK_171030"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_024473458.1"
                     /db_xref="GeneID:13393237"
     mRNA            <418077..>424238
                     /locus_tag="LDBPK_171020"
                     /old_locus_tag="LDBPK_171030"
                     /product="ATP-dependent RNA helicase, putative"
                     /transcript_id="XM_003859908.1"
                     /db_xref="GeneID:13393237"
     CDS             418077..424238
                     /locus_tag="LDBPK_171020"
                     /old_locus_tag="LDBPK_171030"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_024329230.1"
                     /db_xref="GeneID:13393237"
                     /db_xref="GOA:E9BDC3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BDC3"
                     /translation="MDWIGDVVQSRWSVVYGLRYAQCTAQKERHAVMDAMQRHALDDP
                     RVEHLYQSITGKEVDPLNTEQLQQRRESAAAGGNEEVESKLASTVPRQPLLRRVNLQA
                     CAFQDERAPHLHVRATVPQGTQRLTYETHDEVLLPLTSSCNTSNPLIRVATSFPGWAV
                     PVFLGVEELNAMQSKVYDCAFHSDENMLVSAPTGAGKTNVAMMAMLRTIAAARNPVTG
                     VIDGHSLKMVYVAPMKALVQEVVRTFSKRLESLGLTVAELSGDAAMTQQQMATTQLIV
                     TTPEKWDIVTRKSVELGVASLLKLLIIDEVHLLHNERGPVVEAIVARTMLQQQLRGEG
                     GIRLVGLSATLPNHEDVAAFLQVNRQRGLFVFDSSYRPIPLEQTYCAIKKMKGVAQSA
                     VMNLVAYDKVLQTVQAEEQVMIFVHSRRETEHTARYLQKRAAEERRGYYFVRPDSDSH
                     KALVEASSGAGGAVLRRSLQQLLPDGFGIHHAGLSRDERNTVEQLFADRHIKVLVCTS
                     TLAWGVNLPANRVIIKGTRVFNGSKGQSELMSALDVLQMFGRAGRAGYGAAVGRATII
                     TSPDDLHYYLSVLNQQLPIESQMMRRVVDMLNAEITLGHVETVEEGVQWLQRSYLYVR
                     MRQVPEVYGIRASASDPLLLHHLANIVHTACEELKESKMADYDARSRKVAGTAYGRIA
                     SYCYITVTSMAAYLGLMSNAMQDVELFRVFASSSEFANIGVRAEEQAQLKELLENAPV
                     AVRESRYTPMAKINILLQCYISQKGLEGLPLMSEMVYVKDSAQRILRALHEISLVREY
                     GRTARQFLELYLMTVHRQWAVQSPLRQVRDYLPAKHFDAILPALERVRVPWEEVRRWS
                     VEDLAEKLSDDRRAQSAYEAIHVVPHYAVDAAVRPLTRGMLYVDIDILPDFDYVESLH
                     GCSVCEVLLMIEHTNGRLLHHESILIPLANVLEKAAYACPPVVVPMVEPAPTHLFVRV
                     ASPHWLAATAFTSVCLLNTLLPPVAAPLREVDQRPPSQDANITSVTERLAPYQLHTVG
                     EMLFPFQDFTALQSDLMDPIFLDHPHNLLVGVPPGGGKTAIAELFVLQFLLEEALKEK
                     ERTAGVQQKQQRDEEEGSATQSTLLLPGKLLYLTSNPDVVHRRALDWRYKFGEVLKQR
                     VVELAGGVSDDTDADDAETVSNAVEVASAAIVLATGENLIRLVRRGDSALACVTHIVV
                     DHLHLLRAPEGQAMEECMARLNSEPFLVRRGAGRARVLGLTYPLISTAELGRWLKVSV
                     SHQYNYGASYRQLRVRMVGLELPGPRSRYESGVIAALKLLRRPSYAAVPTVIFVPTAH
                     QAREVAQRILLRCRDNYIPETTEHATDDARLAFFLAAGVAYMHKGTSELDALAIQELV
                     DAPAVYPTTQALLPLRLVCAFDAAWRLPAALFTNAIVCCGERLTAFESEDGERGMRYQ
                     DCTVVELMQMASRAMNEAVMYTRTSRVWVLGKLLNEPLPLESSLRYADDFRDTVNTAI
                     AQGRAHNRVDVLRVLSSHYFLYHAKANLHFYGVPTVADVSLYASSFASHVVTSLKELK
                     CIEELRVRRRHADGDGAADEDGGNSNAELGEAEEDEDPHAPLRPTARGMALAYHCIAV
                     STAEDLVRVLPGSLEAEKKAALYDCTTYLWQILSHHCAELTPAHLGDAARVTEAAEYR
                     ALHSIARALPESIGVRYIDLDFGATGTKIYVLVLAYCSRLFPATHFHAAGSASSIEEG
                     TAAAAAFDEHFGHSLYHAAVPAPARDALCNAVSDDTAQRLVQDVRSILPTVRRVVTAV
                     VELLDGDTQAWAVARLIRFVACLQQQGWDSEPPVAQLPCWRASRWASVDARQAIQSSC
                     TLQELQTNPAEAASKLEPALRGVLTTDDAAVVVPRVLASAAQDAAGVPQVVSISAKGR
                     VEEMNGVLAMVVGVTAQLRWSAPTTLKLSKGSDGADRTSQDDLTEDAAPALKWWVRCV
                     ISHRSSVTSRAGASAGTRQLALRVSVAKSVTSAEATSLYEVSSDVFFSLARLEAEDLD
                     AVEMRAVLTSMAYCGVEATAAVRFEADEEEVEDGEGI"
     CDS             418077..424238
                     /locus_tag="LDBPK_171020"
                     /old_locus_tag="LDBPK_171030"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase, putative"
                     /protein_id="XP_003859956.1"
                     /db_xref="GeneID:13393237"
                     /db_xref="GOA:E9BDC3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BDC3"
                     /translation="MDWIGDVVQSRWSVVYGLRYAQCTAQKERHAVMDAMQRHALDDP
                     RVEHLYQSITGKEVDPLNTEQLQQRRESAAAGGNEEVESKLASTVPRQPLLRRVNLQA
                     CAFQDERAPHLHVRATVPQGTQRLTYETHDEVLLPLTSSCNTSNPLIRVATSFPGWAV
                     PVFLGVEELNAMQSKVYDCAFHSDENMLVSAPTGAGKTNVAMMAMLRTIAAARNPVTG
                     VIDGHSLKMVYVAPMKALVQEVVRTFSKRLESLGLTVAELSGDAAMTQQQMATTQLIV
                     TTPEKWDIVTRKSVELGVASLLKLLIIDEVHLLHNERGPVVEAIVARTMLQQQLRGEG
                     GIRLVGLSATLPNHEDVAAFLQVNRQRGLFVFDSSYRPIPLEQTYCAIKKMKGVAQSA
                     VMNLVAYDKVLQTVQAEEQVMIFVHSRRETEHTARYLQKRAAEERRGYYFVRPDSDSH
                     KALVEASSGAGGAVLRRSLQQLLPDGFGIHHAGLSRDERNTVEQLFADRHIKVLVCTS
                     TLAWGVNLPANRVIIKGTRVFNGSKGQSELMSALDVLQMFGRAGRAGYGAAVGRATII
                     TSPDDLHYYLSVLNQQLPIESQMMRRVVDMLNAEITLGHVETVEEGVQWLQRSYLYVR
                     MRQVPEVYGIRASASDPLLLHHLANIVHTACEELKESKMADYDARSRKVAGTAYGRIA
                     SYCYITVTSMAAYLGLMSNAMQDVELFRVFASSSEFANIGVRAEEQAQLKELLENAPV
                     AVRESRYTPMAKINILLQCYISQKGLEGLPLMSEMVYVKDSAQRILRALHEISLVREY
                     GRTARQFLELYLMTVHRQWAVQSPLRQVRDYLPAKHFDAILPALERVRVPWEEVRRWS
                     VEDLAEKLSDDRRAQSAYEAIHVVPHYAVDAAVRPLTRGMLYVDIDILPDFDYVESLH
                     GCSVCEVLLMIEHTNGRLLHHESILIPLANVLEKAAYACPPVVVPMVEPAPTHLFVRV
                     ASPHWLAATAFTSVCLLNTLLPPVAAPLREVDQRPPSQDANITSVTERLAPYQLHTVG
                     EMLFPFQDFTALQSDLMDPIFLDHPHNLLVGVPPGGGKTAIAELFVLQFLLEEALKEK
                     ERTAGVQQKQQRDEEEGSATQSTLLLPGKLLYLTSNPDVVHRRALDWRYKFGEVLKQR
                     VVELAGGVSDDTDADDAETVSNAVEVASAAIVLATGENLIRLVRRGDSALACVTHIVV
                     DHLHLLRAPEGQAMEECMARLNSEPFLVRRGAGRARVLGLTYPLISTAELGRWLKVSV
                     SHQYNYGASYRQLRVRMVGLELPGPRSRYESGVIAALKLLRRPSYAAVPTVIFVPTAH
                     QAREVAQRILLRCRDNYIPETTEHATDDARLAFFLAAGVAYMHKGTSELDALAIQELV
                     DAPAVYPTTQALLPLRLVCAFDAAWRLPAALFTNAIVCCGERLTAFESEDGERGMRYQ
                     DCTVVELMQMASRAMNEAVMYTRTSRVWVLGKLLNEPLPLESSLRYADDFRDTVNTAI
                     AQGRAHNRVDVLRVLSSHYFLYHAKANLHFYGVPTVADVSLYASSFASHVVTSLKELK
                     CIEELRVRRRHADGDGAADEDGGNSNAELGEAEEDEDPHAPLRPTARGMALAYHCIAV
                     STAEDLVRVLPGSLEAEKKAALYDCTTYLWQILSHHCAELTPAHLGDAARVTEAAEYR
                     ALHSIARALPESIGVRYIDLDFGATGTKIYVLVLAYCSRLFPATHFHAAGSASSIEEG
                     TAAAAAFDEHFGHSLYHAAVPAPARDALCNAVSDDTAQRLVQDVRSILPTVRRVVTAV
                     VELLDGDTQAWAVARLIRFVACLQQQGWDSEPPVAQLPCWRASRWASVDARQAIQSSC
                     TLQELQTNPAEAASKLEPALRGVLTTDDAAVVVPRVLASAAQDAAGVPQVVSISAKGR
                     VEEMNGVLAMVVGVTAQLRWSAPTTLKLSKGSDGADRTSQDDLTEDAAPALKWWVRCV
                     ISHRSSVTSRAGASAGTRQLALRVSVAKSVTSAEATSLYEVSSDVFFSLARLEAEDLD
                     AVEMRAVLTSMAYCGVEATAAVRFEADEEEVEDGEGI"
     gene            <427243..>431553
                     /locus_tag="LDBPK_171040"
                     /db_xref="GeneID:13393239"
     mRNA            <427243..>431553
                     /locus_tag="LDBPK_171040"
                     /product="formin, putative"
                     /transcript_id="XM_003859910.1"
                     /db_xref="GeneID:13393239"
     CDS             427243..431553
                     /locus_tag="LDBPK_171040"
                     /codon_start=1
                     /product="formin, putative"
                     /protein_id="XP_003859958.1"
                     /db_xref="GeneID:13393239"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="UniProtKB/TrEMBL:E9BDC5"
                     /translation="MSFRRPPPVRRSCTYVEFAQAGEDVTPERNFTVPDVMNSDSVTV
                     DTGGPTASPNAPARVRSPEHPRRRSTVRIDGATLPQPGASPSTSLQQLCRPSVSECRR
                     RGSLSASGTHASLRRFSRPNTVEVSKDYLQSVAEAHGVTVEHVRDVMIAAQGDTDLML
                     AILQSEMDVQLASPANIDVLHFGTQETVRRLLLFLELPREWEGEVVRTLNVTNGDAQE
                     AAAILAQKSGQRSISLPNDVTASRQQVLTATEAEELPLLLQRLGQSPNGETRQLQAEF
                     PDRTTDEIRTALQLTDGNMENARVFLREDHTASKNSNRDAISNIFARAAATRGSRPRP
                     DHRKEIEAVYHKLNGAVGISNSAAEVIDVATGEDVVKTSLSPQDFQLYRSSGGGGGCT
                     AAEGADSASRQQPVSRSGSSTPTTSTLNAFAFTKTAPSLLTPDTGASRGSDKAHDLRR
                     PHPRPLSPAMSMTTPPFSDRGTSGTRHPSNATRLNVMRASSHELPSAAAVADMIQHAA
                     LPAKRSRRPSLSREAKNVSTRLAGRLDLPSLHVVRTGGGAAETGSSAAALNDSTSTSA
                     ADSSVSGHSSRRSPPSPHSARVIAPRRSSVAAVNLNDYRGSGAAAEARRADHAWNSTV
                     GSAAGSSGTYFASVAPGSALIASQQLTGQPFHSPHTESLLNSVLSQLGKNTESHQDKE
                     QQRRQHQLSSELVDTTSLRPFWPAGSADNNSTSAPASGVSPPPPPPPASSATAPTAAG
                     PAPPPSLPPPPPPPGYKAGGPASSAPLPPPPPPPGGSGVPSLPAGLPPPHPPGLPPPT
                     GGPKQPPPPPPPPPPPPPRMGNGPPPPPGKGASGAAAPVPNSSTTRNVPINGAVGDSD
                     DAIFKAARPIELTAGARDKLLALFPKAAPKHAIEEDEATSRVQRILDVNRDRNVGIVL
                     KFIRLPIQQIEASVRTFDTLTLGEERISGLLKIIPTSDDFEAIARAQKEHGGPWKRAE
                     EQQLPQAVRFFLMTQRIDHYAERIHAWSLRYELHGRLEYLEQKLSKADKAIDATFASP
                     SLPDLLYFLLEVSNFLNAGSRFQGAKGFPITQLPQIMDFRTTDGKGTLLQYVAEILDT
                     VNPHLQAISSELMPAVDEGRDIDVASIEQELKKLRGRLQKCKHLIEQLKNDVRWTNVL
                     GKFIYRSLPELERVEKLAESINGKAERLQEFLCEKKETFSLNEVLRVLSNFCKRYEQE
                     REKQRLRQERQDRMEDNKQRRQSTVSSTVASHGDLPSQTQPESSSQQRRFSQQPLQQS
                     PQRQSPSLQASSNGADCVRATPDAEFSTSRLRGGASLRASGIAPASRSDGSLGTAEHG
                     RSHPPHSNGIGAANGTEDRTSPPVDRTSSGSTPANSNTGGGYRRRFSNGEVKQPGAST
                     TVVSARGPPPSSSARAGTGTVGGEVLPPVGKSPVALSARASNSGRTHVESARRDARQT
                     "
     gene            <433434..>436640
                     /locus_tag="LDBPK_171050"
                     /db_xref="GeneID:13393238"
     mRNA            <433434..>436640
                     /locus_tag="LDBPK_171050"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859911.1"
                     /db_xref="GeneID:13393238"
     CDS             433434..436640
                     /locus_tag="LDBPK_171050"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859959.1"
                     /db_xref="GeneID:13393238"
                     /db_xref="InterPro:IPR022035"
                     /db_xref="UniProtKB/TrEMBL:E9BDC6"
                     /translation="MNARTTRDGVAEVFERDRVALIMQQALAHRYSHPLSSPLFDGVH
                     DGHLVDSEGYGTATSDMAAKSPSSPPRLTCPLHYTLRRCSRTEYYLRFTPPISDTTGF
                     MESSTAGGSPSVSTQWQPRDDEASVATAVAAECWRHAAFTALTQRDLRRLCGLPEETG
                     PGTNGHRHEPTPSPPSLSATPVTSHPRRSSPPLVTHHEFFEMPSRWVMQSLGEVDQHT
                     FHSYAEWDCRRLVTPLDVGATVVKQAVGAEAVVRGAAAPAPGGDQTASPGGPAASLYS
                     PAQMMTERGGAAPPSSSYLSRTSASSSEAEHMLRRQERFRVRSTAAMARGAYWVDVVP
                     LTAEEECDRRAIRVTASTDTAISAVADTENNSITCERVDRDALLLHPPVALYVDPLLP
                     CDELYSERGVNTSVYVFFLRALQQQQHKLADGRISCDTAAFDSSSDCSGMRPGKGTGM
                     PDPPEAAAALALQLALCARQLRLELAGRIHRAINAANPSSVLLRVPSREVATCAIEGA
                     AVTSAKCSGVAAPAVLLQVRVDHARGSVQLRALTLEDSADSTSDLLGSEWHASGRAAT
                     PTSSAAARPRLQDTETSSAAYTKRRREDAEEGEEAVRYSHNAATTKATRSPTVEVLLR
                     SAWKLAALYDITRSASLEPQQADQGASDESRAARVKSPEGAQMGASLPASLPSWLATS
                     LLRRLTGRPQAVSGLTASGTTDVHSEASCDSSWSTVALHRGDACLPSTMPLAGERVPC
                     LPLSAGRIDHPSASSPPLLLADDDPPTGVPAATAIASTTLTTATTTAEERIFLGRLFI
                     LLLRYRTLFGGHGYNQGPQAALPPPVMEHLAAAFEISAEAFASPLNAQLPQFGSLFPD
                     TDRHFGSMGSFFDLQFGGASGDCHAQRAPIPTDCAAPPPGCHVEVNPPFDTTLLRHMG
                     THLLSCLKRAQESMQSLLFLIVLPSHDLTDAEKAAAAVASTRLPTQAATAKRLGSDQL
                     RGSSAATASVPPSTERTLRESPYCLGHVLCAAAESAYVDGHQHLLQSPFFRIETPTRL
                     ILLGNTVARTRFPHAAAQLESVRVAWKELTESALLQQR"
     gene            <438971..>443749
                     /locus_tag="LDBPK_171060"
                     /db_xref="GeneID:13393241"
     mRNA            <438971..>443749
                     /locus_tag="LDBPK_171060"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859912.1"
                     /db_xref="GeneID:13393241"
     CDS             438971..443749
                     /locus_tag="LDBPK_171060"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859960.1"
                     /db_xref="GeneID:13393241"
                     /db_xref="GOA:E9BDC7"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="UniProtKB/TrEMBL:E9BDC7"
                     /translation="MPGRSGSEAGGVAPSAELGAPLSATGATSARSSSGRSHPLHPSA
                     SASFCFGDAVPTHGQHALANAGEVAHLGRGGGQSQQSCPPTIIDTSATGPTAVGVSSL
                     RCDFASPPAVLVAGVPMSSHVPTPNQSTPATETRSVQLLEHLQQLLQSNVPTAMLQQW
                     VSAQLLQAKSPATVARPPAAVVVVSSSSARPLAPTALPASALGQPTSPRIPGGSCPPR
                     RPAPAVSFSIFTYPHCQTQQQQQQLSPRQGSPLDRVNVSSEPSFTPSTIGCVCNANSG
                     SAPSALTSAVDGGAVALAPAMCSATSVVATVPSKADIEAPLSGPSLPFLAGSAVVPSV
                     ERGGPCSTVNDPLASGAGNDNDSAEAHQRCSGEGLRKTSRLRRQHSQCRSLRNQSSNA
                     GFSSPTAPSSGVWPATGSCTGANMAPSTIILHSKSPSPAGSPTHRCIASALHSATKAA
                     IHATTSQLVAAKQQNISLLLGERFSRHPQNLVRRVATPLVHVGSGSSGTSALSGATSG
                     ATFSQGRSRCERDFSADGDNSSLATANTVLERVEGPTGSLVAPQTRFPSLASAPLKVA
                     EGGAAVAAAGFLARRAPLPSMAAAASASDPARKLPARRLSRAITPPSLLMTAMDVSKS
                     GSSGVSSLQGNGTVSDDHSAVSNAPCGSNDAAAAAPPPLPASAESASIHRCTDSIPSE
                     QPANAEAEAQLKLLLQRDRPSSTLSAVMAARPLTAATEAASGDAPEPVAATEVPDVIS
                     LIAVDTEGASVPCTPFREPSSHTNSSLLSGGDSHQLPRWWGGAAAHDGERYHLPHRGT
                     ILTLPAVNASATPFAWAQPPNMDSHAPGLETSLSQLAPLPSTVIQGTRQASVTPRRAT
                     SLVSNASSHLGCAGATRGHGAATLLDVAGQDSLSLHDDVPSFNSSHTAGMSSIGDGVN
                     GNRLRRFSVLHLSRSSMNGGVDPMDGVMPSFILDDINGAQRRSGPRFLRSFCRHTPVR
                     VTESVTREALRGLGVPFIAGIDQASVPTNVLKLMDAYRFTDSCAFYVAMCLNVFLRYG
                     FVQRFGWNLQKLKRFFEVAATYFRGGNPFHNPVHAIDVVMAAHQWLNEGSTGAALSDD
                     EAMTFLFTAMVQQLAHTGADNRLLGQLKHPYAMLCSYASPQQGATVALVMALLSRPEL
                     HFFPVPFLATAHTADASDATDPAVVKEWTTSRESQVYDMLADLIMATDERNHATLKQN
                     IVRMGEENARRHGCMCAYTHTDRSSSQADTATRLLYPSQPGNFCLNCCAYITDAHVPD
                     LLKAVLHFIDFAYLFRPYQVYLSGNVTYTAEVYRQSQREYQLLQRLQEQQLLRVLTDE
                     ADRERVGEEVLRRRSGAQSPGAPVSAPAVTFATALLAEQQPWRQGVAQASTMTSLQRS
                     GDEAVVAADTPPPSRRVADMTLPSETTARRHSSMRPPLLALDGQLRQQATRMPLDEDA
                     SASNALDSATSTQPLKGLGRDIVLISLEDLCLPFLEQLSPYMPEAWVAASYQNHQRLM
                     KSLPTPEKFDEIVNRLLGMGEETEAERLEEDIKKEGEAEDEEADWLAAECPFTLPWRL
                     LRPMRPIEAEWTVDKDSLVRRVVREIMRGPDQLLKESDAS"
     gene            <447501..>451763
                     /locus_tag="LDBPK_171070"
                     /db_xref="GeneID:13393242"
     mRNA            <447501..>451763
                     /locus_tag="LDBPK_171070"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859913.1"
                     /db_xref="GeneID:13393242"
     CDS             447501..451763
                     /locus_tag="LDBPK_171070"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859961.1"
                     /db_xref="GeneID:13393242"
                     /db_xref="UniProtKB/TrEMBL:E9BDC8"
                     /translation="MGTEDGALHRVSLSTPLLFLAPSSPSADADAAASSVASTAGTTL
                     AHSTTEPAHDTCNLPRSYSRPSGTRYHPQTPRKGHTDVVPSHLVDHPLLSRPPPLSSA
                     EAAQGLLCPPRNGRASATATAPHARDSRPLTFHSHEGGVPSLSTSRWPSTLQAHSSIS
                     LPSSAAGAAAVPLMSSAQPGPSPTMSQQQQQQQHSLLFAVLPTMSVIPSSRSMPGATT
                     EMPAAGGSDSSTPPLVFTAIEPAAADMRSTSGAQYLSQEMQPASRSSSTASVFPHLAH
                     GNGRGGSPARAFMLQQHPFSEPVVATSALATSLLPSRTATPPGIAGSSHDRIAHVDPS
                     ATTPRGTSDAAVVGSDRPRCAHPPHSHPPKGAVVAAAAVASAAASPSRSSVLRHQQPP
                     PLLLKPAEGHHRPGMPPPLPSLSAMSHACETPSRRQQRPPAERRCVTTGGHARQPETA
                     VGGTVRAAAEMMVVPFADMAMLLVVPGGVSSVPAASIAAMTGSSGDAPSWGSDTHADA
                     ALALIEDVVEGGSSEEGRLVAPGRRVGGDDGGAGSAETATEKVVTYFPIQKSVLAQRS
                     AYFAALLDEGSGCGPYVRSTPDEYVDLTSLLPLPTIAEPAEARDAHLCRAGGAGGPCP
                     MTARILSVWRRPDHLRRGPAAAKASEDAEPARSVATAHRQRVPVYYIPTPETVACFTD
                     DSSGARLGRSGAHSRIGTGDPAAASTAPTLSHACVCQLLHYLHTGVLPIFYQLPGRTE
                     VTERESTAAAGIASLQSDALRNGFANDYAAVLWMGLYTGLSSLTSSMLKLLWHFLALS
                     RDVWPYWIAAAHWRVPEMQLICEAWIEQHLCAMLRASTAQGLWRGLRLDQVQMLVSLR
                     KKALDAEAEARAAQASPMASNASPRYLRGRTTTVGGAAAEASMSTTTTTMPSFLREQM
                     NDSDAASNVDDSVSVSEEAAEQRRAQFSLRPPAPPVATIGWPAEVLRYQQPHPLRLRG
                     GSGSDSGVGTPSFSSSQPGAGRVSSVDNPRVSPTTEVVPVLSRDAEASPSRPPLESPS
                     PFALPTPPSALAIPPALATPLAFDGVSSPGAMAGVASAPFSRQSSRASTPLFASSAAA
                     AVRHFRGFSGRPAALRVATTTATPGIPSSAALTFDDLSGADGAQAAEGAGNTAAIAGG
                     ARGHRTDLGGGGESGAMMSGAGLTSRMETPSAANTAVAFRTLVTTGDAAVPRSEAADL
                     PTLAQANIPARANAEMSRTTPFRSPLTTRGVHDLFNDSRAEPCSPSRLHVAYPPITSA
                     NAYYTTPPNGVAIQPTLQVLADGAWAIGGCGRLYTAETREELDKRQAYWYRAECEQQQ
                     QLPSAALLTETEVLERLWTWWRARTEDSSNQPTEMEVRAVVEMLQKVRLSDAQASLPC
                     TSSRDDSAYDGFRALLDEEQRCPVASKVGLPNAAAATVQPPL"
     gene            <453441..>455666
                     /locus_tag="LDBPK_171080"
                     /db_xref="GeneID:13393243"
     mRNA            <453441..>455666
                     /locus_tag="LDBPK_171080"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859914.1"
                     /db_xref="GeneID:13393243"
     CDS             453441..455666
                     /locus_tag="LDBPK_171080"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859962.1"
                     /db_xref="GeneID:13393243"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:E9BDC9"
                     /translation="MQPPPKPLCDLNDTWEDVLTAFNDCLKGESTWSCHCLDGIDKEV
                     ILSAPEIMDPKTDSGFNCEEIYSLSHLLKTEEVPSAATVSTEAALLDVMDYIHVKELT
                     YLQGYSLTQSYLDFPYFLRMDLLKEQNGTLHAYCRGVLRSLDCVLRAVFSTTNRSEEE
                     FMLVPPELDRQPDCSVDEILAELETAAAKSSSPAVAARLRFRKHFLAALSLLLDSKKR
                     SDIEAACDICQEALALLESGLYIRSSEPAPEAKLLRAKEIAYWVSVITPTKALPATSF
                     ADAMSAYKRLLQQLMSFKTLVNMESLACIADFIENFGALQPLLPARSLCAVVLFSRDP
                     NESFLYGAPLHRRTLETLTRRYGAPLYQKIFEADEAMVDGVVEYRVKCTMNRLKVTPE
                     QRMLLRQQTIDSVRRWVMEVSKLYLVFLETMLCNRGLAHRRMMNTMADFIRLQELSYT
                     TDLSVFLANMPGVSKELEAECIRCSTVLTLFSNDYVLRAMELIMSFEVELDLLTQGEL
                     VPAIWYINFAQRAQKENMTALCLQSTNFIPATLINKRTHIPVHNLALTTRTTGQMDLA
                     RDGLLDACCSLSDATYLSACLMERKNLIDLASAPKGSLISVENIFNHRLLLCYGQLRN
                     PPLRSYERCMSAKPSLDDVSKIPIYAKKAAEVASNAAEKLKAVMSSSAVDEVRKAAIR
                     RNAEGLEKTAHIVAASLRAFSAVCENSEELKDYCAAVERPGLPSALTFTFRKRKETAT
                     A"
     gene            <458563..>479592
                     /locus_tag="LDBPK_171090"
                     /db_xref="GeneID:13393246"
     mRNA            <458563..>479592
                     /locus_tag="LDBPK_171090"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859915.1"
                     /db_xref="GeneID:13393246"
     CDS             458563..479592
                     /locus_tag="LDBPK_171090"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859963.1"
                     /db_xref="GeneID:13393246"
                     /db_xref="GOA:E9BDD0"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:E9BDD0"
                     /translation="MPSRLAHITTHFFNLPAAQDEPTYGTMRPAQELTSSTTLAMGGA
                     TGHRTTGGPLDGSRLMAAMRRGGIASGGGHIYAAGATGRPSSSASSTVALTPLLSPAS
                     PTSSVITRWPTFSVSPRSSGGGPRSWTALTKARRALEDSSLGSPSSPVLPSAGAGADV
                     VGIEAALPSLPTWSADARAWPASAGAGVAGKEAASGVAGLVGSRHTSPRIGAAGHHST
                     LHSATVPMSPTGKLSPSSRWGPAGTAVGHDRSTEGISAGASGRGGDGVGGQGGLHSTL
                     EDSARTLVTEADGDLLVPPLIHFVEDEEVLRYVAELLNRRRVDEVASAVEAVEHASAE
                     DLSVPTKGLSRAVVLQRDYVLSASQSKSLHALMMPSSGAQSTMGHRRAYPSTLVSASD
                     ATRNAMKGAVVGDDVGAAVQGRDRSRAASLGPQLHSRGEEEAAAATMRSANTGSVDTG
                     SPTSPLAATASSLYLTALTRPLCDTGSSGVYLSCTSSGDAAASNHSTAQQRSGRSRRS
                     LDATKSGGSASAAAASSAATAALQRADSASEGRTAAADAAMASAPPIDLEGFCLAVRY
                     NVFANYRTLPVHCAQRSYEQLPVRYRAGLDAISADVLQQQQHRDQQQGSTDAVSASDE
                     VANVAVSTSVGSGGAANMGHPRGRRSEGSSAGLSAAAPGAAAYVAEGCHDSVTFIGMG
                     YYGAGGRGGAWPATMNLSGSIGAASTATTPAASPGWLSRGGSMCLDTSVFPSLPSCSM
                     EERAAVTIASPVSVPTTSTPGGAAAPVPAVSPLPSSSPTSAVTTTSATIGDAAAGAGL
                     VSRVAPLHHIQQTIQSFIARGEREVALHFIMATAPYRFSGTTDSDRVLAFFNQIRFFL
                     PSPRFGIVMLAMDAWRSLYRPSVGAGAADCTHMTLELLALIETYLCHGRTYAEYVSGL
                     LMLRAVLALAMENSTLCSRTAAVLLQHRSLLQGRLPTFLLAVWLILMEFYTIDDTLLP
                     PRRVLRDLAANAMQDLFTVALELHMTLPVQNVVANAVNVFFAGPQPQPQLGLSPLVAA
                     FSGGDEVSVDVGHRGGAEASNSSSGNANATAAAVKAAHSLYSNAASNAGKSVDSEAVM
                     LPLRTLDVPAAAVGAGVGVRGSGAPGSGAARSPSLSRATPSIGKAASDDTADTAAAPL
                     PPHRVPGADAASAAASASLSRDPTESSQSAMRTRVVTPASPAPQAPAFSYRAVAKSMW
                     VSVKRAARRLAHSTSVPSPSPALAIAAAVDGRSDAAEAASATKDAIGGTPSLFSAPPA
                     FDLPRRMASARTMAANRHPSPPLLVEVLEDIFRESMEADLSEHAEAVARSTGSVQQQV
                     PLYTTSAAAGSRWLVQSSSSPSSQVARRVSVTNGTAAGGRGTMLSPYHALRQSSAAGS
                     PLLRPGSWAQRRQQRRSFSVTPAAATTLGLESSSAFSDPLWGDIPFDGTVPNRDALWT
                     LPLAHALRAAGRPQTLEATVAASTLTLGAFLCAWRIAGLSDETDSAGSRASRHSSGMA
                     TATAASLGANPTEVSIVPSGEPPLPLYFGPASGGAGAGDADPFTEGVVLPLLTPENLV
                     AAAGSGVPAGCRDSLVEPVSLPYPSPATGNSTAMPPGVGASSGAFGVSTGEPEKPVPM
                     LPTTISALASRTGASRCRGRLLASTATDADPEWQSVESAATNVYVPPVAGVAPPIVRA
                     SGAATRAARDEVSAATPAVSTDMAALLAVPPLPGPRVSPSLHVAQGAVATAAAARNGF
                     DNTSADHVTLAGLPATAAAAVATPDAAFSHSLGCANEIMQGAAGLVGSATVAGRQSGL
                     PATIPTSTGGLCRARVFPTAAADVSVSDDSRSQVGARGANDTARLTMAAPRPAMGTGT
                     ADGRPNVAATVPQTPSLSFFLPSWAAARVMERCVRPCRDATGPATLSSTADGARAATR
                     HTSAVAVTKEAEILLSSVVPILSQYYVDALPASAVTAATQVLVNRAIQSVKSLSQGLR
                     DCSSRLGANSRGGAPTETTARASSGGTTLPSSSAPPESDVAPRDSDMGAPHNGAEPPA
                     SSPRAAAPTDTASAATTATPSTPFASPFSAWPAEDSALVDGTELLNAILFMTTVAERY
                     PAVYERMINQRLYPLLHHILLLHNAAVEEPQLWLSMPLSSAAVAAHFNVGDRAAAVLP
                     VAPQQQQQCNSQSVTPPTPMEGEAVIQRMRLITARAMYQRLAMPALVLLSHNMPDDAC
                     ARRCYPLVVRLAQLGLRRPFSMASVTTALCICAVYPPLSRVCQSELVRAMAVVLATPD
                     DGLSDGDDDGADNTAATTASREAEADGVRVTHHSRRVPLQARHEDEPRGTREEDAIAN
                     KPAGPTRGAVLSPRPLPMTAATAAVSQALLPRPSSRRAAPTTAVAATGSAAHPMWRSR
                     LNLQLFFPFSTNVGHLRLSAASVRAARRRQAAQTRLIKHHCFRAMSLFYSSWEGTTLF
                     FLEVCLPYLWHPDAQLRLECVQCCMRWLLSDCWHSTDQTLLHHHAATPTASAGGVDAA
                     PSTALTSFHGIVTAAVTRAPVRDPRTTANSGSSAKGGVHGTTALRCLTTLSTPAPTQA
                     GQVRVPYHAPPRRTAEALRNGVSSGFDEGAAAGPAVPAATTRAPAMSICTVQHHGRTH
                     VNALREVVHHLVELAVCDPEPLIRKCALESLSPETYPLLYPHEPFVHQLFTVLWDSHM
                     PNRSRAAQLLCALAPLNPSSIFPRLRQVLVRYTEDLTNSIARLAAPSLPAKSTSAPLS
                     VAPPGHIHEDALFVLFQIASRLKQSTHLYLPQLLSIVSSVLRSGSSPRGSVLQALHFL
                     VALREDSTEEQSALFAPFFDLVAQQLIDGDGDTARLLATVAALQSLLQQFSGSAHSSS
                     KTLPMVVERLHSLLYRKPSVVTEFAMAVLQLLGTISSIEPWDSEAAPRAPALLRRPQN
                     RYALPPLSSSAGVLGRGRAVRSRWLDRDERADSAAEALAQLQKADRFAPFTARAWCDT
                     VLRALMRTVSEYVNGTMSQTQGGLCTCLAAIMNILTNTVAIHHLELYLPTVLTLVIDL
                     LEKRQTRWRNVETAYQSAVGPAEAGKINDSSEAIRQLFLRRLFDLVLAAGRRIGPMYP
                     LLNVFLRRSWKTMSPRGIVQCCEVLDALCWAVPDLLRDDCDVWIPSLLEALIQYDALV
                     VTHRRAHEGVPDSAPAAANTSTGAAATGTAAGTSVTPTESEETPAAPASTSRNFSASA
                     NRMSPARHGSVAADANDSSSSPLKKPHKLPQSLHRAAAADGTEEAPWEQQLKLVYQAL
                     TLCLTSLQPLVPPLAKRFVAVSLSECLKSSHVPRGEAVRRTAAPPAAAGPTDGRTEQG
                     SGFDADYSATLATSTRSSLQSLWPAAGATTASAVFDLMADPHEELISFLNACVCRPLL
                     EYMVHSNLSSVSMKLVKNLLSRLESLSAVHEEALQRLWGAMSRRTASLLSQPESSRGL
                     SWMPDAASGTATCPDGSVGSLAAPARAQLEVKLREARELLHLQRARQHEEGGGSANAS
                     GCGAGAFSSLAAFYAAPRSASEALWFNNAALSRMWVQSADRAVTVRRYFPFDAVHTSW
                     ETEGEVQLLGCLLVSAAWHHPPSTTAFATTLHTYFAQRFGPDSVAVAYVRCICSSYYN
                     LCMPLASAHDEMAVKWAEQQQQRVATAGSGSDAGAESDTSLTTATRSAVMRGPGFYDA
                     AGQVTREGSADIILRHLSSPVAQTAVATAPARRNAAASPRGGAALSGSSGMGSRAVSW
                     EEDAPAPAITGGEGTSAPSSAAATAFVGASGTRATTRWAQGNSVAASLGSVLTTTAIV
                     CGDSTNDMALARPMTAYPSMERLDSSSDGRRSAEMNTTVRFSDHDEDQDGNGRTWADS
                     HYAHHTRSGNGGSAMPHRPHISYQQLNANQLHQLQYPLPTRTATSTPFCGPNSLPRTI
                     TAHSTNGADTSPSTTHNHSPTIATLAIPVEAGAGGSLDNYVNASAPVGVSGLRSGSGS
                     GSSFYPGSFFTSAVVTEGRTGCDAGACSGVVNSSPHRHHPHASLGAGDGGSSADAESV
                     YGRGSSEAVPPAHASVGGGTGAHLTTPICRPFQLPHPQLFPAGQSYGPYPISSRASPN
                     VNLGQQPAASPSGSAGMLSLGSFTAASVDYPRGFLGLSALAFSPVGGAGGGAHGAAGG
                     PGGIPPRWRFASIAASVTADDVASPNSFTMPPAGGGVGGATLSFTVAPHDAAAVQQQA
                     CRRLSPLVSHPPLHHHLSCGTMTPATATMRSRGGSGNDLSGYQLQPPPVQHAQKQPPP
                     ALLSPEASATSAATWTAAAGAVRSTSTTATGTPPLRAETRIFTSAVQSPSAATQMDHD
                     GSTSPAAEAASGRLGKEAATSPCVAREMSEACAAFASAHEAGEVAHNNSLIAYFELHR
                     SISGHGWRSWWEQFCLYLLQCSPDYCIQACEPFARQHHIAFSYSELLPLALLSTLPSC
                     TVAELVAWLRALRDFYAFHTDPSAPVPQQVASGVARVAHDIRLYHRTFFPPEVVSRVV
                     DVWLPESVVAELANRSLNPPLRILYLEQDLTRFFSWGCTALLMVSADDVASALERTLF
                     VQDPRFQQWLSAAAATASEMRSRGRAVARSPGRRRRSCKAVMRLAAAVAKSSSSIIDT
                     LTPSALELLGFHRAAALEYVRMYEEQQLSERRDSRRGAAAEEDEAAQFSPGPTSKDTA
                     TRHHSSAAAARLIVGAMRCHICLCDFEAVLRLWEAVKGRGAADATTSMASSSPSADAC
                     SEASDGDSGSAVVWDGCRRASSCVLSPETARYVVMSAQALSRWDYVQEAAHYAFGRGS
                     AGGLSWTASAPQEAQGHTPKSGGPAANCAVTPQMQRLQQPPGSPRWAEDVEEEGHAQQ
                     FLDEVFSSDLPSVMGVTVDHRAADHTRESLLQRQMEVFVGAALVAAHDYDGAKRALTA
                     VRDGLRDSYAVFHSDNDRVKLEWSSIFQQLSDLEEGMHALEQVPAAQEGVAAVPTSTE
                     SGGTSAAWSGARLPALDREINGKLFPEVTVRRLRNITCRPVSATTTILQLFMIIAVRS
                     AIAPVTWQLDNVLALGERLEKAGQPMRAVQVLHHYAHLPVVATSFTATAMEFKQQLNL
                     EMLRRLIRNLSSEEDLREVYACVQTALRNDLWLARRAATRRMSAVSPTSSFSASPSAA
                     AALSSWPLRNQLAMDAAAPRGSMLTAQELGPSLSHYQVDLLLLNVACRRRLAHVLLHR
                     APLAHRPSPVAVTSATSGASAPLADATVSNSTPSWTSDAVRHPTNMFSLPMDVDRTLR
                     RVATDVVEDEKATRTDSHSPASSSITHQPSDFPATTAAPLSARSGAGSTAAATNCTGD
                     GASCRHDSAESGRVGRSDTSPARERRAKMDEAAATAMEEPVEAKEEGILSLESVTGKT
                     AMFAEYYLLEQAVAVTCYVPSVWREFGLVLFDVCMAIHAEWRSTGDEETKQNFLAQSA
                     KAIHGLQRAAQLWRSQSESVFSRGIGPFPATMLRRHGHARTALPSAHLLLKALHLAVT
                     CEVIVQDDARAAAASATEATTAAAAAAAVVVTPSLSPAPFSASSPAPRPSSLGAGSET
                     ANDAEEAVAASGTGGGGRTCSAFTTPRSLSASQRTEQPRAGACEAGTTEGTETENSRD
                     PTTIENSADTTVQPSPHSASQPQPAAAAAVTEQQGGFACLDFSAASYLQWAAVAPFLL
                     AAATRHHSLYAALRDMCVQSRDMLRQLVFPLIAMFEHGYGTMLAQPAGHPRYHRASTA
                     EEAPAATASRHLTSTFVAAGSGGQEGGRRQQQRKGLKPSARVFEGEDGDEHVSGVSCS
                     NSTEAPSLLEHPGMAEGDTSDAGLIAKRAARTSAIEVTGRWHKGGRRAPRAALTMPLL
                     PTRAGTADGEAATLGGPTASYTVSAPHRLMSPLEESEREVYSSLLADIAAASPGHRRL
                     IHEAMQMRTFVQGLWEVPKAASQRRNSLRAAMRQDGMDASLASSGVVEGAPPPTQRPR
                     EAASSGAASHGTTRAKGAASGFVAIDDAGGMHGEMELLLDGFCPLPAPLWLLPSVFGV
                     GMTAGDAGGSSAHNNTGGDEGARAGKAHSGGVGPGPDAATLGRPHGGQSAGPTSPAST
                     APATRTAGYCGARVDDGGGGVAGLPRPSAASLPASATAAHDQRAAHSTTTSAVSFAPA
                     TVPTIMHVRRYAVLKPAPHHQCEEVIFVMLSDGLVCRFRHAAPAATTKSGEALGACEP
                     PHGATDCASVQLGQSRKSGAASVGAGAKGAPTASGNSGADRYLLPCALMEQIASLLLS
                     HLPLTHLQRPFVLPLAVQDYMTMLPEHRTSPLILGAATAASVRSDDPQGWRHDMALLT
                     GPSSGSSAAALRTATQLLAWSSDATRTPPSLYHLMDDYTVHLRVREMALAAQEAVEAY
                     PALDLDAMQIAAETGRRPGVSADNAYPFNWAYGYPASAPPTDEAAAALTSSHRYRDLV
                     QRRRMNEGRFDQLVAAAYDDGCVGPLITFLQGMLAARPPPPPSPSPPAPATQTGAAAL
                     TNTASTTATTTSPFSASSSAPAPQPFRSPEETFSMQQRLYAYAAVLPRTEAHLRNVLA
                     AVSAVAAGGEDNLTKESSTPSSSSSPLSPAVSPVLNTKKRHYGHRQAFTATQATPLSA
                     RELQACRLALFRLESARCRFALNDAFSADSSNASHWLEARRTYAKELSEWSVMEYLLD
                     VHTRECGTVLVNTYDGHVAVHALGRYCLQSPPRQSRGACAKEAAMCAADIAPLIVSPF
                     PTHDATLFRLTPVLVAGLPLQSAHAAFQYHASSVLYEIFQYVRDLTGIATYGVDCVTA
                     FAHAAAAPHAAPSPSLHTSSTDTPLSTCRSSDFSVNASGDLSAALPSRRAALRPEGNR
                     ASTSGSVNAGAALEDAPEPSTAAAPRRAGTKVAVASTKRQREAPPPLEYLVSVPATVA
                     STAPSSAFGAPPARGVAPRHPNSPLDDAADASTRPLPPRCFDSSSFRLKLSYDALFAL
                     HEEAERRGRATMLRLLRSQREATEAQWLHVTPTSPSRDGDDGNAVETKPSAASHGATG
                     AKVGRALPSPLSNAADDDDDSAPRPTSAFDLAAAMITAATDEENLLGVDGLCPHTWRR
                     WAPHW"
     gene            <480339..>482531
                     /locus_tag="LDBPK_171100"
                     /db_xref="GeneID:13393245"
     mRNA            <480339..>482531
                     /locus_tag="LDBPK_171100"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859916.1"
                     /db_xref="GeneID:13393245"
     CDS             480339..482531
                     /locus_tag="LDBPK_171100"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859964.1"
                     /db_xref="GeneID:13393245"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:E9BDD1"
                     /translation="MSSATSSAALQFSRSSARHMVRQLHHRVVEQRQAVMECRNRAEA
                     MSARDTARSGRAGEAEQSSLPCFADVAAEKAVMQSFIPDGLLSGIAVAVSDALDVQEF
                     YTSSRLCTPMHHDAACKEFPLISWLRLHGAQFVGKLRCCTPFALSEGIVFGPEKPASI
                     AVTEHACDYAISCSLNGPPSVLCAVHHDMVGFKPTSQTFGTFTERFELAVPSMTVGLS
                     ARCLDDLMYLWQVYTASIDPEAHFEATSAKRAKSKTSSTAVSTSASSPPSAPMHSGAS
                     ASAATAGELTGEYSTASVAGDVPPLPALSTTAAPRGGDPSHPQASDPPARLVQLISSW
                     WSGKAAPKVKHPDDVPKYSNPDILDHSPYNYTVRSRSGHIADIDVGWCDYNAEAAMAA
                     DFNQPSRPGFLRRLFTGAQTYEAPKVELAVGYPAEWIDQYCTNKYTSSAEFHQRITDA
                     VSMHSALHYNQKLEIVPLAFDFSVEEVMEAVTVISRYELAKAFERLVAPATAPAQADE
                     DAKSGAVHEQSGNGDNDKDNLTVSSPGKALQLPVVPGVEPIALSGGDAPGTNRPHLFV
                     GLSGTPEDLPASLADSVQAGQKLSVRDYHRALRVRDDVVRSTEEQFMDVDCFVTPLLC
                     DPYTSGDVRSARLMLPFQLAGNPILSVQVDPQTPVAMVGELGRDAALMEDAFCFLQFV
                     RGASPSLWHEKVVEESPVAAPGADKGGQAGAAEIATRSQPGGSAALTT"
     gene            <483621..>484631
                     /locus_tag="LDBPK_171110"
                     /db_xref="GeneID:13393244"
     mRNA            <483621..>484631
                     /locus_tag="LDBPK_171110"
                     /product="hydrolase, alpha/beta fold family-like protein"
                     /transcript_id="XM_003859917.1"
                     /db_xref="GeneID:13393244"
     CDS             483621..484631
                     /locus_tag="LDBPK_171110"
                     /codon_start=1
                     /product="hydrolase, alpha/beta fold family-like protein"
                     /protein_id="XP_003859965.1"
                     /db_xref="GeneID:13393244"
                     /db_xref="GOA:E9BDD2"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BDD2"
                     /translation="MMSPEITETDEAENMPRELRGKGKPMPCDKFVRVGRCHSTRKEV
                     IICYRTLGDPSNPCLLLVIGLGGTLLHWPGEFLAELLKNGFYLVLFDNRDSGLSTHFD
                     GYPTPCLPCMIFQSWSPLCGGAPPYTLYDMANDAWCLLTALGIGRAHLLGTSMGGMIV
                     QCMAIEYPKRVCSLTICYSHSSGPYVKPQACRVTLALLDKPASLSLKDVEDYVVRSDC
                     LFRGDYPLDEAHVREVAAANFMRSPPYKSGLLRHVWAVQRASNREPALRRLRGFPVLV
                     VHGRKDLMIPYENGLRLACVLCNAKLVLFPQMGHSIPRPLYVEIAMEVGLQKLRMVNV
                     PL"
     gene            <486703..>488619
                     /locus_tag="LDBPK_171120"
                     /db_xref="GeneID:13393247"
     mRNA            <486703..>488619
                     /locus_tag="LDBPK_171120"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859918.1"
                     /db_xref="GeneID:13393247"
     CDS             486703..488619
                     /locus_tag="LDBPK_171120"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859966.1"
                     /db_xref="GeneID:13393247"
                     /db_xref="InterPro:IPR021067"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:E9BDD3"
                     /translation="MPDYGQVPSLLKRPLRMPRRRLSARRRQALIAFIAILCLCGLPF
                     MYFFSTSSATALGELPDPREKPWITSDENSTRFEHIVHGRTPGTAWRDPRFNMIFSFS
                     KSGDVVHVTPTNYVRHRRGSDDSPGTFRKWESIYQPSDKYRIPAWATPADRDALHHAS
                     IFTSLAAFRDHECALTLRNLFDMAVAPHRLYVGVSEERSPSDASCFSSIGVDDLASGE
                     TRRVLYGAEAPRTLGLEVRSLTWADVVAPRQLLDVDAALSVPTDGAAEYGARPAGVFL
                     HPAHAGERVTCVAGELETARDRLLLAEDDARQGMDGGSVFRRGRGGPQQQPSRALAGC
                     RVTTRVAESAFARGPTFGRYITSLFFFDQDYYMVVDSHTRFSVDWDMKLITRVFQLPT
                     RGVLSHYPNGYREGHDREEFDKKIVMLMCTAQVLSNGMPKLGARWMKLSPHPVLQGFA
                     AAGFMFGDAQFMLDTPFDPFLPYMFDGEEVLYSARMWTAGWDLYGPGQPDVFHHYGRP
                     NTPKYFGIMTPKEAARRVLSEQRTLYMLRRAHPWIEELVRRGYVSANGQSTLKPLPLE
                     EAPETRLIVTDEVAAETREISVWAKYYGMGTERSVSAYWQHTELSDAFVKAKDEENRW
                     LGGFGLCQKGGAMA"
     gene            <491505..>493973
                     /locus_tag="LDBPK_171130"
                     /db_xref="GeneID:13393248"
     mRNA            <491505..>493973
                     /locus_tag="LDBPK_171130"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859919.1"
                     /db_xref="GeneID:13393248"
     CDS             491505..493973
                     /locus_tag="LDBPK_171130"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859967.1"
                     /db_xref="GeneID:13393248"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:E9BDD4"
                     /translation="MYGGYYVMGSGMHQGGGYGGGPMMQQQQRCQHPQLQQNAQQPPP
                     PPHVQARLRGSGRGVPPGHPPTVAGGGSPGQLNRNPSFMMMYNDRNFGQPNPMLQRMG
                     SFHSMGSTGVIPRFGSFSAHGCGGSQPQRRGSFSSIGTSAGSLRRVNSGLNFDYSTGS
                     QVHRGGPLMRTNSYGSMHQGGGSFFGGSAAPSGGGRPLQQLSRQNSTLCSYSYGSFRQ
                     PSFTQGNVHNGATGVGPGVSLNSINGMLKLADSGSSSAGSPSTAAAPRGDIGATVAAG
                     VPLESLAPGLARQDSARSLQRKYSISGQFYNYGSSNNNGGGVDQCAAAPVLQHRLSQL
                     LPGGGPIMGDGGGMMALNALTATIGQRGGAGVMTQQRQHHMMMQQQARMSAAGDGSGV
                     AASDAPPSKGTSENTTVAEGQPQVLGRKNSVQNLTRKNSEKRVGMYFKNRAAEQDGVQ
                     YKKDGDPGTSGKNNSGERDPSLTNTLKASLLLDTSGGRSPAIEVDGRTIRASKPGAEE
                     VQKYDMRDIMYVNRNTDVQLSSDSLEEMRDNFLYGCNIGMIMADAGFSAARPTEWFTW
                     LALKSVVKGSFGKLASTQFEFTVSVCLLQDDQVMDLLSDPPQRFMNLTVAESPLFGNV
                     ANGMVYVCVEDAGEFNDVLDASLHCAQEHCSPLAEEQGIVLCTCVLKQVKTSQSSGKE
                     DVIVSSIFASGVGDGVIHYNRIIDKNPAEPRALFYSVMHRSVHSTALFSCAMHDDEIF
                     NYLATLQRFSKIETRRPKVGSARAFVAYGTSTIPRIREELKETKDARQRAMMQRQLEK
                     LELMVVDAEDMLRSPADCVPKTYI"
     gene            <499767..>501062
                     /locus_tag="LDBPK_171140"
                     /db_xref="GeneID:13393249"
     mRNA            <499767..>501062
                     /locus_tag="LDBPK_171140"
                     /product="hydrolase-like protein"
                     /transcript_id="XM_003859920.1"
                     /db_xref="GeneID:13393249"
     CDS             499767..501062
                     /locus_tag="LDBPK_171140"
                     /codon_start=1
                     /product="hydrolase-like protein"
                     /protein_id="XP_003859968.1"
                     /db_xref="GeneID:13393249"
                     /db_xref="GOA:E9BDD5"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BDD5"
                     /translation="MPGPAAPSTLSPPQRVAVLRPRDQFAEVGRCHSTGRTIRLCYNT
                     FGAAKDPCVLLVMGLASPGLFWDDRLCTLLAHSGPYHVIRFDNRDVGCSTHLDDCKGS
                     DGALPVGPASYLRYAYAALRPGTRSIREVYTLNDMAADAFGLLDVLRIRFVHLVGSSA
                     GGMIAQCMVLAHPERVLSLTLMSTHSSSPHAQWPGIRDIMSLISLVPKSTSARYASRI
                     ARATSAEERQRLCAERDAERVTAYAASFTKLLEKMSGDRGKYPFDHVAAQRQMTRIFK
                     RSLCVTGGPRQFLALLNAPCRDDALRQRITSVAPMSQSKAGGNKNISRHATSAVTTPF
                     YVPTIIIQGDCDPLVPASNARHLASVIAGSRLYVVEGMGHTLIPALRGTYIQIIRDNV
                     RAGEAAAQSLGRKAQQTAAAAADGGLSAKKQPVKAASRL"
     gene            <501927..>503099
                     /locus_tag="LDBPK_171150"
                     /db_xref="GeneID:13393250"
     mRNA            <501927..>503099
                     /locus_tag="LDBPK_171150"
                     /product="hydrolase-like protein"
                     /transcript_id="XM_003859921.1"
                     /db_xref="GeneID:13393250"
     CDS             501927..503099
                     /locus_tag="LDBPK_171150"
                     /codon_start=1
                     /product="hydrolase-like protein"
                     /protein_id="XP_003859969.1"
                     /db_xref="GeneID:13393250"
                     /db_xref="GOA:E9BDD6"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BDD6"
                     /translation="MPQHNDGGYVVVSDGSTSPHPQTATKQPTRPEDMDLPPAILEEL
                     SRIFPRPPDDAFVHVGRCASTGKDITLCYSAFGDPSDPCILLIMGMNATSLMWDTRFC
                     GYLAAAGFYVIRYDNRDVGLSTHLDEYPSPFILRMALPTWASIGEGSLAYTLEDMAED
                     AVGLLKALRISQAHIVGCSMGGMIAQLLTLRHPDMVASLCLHSTSAGPAWPRASLLMN
                     ILDQPESTRDVHSVLDYRVRFFKAVAGDMTFHEREFRLGMWFDFARAPYQGGGRRHLA
                     AIVRSKDRSAALKAHINRLNSTMTRGSERGSSSLPASGTTPSRCIPVVVLHGGKDPLV
                     VLSNAQHLASCINGARLVVFPKMGHYFSKEMYRAIADEIILNARTDATAMMNAFPS"
     misc_feature    503422..503463
                     /note="Short protein (LDBPK_081310, CBZ33263.1) was
                     converted to a misc_feature."
     gap             505953..506051
                     /estimated_length=99
     gene            <507063..>509444
                     /locus_tag="LDBPK_171160"
                     /db_xref="GeneID:13393321"
     mRNA            <507063..>509444
                     /locus_tag="LDBPK_171160"
                     /product="hydrolase-like protein"
                     /transcript_id="XM_003859923.1"
                     /db_xref="GeneID:13393321"
     CDS             507063..509444
                     /locus_tag="LDBPK_171160"
                     /codon_start=1
                     /product="hydrolase-like protein"
                     /protein_id="XP_003859971.1"
                     /db_xref="GeneID:13393321"
                     /db_xref="GOA:E9BDD8"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:E9BDD8"
                     /translation="MSGTTLSAGVPGQSEGAANPHSSSLHAPRSDAGASGGVAAAAAT
                     ATVGSACPGGEPRKRRPPRVPRTPEMVVRVRDCPASHMQIEICYQCFGNPDDGLPAVL
                     LIGGLNMQLTAWDESFCESLVRAGFYVIRYDNRDIGYSTKIENCGKIKAPMLLLPGRA
                     AKWLGEELPYQLEDMAADAWALLDALHIPCAHLFGISMGGMIAQLAALQAPERTISLT
                     SVMSSTNAPDLPQPELWVKLWMLRRPPRNCTVDELLEFRVHSLRHLLRYALPPDGEYL
                     KRRFLMSLRRSSYAAGLVRQAAAIRRAAGRDALLQQLHVPALVVHGVHDVVVPPMSGY
                     RTATMLPYARLLVLKSMGHYFHPAFFSTIIAAFVDMAASTDPAKRYLRPALPSASAQE
                     LPITGGDSADDRGARGKSASVEELGAGDYEDEPSGEPGDAIDPKTRMMASLGEYIVPV
                     VADAESPIGKAVCRSVMVAIPGGNSNPAVPEAVIVENLFQRDPYATVSVPTPAIAKRP
                     VPSSSPQSTKQRAATAVSTGDGLMIASLQDARRKVQSSSSRAAKLRSSPPPSRMEGAK
                     PFVSCSPSRWHELEPFPQRRAAAAAVGGAGTAELSGGGRPSAKKTATGLPGSSSSASS
                     SAAALAVETPACSAGKGAGVAEAPLWQRFPRFHPVVVGVTVEEYLRMHPTAQKGSGIT
                     PATAAGSTVAAGAGRASETAAAVQANADATLSVTAANGAAAPRDAVSAASPMVPAVSV
                     TGGGVGTVKAAHGESASHSPASSVPSEERRADEAFLHSEAPQDVVKASSFTSL"
     gene            <511498..>513084
                     /locus_tag="LDBPK_171170"
                     /db_xref="GeneID:13393253"
     mRNA            <511498..>513084
                     /locus_tag="LDBPK_171170"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859924.1"
                     /db_xref="GeneID:13393253"
     CDS             511498..513084
                     /locus_tag="LDBPK_171170"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859972.1"
                     /db_xref="GeneID:13393253"
                     /db_xref="UniProtKB/TrEMBL:E9BDD9"
                     /translation="MPDTPLSDTRAHHDTAVEGTPPIAPAVHVNGRPATPQHNQERHQ
                     RPFHTADPQPTAPDAGAAGAAMPDTPGQWRLSQMQYPGLHLEQRPSRFLTSTHNVDAA
                     VPRMTDHMLVNAEFSAMQLLPERRVELPSRDTEAGGGVGRTGPEAHLQQRAIRNSESE
                     AGIGWHDAAHLTPLFRAIPPVTSTSLTGAAFLQQVRIATSEERRVRLLFHTRPRIRLR
                     DRPRIVTNPVLDRPGWVQPLCYPTLWIPCMRNTIYSIPLSTVMRAPWETDFFGSAQPS
                     VAFSASETSVLPGEQPRPDFSGAAHGGSRALGAPLTTAMPTAPAFYHVPITAPRLAQS
                     SAHNHRADSELLLHRMPAPPSLNPLSGIGERAAANSHGELLISSIETASRPVRFAHNC
                     SHLLYRCFCVRCAIASQMQALQADAEIRGAKMTLFPSCTCLGVESESHTEILSTLCLL
                     DLFTLGAPFGCCCYHGLGSALYGWHLRYMLRARYRIFAWTSIDLLIMCCIPGLALDQQ
                     GAELLLNGTPEATVGLQFMA"
     gene            <515346..>517577
                     /locus_tag="LDBPK_171180"
                     /db_xref="GeneID:13393252"
     mRNA            <515346..>517577
                     /locus_tag="LDBPK_171180"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859925.1"
                     /db_xref="GeneID:13393252"
     CDS             515346..517577
                     /locus_tag="LDBPK_171180"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859973.1"
                     /db_xref="GeneID:13393252"
                     /db_xref="UniProtKB/TrEMBL:E9BDE0"
                     /translation="MLFSATRQLLALRAKQRATRAAVLEQMAAYEAARHAYETAQRQE
                     AELRAMLRAAEARTTQLLQDFDDAEAQLRKTTTDLSHNQFLCHSLESRIAEHVRCQRS
                     AVLLLAPPSSSISQSSAPPRLCHMDPYSLLHTPTGEAFTYDLVELSSCASADQAVGML
                     SGGESDDGSATEGRNDAADAAVGRSNDEGDDIDAEANQLPNSPSITSLLTEAVRDALH
                     GYHYTLLCTSSGGCRLCAHDENLTNNVCPGTVPSTSDVPAAAHGQPSKHWWTCQPASL
                     CLRLLQLLQREAARSGIRALSITVAAGCVDEREAAHIPGSGVTTRTASAKASHRAAVA
                     CGWTDLLLPAAARHQQVTVSMEAAPSQEGEETALPSMMSDVRVMRGTSGGSAGVGSWL
                     EAACTRPNDRHILLPSTPCAAAAKGAPLTTHAPTLEGVPVGSIEAAAFWLREAGLLST
                     PDTSNIPKDRAALQSSTATSTEHVDAQATTAASSVVVLLVGVDSQDATGKLHRSLLRV
                     VSDTHFDPGCFASARPLLKSGRGGINADPPACCSPSTFALYMSHALGAVARAAAEKTP
                     DAPDTGRSATQVNGEHDGTAASSPVPMPLLQRAQVAPLAACEIRAAAQSISLQCPAEV
                     CAVSAAARGYASSRSQLDAAWSLWAALLRPVFGGNSKALWLHCTSVGGRGGGSRGTDA
                     SIGFRDSAESASSPGGPPSPPVPRDDTAALRLSALFCRLVRHDAVASEVSPDLARLVR
                     VCL"
     gene            <521421..>523160
                     /locus_tag="LDBPK_171190"
                     /db_xref="GeneID:13393251"
     mRNA            <521421..>523160
                     /locus_tag="LDBPK_171190"
                     /product="ubiquitin hydrolase, putative"
                     /transcript_id="XM_003859926.1"
                     /db_xref="GeneID:13393251"
     CDS             521421..523160
                     /locus_tag="LDBPK_171190"
                     /codon_start=1
                     /product="ubiquitin hydrolase, putative"
                     /protein_id="XP_003859974.1"
                     /db_xref="GeneID:13393251"
                     /db_xref="GOA:E9BDE1"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:E9BDE1"
                     /translation="MTTLVNMPRMQAAERQRLLETKIYHDNDRDFDGQVYTHGIRLNA
                     VANLFDGEFFLGDQEDAHELFVSVMAKLETEAVKFQHHCDEVLERRSSVTPTERSSAE
                     DEVDEEAEREEGRPNNEGGASFAEKRLLRGAHAPSAFSMRPSDVPAAASPSKPHRLSV
                     STTAGEVWINTLVQTRLLNIIRCRTAECHHEIVTDEVCVNLSVHIPEEPLTSPPPALP
                     LPPQSCFPAQPPPLSPTPIFPSSSIAAAVAAPLPAMDGGGGRCRSLANLLHESMAYEA
                     LNEYRCDCCGSRTSQFQGGCFYTRPPPLLVLQLKRFATQFVNGTIIIQKNGRRVAVED
                     KLVIHALPSAGEWHAGQRRRGRQHRRSPDPVEPVEVTEAVEDAREGAECCPYYDPDKK
                     CFSAALQEICDVSGGGGLAGRDGLKDEKHDSTGDGLLTTLAAAAPPSSLVRAIRCLYR
                     LRSCVLHLGQSLHYGHYVSDFAVDGEEDDEEDGEDGETARARRTAEQEAGVRSTSQAT
                     LNSCSAVRRRWRRVNDERVEVLSDEVVQARRAGCSDTYLLLYEKVAEERVWCPAEAVL
                     PTPVYRSSEGGKT"
     gene            <524073..>525695
                     /locus_tag="LDBPK_171200"
                     /db_xref="GeneID:13393257"
     mRNA            <524073..>525695
                     /locus_tag="LDBPK_171200"
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase-like
                     protein"
                     /transcript_id="XM_003859927.1"
                     /db_xref="GeneID:13393257"
     CDS             524073..525695
                     /locus_tag="LDBPK_171200"
                     /codon_start=1
                     /product="3-oxo-5-alpha-steroid 4-dehydrogenase-like
                     protein"
                     /protein_id="XP_003859975.1"
                     /db_xref="GeneID:13393257"
                     /db_xref="GOA:E9BDE2"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:E9BDE2"
                     /translation="MSADARIAIIAVVHLALTWVLLRYIADSAMPFYVHREGSSPAGA
                     ANGASVRRAVAHEWDQWSPFLVPSQEAYAAQLGRQQRATSAADAVALNSRVVWRSSAF
                     HLTLAIFTYALLRFGVTAPYGRHSWALGFQLTLPSRVSWMLQESPTIFQVIYHVFLEY
                     PRLMGHSPSWPSLWPSSSSASGPTAAGMPSSHSSADTCHSYWGCVRAACTQQHLGLLL
                     FVIHYVHRSWLYPLSIPATAHDVPLVVTWMATMYCLFNGRLQVLASAGAAATACATDT
                     AAPSLACTPAYTASMGFVRCWRERHELQSLHSSSASVGAVAVRVGWRLLLGLYAIGVL
                     GGSALFFLGQRINMQADYYLVRLRRGDKGSISHGGSKPVGRRAANLHGDALATSSSLE
                     ASRDAQHRSSIDGYRIPVGGWFDSVSCANFFGELVEWTGYVIVVAATSATSNGNCLSV
                     TTALEEELLQPLSSSSWWSLMNPIMWLRLVARVFFGGSESRPAALAAFSFLVYVFSNL
                     APRAVAHHAWYAKTFGDPYTRLGRQALIPGVY"
     gene            <526498..>530790
                     /locus_tag="LDBPK_171210"
                     /db_xref="GeneID:13393256"
     mRNA            <526498..>530790
                     /locus_tag="LDBPK_171210"
                     /product="kinesin, putative"
                     /transcript_id="XM_003859928.1"
                     /db_xref="GeneID:13393256"
     CDS             526498..530790
                     /locus_tag="LDBPK_171210"
                     /codon_start=1
                     /product="kinesin, putative"
                     /protein_id="XP_003859976.1"
                     /db_xref="GeneID:13393256"
                     /db_xref="GOA:E9BDE3"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR022682"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:E9BDE3"
                     /translation="MSTAVVSRPRVYVRIRPLNDREVRDGKGELACRGDTRQQDVLFL
                     KKDETLEQQVRFDQVFDQCSNQQLVFDHIGPEILRTLFSGYNASVFAYGQTGSGKTYT
                     MEGNRGGGVSGGASSEEQEGLIPRIIRGIFSSFKSNANITDALVEVSLVQIYQERIQD
                     LLNHRKQVEIHMDRTSQYVARDATWRTVRSLEECMKLYGEACKMRATSATEMNLVSSR
                     SHMILMLRMQWDEPALPGSHAQLNMIDLAGSERLNESGATGETMKETITINKSLSALG
                     NVVVKLVEQAKKPNKRIHIPYKDSKLTYLLQSSLGGANLVHFMLSVSGSAMWRSETTS
                     TIEFGKRALQLVLRPVRNAIDYTRLAEMEAMIERMRSHIESLEEELQLKRNFEAAGFL
                     QLRQIAQSDDDPAQRRRWQETSANHKHLKRQTELTRIMANLPETFDDLTSHCVLFPES
                     KVTFRELGGLEKLIHFVGKSASNYYRASAAQTIASVIDEPGREVFASLGGLNALAMLL
                     RVQEERCKEAACVALEAVCRGCVTNKRSLSADVYAELVDLVYGYSNQQVQEAACAAVA
                     SIVDGYAEATRRFERLDVVPKLLETIRTCPAEVVNLTKAATNCVGRLAHGDKEMQQTI
                     ASLGGVDLLIDVLFSSSGDRDHQVPILASYALVNLCCSSHENLKMAMEHSRYGEVKFR
                     LLEGLARAFGTNTSREGFGRATAQETAGPFPYYGVTIQDEWTYASSGGRPIFSTFMDN
                     PQFHLYVREETDIAFIIQDTLYEARMRKKRRNNSVYMGIAIFEGDPTLAKLGLKQLDF
                     HGKMIEIGRYTSNCENVLHCTLPASDTPYMVVPFTSQKGRHTHFALSAFGNHPIELTS
                     VPDQVGWVHTVLQGKWTEFTGRGGETFDWRCNPQIRLKTKEACRVVFVLSYLSLDEQR
                     AQLLQEEEEGEGQNTRPRLHGRLFSNAFAVHKRYLKAIVPLPQGSTFVASNTFASNSY
                     ITTSANLDRSGDYVYIPFTETPFQDTYRVSVYCDSDEVEIKPMQGQSSEWMCASLSGV
                     WQGKPVSVDLDTTGKLVAVMYSPGAFVRPRLLSGFNQKRIAGIDSYWNTEATVEYDSN
                     GQLTLQVEAMMRSGTPSAAAARGTTQSATNQVTQVPATDIKFDLFIFTDRKCTLTRVG
                     FDASPSSWPCPTQSTSQTLLAYPQLVEDVDAVGGDDDDNSDSLASELWRDDPGNISAA
                     EQEARETELLRLLEKQEAANHILKLQLAQQARELEELRNGGVSATTSSNSDGKRGGSA
                     KPSGTKTPKRTPSATMDGYAGLSEGRHRSRKEVGGGGSAQAALHNPSRGNTSGSAEAK
                     GAAAKPPSTGPAQRGTNTNSAEAWRQKPLALAGTTLPTNRPGMADNTALAAPSPQVKE
                     LVNYTLVKLIEMSKRAATSARLGDKKEDREWRAMLKDIEEVHQRLHDAFSIL"
     gene            <533222..>533578
                     /locus_tag="LDBPK_171220"
                     /db_xref="GeneID:13393255"
     mRNA            <533222..>533578
                     /locus_tag="LDBPK_171220"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859929.1"
                     /db_xref="GeneID:13393255"
     CDS             533222..533578
                     /locus_tag="LDBPK_171220"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859977.1"
                     /db_xref="GeneID:13393255"
                     /db_xref="UniProtKB/TrEMBL:E9BDE4"
                     /translation="MLRSLHRAAPLAVTATTTTLSTPAVPFALQTAARTKYVRQPSAQ
                     WDPVHEDINAHVKRRIPGETRVDRVRRFAREWRNVELELGVYKDSRGREIKYRKTFVY
                     RYTYPNAFDEFWWPCK"
     gene            <534784..>538311
                     /locus_tag="LDBPK_171230"
                     /db_xref="GeneID:13393262"
     mRNA            <534784..>538311
                     /locus_tag="LDBPK_171230"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859930.1"
                     /db_xref="GeneID:13393262"
     CDS             534784..538311
                     /locus_tag="LDBPK_171230"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859978.1"
                     /db_xref="GeneID:13393262"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:E9BDE5"
                     /translation="MMRPTRRAFFDSFRAARGELDHLFSSMKSEQHMRRAVQQYLLPS
                     LSRRLHRSRGGRLGRAQERSLFRTNASLLLQEARRRCNHRVAAATLDVVLAEPQLSRF
                     AQMFEPAWVKDAVSSCRSAAELRVIEGVLRQHERRVLASGSAATSEGFLLAAAFGRSR
                     ATESALRLGDDDVDADADDGAQSGSLASTRTASLQAAGDALPSSGAAEGGGAGVTISK
                     EARVSAALAQPPSLTDLATTGGTGSDALWSSPEERAAAGLRGLQRHQRNLTAGPNVSF
                     TRYFLHQGLVRHEGELMALYQAMRARPLDVSFRVVGGGDAASGAAQAPGLLSPHASAV
                     HILLQRRRGLHRVPWLPPAMGAYTLDTRASIPADTVLANRQLLRSLARERLIVYQSLP
                     SMLPIYYLDPQPGECVLDMCASPGNKTALILDCMHAGGNSHPHWPSTTTSEAGSTACE
                     TSRRALVGSGCVVANEAQASRISDLQERLRNVSPEVVVTQGRGQALGLGDWHEGSSNG
                     GVGGGGDASSLAHGAVLVEGLYDRVLVDAPCSGEGRMGRDALSWRLWHPGRGIEFFPL
                     QCALLQRAVRLCKTGGRIVYATCTLNPLENEAVVSAVLRACGGAVELIPPPRPLPRRT
                     ELQTEEDVGGSVPPLRLTAGLRSWDVPSGAGGFLCSAAEAYAQGESAARLPPDMFAPT
                     SAGAEGDRTDISGALQRCCRRVMPHLNGNADGFFVAVLEKRAGVPHMLGAAESRSLVA
                     PPSRLDPASATAVGPTSPAAASLAVSLAGGSNILNDRGFVRLPPSHHLVLQHLGGFFT
                     SAPPRQASSLATASSCMAEQPQQGECTSVQAFLERHGWTAVWCEGEGLRLLSQATVQL
                     LRRHSTVPVAPPKGRPNSSALGFARHSEEASKASPAPPSTGTELLDAGVLVVGAQGEL
                     TERGAALIRPSARSRVVSLPLPFAQLLLANRTLDVGASLQLMPAYVQEAEQALGPQHG
                     FLAPSSAATRGRDDPASSEAHTSTWYREALAALTPALGGGAGAAGNAIVVVRVSSSGP
                     SASPSWAAPLAQWAWPVRVEVMQPWSWHDIGDTPRGLARLHLTLPAAARHRTQALIGR
                     LQGHAHRQRSTQERLQASSRHDPSLIMGQQALHGSAMQASQQHRLLFGGAAQASALRA
                     QPTEALPARDSTMTTPATPLSQSLDVFEL"
     gap             539850..540452
                     /estimated_length=603
     gene            <541691..>545881
                     /locus_tag="LDBPK_171240"
                     /db_xref="GeneID:13393258"
     mRNA            <541691..>545881
                     /locus_tag="LDBPK_171240"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859931.1"
                     /db_xref="GeneID:13393258"
     CDS             541691..545881
                     /locus_tag="LDBPK_171240"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859979.1"
                     /db_xref="GeneID:13393258"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:E9BDE6"
                     /translation="MNEIPSSGEVFRSEDGTVSTILPSNYGQDYEASEGELEEYAEYI
                     GIDPAKEPELMWIAKEGLRAALPDGWRACQTDDNEVYYFNFQTGESLWDHPMDEHFKT
                     QVVNERAKRGGGGSSAGAAVGGSTRTGRTAAGTGSTKAIADSFFLKPSAAVSSNRTPG
                     SLADIGGGGVAPATTGTATAKDSRTPGSSMKDGASAPRAPPDVSDILALSSAASHPPS
                     LGASRATTNAGLPRMKEREAALRKRLEEGNEAQLRALRIELDKKAGAERQRLTEARTK
                     LQKDLDAAWEQERSSAAGDTVAASSVTSAATQRRLQIAREVKQIEESWKARLHDVGAR
                     VRELQQQVEEKQQTLLKAFQQSPEELRKTLEARNAAEVAQLREAKRKESEIALAHLKS
                     EQASALTEARLRANDAVAAAAKATEAEFEKKVQERRVQNGAMLASLKAVVEAKQADLA
                     AKEKATAAASSTTTPNTTAAAAAADASSDAEEAAIAAAQAAADAEVLKAREASAAAVA
                     RLREEYAAKKREKEASLKAAQPPPLSRSSFTSSAISSPTADLSSPADSFSARGIGAAE
                     QAKLDEEDQKLRDEADRAVRIFEEETQIMVENKKAGRSLTAAPSVDVAASVSAEAIAA
                     LGRTANQEQRAREAENTRHFMVMKQLEAKHDQAVRALKAQLDKNLASSASSSAPRLFN
                     PRQQPSFATQLATRKREWLRDHPAPSAEMPTLLPVPTLPAAALQSDVAAVRMPDEEEQ
                     AKLIKTRLAQVREEAHRQYDQEVQALQTTRQEDLEAWREAYRSSRLMEVEKAMAALKE
                     AAAAAGASAGEGRRLEKLQSELQALEAAIIAADSEHERQTRVLEESIASLEASLAQLR
                     TQERREEEARAEQLHFQQQRLLSKGAHKSPSSAHAVALPSRSAVPASNELYISEEEAA
                     DEAAALRARWTALIKALRSAVQREMEAYQRALDESTAQHHTTSAAGAVWAHPAGCAAA
                     IVAANAGAPIHTVSTPRDRGPATCVTSSLPPPAPSAMLTTVSALPGRPAALQEQKPPQ
                     PTSSLLAIGTTATNPSGYTTPLQRHPREHDDSGAGSMILGSAATRMSASSPAPQLCLM
                     DSRLGEVGAHAALPGQCPLHSTSLQPQSQPHRLWPDASVVPSSDALMGVRSRHLDPHR
                     NTSVSSAAAPWTTVPGGAQWGGPPTCTSAASAQQVTEAPADRPSYSGGPASGSASVDA
                     DDARARHHAARLAALQQTLRARRRDLQARRREMEALRAEWRADMRVCKRQGDRALACR
                     LREVKTELEVRARELNEEVLQLKKMHENVHEEVRQFRRWLDLRQQPEGQVARGSGGSV
                     SSSAAWSGLALTGSKLAYVCRGEGDRSPASSSKTADVMGLLHNMVDRTERLEELLLGR
                     LETHSPSTHRSGTQHSGR"
     gap             547673..547683
                     /estimated_length=11
     gene            <547755..>549212
                     /locus_tag="LDBPK_171250"
                     /db_xref="GeneID:13393261"
     mRNA            <547755..>549212
                     /locus_tag="LDBPK_171250"
                     /product="5'-3' exonuclease, putative"
                     /transcript_id="XM_003859932.1"
                     /db_xref="GeneID:13393261"
     CDS             547755..>549212
                     /locus_tag="LDBPK_171250"
                     /codon_start=1
                     /product="5'-3' exonuclease, putative"
                     /protein_id="XP_003859980.1"
                     /db_xref="GeneID:13393261"
                     /db_xref="GOA:E9BDE7"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:E9BDE7"
                     /translation="MGVPKFAAWLTRKYPSMVMDSCPGDVHGLYIDLNGLIHPCCHDE
                     HDPSVALRTQGEKLRSICLAIETLVVTVRPQHVIYIAVDGVVPRAKMNQQRARRYMSS
                     AAPLTDTDKPIHGGGHELSATIVAAIEKEFTQAECDGVERELADVSQALMGDVLYGGC
                     ATMALAEDATEKAEAHTLGAAPWTTALTLASEGAEGACCAAAQVGRQPAAAASPAKFD
                     SNCISPGTAFMDAVAAAVRDYIRHKLAPKKNDDGGKAEAEAGASPAAINATCAHWAGL
                     TVIFSDSNTAGEGEHKIFDFLRTQSAFPGFNGSGCHVIAGLDADLIFLSLSLHIPRVV
                     ILRDQKRSSYEQALLPDTAGGTLVTKKVSPKVKPRRVRRPAVPSSSMSSIGSAAAPTA
                     AAGDEVALASGTASMAAPSDDEADECGLFWRSEAPSSPASPATMGPKTAPPQHVADMV
                     VEPSSGYQYFDIDVVGASVVSEVYQLCLENGLQLRG"
     gap             549213..549311
                     /estimated_length=99
     gap             552628..553215
                     /estimated_length=588
     gene            <554298..>556190
                     /locus_tag="LDBPK_171260"
                     /db_xref="GeneID:13393259"
     mRNA            <554298..>556190
                     /locus_tag="LDBPK_171260"
                     /product="UDP-sugar pyrophosphorylase"
                     /transcript_id="XM_003859933.1"
                     /db_xref="GeneID:13393259"
     CDS             554298..556190
                     /locus_tag="LDBPK_171260"
                     /codon_start=1
                     /product="UDP-sugar pyrophosphorylase"
                     /protein_id="XP_003859981.1"
                     /db_xref="GeneID:13393259"
                     /db_xref="GOA:E9BDE8"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:E9BDE8"
                     /translation="MTNPSNSNLQALREELCTPGLDQGHLFEGWPETVDECDERQIAL
                     LTDLYMFSNMYPGGVAQYIRNGHELLARESEEVDFAALEMPPLIFEAPSLHRRTAERT
                     ALESAGTAMLCKTVFVLVAGGLGERLGYSSIKVGLPVETATNTTYLAYYLRWAQRVGG
                     KEVPFVIMTSDDTHDRTLQLLRELQLDVPNLHVLKQGQVFCFADSAAHLALDDTGKLL
                     RKPHGHGDVHSLIYNATVKRDVVPNSGDGTATAQPLVNDWLAAGYESIVFIQDTNAGA
                     TVTIPISLALSAEHSLDMNFTCIPRVPKEPIGLLCRAKKNSGDPWLVASVEYNVFAEV
                     SRTLNKDGGEEASDPTGFSPFPGSVNTLVLKLSSYVDRLRESNGIVPEFINPKYSDET
                     HRSFKKPARIESLMQDIALLFSEDDYRVGGTVFERFSYQPVKNSLKGAAALVAQGNGA
                     YCAATGEADFYELQRRRLKAIGLPLFYSSQAEVTVANDTIGVHIFPIIVLDAMCASSG
                     SLDDLASVFPTPEKVHIDQHSTLIVEGRVIIESLELYGALTIRGPTGPMALPHVIRNA
                     VVRNAGWSVHAILSLGAGCDSRLSEVDRIRGFVLEKTTMTVMDCRTKGESEAGAPSGA
                     ADPAKL"
     gene            <557427..>559223
                     /locus_tag="LDBPK_171270"
                     /db_xref="GeneID:13393260"
     mRNA            <557427..>559223
                     /locus_tag="LDBPK_171270"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859934.1"
                     /db_xref="GeneID:13393260"
     CDS             557427..559223
                     /locus_tag="LDBPK_171270"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859982.1"
                     /db_xref="GeneID:13393260"
                     /db_xref="UniProtKB/TrEMBL:E9BDE9"
                     /translation="MQVTLATTVKAVLQQVQETVERRMCASLCAGYTHGDHHEISGGN
                     SAPCALARPTSLLGRSGGKDHSSGSVVDGTQAADPLTSRTPHLTDSLQEAELCLCLQD
                     KDGEYRWAGGTQHFHKVAVLRAPFITEVCLRTHAVFEEERRRSRREARQERTSSARSS
                     SLTLASHAPSLLPSLYRSAEDALNVSDSRECSDEHSDQRAKSTHGKRGGAPGNAPDTS
                     AATTTVNKGHAAHTLTGQSFARKAGRPRFAFLKGVVVPMVVLRQCNPQYAMVGKHHPH
                     GRTPRQYAEVRVPADMQAEPLDDFLRSSGTAPASDTAQVTSEESVAHASAHAELLPLR
                     VTALSTSDRLGDTVLRSPASPHSTSAPATRDISAETPCLAAALMPASSTSTLPSCSAP
                     LDRSCGVVEDAHSPRTRPSIFDTHQVHSYHSTAAATAHTATAAGPVGLVAHATTVERA
                     SEASGPSATADALRVRGTVDVQACEASAKEEAAVRIALAAAQQDYTAALAEYKSVVAC
                     SSAKPTAASECEVQPWQPAQCADAELATLLQRRVELQRQLKVCREAEQQCERLTMLAE
                     RLEKAVREQEERRVPRTPLRHGNDSAAFSAGY"
     gene            <560145..>562442
                     /locus_tag="LDBPK_171280"
                     /db_xref="GeneID:13393264"
     mRNA            <560145..>562442
                     /locus_tag="LDBPK_171280"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859935.1"
                     /db_xref="GeneID:13393264"
     CDS             560145..562442
                     /locus_tag="LDBPK_171280"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859983.1"
                     /db_xref="GeneID:13393264"
                     /db_xref="UniProtKB/TrEMBL:E9BDF0"
                     /translation="MRSALSTTGTRHRHARGPTNTTPITPLHMPPSRVHPDVRAMVVV
                     VDVVRPLAQATVSSSPTTALAVERLEIDVDVVPFSTTADALLTDVAVALQEMQLTMCV
                     PLQAAALASGRVLPPVAWIQEAVVVSASSGLDRWQRSSTPFLGRRYAAAVQHAQNSVD
                     SRQMPAAAPALSSSLVLRIGSDYVVEDMTGQLSPPTAVWSVVPQSMEAASSIAGKPPA
                     QAALLITSSPHLLTPDRAPEGVAVEAHGALHAPLAALPPPSRGSAATMMPASSRVRGG
                     DLLPGSQPTVASAAVERAAADFSQDECLSMPSLTVGSTAPPLSPPPPLPQQQSPTRAV
                     SLKDADAVAFGHLQAHQAQILNHDTQRCDDSPNASTSVAAPAEEQRRLQRTLSWAAAE
                     TAVQAEVERLQAEHVLTGEQGEGGAATATRRGAGANFNDAASGDTHEGTAIHTAGRRD
                     GGSASDTFSPPRLRAQSLAALREEIGAYEREAATLRRATEKARQWRESTKQQLCEEVA
                     RLEREAVQRSAALAERDVLRRRVEQLEVQVAAAKAIEVALLVTQGTAAVLPPASADAQ
                     RAKRDCRAIGGSAKSHRPCVTAAITMPALECFSDNSASEHGDSSEHSSPTPPPAPALP
                     PPSQACRLAPRVNGHAAESGMGAHRWSGRRVSLTHCDRAAAPTTSTAYLLPEAQRQPS
                     HSRSGLGIERSFLSPSLEAEVRAALDSDDDDAGSSVTDNRKNGTASAEATTGGGSACR
                     CDTIAGKGAEAARQPPAVGTRGRRQ"
     gene            <565591..>567030
                     /locus_tag="LDBPK_171290"
                     /db_xref="GeneID:13393263"
     mRNA            <565591..>567030
                     /locus_tag="LDBPK_171290"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859936.1"
                     /db_xref="GeneID:13393263"
     CDS             565591..567030
                     /locus_tag="LDBPK_171290"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859984.1"
                     /db_xref="GeneID:13393263"
                     /db_xref="UniProtKB/TrEMBL:E9BDF1"
                     /translation="MAGTWRVDSLPSSLPLAPQSIGVSHSYEAATEQASHGTGAPSSA
                     TPMGAATNAILIPRVISVATTSLASDCEPCMGESRRAGVWTPILADTATLSDQAAVTS
                     LASTLPSPSHGAPVLSEDSLRRLGEEVSAREAQVAAAAMALEGQLEFDGPSSMAPSPC
                     PNPWASAGPRCACEQPAELLAWLMKPLASLCDHRPHPCTCEEDREESGAANISDTALA
                     GSASAQSRQREERRAAAWLSRRMSFISSSSLATSLLPSAMANTTFPSAASPATSAASS
                     SIFTLESSLLWSQACIVCAGSSQRALKGLHQLCDYVWQDLKNHWYPQLRLVLGDHSSA
                     RKIRYGRHARRRLKPKRTPGNGESATATSDTPTNTTTGVSPAACGAAAASPVGTMRCR
                     SVSSPCFFNGDVRITSDSAAHPCMSWRDRAAAAATLHLHASNSNSTNSSGASSPLPAQ
                     STKEGMRLYAVMTAEAVASAAQGLLVFLL"
     gene            <570992..>573559
                     /locus_tag="LDBPK_171300"
                     /db_xref="GeneID:13393268"
     mRNA            <570992..>573559
                     /locus_tag="LDBPK_171300"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859937.1"
                     /db_xref="GeneID:13393268"
     CDS             570992..573559
                     /locus_tag="LDBPK_171300"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859985.1"
                     /db_xref="GeneID:13393268"
                     /db_xref="UniProtKB/TrEMBL:E9BDF2"
                     /translation="MRQEARDRGGYDSGGSCCSAADPSDAGRATAAAAAKRSNPHEDL
                     VHVLDRPEHCSAAAGIAGGDAAPLSPSISPLTGPPSGAPDSDYGEVLSPSEWWKHRHR
                     DDVARVSTALGQPQTFSPPPQAPLTAPHNDTQQQHQHTHLRQEHRDAASSSSGGGSSG
                     CFHSNQRHLDEEHDAHHLHAHPRLSPDAGFKFGHDDAPFSQNSSFTTAAAASAARRQS
                     ATDRARRTSCSVSSIADLYRHADRSASAPRRFSLGRSSSTQSRKYIDSTLSSAVHRAG
                     ARQDRCGSITRVEASLVALQVELAAEKRNNIEAEHHITTLNREVKRLREENARLSREV
                     AVAATAAHGASAPPHSVAPGGGADGAGAAFSSSTAQANSDAVTAEKRIEVLEARLGEL
                     SRNMETKLRELDTKDERIRLLEHKLADQLLLYSGMSYMGEVSTNPPQALQPAMMVRHN
                     SATASTHQQQRRPSRTRQKGSERVSSVGAHASPSRLYWQAQAPDTTLAGPKVSAIRSV
                     SVHNLHVGQSDNGGSAGPRLISREQASSTCNHVRHSDDAGAWGEGAPTDAGPQPSAFL
                     LRESQPDARVNRPLSATRDLRQQTPRTSSLRRRPYSTASQPGSSDLSAGTRPAARTHS
                     SVRRRYSRDAFGSAGHADGDAAGRRASGLEKAHPPDRSGSASAPRRPSVQRRTSTSSL
                     RSARTVTRADSQRASSRRNSAASPARRNSGNITIGSHPMRLSVGASAGGDARFPSPGS
                     PACGRAQSIFLSNGSTARRGSATRSVAQQSVRSGTSTRSRPQITYSADNESATIKGST
                     TTVVFRSGNATNAGAHSYYRGNSYARDGAPLLPSRLTASGPVVAPGDARTGAAVDLP"
     gene            <575511..>576878
                     /locus_tag="LDBPK_171310"
                     /db_xref="GeneID:13393265"
     mRNA            <575511..>576878
                     /locus_tag="LDBPK_171310"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859938.1"
                     /db_xref="GeneID:13393265"
     CDS             575511..576878
                     /locus_tag="LDBPK_171310"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003859986.1"
                     /db_xref="GeneID:13393265"
                     /db_xref="GOA:E9BDF3"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:E9BDF3"
                     /translation="MESRYSLRNESPTEGLATTSSARKHHAPLPQRRHGAAKAHPQIK
                     IEPSCLVFPPPHFGRCIQNAISIYNVSKQPCVFKLRSQNPERYVAKPHVAIVAPESAT
                     RSFVTLRDMNTLGMKNLPEGTQDRFRFSLKLYDPMTVDPSLSPKDLWNLLTARGDKVD
                     HEQDLIAYFTKRDTPVGGLVTFFPPTYIPVIPPAVPKAAPPPNSATAPTSAHTSSSTD
                     KRVFNRDGSAVAQRKRAVDAAGGGAASRFLAASDAVKEWAKAAATTHGLWLGVFAVAL
                     IVLSVAVVTSHMWVAGDAAAGRVQATAASGRLALQEHPTQASRADYTAPVEPLPHHAE
                     PVAHYAVPAAEPVQAQQHQQHHGEHPNSQPEAASPIVDPPYEHHEAPPAQEEAHHQRH
                     EEYWRHPEVPVEPTVAEPVHGTQAEQVAPQEQQWQEPTFDYAQQQQESHSEQNRYQEG
                     PYAPP"
     gap             578115..578213
                     /estimated_length=99
     gene            <579966..>580301
                     /locus_tag="LDBPK_171320"
                     /db_xref="GeneID:13393267"
     mRNA            <579966..>580301
                     /locus_tag="LDBPK_171320"
                     /product="histone H2B"
                     /transcript_id="XM_003859939.1"
                     /db_xref="GeneID:13393267"
     CDS             579966..580301
                     /locus_tag="LDBPK_171320"
                     /codon_start=1
                     /product="histone H2B"
                     /protein_id="XP_003859987.1"
                     /db_xref="GeneID:13393267"
                     /db_xref="GOA:E9BDF4"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:E9BDF4"
                     /translation="MATRRRPSCKPSNSHKSHRKPKRSWNVYVCRSLKAINAQMSMSH
                     RTMKIVNSYVSDVMERICTEAAVLVRTNKKRTLGAREVQTAVRVVLPAELAKHAMAEG
                     TKAVSKMCH"
     gene            <581771..>586393
                     /locus_tag="LDBPK_171330"
                     /db_xref="GeneID:13393266"
     mRNA            <581771..>586393
                     /locus_tag="LDBPK_171330"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859940.1"
                     /db_xref="GeneID:13393266"
     CDS             581771..586393
                     /locus_tag="LDBPK_171330"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859988.1"
                     /db_xref="GeneID:13393266"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:E9BDF5"
                     /translation="MKVQHLTVETLDGNGERGASAPAIQILVPPLFKGDAAVLRAAAV
                     ANHDGGAVTRASYLSISSSVNSSQCSFFGGSSSAVSPLASTSVSQANVDTPSSTYEAA
                     VCAELQRLLERCEQSWMHTMHIPRVILRSVALDQNCAIAATCAMLIISCILYPMTQTI
                     LCTILFFALYGLCVLLQAYHFWARVTEMKYRTASVTREVLARWWRRVQEMPLRRSQTA
                     EERRRVFIESFSQLPASAFRMVAVVDERTGRLKHIHKSLMVKMSKRLDESTLKVRSYL
                     EPTSICKLVDVMRITLECDAIVLKPLTDRARPPRLPNLLLSDKPFVEDEDTTDSSDHE
                     RESRTVLGGGNTITVSHHMEYFVHRVFLLVWAAVMVLTIGTGVMLCKFVRLPLGEGVF
                     LDPAVAALGLLPLNAIVLNRVLIFYANVYLDKLFHYMVSRRSYALEDRLPRFSFWSTL
                     VTMARVVCRMPPPNGGRNPLVFSTSLVDVFGMATVVAMLDQTGIVTDMVLVPKQVFLL
                     KSDPQQQHQHQQSSSSGESGDDDDGTTTVKGCFSQRSERDARERRRDMHKQIKRKKYQ
                     ERRFLELRLMQSTRQDLAVEFADEKARHKHNSHLKPLCLAILVHALAREPTQLATWTE
                     PFRFCDRSLLWARAMHWIPRACGFHDRVAHNFLILARIFVISTSTGSGYRDTYPEQAC
                     SYLVEGSDGALHLFTIGTPYLVCHHSTTHWTGTTIEEFDAHDKAEVLYMGKHQWEEGA
                     TLETVALSHRILPERYRRYVATLPRHAHHYNEFFFRNGAEVNSTTAKKAQVERRHRRQ
                     QRAAAKAARSGVAAPHPQAAPQSADSRQEPRGESGTSRCRVMRHDGGGADTDDGAPIP
                     SAAMQRERTEAAVRAGDREMGAEKEVGAVGVSDDSTMSSYDADKWGGDRDIAVDERDI
                     SGRDIDRQRQLCGTPRRRCRSAPPVRSTRPANVQPPRNRSFGAAPTDVVADIEGDDCI
                     TVNTFIWLMATTSHTFLGLIGLQDSVRPNVQSTMSLLDESGVRCMYFYAGTERQTKSF
                     GSRVGLDTDWNCCISLKEDAVALDPHSIRAQLPFGIKSIRKHILHVDPIPLQVSLFSH
                     ALGVSKRAMLSVLQDNHEVVVAVGSVFNHSNVRSFVQADLSIGVLPTRRGTNADKEGA
                     LKHTRVVEPSDFAAANSLNRDIPLYRNVAELIGCSCSLRAPPTTSILPIVAMMIRQAR
                     LRLSGISNGAEFVMHANFFLVMVNTSSLIVGVPLLLTPSVTVFELYVLIPILALCCTY
                     TAYAGMDAMRVMPSRHNHFVRRAIFRHSAVVWCLRYAISVVALLALGITASTKLCKVR
                     VLKLITMEEATCMSSGQGYVALTFNYWLMVHCWTHISRHHPISLTFSLKLEHGRRSTY
                     LFRSFRWVAASFLVTLLSIIIVVLDTPKAALHHAFFPSVPHFIVSLLFPVLILALDWP
                     VKRWRERRFTNMQKFRKLSYGTRLGMHSPRGDYEPEGITYTHTSTVGGAGREEAAPAE
                     RVGLLKRVSEWFYRFSSMRGGKLELNCVCCDHIGGNYATYHTTANV"
     gene            <587329..>590193
                     /locus_tag="LDBPK_171340"
                     /db_xref="GeneID:13393269"
     mRNA            <587329..>590193
                     /locus_tag="LDBPK_171340"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859941.1"
                     /db_xref="GeneID:13393269"
     CDS             587329..590193
                     /locus_tag="LDBPK_171340"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859989.1"
                     /db_xref="GeneID:13393269"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:E9BDF6"
                     /translation="MELLLTLPSPLEGIERYLVGDRLQLTLEEAGELSSRYHAAVELH
                     LRSSSSREAVRDEAAEDGIVSALTFALRLFNAENFSGELTAAERARYGAVLNHFGGTL
                     PKGYEGPDGRNSDNEEEAAAPVSTSPVAPSSATALTAAQRERLQDLFLQRLLTTDGEM
                     PVPAMRLPGLLLCIISIAKAELEPGVPLVPLTSPWRLRAFFRHQLCLSHRSNTVFLAL
                     AACVDAVLRLPSEEQTVEMLLEVGQVQGYYHRRDLAKITFEAAMRLSGLRVEETSMMG
                     VRTRWQQNQHVQMVLNATSSRPVPPQSMLEEQPKTIMTEKDGHDLLDRPRETPEAALQ
                     PLTPLHPEDKAILLALCMDIRNNNPDHGLTRHHMMTYIERLLADPAPSPFMVRCQTLL
                     MRARLESRRNRVQERAFMQLTELVEQYSARRDPTHEVFGRTASDYFYSVAFPPVWALK
                     REYAGFCFEETLYKTALDVYEQILDWECIIECCKKLDKRRRAESLARQLLETDPLNPM
                     LWVALGEATRDDAHLWKAWELCGHKMAAPMRALARLALDREHYAKVVEYFDEAVRINP
                     VFGGDWFALGYASLRLERLGRSGEAFTRVCQIDPSDAFGWNNLASVMLRERKLRPSFN
                     AMSQAIRNNRRDWRMWQNYFRIGCELKEVTETTNALGIALGIAQRQIHLERDTLELFV
                     DNTVAYLKGEIHGSSLDADETDGSKADALVYRSLGILPGENDIHHAPVAQTMTTAEED
                     EEMADLTPLGAGVELPEPVTGAAAAQTTEERDAVLAGIRRRHADRVRALFARILELFV
                     SDPDIYACAAKLMHFLDGPMASFRYRQKELRACQQKEQWCREEALFSRTVECLEAMAS
                     DVFEAFGEAQDGGAAAAAVPYAQTTPAGAEGAPQAPIPLAGEALQQAIVDAFKEIQTN
                     IKGALDAAEEHMEEHAVYKRLRELSTRVRRGAQGAKVAFL"
     gene            <590963..>594160
                     /locus_tag="LDBPK_171350"
                     /db_xref="GeneID:13393270"
     mRNA            <590963..>594160
                     /locus_tag="LDBPK_171350"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859942.1"
                     /db_xref="GeneID:13393270"
     CDS             590963..594160
                     /locus_tag="LDBPK_171350"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859990.1"
                     /db_xref="GeneID:13393270"
                     /db_xref="GOA:E9BDF7"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:E9BDF7"
                     /translation="MVKRKVDDRVKTLIDDIAHHKHRGLILLVGDRAKDQVVNLHLMI
                     SRANHNAKVNVLWCMREDPDFGSTGKKQQEKRARLEVKGGLSTEASKEAFQTFLAQTN
                     IRFCKYKETHKILGQTFGMAVLQDFEAINPNTLARTMETVKGGGLIVITFRAMRSLRQ
                     LYTIAMDVHARYRTETQRDVVPRFNERFLLSLTDCDTAMCVDDDLNVLPITHKMKSYG
                     KSRKSDAYDADLAVQGRLQHEVDLANVKDTLRPSEDVGPLMQLCQTMDQAKTVLSLMQ
                     TVMEKRLDSTCVVTAGRGRGKSAALGMTIAGAIAQGYSNIICTAPTPENVQTLFEFAI
                     RGLKELGYRERTDFEALQGVSEEFAKCFIRINVFREHRQTVQFVSAADTAKFAQAELC
                     VIDEAAALPLTLVKRILGPYLVILSSTVSGYEGTGRSLSMKLVADMRRGSSSGAADAR
                     HLKELSMSDPIRYGPGDPVEKWLNKLLCLDATMANTQLTTSPHPSACELFYVNRDALF
                     SYHPLAEELLQRIQSLLVAAHYKNQPNDLQLLSDAPGHHLFVLCADSVESSAATAPTS
                     STSATARQQVPDIFCVIHACEEGQVSAQSIKSHLSHGLRPSGDLIPYTLSQYYLEEGF
                     ARLAGLRIVRIATNPALPRAGYGSRALSLLHQYYSGSISLTAAEPKTATTKRRSGDSE
                     ADARELAGKEHDGDDGEPSAATAMLAPRSHITNLLTPLIERPYELVDYLGASFGLTTE
                     LLNFWKKASYIPLYVRQAPNELTGEHSCIMVRPMGFDLRPLQREFQHRLLPLLAMPFR
                     HLPTELALSLVGDFEAHDPHKMSAATDLSEVDHHVVRVDGVVQATSDDIAAAFSAGDV
                     QRLRLVSTTFIEGGNVLDLVPTLAKLYFGKQLFRCPDGTDGVVLSHAQAAVLLAVGLQ
                     CQTTEELAAQPAFSGVSTQQLRALFLKALSRLSEHLVALQKIAKKAHKDGHNAGVVAG
                     KRARLLSDGAAGDSAAIGGADEDVEDAEEIYDSHGNLKGLKVARKVKAQVCTDRTLLR
                     DASSSISGNASAASTGRDSLQDVFYRPTKKTSKRR"
     gene            <595416..>596771
                     /locus_tag="LDBPK_171360"
                     /db_xref="GeneID:13393271"
     mRNA            <595416..>596771
                     /locus_tag="LDBPK_171360"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859943.1"
                     /db_xref="GeneID:13393271"
     CDS             595416..596771
                     /locus_tag="LDBPK_171360"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859991.1"
                     /db_xref="GeneID:13393271"
                     /db_xref="GOA:E9BDF8"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR019332"
                     /db_xref="UniProtKB/TrEMBL:E9BDF8"
                     /translation="MSSHELPFLILNLAVEMIFVLNSRLHAQAVPPERAASVLSDIGT
                     NIFDTAFVNELFTPTAMYSSTSVLQVFTALSRSTIMRLSENSMRKLYDLVYMTVKYQI
                     FTLRHPLELLELTLNHLDAAQKILPAAMRPLTSAAEERVLRLASTLNMGDWASTRRSL
                     LNFFTGRHVRVSIFLENKMQDSTSGAFYIPRDAFLSPSPACKPPGLVYVADVPQPGTF
                     AHPDAHLPYPPHIPLGSWRPRKGAARMTSNGFDIYAASAAAAGSSRTATVAGAAGAHA
                     TVVADPLLRQTLEMPMPKKPTFEGASAVTASTGPPTPPPVSVAAEDEQNAYDAEVNYL
                     AQLIGSVNRARGVQYFELDLFPDGTGSSGEAAAAVPVPSAAPTSITNAASSRGASASP
                     AMPVTRMTASAVQEQNKKLLSIMNDFQSPKGAGSGDAGGAVPATGGASMNDLLDIMDE
                     L"
     gene            <598129..>599082
                     /locus_tag="LDBPK_171370"
                     /db_xref="GeneID:13393275"
     mRNA            <598129..>599082
                     /locus_tag="LDBPK_171370"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859944.1"
                     /db_xref="GeneID:13393275"
     CDS             598129..599082
                     /locus_tag="LDBPK_171370"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859992.1"
                     /db_xref="GeneID:13393275"
                     /db_xref="GOA:E9BDF9"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="UniProtKB/TrEMBL:E9BDF9"
                     /translation="MLRLPCFATRAAAAPAVCPSVMAVSAAKRQYRIIPHLYNEIEEL
                     AETQRRGRWSISHRNCLQQPLKKAEIMCDKLNLREGRRSGVLPEKSIARRLSQKYAVD
                     GKVHESESKTRLISITVVNFDGHPFHFRTYPMPDVTLNTLIDGSGMCHGHATHWGKCN
                     NPDCSDWNHGDGCMVNVDIETLDRLLPPNRWEYTSLTAWRATDRPDITFNTRFSCQIP
                     ITEELDGAVFALKQLWTRALRESVSDWGLVDDQATIHGARSKRIEPWAPIIEEPTKVD
                     FPITWDMLWATGYQDIMKEKYSNFRRKDGFHTKPEMWAAYV"
     gene            <600050..>600253
                     /locus_tag="LDBPK_171380"
                     /db_xref="GeneID:13393274"
     mRNA            <600050..>600253
                     /locus_tag="LDBPK_171380"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859945.1"
                     /db_xref="GeneID:13393274"
     CDS             600050..600253
                     /locus_tag="LDBPK_171380"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859993.1"
                     /db_xref="GeneID:13393274"
                     /db_xref="UniProtKB/TrEMBL:E9BDG0"
                     /translation="MAPFWTNVLNYTYARGFIRIPIVLALPIFFNKYVLYAYEDAFKR
                     WNAGHNQVDIWNRLQEKVAADAE"
     gene            <601169..>603298
                     /locus_tag="LDBPK_171390"
                     /db_xref="GeneID:13393273"
     mRNA            <601169..>603298
                     /locus_tag="LDBPK_171390"
                     /product="translation initiation factor, putative"
                     /transcript_id="XM_003859946.1"
                     /db_xref="GeneID:13393273"
     CDS             601169..603298
                     /locus_tag="LDBPK_171390"
                     /codon_start=1
                     /product="translation initiation factor, putative"
                     /protein_id="XP_003859994.1"
                     /db_xref="GeneID:13393273"
                     /db_xref="GOA:E9BDG1"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="UniProtKB/TrEMBL:E9BDG1"
                     /translation="MTDVNFGRHIIIDGLPNNVTPDKRDLFQRHFSRRIGELLGGEKF
                     SLHLLTDPETALLSGAILSCVTEAQAEAALAKLNRFPFTKSAVLTTYRWSSLEEARKD
                     DGPYVPPPMANDDDEEEAELVHNMAEDPDARPQFLIKSGVSFDCDWYWFNWEKNEPDL
                     YRRRKISKDDPLCRWSEVDRDNKKLSSGMVCSALPVSRPLPVWSTYGSMVISQHEKGL
                     RVWAGRSMRLHFEITMDINAFMVSPCEKYIIVQTPKDISIINLRTAKKIRTIGNLDLH
                     SDDLWPIMRFSADDSLVVVCKTGYRPMDSTEVPEGHLNIYVSETMKLLKGRGSSGHSF
                     AIPGLYKAEWNPVVGTQMAYVCELGPNQGWKAVVADMVVNEDGEVEQRVLNERNFLVA
                     TRLDMLWHPAGTFLCVRVASKGPTEYFLFHVAERNVPITRLSIKRGYIPTRFAWQTGG
                     DKFAVLLKRDGVGAGLGETGVLQIFMIGKQGPKVLHEVATSATHLFWAPRGGRLAAAN
                     FDKSLLHFFVLHDNNTITDKNKLSGISATNCEWDPTGRYFAVWVSSIHEQTLAPQYRI
                     FDYTGNELFKKAIKPLSHFAWRPLPPTLLTQSDVKKARDMIKTLVRDYEATEMAHKAE
                     EQERIDKERKSKEEDYIKRMKMAARYAEEKGMVQTREEQRANSKWVRYNNNRLKALPD
                     EEHMVHEDVTEYHLVSRRQVGTGVAKK"
     gene            <605176..>605742
                     /locus_tag="LDBPK_171400"
                     /db_xref="GeneID:13393272"
     mRNA            <605176..>605742
                     /locus_tag="LDBPK_171400"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859947.1"
                     /db_xref="GeneID:13393272"
     CDS             605176..605742
                     /locus_tag="LDBPK_171400"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859995.1"
                     /db_xref="GeneID:13393272"
                     /db_xref="UniProtKB/TrEMBL:E9BDG2"
                     /translation="MPDPESVRWVQPTYQDVDALPIVDAKGEYIVSRVQWPTGEAAYR
                     TPAPVDDKLAPRFGYNVVQVRKHVSWWKYNQKYPRLSLAYINIQVLFLLGLAWLVAFL
                     TSEYRQTMEAMRTPGAMVGEHRGRGPATNSTQKISFEKDEMNALLDKAQNNWYDGKAE
                     ASYVGSKAYTMKKIPRPKEFSADDFRKR"
     gene            <606982..>610128
                     /locus_tag="LDBPK_171410"
                     /db_xref="GeneID:13393276"
     mRNA            <606982..>610128
                     /locus_tag="LDBPK_171410"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859948.1"
                     /db_xref="GeneID:13393276"
     CDS             606982..610128
                     /locus_tag="LDBPK_171410"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859996.1"
                     /db_xref="GeneID:13393276"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="UniProtKB/TrEMBL:E9BDG3"
                     /translation="MPAWHSLALPLSADYAHNEREGFSFFCTSGSCDSTTTLDRYLDD
                     LCAFLRSAGLIQSHPDNYFQLIRGERWAASSVHFDNSPVEAEELAHTKALLSAFKPLL
                     QGDDAMSKLRALVRDGPPTDAGQCAGALAGDVGASSASWSPASLSSLAPLQEFYAATR
                     RLMLGRARRVENDVASLTLVTEAERRTIDRDSSSAQTQQQHEQDILDLVVSQGMNLKK
                     QHEVPIMRMTIRDLVLCCNAGVGRASAVRLQTGEQEDVRGKTGKHRCGDVAPVGTVIN
                     IGEGKGYVSRAVSLCDNLQVVGLDCNPAHKERAVERFESLVETSLSSRDGRPRVNLLY
                     EPRGHVASIACRVGEKVDWESLLHGHVRTCADPCCLLSKSCGGDTCSAVGTAVEDQGS
                     IAEDDAAVLTRTRGDDTVKLACRVCGKVVRQDCTAAIMKHVYKHLHGGIGPRAAASGV
                     HALDNATETLSPPPPHQMRVPALTEVQQWNVSLPQHAYVAKLTEHFFAVTDVDKRHLS
                     NRNDAALLRRVAVDGEGGTALRGSSSKATPRYLTLAPRAHGEVRGATSGAQRRRRSPP
                     EHAPVTLEPAYTARGYRVVLLMAVEEATASREHLLSPASSGSPVDGGEAQGVVVTPPA
                     REREAGPGLTSSAAGQPPQMWSYTQVRATVVGYDGGVDSHQVRVDQESKKRTLRLYRL
                     RAGATAAARECVLELTDRHGGGIACVGDWQLPDAGTWGRERVALVLAVLPPALPSTPV
                     VCVPSVRNTVLIGLHSCGDLGSNICRVFRNSSARGLLLVSCCWHALTPHGFPLSRALQ
                     RRGLTTNSISLLLATQPLDAWSTASPEGHRSSAKLLFFRSLFKLLWRQLAGMWEAGRK
                     DGSVSRPSGCAHTDTLGGDDTCAFPDVPPHLEPAFLRRISREKDTLTFTQFVHAVAAE
                     YVYSGSSKDTPYTPWNIGRCCAVCRTAQEAHARYALTQQRLPETMGACFEEEHFASFL
                     GLTVLRMWMCHLVESLLLLDRALYLHEELSECHSRAAGAPADEAESSAVALVPLFDGA
                     LSPRMYGVLARRGGSACA"
     gene            <611591..>612388
                     /locus_tag="LDBPK_171420"
                     /db_xref="GeneID:13393277"
     mRNA            <611591..>612388
                     /locus_tag="LDBPK_171420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003859949.1"
                     /db_xref="GeneID:13393277"
     CDS             611591..612388
                     /locus_tag="LDBPK_171420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003859997.1"
                     /db_xref="GeneID:13393277"
                     /db_xref="UniProtKB/TrEMBL:E9BDG4"
                     /translation="MRPQRHRRRCTATPSLAFWLHVFSCSFRLTFLSYTALAPSLLGF
                     SIFLSPFRSLSTLALRVCVRMPDSFAFTATPLSSCATLVAHRCCMASPPFHSHSLNPW
                     CAHPRRLPRSPFHLVRSRGCALHRCCGTGAAASLGPLPLLQEKKGFRMPCLTASPSLV
                     SRAASQSTSLAPPPPLPLHRLLACPSSSHSCACPPPPTPSPALTLPPKRVLSLAPPRS
                     PSFLFSPHPLNTPLVPFPLTRWHRAVGRVHNECATCLCFLSLGSDFH"
     gap             613293..613391
                     /estimated_length=99
     gene            <613948..>615342
                     /locus_tag="LDBPK_171430"
                     /db_xref="GeneID:13393278"
     mRNA            <613948..>615342
                     /locus_tag="LDBPK_171430"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859950.1"
                     /db_xref="GeneID:13393278"
     CDS             613948..615342
                     /locus_tag="LDBPK_171430"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859998.1"
                     /db_xref="GeneID:13393278"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:E9BDG5"
                     /translation="MQSPITYGGSNDSGSLSGFPNTPPSSLPPRSPFMPRDDSGSTFA
                     GGESAPVRGHNDPYQMNANGGCSSPQYRLQLSGSSRDAAVEVESRSQSPNPHYTAHGT
                     PPPPPPLPVGTSVPQYGARTPSQHTSPTNANGTAASSYAPPGFSVPLKMASVSNGGSG
                     SYHGSLGGRGGSQSPSYGDPRASHSFPSTMSGGNGAPPLTFAAAMKQQQQSSSFQASS
                     YHGPARGGAYLASTPFGGPGMSGGSTGVTHRAEGPHFSDSYDTNTKTVTTMADETMSF
                     SSKSSSSASSIRDDLPLCPNDDACTLINDRKHQKKFAHTCRLLPCYHGHVARHAKLFR
                     HSPGQVSLPEGVSANMKISSHALASVNFSTISPEAPNAYRIYVSHGNKSYEIFGDWAS
                     VKVHTFKRYLHQVYHIAPSAQVLSVVKTGKVMDDDINTVKGFGIEEDSVVQLHSNIED
                     ATVSGRIGISLDDL"
     gene            <618335..>619060
                     /locus_tag="LDBPK_171440"
                     /db_xref="GeneID:13393281"
     mRNA            <618335..>619060
                     /locus_tag="LDBPK_171440"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859951.1"
                     /db_xref="GeneID:13393281"
     CDS             618335..619060
                     /locus_tag="LDBPK_171440"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003859999.1"
                     /db_xref="GeneID:13393281"
                     /db_xref="UniProtKB/TrEMBL:E9BDG6"
                     /translation="MPGFGSLWRWLRRESAIPGVVYSDQLQNIKEELERQQNIRWAGN
                     LRNVRLESAPHLIVRTSSSSAALPGPEEEPYTFWERIGLVPVHPSRVRARQYYHPITD
                     FALYDYDEVSPEEKELTAKWMARVMEFNAATPAGILCVTGCLVLPLHTVYRMPLLVAA
                     GITGVAVEVTRAYMAASQQRQDLDDFLLAKEIWYIKNVETYQLGIPRIPRGREREYQQ
                     YVDGGAPMQPQELPEELARDLHY"
     gene            <620051..>620974
                     /locus_tag="LDBPK_171450"
                     /db_xref="GeneID:13393280"
     mRNA            <620051..>620974
                     /locus_tag="LDBPK_171450"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859952.1"
                     /db_xref="GeneID:13393280"
     CDS             620051..620974
                     /locus_tag="LDBPK_171450"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860000.1"
                     /db_xref="GeneID:13393280"
                     /db_xref="GOA:E9BDG7"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:E9BDG7"
                     /translation="MPPSTAAPYALRTDKLKPLEGCVAGCSVSPAEAASQVASSLQPV
                     VLAICGSFNPIHNAHLKLYDAAKRSIDGAHGRVVLGGFLSPVGDAYRKPGLRSAADRF
                     QIMRKALCHHPDLNVDTWECQQPVYTRTFFVLQALEEHVNAWYAESEPAAMEWLTSHD
                     RRVRVVFVCGADLFSSFWIPGCWQLRLLRQLLDSFHLVVVHREGARGCVRGADDFAHI
                     CQTAPLLSETAVDGEKIEIDMSRYTFTFATFSAPDDTSSTAVRAAAMELAKTPLGDAV
                     TRAALQSRLRAMLPEAAVQSVVELYGEVLTS"
     gene            <621777..>622316
                     /locus_tag="LDBPK_171460"
                     /db_xref="GeneID:13393279"
     mRNA            <621777..>622316
                     /locus_tag="LDBPK_171460"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859953.1"
                     /db_xref="GeneID:13393279"
     CDS             621777..622316
                     /locus_tag="LDBPK_171460"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860001.1"
                     /db_xref="GeneID:13393279"
                     /db_xref="GOA:E9BDG8"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:E9BDG8"
                     /translation="MLEHDWSGGVLAVLALLVVTACGVISSCDVCGLSIVKQVMAPSD
                     RSDGGVPEATAVRSSPSTATETPMLELDDRPRGAAAGKANKYVEEFYQAAGHLRCPQL
                     QRYTQEEVARHRTKDDLWIVVDSNVLNVSAFVPHHPGGDVILDGVGGQDMATVFAYFH
                     DPSTVRLMLSFCIGRILLQ"
     gene            <623925..>625412
                     /locus_tag="LDBPK_171470"
                     /db_xref="GeneID:13393282"
     mRNA            <623925..>625412
                     /locus_tag="LDBPK_171470"
                     /product="L-gulonolactone oxidase, putative"
                     /transcript_id="XM_003859954.1"
                     /db_xref="GeneID:13393282"
     CDS             623925..625412
                     /locus_tag="LDBPK_171470"
                     /codon_start=1
                     /product="L-gulonolactone oxidase, putative"
                     /protein_id="XP_003860002.1"
                     /db_xref="GeneID:13393282"
                     /db_xref="GOA:E9BDG9"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /db_xref="UniProtKB/TrEMBL:E9BDG9"
                     /translation="MSAQSAASRWTNLAGIGSCHPTHHHYPTSTEEVQDAVELVRSQN
                     GKCRVAGAGKSPNTATFTNEHLIHMERMNRILSIDTVAHTITCEAGAVMEEVMRSVDK
                     VGLMVRCVPSYVRTTVGGCIATATHSSGSQCHCLSDYVRGLKIVDGCAQIRTLVAGKD
                     DAELRLAACHLGVIGIVTEVTLEVQPRVQWKLVSQPLPMKDATNAALVAEKVRSTEYY
                     RWWWVPHTDGCYESYGRVESTTDISALPPLPDALTARDDAPVQPSPAALQEASSASDS
                     SASLIVKSALKSIATDFVRHQVVEWSLWAACLYPAIQPYVNKAYQRVFFSAPQVQRGS
                     ALECFTFDCLFKQWANEWAIDASRAVEAFNRLRDMIDREGMLLHFPVEFRFTAPDVSD
                     MSPAVGRPTCWIGVVMYRPYGQEARDTRRCYDGFCHVMEEMGGRPHWAKYYDWGHREI
                     TAAYGDHWERFLALRRRMDPDDIFVNRWFRNLMSSDRVNSTACTP"
     gap             626007..626891
                     /estimated_length=885
     gene            <628473..>631088
                     /locus_tag="LDBPK_171480"
                     /db_xref="GeneID:13393283"
     mRNA            <628473..>631088
                     /locus_tag="LDBPK_171480"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859955.1"
                     /db_xref="GeneID:13393283"
     CDS             628473..631088
                     /locus_tag="LDBPK_171480"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860003.1"
                     /db_xref="GeneID:13393283"
                     /db_xref="GOA:E9BDH0"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:E9BDH0"
                     /translation="MAEPAFRGTLLLLQNRTRRDPESYRDEFLAQLDHFRAFSATVLS
                     QRSLNPQFIAVLNYVCHVGHCFPKDAAVIVNIVLELLRASKGNGLPMDLRLALVKSLI
                     LLRAKDLVSTDHTFPLFFELLQERDKTLRKLILTHVVSDIRKANMPGAKNGAQINKRA
                     QNFLFSVMAEDDPVQARCAEMVMIDLYRRRVWSDERTVEVLTKACFSKHTPILRTALR
                     FFLLQMPRITSVDDEDGEEQDPGRTISKLQQKMKIVKKTSKRERVLKRSVRGAKRKYD
                     RQEKEEALFAKQHVDPVRLLRDPQQFVERLLAKLQKTSERFEVRLLYLNVIARTVSEH
                     EVLHLPLYGFLERYMEPSQLHATQLLALSATCVHAMVPPDAIEPLLRTIANHFVSDRS
                     SADAITVGINTIREICKRQPLAMNADLLKDLAEYKNQRGDKGVMMAARALIQLYRDVY
                     PELLPAKLRGSKAGAADMATKPVYGSKHVYTDIPGLELLYQDIDNNAGNDESGSESSS
                     SEVDSSSGEWATDSDSEADADDVDGEFVDVPDSSAEEEDKSEDACPQLAPVHEHAHSA
                     ANRTDADGEGPRKRARLEEAAPVSVASQNGAALSESSTDDEDEGVDSDVDEDGEGVAS
                     DEENDDEESDDEESEDESEFGWEETSDDEESERDEESTAEAKEEEPASLSAALANANS
                     GADWFEDLTEGMSSRNASSSLRAGSVSSSKALSTTSISSSRLLTDSDFQKINQLRTQH
                     GSHQSLRGKRKERDAQSKKRHDLIHSISNDLDAHDIEHFTEKKRETDKQAKIEQAREL
                     RKASSTFELRRKKKSKLNSTHGEHSKRGKLFQMTKRSRRVAAKLKSSVADRATRAKEM
                     QKKDIKFRIKRGWKA"
     gene            <631885..>632274
                     /locus_tag="LDBPK_171490"
                     /db_xref="GeneID:13393284"
     mRNA            <631885..>632274
                     /locus_tag="LDBPK_171490"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859956.1"
                     /db_xref="GeneID:13393284"
     CDS             631885..632274
                     /locus_tag="LDBPK_171490"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860004.1"
                     /db_xref="GeneID:13393284"
                     /db_xref="UniProtKB/TrEMBL:E9BDH1"
                     /translation="MSVQAFFEFSSSILSPKYVGLSPFHAPKESRLDTSPPGVLSSMC
                     EYTICTKRALNTRIIGFAEPTLQQCVEELARALKATAFIQDKDATSALLRQRRGTVDP
                     SQLPWSPRPEYLAWLRAQGRLDETMLL"
     gene            <633002..>633484
                     /locus_tag="LDBPK_171500"
                     /db_xref="GeneID:13393285"
     mRNA            <633002..>633484
                     /locus_tag="LDBPK_171500"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859957.1"
                     /db_xref="GeneID:13393285"
     CDS             633002..633484
                     /locus_tag="LDBPK_171500"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860005.1"
                     /db_xref="GeneID:13393285"
                     /db_xref="UniProtKB/TrEMBL:E9BDH2"
                     /translation="MHHVRHLSPPSLAPSIFFYAFWPHADRQETQTSACCPVSLSFIH
                     TCTHERLSCAEVHRTALSPSFPIAARAYADHPARAWKKDSAAFHRGALRPFSHRTRSQ
                     PCQTFPLSSARWTASRQRQAPTATLSLSPSGSPLALACPPLTCTDEVPLAAVYRTRRT
                     "
     gene            <636564..>637427
                     /locus_tag="LDBPK_171510"
                     /db_xref="GeneID:13393289"
     mRNA            <636564..>637427
                     /locus_tag="LDBPK_171510"
                     /product="myo-inositol-1(or 4)-monophosphatase 1,
                     putative"
                     /transcript_id="XM_003859958.1"
                     /db_xref="GeneID:13393289"
     CDS             636564..637427
                     /locus_tag="LDBPK_171510"
                     /codon_start=1
                     /product="myo-inositol-1(or 4)-monophosphatase 1,
                     putative"
                     /protein_id="XP_003860006.1"
                     /db_xref="GeneID:13393289"
                     /db_xref="GOA:E9BDH3"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="UniProtKB/TrEMBL:E9BDH3"
                     /translation="MTQTALTEDELDDALGLAIRAANTAAFIINSAIDDRTNNIEAQI
                     RNNPNDLVTQYEKQCKEEVLNILRVGTPSYAILSDDVHSEAVLDDGPTWIVGPIDGTV
                     SFEHGLFDFCVSIALALRKEPILGVVCAPRLQEVFTAVKNRGAFSNGQRIHVSLVDSL
                     KQSVVLLHESCTRSDAAVRSVTAMQAELAKHPVQGLRCNGSAALDMCLVAAGRAELFW
                     EAGVNPWNVAAGVIIVREAGGVVHDVESTDAFDFTRRGVCCGCSLDVTKHGVELSLKH
                     NYRSSVLNTSS"
     gene            <638654..>639466
                     /locus_tag="LDBPK_171520"
                     /db_xref="GeneID:13393288"
     mRNA            <638654..>639466
                     /locus_tag="LDBPK_171520"
                     /product="otubain, putative"
                     /transcript_id="XM_003859959.1"
                     /db_xref="GeneID:13393288"
     CDS             638654..639466
                     /locus_tag="LDBPK_171520"
                     /codon_start=1
                     /product="otubain, putative"
                     /protein_id="XP_003860007.1"
                     /db_xref="GeneID:13393288"
                     /db_xref="GOA:E9BDH4"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="InterPro:IPR016615"
                     /db_xref="InterPro:IPR019400"
                     /db_xref="UniProtKB/TrEMBL:E9BDH4"
                     /translation="MDEGLPIDASEAQLEAIRREVAHYPLLSLSLPLNKESMIVKEME
                     HDDAYLAQTLSLFGASPVSTKQYDFDSIRYSRRDGNCFYRCAGFRLCELIVEHPDRAA
                     EYVALLKSREESLSRLFGLFVFDFTDALAEILQGVADKTITSVAQVYNRFISDDGAYV
                     LAALRYLISAYLQEHEEEYEPFVSGLGYGTVRDYCNAEVELVDHESDNVQLAAFAKAF
                     NVCIKVYALDRNAGNNITEYSFNGEDNDAGDRLVVGLLYMPGHYNLLGRGPG"
     gap             640050..640148
                     /estimated_length=99
     gene            <643809..>645302
                     /locus_tag="LDBPK_171530"
                     /db_xref="GeneID:13393286"
     mRNA            <643809..>645302
                     /locus_tag="LDBPK_171530"
                     /product="zinc-finger protein ZPR1, putative"
                     /transcript_id="XM_003859960.1"
                     /db_xref="GeneID:13393286"
     CDS             643809..645302
                     /locus_tag="LDBPK_171530"
                     /codon_start=1
                     /product="zinc-finger protein ZPR1, putative"
                     /protein_id="XP_003860008.1"
                     /db_xref="GeneID:13393286"
                     /db_xref="GOA:E9BDH5"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="UniProtKB/TrEMBL:E9BDH5"
                     /translation="MSEKEHDETPVTTEGPAAAHEGSKTDLNGKERRTNYIKTDLGEL
                     NMIESMCPKCQEMGTTRLMITSVPHFKEIIVSSFECQRCGEVNNEVAFGGTFGPKRVR
                     YELQVHSKQDLDRQVVKSEFATIAIPELELEIPPESQKGNLNTVEGILEQTYSGLQLQ
                     QPLRKIQHPDLYEKIEAFCAKLESFRSGDVPFTLTLDDPAGNSYIEPIHDYYHPTLDP
                     QLTKYEKERTEIDRQLLGIAIDYNTERTKEEEKDVEEGQFSDVTQILCDCPACRRPGH
                     LMMHECDIPYFKQTIIMAFKCEYCGYKSNEIKAGGEINPKGLRLTLHVKSEADLKRDV
                     LKSDTATLIIPEVRLELAPGTLGGFFSTVEGTITQVRDQLMNLPQAAFAAGDSADDNS
                     KTMLEFVKELDELLALREEFTFILDDPLGNVYIQNPCSHLPPPDDVDPKLEREEYTRT
                     EEQDEELGIRSMRHNEEQANIEKSEDEADHEAEEKDGAAAEEQETEQ"
     gene            <648878..>649651
                     /locus_tag="LDBPK_171540"
                     /db_xref="GeneID:13393287"
     mRNA            <648878..>649651
                     /locus_tag="LDBPK_171540"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859961.1"
                     /db_xref="GeneID:13393287"
     CDS             648878..649651
                     /locus_tag="LDBPK_171540"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860009.1"
                     /db_xref="GeneID:13393287"
                     /db_xref="UniProtKB/TrEMBL:E9BDH6"
                     /translation="MTAPESKGFAELYHQLLQDGVQLQKELEAYYLRQEGYIRKRVAV
                     LDEMQENIADERRCLELQHQECRAQISAARKQAASFLSDERKVSQAVRHAQPFLAAQE
                     AEIDKRLEELQREKEREDTALLNVMARQEALGKQEALLASRERQRFLEEQDLQKALIE
                     MRSLNREMEERRKSLLRKHGTVAEWDRKLESRERELLVCQDQLRENLKALEQEENALG
                     IHPAQRTAVAPAVSQRTVMDDHDMSIEHDSACEEIDYED"
     gap             652274..652372
                     /estimated_length=99
     gene            <652527..>654074
                     /locus_tag="LDBPK_171550"
                     /db_xref="GeneID:13393290"
     mRNA            <652527..>654074
                     /locus_tag="LDBPK_171550"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859962.1"
                     /db_xref="GeneID:13393290"
     CDS             652527..654074
                     /locus_tag="LDBPK_171550"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860010.1"
                     /db_xref="GeneID:13393290"
                     /db_xref="GOA:E9BDH7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:E9BDH7"
                     /translation="MLTGSDVLQTRERGLEGAQESMLPSFPSIQDAKKFGGSHLPDSV
                     SVAENCRDGSESDDVIKATPFRFVIVALFAAFGFINQVQYVAFASITRETQTYFGVSA
                     LEVNLLILLIPIVYVLGVIPGCFVYNKVGLRYGMIIGAALNAFASVLKLVAVWAPKYP
                     LLVVAQVFVAGGQILFLSLPPLIAGIWFPPNERTVATAVASLMGFAGMAVGMFYSPNV
                     IFLPDHNTRKEWGASMGSQFGFSTLVLLLMLALASDKPKHRPSFTSTEHYKLPLLKFL
                     KSQFEHLNFVLLTVAFGLITGFFTAVAGILAQLLEPFGISETKSGILAFSGILGGAAN
                     CALVGTFVDRTHYYKCTALTLAAISTALLLVVVIVAKAPTNLGAVTLAFYILVPFLAF
                     LVLPIVPVVMELAVELTYPCPETVSSTIVLASMCFVSFAGMVVFSLILGDKPTMDSSL
                     YVLLITLLVSAVSLGMLFFVKEQLRRKAQDKILCETGNGSASQAVKRPTAETDVPAAD
                     ARAQSPL"
     gene            <655785..>660083
                     /locus_tag="LDBPK_171560"
                     /db_xref="GeneID:13393291"
     mRNA            <655785..>660083
                     /locus_tag="LDBPK_171560"
                     /product="hypothetical protein, unknown function"
                     /transcript_id="XM_003859963.1"
                     /db_xref="GeneID:13393291"
     CDS             655785..660083
                     /locus_tag="LDBPK_171560"
                     /codon_start=1
                     /product="hypothetical protein, unknown function"
                     /protein_id="XP_003860011.1"
                     /db_xref="GeneID:13393291"
                     /db_xref="GOA:E9BDH8"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:E9BDH8"
                     /translation="MRAFAAARPLRFFVFVPWWREQLVPLCRAFPRLLDVMITLGLCL
                     LALGLTGVMGVGGELHQRCYITNTTGSSPYENLTLPFLLRNISAACGVGFSCPTVSAE
                     VTVQCLAIAHAHRDRFFTYDNAGAALLLMFKVASMDMWFENLEDIMNVKGASAALYLV
                     VVALVSLFLFVLLTSVVHGAYAPVDTWCAPSFTAKVGPAARQRQDCGVQTLPAWPKTR
                     QHCSARPTHAHQRTHSMDDGREVEGDVRRQNPLSGDGGGQQAPLYASRIPAEGTLVAR
                     EFPRHVRDFERDLHVLGFRAALRALEATTTTGAGGAPLLPLMASLVDSLPFVILLMVL
                     SVSSVMLLAVVSTSTPDSAARLLHAISASLAVFFIVPAVLRLMAFGLVRASVDVWNYA
                     DLLAAVSGVLELTAPSLFNYRVVGAVRVLRCVRVAKYLCPLYRYEYRLKGLLSLLLLT
                     SATLTLYALLGMQLFAGTYDAGAAPAPIRNGDFNTAWTALLACFRAFTGDMWTRYMVA
                     VSEGGTIATGSLFFLSLQLFSRMMLFAVGSSIIILGSRDSARDEDALCSNAFPPLLLL
                     PPLKKDDTTAAGAAVDTRNGARDLSPSPDAGATADRWRRRRRPGRQAAELATEKRLRV
                     RGDAFLFVGPMNPVRILLLRVLGSPFYTLISTLCVAIGVVALFFERRHLDADTERTLH
                     LVNIVCLVVFVVEMVMKWLAYGVVTQGWSDGEDHYREARPRYMPAYFRYPLNWVDFAA
                     NGLALAAVAYPPLRVGRVIRTPRLFTTQERPNKSFVELVKVLRCTMRVAPLIFFLYVA
                     FAVTAMQMFAGGLFRCSDAAVTTSADCFGDYNTTVMGYTGPTTSVRKRRWVRAGFHYD
                     AFGPALLSVFAMTTVNHWGNFMDDAMAITHTMTTYNHSGYCVVFFIVSLLLIRFFAVR
                     TMAAVFIAELRGVVMDSLGTAQRTPHQIRFVVSRECIAHLTQLQRLLPPLPTAVSRLC
                     HRILSAQPAHWPITVFDAVVQGVLVVVCGFVAATCAGESLWQKRMIVAVDCVAVALCG
                     AEVLLGMLAYGVRYLTRASYAADVVLFALMVVGVASPSLRFVTVVIFVKLIKAASTGL
                     ALLPAKRHIRMLLSSGALALLVLHAYAVVGTLLLGDIAPDGVYLTEKRNFSTVIRSLL
                     VLLDCSTFDQWHLVMNACFDGAACHSDASATCGHTYSAVIFFVSFIVIESLVVSQLML
                     ASAVVVFTVPLFTDVIQPFVDVRRAWQRGVGAGEPTCDFDTLLTLLPRFPASLTDGIT
                     SETSSKADLMAFLSSLRLPLDEHLRLRYADVLRGFAYRKYKVDLDDDHACSPARDRRM
                     YLTAGEYYGQLLVQRYCDEMSRLTHSTVGDARTLSTGPPAATPSSDGVGDHDVLRVHG
                     DDTLVPKGALPIPSSNVFLYTFPGESNKDGVFPLHIVEEQSGKQRGTGWRGGPT"
     gene            <660738..>662204
                     /locus_tag="LDBPK_171570"
                     /db_xref="GeneID:13393292"
     mRNA            <660738..>662204
                     /locus_tag="LDBPK_171570"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859964.1"
                     /db_xref="GeneID:13393292"
     CDS             660738..662204
                     /locus_tag="LDBPK_171570"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860012.1"
                     /db_xref="GeneID:13393292"
                     /db_xref="GOA:E9BDH9"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:E9BDH9"
                     /translation="MNDLSFFVLQHQRRTLTPQLLRDTLDFAKPHAEEGALFSWRWHF
                     FLGTLPLPAEDDMKLDDCRAACEQWRRQWQDAGRRLDQSIRESPRKTGKAIKFGESSS
                     DSEDALPPPSAVAPLSALSTSGDGCTVNPLAPASESSYALQFQADMVRQTVAKDMSRL
                     SWDAPPFHDVRAKETVADILLKYSLVENKDYMQGFHEIVAFLYYACYRDKVLGERFVQ
                     EHPALRSAAFFELFELVYADLPAAVYALFRRVISEKDGGMCLAKWYYSNAHGEQSGVV
                     LACQRVQKDLLSRVDPVLQNLLDTVYGIESVVYLVRWLRLLFLREFPFEQTLRIWTTL
                     FCERYIIVEQQKTTFALNNSIALYFAAQMLCHVHDALSVDAAGALQVLMKYPPTKHVD
                     DMLYAAAINNSESPLSRHAKAPRLVDAKDAPALPAEVTLRQGEVLARVIGSLEQYWFP
                     DASATAEEQALTTEMYVQSIAQLKKVRDVLLYGMGDEA"
     gene            <665415..>666572
                     /locus_tag="LDBPK_171580"
                     /db_xref="GeneID:13393296"
     mRNA            <665415..>666572
                     /locus_tag="LDBPK_171580"
                     /product="ferrochelatase-like protein"
                     /transcript_id="XM_003859965.1"
                     /db_xref="GeneID:13393296"
     CDS             665415..666572
                     /locus_tag="LDBPK_171580"
                     /codon_start=1
                     /product="ferrochelatase-like protein"
                     /protein_id="XP_003860013.1"
                     /db_xref="GeneID:13393296"
                     /db_xref="GOA:E9BDI0"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="UniProtKB/TrEMBL:E9BDI0"
                     /translation="MSCAPGPTKAVLLVNLGTTTAPTAPAVRRFLREFLSDRRVIDVP
                     RFLWHSVLYGFILPFRPRSITPLYKAIWIKSDSGVVINGKTEGSPLTLYSESLAAKVQ
                     ASVEKTSGGAVVARHAMRYGVKNIPSTLKALHDEFATLRELVVLPLFPQYTSTTSASI
                     YDEVFKFYTDTRRRSIPSLRTIRDYAEHPVYVEALGSSLLSSIKAHVTAKAGAAKDWK
                     SALSDQLPEIGIIITYHSIPVRYVEEHDDYPQRCEATTAAIKAYIEAESGVSLSGCLV
                     HVYQSQFGNQPWLGPTLNAAATAFPLPPHDPRKHAFSDAHRNTALLTKQANVCFAMAP
                     GFAVDCVETLNEIEREAGEVFKQSGGRQFIYVPCLNDSDTHVKVLTSVVGA"
     gap             666810..666908
                     /estimated_length=99
     gene            <667879..>668610
                     /locus_tag="LDBPK_171590"
                     /db_xref="GeneID:13393295"
     mRNA            <667879..>668610
                     /locus_tag="LDBPK_171590"
                     /product="hypothetical protein, conserved"
                     /transcript_id="XM_003859966.1"
                     /db_xref="GeneID:13393295"
     CDS             667879..668610
                     /locus_tag="LDBPK_171590"
                     /codon_start=1
                     /product="hypothetical protein, conserved"
                     /protein_id="XP_003860014.1"
                     /db_xref="GeneID:13393295"
                     /db_xref="UniProtKB/TrEMBL:E9BDI1"
                     /translation="MEFFQVVDPVTLAPASYAYVALQLALAVACAVLLGVCLHVLPER
                     LVRCSKTARPKVPREALAKAVTPASKLSVANKPSSSAAASATPSFSAAAPVGTAPKAQ
                     AKATAPAASAAVADSTLDDALEAFFDEEILLDEALLDATAPSALPEEETAPTNRTPGK
                     PTRPPPKKTGDFSTALAAKMAKGLRIKACPASTASLPQAQSKPPERNDTAEKELEDAL
                     DAYMEEEQLLDEAMLDSAVDAAHRT"
     gap             669900..669998
                     /estimated_length=99
CONTIG      join(FR799604.2:1..671483)
//
DBGET integrated database retrieval system