GenomeNet

Database: RefSeq
Entry: NC_018659
LinkDB: NC_018659
Original site: NC_018659 
LOCUS       NC_018659              88544 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Escherichia coli O104:H4 str. 2011C-3493 plasmid pESBL-EA11,
            complete sequence.
ACCESSION   NC_018659
VERSION     NC_018659.1
DBLINK      BioProject: PRJNA176127
            Assembly: GCF_000299455.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli O104:H4 str. 2011C-3493
  ORGANISM  Escherichia coli O104:H4 str. 2011C-3493
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 88544)
  AUTHORS   Ahmed,S.A., Awosika,J., Baldwin,C., Bishop-Lilly,K.A., Biswas,B.,
            Broomall,S., Chain,P.S., Chertkov,O., Chokoshvili,O., Coyne,S.,
            Davenport,K., Detter,J.C., Dorman,W., Erkkila,T.H., Folster,J.P.,
            Frey,K.G., George,M., Gleasner,C., Henry,M., Hill,K.K., Hubbard,K.,
            Insalaco,J., Johnson,S., Kitzmiller,A., Krepps,M., Lo,C.C., Luu,T.,
            McNew,L.A., Minogue,T., Munk,C.A., Osborne,B., Patel,M.,
            Reitenga,K.G., Rosenzweig,C.N., Shea,A., Shen,X., Strockbine,N.,
            Tarr,C., Teshima,H., van Gieson,E., Verratti,K., Wolcott,M.,
            Xie,G., Sozhamannan,S. and Gibbons,H.S.
  CONSRTM   Threat Characterization Consortium
  TITLE     Genomic Comparison of Escherichia coli O104:H4 Isolates from 2009
            and 2011 Reveals Plasmid, and Prophage Heterogeneity, Including
            Shiga Toxin Encoding Phage stx2
  JOURNAL   PLoS ONE 7 (11), E48228 (2012)
   PUBMED   23133618
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 88544)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 88544)
  AUTHORS   Johnson,S.L., Teshima,H., Chertov,O., Gibbons,H.S.,
            Bishop-Lily,K.A., Strockbine,N., Minogue,T., Rosenzweig,N.,
            Sozhamannan,S. and Detter,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2012) Genome Science B6, Los Alamos National
            Laboratory, PO Box 1663 M888, Los Alamos, NM 87545, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003290.
            RefSeq Category: Reference Genome
                        PHY: Based on Phylogenetics
            DNA and stock bacterial strain for this genome may be available
            upon request made to the authors.
            Annotation was added by the NCBI Prokaryotic Genomes Automatic
            Annotation Pipeline Group. Information about the Pipeline can be
            found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
            aware that the annotation is done automatically with little or no
            manual curation.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..88544
                     /organism="Escherichia coli O104:H4 str. 2011C-3493"
                     /mol_type="genomic DNA"
                     /strain="2011C-3493"
                     /host="Homo sapiens"
                     /db_xref="taxon:1133852"
                     /plasmid="pESBL-EA11"
                     /collection_date="2011"
                     /note="isolated from US citizen afflicted with HUS after
                     travel to Germany during the 2011 Escherichia coli
                     oubreak"
     gene            complement(join(86977..88544,1..1477))
                     /locus_tag="O3K_25572"
                     /db_xref="GeneID:13703856"
     CDS             complement(join(86977..88544,1..1477))
                     /locus_tag="O3K_25572"
                     /codon_start=1
                     /transl_table=11
                     /product="TraU protein"
                     /protein_id="YP_006781712.1"
                     /db_xref="GeneID:13703856"
                     /translation="MNINRLIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRE
                     RRPWLNSPYIAATKRGEYLSVFEVSGAFREMDEASDQTGSGSLESLITSMSDSLNTAY
                     KNSGHKISCVFERDPEMGKEEIEDMVAPQKRSLANTGIQLQDVVDEKVTTLSPWLVRE
                     RCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWTLSALKIRHEAFLD
                     NVEQALRHSSDGLILRLLDIHEVGREIRRQTERYSTPRNWQPHLPEDAQPAGYRWTDD
                     ESVLHAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAV
                     PWRIRMDLMPGGMKALNLKKTLLTYSSFISAVRPMYESVMTLAATDEKEPVCIMTIMA
                     STWGKTREICARNQAILKSAIEGWGVCGTTTTFGDPRRAWVNTILAASGGSGPVPLYP
                     PLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLASSQQNKHTELAPGDPGLGK
                     SVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPQERKDEAVGIILSND
                     PDYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELA
                     FKEYGENNPRLYRASTEELVDSALQDSGLYEKHDAAWWARSTWFEVRDMLHNAGYIMA
                     AQRAHYQAMPQLPEVSSMLGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMI
                     SGYTRFMINPETRVIAVDLNNVAGDKTPAGRLKTGIMYLLAGQIAGGDFTLPQYRDEV
                     LKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWENLDTQEREQRKFAIRT
                     VLSTQYLRDYPESVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEGPAPD
                     GSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKI
                     LAENFPRGSATSLIEHRAGQHNSDNVIEELASELIRKQGYNL"
     gene            complement(1567..2367)
                     /locus_tag="O3K_25577"
                     /db_xref="GeneID:13703764"
     CDS             complement(1567..2367)
                     /locus_tag="O3K_25577"
                     /codon_start=1
                     /transl_table=11
                     /product="TraT transfer protein"
                     /protein_id="YP_006781713.1"
                     /db_xref="GeneID:13703764"
                     /translation="MQHSIKDLWLYPFPEIDVVHTQEALLPEPELTTPGRCICCRQNV
                     RHRFRLDDSWPLRQLTDTISNTRVRLNKATEHLVKLIRRGEPVATGKKEKYNTAVKAA
                     ERALEHARLSARRLSLRHVQKAEITSTEPLSEKEQELFHEDGPPYSLCAFCHAWHSLN
                     GYAAAQGVMVWLPDLHPSTVVALNRRSLQEVFSNDKFRVRRGREALSALMQNRLAVED
                     KFRSFRPADFADVFRRYPPSGRSPLREKMNGIALILTPDSFIKKEYVD"
     gene            complement(2351..2539)
                     /locus_tag="O3K_25582"
                     /db_xref="GeneID:13703857"
     CDS             complement(2351..2539)
                     /locus_tag="O3K_25582"
                     /codon_start=1
                     /transl_table=11
                     /product="TraS transfer protein"
                     /protein_id="YP_006781714.1"
                     /db_xref="GeneID:13703857"
                     /translation="MSAWSPEHITLRRTENGNVIAHDSRDDQEFIFAECCSDEIANII
                     LEAVKCYTSTEPAHATQH"
     gene            complement(2603..3007)
                     /locus_tag="O3K_25587"
                     /db_xref="GeneID:13703765"
     CDS             complement(2603..3007)
                     /locus_tag="O3K_25587"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781715.1"
                     /db_xref="GeneID:13703765"
                     /translation="MSRIRVVAARLYAAFIHAQLFVMSCRSKLTKYLLLIPMMLLPKA
                     VLADGDLADMVRNVGEGAKTAQSSSITIAQFIGVILFLGGLIGLKKVGKQGGMGLAGC
                     IVSIVIGAVLVAGPEMMSRSQKQLGISSISIG"
     gene            complement(3058..3585)
                     /locus_tag="O3K_25592"
                     /db_xref="GeneID:13703766"
     CDS             complement(3058..3585)
                     /locus_tag="O3K_25592"
                     /codon_start=1
                     /transl_table=11
                     /product="TraQ protein"
                     /protein_id="YP_006781716.1"
                     /db_xref="GeneID:13703766"
                     /translation="MNMDALTAIENFASSIFSAGMDFLFTWGEFIGVISMITLFARAR
                     SAGPVKMSPGKFIAGMLTSCMLVSLPAMINAGGVQMGFRADSFGPIAYVQPQTFGAAA
                     GAANAVLSLAKLAGVGFVMNGISIWRKAGLDGHTALSASESVSKGNVKFIAGVLLVFI
                     DRVLNALLASIGIVF"
     gene            complement(3585..4289)
                     /locus_tag="O3K_25597"
                     /db_xref="GeneID:13703767"
     CDS             complement(3585..4289)
                     /locus_tag="O3K_25597"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781717.1"
                     /db_xref="GeneID:13703767"
                     /translation="MKPETEIDETGSFGEPEEKPAPFWKRSVWGISVATWGLCAVVLL
                     AAIWYLFLRAPSETGMPPFNDADAGVQTWQTTQESSPSVQSTETMTVRTGEDMSQLAR
                     DVKTELDNRDEKIQATLNMLHDSINKLGEAIKKDEEYAQETRRQLDDIRSRLNGIMTQ
                     KSVTESSSTPHPAKKKTSSVLNGMKIMSMETGMAWIRWQGSTWAVREGQTLGNVVIQR
                     IDPTTRTIITSAGTLR"
     misc_feature    complement(<3807..4052)
                     /locus_tag="O3K_25597"
                     /note="Septal ring factor EnvC, activator of murein
                     hydrolases AmiA and AmiB [Cell cycle control, cell
                     division, chromosome partitioning]; Region: EnvC; COG4942"
                     /db_xref="CDD:227278"
     gene            complement(4289..5578)
                     /locus_tag="O3K_25602"
                     /db_xref="GeneID:13703768"
     CDS             complement(4289..5578)
                     /locus_tag="O3K_25602"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781718.1"
                     /db_xref="GeneID:13703768"
                     /translation="MSAEQDAGKSGKKLAALLGLGSIILFGGGYIAFSKLSGSNSDMQ
                     SAVNINSAASGGTRSVTETPHYRELLRADNERGAAAAARNNQTFIASLPQGLDIPDTP
                     EKQQQPAAKPENYAHRQASGTPQEDRAASEKRMERLQKLIVRIKDQHPAGSTPTIATT
                     MWNKSPAETTGQNGTQQFALQNASLSTPVAEKGIQLIPALTRIPAYIDTAVDSDNPSS
                     KVIATIPAGPWAGATLFSPGVKLVGNGVEIHFDRMSWNGMDLKVNAYAQREDNLMSSV
                     ASNVNTRWFKHIILPSVLGGVGSIGTLYKDANTQVIQGNYGTVTGRVGMPSGEAVAGV
                     IAGGMAERGSQILTRQAESEPYKQVEVYQHEVVSILFVDPVMTNDARSSSLSSGISPS
                     VNRTSQAEQRSQARMQTAMEQRKAVMQRRYDEQPETP"
     misc_feature    complement(4454..4993)
                     /locus_tag="O3K_25602"
                     /note="DotG/IcmE is a homolog of VirB10 which forms part
                     of core complex in Type IV secretion system; Region: IcmE;
                     cd16431"
                     /db_xref="CDD:319757"
     misc_feature    complement(order(4454..4462,4469..4471,4481..4483,
                     4487..4495,4499..4501,4505..4507,4538..4567,4688..4690,
                     4697..4699,4703..4705,4712..4714,4721..4723,4727..4729,
                     4766..4774,4787..4801,4802..4804,4811..4813,4817..4819,
                     4823..4825,4832..4834,4838..4840,4844..4846,4850..4852,
                     4865..4867,4874..4876,4880..4882,4886..4888,4892..4894,
                     4898..4906,4919..4924,4931..4933,4943..4954,4958..4963,
                     4973..4978,4982..4987))
                     /locus_tag="O3K_25602"
                     /note="putative oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:319757"
     gene            complement(5581..6564)
                     /locus_tag="O3K_25607"
                     /db_xref="GeneID:13703769"
     CDS             complement(5581..6564)
                     /locus_tag="O3K_25607"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781719.1"
                     /db_xref="GeneID:13703769"
                     /translation="MQSRYLLSTLLLVCSAATSADNAGWQNARTPQTTNSASDHVQNA
                     SQNTGGVPATLVKGELPAPGQASPLVQDAARLDSELSADEIRSLRSLMADNERAINAP
                     ITSVVPRISSLTVNLSPGASLPLVRTAMNNLSVVTFTDINGSPWPQSDPPYNAAPKLF
                     DVQYNENMVTITPLRPWASGNISVYLKGLSVPVILNVTSGETDTPSSSQEMDSRLDLR
                     IPRQGPTSPVVSIPTDKIALHDATLQAFLDGIPPRDPSVKRLKFTGNVPDTTIWQHGD
                     DLLVRSRAMLRDEFEQTLSSADGTHLWKLPVTPLLTFSVNGQSVHVTPELE"
     misc_feature    complement(5602..6327)
                     /locus_tag="O3K_25607"
                     /note="Putative outer membrane core complex of type IVb
                     secretion; Region: T4BSS_DotH_IcmK; pfam12293"
                     /db_xref="CDD:315056"
     gene            complement(6575..7267)
                     /locus_tag="O3K_25612"
                     /db_xref="GeneID:13703770"
     CDS             complement(6575..7267)
                     /locus_tag="O3K_25612"
                     /codon_start=1
                     /transl_table=11
                     /product="TraM protein"
                     /protein_id="YP_006781720.1"
                     /db_xref="GeneID:13703770"
                     /translation="MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKAL
                     LCTGTCLLISITGNAIQYWHSTNVEREYFATDNGRLVRLAPTSQPAWSQNDAMAFGSQ
                     ALATAFNLDFVHYRSQISSLSPRFSDEGFVGYVNALQASNILETIKKEKMNLTATTGA
                     GVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPRLKPSGMEI
                     RQMISRNAGPNS"
     misc_feature    complement(6596..6994)
                     /locus_tag="O3K_25612"
                     /note="inner membrane protein IcmL/DotI; Region: IcmL;
                     cd16385"
                     /db_xref="CDD:319861"
     gene            complement(7264..7611)
                     /locus_tag="O3K_25617"
                     /db_xref="GeneID:13703771"
     CDS             complement(7264..7611)
                     /locus_tag="O3K_25617"
                     /codon_start=1
                     /transl_table=11
                     /product="F pilus assembly"
                     /protein_id="YP_006781721.1"
                     /db_xref="GeneID:13703771"
                     /translation="MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARA
                     AADAWSQRENDVSSSLQSCLSRIKKISINLPQFPSLDDILSQLENQVCDAVVDKVNEK
                     LPGNIDPWKDYNL"
     gene            complement(7629..11393)
                     /locus_tag="O3K_25622"
                     /db_xref="GeneID:13703772"
     CDS             complement(7629..11393)
                     /locus_tag="O3K_25622"
                     /note="COG4643 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="SogL protein"
                     /protein_id="YP_006781722.1"
                     /db_xref="GeneID:13703772"
                     /translation="MPSVSRYRTWLAVPADEIEDLKKAHPPMNGHTPVLWDKDHKLWF
                     ARPGADLSMLDRWLPRPQEVSMNGSDPVTEFAQVLENAGLVLKELPVMDGKIHRVPTA
                     GDKKGQKSGAYRGFLDGRPAGWYRDYRSADDSPVTWTFSGGEQTDPRARLHLKAHSMQ
                     RREDAERELKAQYNRQAAYARRYVSKWPQATAHEYLTRKGIQAAPGVRINDKNELVIP
                     FSNRNGAIRSYQRIPVTGGKDARILKDSEKTGNWFALGTPRNGQPVLFAEGYATAASL
                     HEATGLPVLMTVDAGNMIIVAEEARQKWKQSPFIFCADNDHARQVNKGIVSATKAAEL
                     TGGSVIFPAFTDAEKAQGLTDFNDLDASRGRAAFLHVINAQLEHIGVSTPNSNTPEIR
                     EALVIGNLVFTPVHTEEKTMTPTEYPETSPDTGHSHDQGPSLPSATQQVQPAASSGNI
                     ADETQPFTSHATENNGKDERHPDNVQAQTESSVVQDAPAESPASPESTTASAPDELAH
                     PAEPPEKVVSVATDKDWREFEAELSQPEKNELQQESGTSPEIPAPAAPAAPEDSPSSE
                     TMNESTEPSPSPDAVKEEMTVMTEPDDKQSTGISPDTPREEAVSHVTEDIPLQPEPFL
                     PESDGPEEYEDYSAYQELMNNENPEHLQENSDMPSQPDTGHVQADESELQATTATIEP
                     AVRDEPTPQQPVQSTSPSDNTSSFLDKARGLFTRKKTDSQAHENSDPTPSAETTTTPP
                     IPDSIVYAPERSDAPISLNMDEILKELDWEKRADRTVLYKLDGKPAFIDRVNRLEMVN
                     GASNDDRSVLAALAVATKFYGGVIELTGSDAFKQKAMQLIIEHNIDVRMKLPDQRAEL
                     EKLRKEMAVSKDAVVTHQPTPELNRNTPEQPAVPDPVQEKEATQSPASPAATESSTVS
                     TAPASSPTEPGKTADAAPGEEPPGKLRPGESVTAVLHNFGRAEYAPGKGESFFVELKN
                     RSGSKLYWGEQLESLVKNHQKGDVVTLTLQNREQFILPGEQKARFRNKWSMESVTNGI
                     SVSHDNPDKGQRIQAIPVETFMKVAAQISQGWPEEMKALRMPENVGSHLFIGEDRHPV
                     SAPQNANQVTEITSAAPDKLTPVLGSVDKDTRELNLLLVQSADEHLQGVVRLNGTLYP
                     ALATPSADNSQLVINALTDKGLRFAGYGEAVNHDADSTNRPAPELMQFHLKTREEPLF
                     AAVYTPEKQPDALYRNLGFEQSWQQWSNSQKPEDRQEKTLHQDLSHSPGR"
     misc_feature    complement(10266..11174)
                     /locus_tag="O3K_25622"
                     /note="Uncharacterized domain associated with
                     phage/plasmid primase [Mobilome: prophages, transposons];
                     Region: COG4643"
                     /db_xref="CDD:226990"
     misc_feature    complement(<9117..>10100)
                     /locus_tag="O3K_25622"
                     /note="DnaJ-class molecular chaperone with C-terminal Zn
                     finger domain [Posttranslational modification, protein
                     turnover, chaperones]; Region: DnaJ; cl28246"
                     /db_xref="CDD:333066"
     misc_feature    complement(<8565..>9068)
                     /locus_tag="O3K_25622"
                     /note="conjugal transfer relaxase TraI; Provisional;
                     Region: PRK13878"
                     /db_xref="CDD:237539"
     gene            complement(11483..12034)
                     /locus_tag="O3K_25627"
                     /db_xref="GeneID:13703773"
     CDS             complement(11483..12034)
                     /locus_tag="O3K_25627"
                     /note="COG1502
                     Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
                     n synthases and related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="EDTA-resistant nuclease"
                     /protein_id="YP_006781723.1"
                     /db_xref="GeneID:13703773"
                     /translation="MSGKKTIVTLLRVSLLACPLLFTTPSFAMIDTPSVKVGFSPEGS
                     ASALVLDTINSAESSIRMMAYSFTDPDVMHALAKAKKRGVDVRIVVDDKGNTNRASRE
                     AMKYINLLDIPLRTVDVFPIHHDKVIIVDGNTVETGSYNFSRAAARKNSENVVVLKNM
                     PDVAAQYLEHWQDRWNKGTDWRP"
     misc_feature    complement(11507..11935)
                     /locus_tag="O3K_25627"
                     /note="Catalytic domain of EDTA-resistant nuclease Nuc
                     from Salmonella typhimurium and similar proteins; Region:
                     PLDc_Nuc; cd09170"
                     /db_xref="CDD:197267"
     misc_feature    complement(order(11579..11581,11612..11614,11618..11620,
                     11657..11659,11663..11665))
                     /locus_tag="O3K_25627"
                     /note="putative active site [active]"
                     /db_xref="CDD:197267"
     misc_feature    complement(11663..11665)
                     /locus_tag="O3K_25627"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197267"
     gene            complement(12336..13484)
                     /locus_tag="O3K_25632"
                     /db_xref="GeneID:13703774"
     CDS             complement(12336..13484)
                     /locus_tag="O3K_25632"
                     /note="COG2805 Tfp pilus assembly protein, pilus
                     retraction ATPase PilT"
                     /codon_start=1
                     /transl_table=11
                     /product="TraJ transfer ATPase"
                     /protein_id="YP_006781724.1"
                     /db_xref="GeneID:13703774"
                     /translation="MNIPDEFGLFPFQRFTADELRHFFVWCAAHKVSDVDLTGGSPVS
                     VSRFGRRVRCSSATLPTTLMSSLIDELFGREVIPRVLAGNPVDRTIQINGDASGRYGL
                     KRGERIRLRSHLIQGTSGAEEKAISITMRVIPTEIPDILSMNIEPDLLEAMVCKSGLG
                     FVCGETGSGKSTLCSALYRYIMDNFPDAKIVTYEDPVEYILGNENDLLPPHQAEIGRD
                     VVSFAAGLRSAVRRNPEIIGVGEIRDNETADAAVQAGNTGHYCLSTMHTKSPGETLAR
                     LLGLFPPVIRDSMAWAVLSLLQFILVQVLVRTNDGGRKAVREYIVINDELRDNLSGMP
                     HAEWGHHIDAIIRQEKRRIRDQILEMYIRNEVDRREAILFIPPGELRS"
     misc_feature    complement(12345..13457)
                     /locus_tag="O3K_25632"
                     /note="Type II secretory pathway ATPase GspE/PulE or T4P
                     pilus assembly pathway ATPase PilB [Cell motility,
                     Intracellular trafficking, secretion, and vesicular
                     transport, Extracellular structures]; Region: PulE;
                     cl28318"
                     /db_xref="CDD:333138"
     gene            complement(13481..14299)
                     /locus_tag="O3K_25637"
                     /db_xref="GeneID:13703775"
     CDS             complement(13481..14299)
                     /locus_tag="O3K_25637"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_006781725.1"
                     /db_xref="GeneID:13703775"
                     /translation="MKALTSLLLPVILLTGCSSSPTISPGGVNTPPPDINAWLKPRSE
                     KPDSLSETRWKMLTDAGKTLGFRGGKAQRSWELIQALNARESTLNALYDFRPLISPEG
                     WLPPVIDEAQDVAHITPDQIRTSSRVWTIIRPERFVSNPPGWRDWLLRGLSTTATPGT
                     EGSVVPEDSVQRKVWETALRQGWQEGRQNADLTLEANQKTLTRDYRGMMLYSLLWRQG
                     MITRPDVSDQMQTVTGDGKKLVTGDRVRRLKNHAEFNLQKSHWRPLIGTEGGSR"
     misc_feature    complement(13514..14146)
                     /locus_tag="O3K_25637"
                     /note="Type IV secretory system, conjugal DNA-protein
                     transfer; Region: T4SS_TraI; pfam16932"
                     /db_xref="CDD:319015"
     gene            complement(14296..14754)
                     /locus_tag="O3K_25642"
                     /db_xref="GeneID:13703776"
     CDS             complement(14296..14754)
                     /locus_tag="O3K_25642"
                     /codon_start=1
                     /transl_table=11
                     /product="TraH lipoprotein"
                     /protein_id="YP_006781726.1"
                     /db_xref="GeneID:13703776"
                     /translation="MNRIIPAGCLAALFLAGCNSPSQHTPVPRNYGAASDVAVTRHTQ
                     YTLWDKGVFSGQLPVSTGSHLLTANSDRLSFDWEGDAIELLNELARVRGMQFNYNGVR
                     LPLPVNLHVRDMTFSNTLRLIEAQTAWRATIHQYPGLLQVSFMQPENRKK"
     misc_feature    complement(14323..>14541)
                     /locus_tag="O3K_25642"
                     /note="DotD protein; Region: DotD; pfam16816"
                     /db_xref="CDD:318918"
     gene            complement(15149..15733)
                     /locus_tag="O3K_25647"
                     /db_xref="GeneID:13703777"
     CDS             complement(15149..15733)
                     /locus_tag="O3K_25647"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide core heptose(II)-phosphate
                     phosphatase"
                     /protein_id="YP_006781727.1"
                     /db_xref="GeneID:13703777"
                     /translation="MMKPRSSYSKTAFILLFSVFLVAAVTKAKSSLPDITLEQAKEIN
                     ADNTVIFLFRHGERCDRSDMPCYSDKSGITITGTEKAQQEGIKFATIFSEYDIYSSNA
                     VRTIQTAKFFSGKEPVVMDSLSDCNNDLYKTLESIARESHKRNIVIMTHNHCLSFLAR
                     DRLGKKFKPAYLDALIMHYDGTRLILDGKYNKEA"
     misc_feature    complement(15155..15733)
                     /locus_tag="O3K_25647"
                     /note="lipopolysaccharide core heptose(II)-phosphate
                     phosphatase; Provisional; Region: PRK15416"
                     /db_xref="CDD:185314"
     misc_feature    complement(order(15278..15283,15422..15424,15569..15574))
                     /locus_tag="O3K_25647"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132716"
     gene            complement(15793..16995)
                     /locus_tag="O3K_25652"
                     /db_xref="GeneID:13703778"
     CDS             complement(15793..16995)
                     /locus_tag="O3K_25652"
                     /codon_start=1
                     /transl_table=11
                     /product="F pilus assembly"
                     /protein_id="YP_006781728.1"
                     /db_xref="GeneID:13703778"
                     /translation="MMKKNHITRTIIASAVLFSFNAAAATSYFEARNDAMGGTGVASS
                     HYGVAPLANPALLTKHNSNDDFSLLLPSVGAQVADPNDVSNKADDVKDDWDLFDSAVD
                     NQHGVQQAAANLKHRLQEFRNINADAQVGVSAVAAMANDTLPFALMVKSYGTVSVNGK
                     VNDADLDYLDKVANGTITDVDKNALTSRAFGRAAVITDVGISFAKELETAGQKWSLGV
                     TPKYQRVDLFNYNVTVRDYDKDDFDGDKYHNTKNGFNADIGAYTDLNDNWTVGLVAQN
                     IIPRSIDTKVVNGFKETFKVRPQATAGVSWHNDLFTTALDVDLTPASGFTSDSKRQFA
                     SVGAEFNAWKWAQLRAGYRQNMASNSGSAFTAGVGISPFDVVHIDVSGLVGTDHDYGA
                     MAQLQFTF"
     misc_feature    complement(16042..16842)
                     /locus_tag="O3K_25652"
                     /note="F plasmid transfer operon, TraF, protein; Region:
                     TraF_2; pfam13729"
                     /db_xref="CDD:316268"
     gene            complement(17081..17905)
                     /locus_tag="O3K_25657"
                     /db_xref="GeneID:13703779"
     CDS             complement(17081..17905)
                     /locus_tag="O3K_25657"
                     /note="COG0457 FOG: TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="F pilus assembly"
                     /protein_id="YP_006781729.1"
                     /db_xref="GeneID:13703779"
                     /translation="MRLNTTGIAARMMLSLDKKAIGEKLINGRQINPTPLQVRYPQGV
                     REVLGIMSEQLAISTADLTRILLEDALHNMFMPADNTTGNIISRIEYIMLSHDINAPL
                     LATLLSPWNIRSTVIQDPARLADYLSADALEHLAECFNLNPDWLNGHENYPIALSGEW
                     PDTADNFRMLINDSSNTEVIFWHSFPFAGNTKREYCGVILRQEKEINGSVIYPALSLS
                     PTLLNDEKRKWLTEYTTRQNTTMSLRRVTLRPGLAENLITGQILPVSLFNTSLLPW"
     gene            complement(18056..19210)
                     /locus_tag="O3K_25662"
                     /db_xref="GeneID:13703780"
     CDS             complement(18056..19210)
                     /locus_tag="O3K_25662"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="shufflon-specific DNA recombinase"
                     /protein_id="YP_006781730.1"
                     /db_xref="GeneID:13703780"
                     /translation="MPSPRIRKMSLSRALDKYLKTVSVHKKGHQQEFYRSNVIKRYPI
                     ALRNMDEITTVDIATYRDVRLAEINPRTGKPITGNTVRLELALLSSLFNIARVEWGTC
                     RTNPVELVRKPKVSSGRDRRLTSSEERRLSRYFREKNLMLYVIFHLALETAMRQGEIL
                     ALRWEHIDLRHGVAHLPETKNGHSRDVPLSRRARNFLQMMPVNLHGNVFDYTASGFKN
                     AWRIATQRLRIEDLHFHDLRHEAISRFFELGSLNVMEIAAISGHRSMNMLKRYTHLRA
                     WLLVSKLDARRRQTQKVAAWFVPYPAHITTIDEENGQKAHRIEIGDFDNLHVTATTKE
                     EAVHRASEVLLRTLAIAAQKGERVPSPGALPVNDPDYIMICPLNPGSTPL"
     misc_feature    complement(18392..18856)
                     /locus_tag="O3K_25662"
                     /note="Shufflon-specific DNA recombinase Rci and
                     Bacteriophage Hp1_like integrase, C-terminal catalytic
                     domain; Region: INT_Rci_Hp1_C; cd00796"
                     /db_xref="CDD:271177"
     misc_feature    complement(order(18395..18397,18404..18406,18434..18436,
                     18467..18472,18476..18481,18488..18493,18641..18643,
                     18647..18649,18653..18655,18758..18763,18770..18772,
                     18815..18817,18824..18829))
                     /locus_tag="O3K_25662"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:271177"
     misc_feature    complement(order(18398..18400,18494..18499,18506..18508,
                     18746..18748))
                     /locus_tag="O3K_25662"
                     /note="active site"
                     /db_xref="CDD:271177"
     misc_feature    complement(18107..18313)
                     /locus_tag="O3K_25662"
                     /note="HicB family; Region: HicB; cl23837"
                     /db_xref="CDD:329114"
     gene            20231..20350
                     /locus_tag="O3K_25667"
                     /db_xref="GeneID:13703781"
     CDS             20231..20350
                     /locus_tag="O3K_25667"
                     /note="putative PilVB C-terminal segment"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781731.1"
                     /db_xref="GeneID:13703781"
                     /translation="MAETEVVPIDMPDSNGEMTWQAKNYTQYSSYFMKITCLK"
     gene            complement(20375..20581)
                     /locus_tag="O3K_25672"
                     /db_xref="GeneID:13703782"
     CDS             complement(20375..20581)
                     /locus_tag="O3K_25672"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781732.1"
                     /db_xref="GeneID:13703782"
                     /translation="MSFKLLQHRPQVGAFLEQQLPVQLENVLQVAAEYAPHELVTYGL
                     PGHSHQPITHGRLRAIQPKIRMVQ"
     gene            complement(20844..22280)
                     /locus_tag="O3K_25677"
                     /db_xref="GeneID:13703783"
     CDS             complement(20844..22280)
                     /locus_tag="O3K_25677"
                     /codon_start=1
                     /transl_table=11
                     /product="shufflon protein A"
                     /protein_id="YP_006781733.1"
                     /db_xref="GeneID:13703783"
                     /translation="MGNLMKKYDRGWASLEIGAALLIVMIIVAWGAGIWQDYLKTKGW
                     QAEARLVSNWASAARSYIGKNYTTLQASSTTSTPAVITTTMLKNTGFLSSGFIETNSE
                     GQRLQAYVVRNAQNPELLQAMVVSSGGTPYPVKALIQMAKDITTGLGGYIQDGKTATG
                     ALRSWSVALSNYGAKSGNGHIAVLLSTDELSGAAEDTDRLYRFQVNGRPDLNKMHTAI
                     DMGSNNLNNIGAVNAQTGNFSGNVNGVNGTFSGQVKGNSGNFDVNVTAGGDIRSNNGW
                     LITRNSKGWLNETHGGGFYMSDGSWVRSVNNKGIYTGGQVKGGTVRADGRLYTGEYLQ
                     LERTAVAGASCSPNGLVGRDNTGAILSCQSGTWKTSGSLNGSYTNLGSHRGSFSGRNS
                     GGSTLFIYASGGNGGSAGGACANTSRLQGYVGGTLISVNASNNPAYGKTAFISFAVPA
                     GTSYQITSYPTENTSCGAGVFSVFGYQT"
     misc_feature    complement(21186..22268)
                     /locus_tag="O3K_25677"
                     /note="Bacterial shufflon protein, N-terminal constant
                     region; Region: Shufflon_N; pfam04917"
                     /db_xref="CDD:113681"
     gene            complement(22268..22924)
                     /locus_tag="O3K_25682"
                     /db_xref="GeneID:13703784"
     CDS             complement(22268..22924)
                     /locus_tag="O3K_25682"
                     /note="COG1989 Type II secretory pathway, prepilin signal
                     peptidase PulO and related peptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="PilU prepilin peptidase"
                     /protein_id="YP_006781734.1"
                     /db_xref="GeneID:13703784"
                     /translation="MQTIVGISLSPVYILPLMFIFSIIGRTLLFRVRYFLSDTEHLWY
                     KTHTAVLSGIWLYSIAVALIILSPSQLLYRIHAVLILSFMLQMAVTDALTGLLPGTFT
                     RRFLIAGILSQITTDIWWLRATEIVSAAIVLFCLHKLVNRHRLNIGTGDLWLIAGITA
                     WSGLYNAIWSVLLGAGGFVLWHSTWCIKGHKEGPLGPWLCLGHVLLLLDNLYQPLWVI
                     "
     gene            complement(22909..23469)
                     /locus_tag="O3K_25687"
                     /db_xref="GeneID:13703785"
     CDS             complement(22909..23469)
                     /locus_tag="O3K_25687"
                     /note="COG0741 Soluble lytic murein transglycosylase and
                     related regulatory proteins (some contain LysM/invasin
                     domains)"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV prepilin cluster"
                     /protein_id="YP_006781735.1"
                     /db_xref="GeneID:13703785"
                     /translation="MSGGKVPLRLISLILLCSLIYPARASYIAPKQIWTNKWDNCFAA
                     AGARYQIEPLLLKAISAGESSLKPGAININKDRKTGKASSTDYGLMQINSTHIPKLIK
                     MGVIKKSEDLITKPCLNIHIGSWILARHFQICGVSWNCLGSYNAGFRKDRHETREQYA
                     NKVWRIYRDMKGICLPGQGGRQCRQS"
     misc_feature    complement(22954..23358)
                     /locus_tag="O3K_25687"
                     /note="lysozyme_like domain. This contains several members
                     including Soluble Lytic Transglycosylases (SLT), Goose
                     Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:320832"
     misc_feature    complement(order(23038..23040,23092..23094,23191..23193,
                     23281..23283))
                     /locus_tag="O3K_25687"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(23281..23283)
                     /locus_tag="O3K_25687"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(23479..24093)
                     /locus_tag="O3K_25692"
                     /db_xref="GeneID:13703786"
     CDS             complement(23479..24093)
                     /locus_tag="O3K_25692"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV prepilin cluster, prepilin"
                     /protein_id="YP_006781736.1"
                     /db_xref="GeneID:13703786"
                     /translation="MLIQNIDVNALKKNEKETSHDKGWGIMEQGAIALVVIIVLALVF
                     GGLYMLRSRTGVANESSNIQTIITSTQGLLKGSDGYTFTSGTKMTGALIQMGGVPKTM
                     TVRGTPSSGTATLYNSWGGAVTVAPASTSGFNNGFTVTYEKVPQDACIQIATQISRTG
                     LTNGITLNSTTHNDGKVTTEEASAQCTADNGSTGTNKLIFTING"
     misc_feature    complement(23485..23919)
                     /locus_tag="O3K_25692"
                     /note="PilS N terminal; Region: PilS; cl27040"
                     /db_xref="CDD:331861"
     gene            complement(24110..25195)
                     /locus_tag="O3K_25697"
                     /db_xref="GeneID:13703787"
     CDS             complement(24110..25195)
                     /locus_tag="O3K_25697"
                     /note="COG1459 Type II secretory pathway, component PulF"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane protein"
                     /protein_id="YP_006781737.1"
                     /db_xref="GeneID:13703787"
                     /translation="MREMNFSQRLRRFIVRKTFSAPYRVQFYEALRFLLENKQPLKTA
                     LEQMRDAWTDFGRKWHPFAELATDCIESLRENSGENSLEYTLGLWVPQEEAAVISAGI
                     RSGSIVDALQFATTLTDAKKQLHQAIWQMAIYPVGLLIMMTGTLYVLNTELIPVLSKI
                     SSPDSWSGALGFLYGLSLFVDNYGAICAVLFAVVTGVISWSLKNWKSRSLADNIMPWS
                     IYKDIQGAAFLLNMAALLKAKMTTLNSLNVLQDFASPWLSTRLDSIIYRVRQGDHLGL
                     ALRQCGYQFPSREAANFLSLLQGDGATELIGNYGQRWLVQTLERVKKRAAVVRLIMLI
                     FLVMSLLLLVMAVVDIQSIGDNSMGNL"
     misc_feature    complement(24356..25117)
                     /locus_tag="O3K_25697"
                     /note="Type II secretory pathway, component PulF [Cell
                     motility, Intracellular trafficking, secretion, and
                     vesicular transport, Extracellular structures]; Region:
                     PulF; cl28336"
                     /db_xref="CDD:333156"
     gene            complement(25208..26761)
                     /locus_tag="O3K_25702"
                     /db_xref="GeneID:13703788"
     CDS             complement(25208..26761)
                     /locus_tag="O3K_25702"
                     /note="COG2804 Type II secretory pathway, ATPase PulE/Tfp
                     pilus assembly pathway, ATPase PilB"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV prepilin cluster, ATP-binding protein"
                     /protein_id="YP_006781738.1"
                     /db_xref="GeneID:13703788"
                     /translation="MDKYNLKDALLFISRGDTHEILIETNQRTRPDVQSNLQELLNLY
                     PDIIPKVVSLSELQEAGQDDENKGPKERIIHLKDLADVSESEKKVLSYFETARKLGAS
                     DIHFLISESIFKVRMRIFGELQTVDEDQPALGYSLCATAILSMADVTETSFFPQREQD
                     ARLSPQLMRKIGIFGARYSHRPTGDGLIAVMRLIPDDGDKVPTFKQLGFIPEQIRLLN
                     VMLRRPEGKIVLSGPTGSGKSTTLRSACRVYLDDNQGRHLLTIEDPLEGQILGATQTP
                     IICDKSDEEAVKLAWSRAISSAMRLDPDAIMEGEMRDLVSMMSTTYAAQTGHIVLTTL
                     HTNSALGIPERMITMGMNADLICDAQLLIGMISQRLVPTLCPSCRIPWEKRVPELSED
                     DRAYLERHCNKDSLCSTDNIWFRNPHGCSDCNHDVIINGRKRGEIGKGLTGRTVIAEV
                     IEPDNRLFQILKTRGKVAARKYWLENMHGISRVEHLLRRINEGLVDPLEADRIIPLDE
                     DERLSIDDA"
     misc_feature    complement(25247..26710)
                     /locus_tag="O3K_25702"
                     /note="Type II secretory pathway ATPase GspE/PulE or T4P
                     pilus assembly pathway ATPase PilB [Cell motility,
                     Intracellular trafficking, secretion, and vesicular
                     transport, Extracellular structures]; Region: PulE;
                     cl28318"
                     /db_xref="CDD:333138"
     gene            complement(26772..27224)
                     /locus_tag="O3K_25707"
                     /db_xref="GeneID:13703789"
     CDS             complement(26772..27224)
                     /locus_tag="O3K_25707"
                     /codon_start=1
                     /transl_table=11
                     /product="putative conjugative transfer PilP protein"
                     /protein_id="YP_006781739.1"
                     /db_xref="GeneID:13703789"
                     /translation="MRPGKSLIIPSIFFFSGFSFATTQPLVTIGELEAQQNRNILLQA
                     KVQGAQLQKQLEESDVNLSSETVSGFSGMTASLPSVSEQPTSKNRKELPVIMEINGKD
                     KRLHAVLRMADGRQTSVTTGSQLPGTSVTVKSISLSGVTLSDGTTLTF"
     misc_feature    complement(26796..27146)
                     /locus_tag="O3K_25707"
                     /note="type IV pilus biogenesis protein PilP; Region:
                     pilP_fam; TIGR03021"
                     /db_xref="CDD:274394"
     gene            complement(27211..28506)
                     /locus_tag="O3K_25712"
                     /db_xref="GeneID:13703790"
     CDS             complement(27211..28506)
                     /locus_tag="O3K_25712"
                     /codon_start=1
                     /transl_table=11
                     /product="PilO protein"
                     /protein_id="YP_006781740.1"
                     /db_xref="GeneID:13703790"
                     /translation="MADEDINPVVLLADPKVNHRVWAACLKWTPVVKKQRVPSHHKHK
                     YHVKPRRLTSLKVTVGSRNSRGKISRLTGTGILTRPERNHYFSLALAFCSWVRNGYGV
                     FRYSDKELLFLASINGQPAVMADLSGNDADVAQKVSLFLAMNEEPPEKWQVVSSLEHP
                     DNWESIITRLSSADLRRCKLTVGNRSKFTLPAVLFLVAAGAGTVFWMTQPEPDVGPTA
                     EEIAARARLQFKKPEPPPELPHPWASQPVISDFLKACADLRKPSPVALEGWKLTGGTC
                     TPETFTLIYERQPGGTIEGFLARSKEIFNVIPDFNLKDGARLASVTRLLPSLPRRDEA
                     VPAPSEQLMRVFTWFQKKQLTPAINEIAIPEPLPGNNGEPAPVQKWKEYQFSLSTPVN
                     PDALFPLFQDTGVRLSNIHFELNGGTFSYSSEGHIYASR"
     misc_feature    complement(27223..28443)
                     /locus_tag="O3K_25712"
                     /note="Pilin accessory protein (PilO); Region: PAP_PilO;
                     pfam06864"
                     /db_xref="CDD:311055"
     gene            complement(28499..30181)
                     /locus_tag="O3K_25717"
                     /db_xref="GeneID:13703791"
     CDS             complement(28499..30181)
                     /locus_tag="O3K_25717"
                     /note="COG1450 Type II secretory pathway, component PulD"
                     /codon_start=1
                     /transl_table=11
                     /product="PilN type IV pilus secretin"
                     /protein_id="YP_006781741.1"
                     /db_xref="GeneID:13703791"
                     /translation="MKKSHQRSMKLAVLPCMIAVALSISGCTFSEINKMQKKAQEDSA
                     HAREKVSALSARKSQALTWLDNQWINPVPVAQVSREKKQTAPACYITQARKGEITLQE
                     LGQRITAVCGIPVIITPDAANSTLEGGATRQMTGTLPAPDENGRLPLSSLGSTTMTTS
                     TQPLTLNNLMWQGDINGLLDLMASRSGLYWRMDNGRIVFYLTETRTYPLHMLNTKTSS
                     SSSVSSGSTSTMGATGGQDNSASGDATSSQSTTVGQEYDLYEDIRKTIEAMLTPEKGR
                     YWLSASSSTLTVTDTPAVQEAVTRYVDEQNSIMNRQVALNVQVLSVSNTRNEQFGLDW
                     NLVYKSLHSAGATLNNASGDFTGATSAGVSILDTATGNAAKFSGSSLLIKALSEQGDV
                     SVVTSQESTVTNLTPVPIQMADQTVYVAQSATTTTTDVGATTTLTPGMITTGFNMTLL
                     PLIQKTGNLQLQMNFNLSDPPTIRSFTSKDGNSYIEMPYTKLRSLSQKVNLKEGQSLV
                     VTGFDQNNTTTSKAGTFTPANPLFGGSQTGKNERSTLVIIITPTFPSGGNNG"
     misc_feature    complement(28529..30001)
                     /locus_tag="O3K_25717"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; cl27726"
                     /db_xref="CDD:332547"
     gene            complement(30195..30632)
                     /locus_tag="O3K_25722"
                     /db_xref="GeneID:13703792"
     CDS             complement(30195..30632)
                     /locus_tag="O3K_25722"
                     /codon_start=1
                     /transl_table=11
                     /product="PilM type IV pilus biogenesis protein"
                     /protein_id="YP_006781742.1"
                     /db_xref="GeneID:13703792"
                     /translation="MGWLVMAVGLTILIITGSYQNQKMSETTNAQQYASASVWASQIL
                     MIANRINDIRYVSGQQDGVISSDKLALPVTPDSRIKHQLQQGRLWVWMPEQPGLVETL
                     RLKSRGSALIGIFQNGQLTWLSGTATGLTPPAGITAGSVVYVN"
     misc_feature    complement(30201..30584)
                     /locus_tag="O3K_25722"
                     /note="PilM; Region: PilM; pfam07419"
                     /db_xref="CDD:311389"
     gene            complement(30632..31699)
                     /locus_tag="O3K_25727"
                     /db_xref="GeneID:13703793"
     CDS             complement(30632..31699)
                     /locus_tag="O3K_25727"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein PilL"
                     /protein_id="YP_006781743.1"
                     /db_xref="GeneID:13703793"
                     /translation="MKKNYLTLILPSLLSGCAGISGGNNVAPSDTPALVFVDGQISES
                     AGVLALTQQRLSPPKITPPPRVSVPETVKTAQPVSESRPLPSPTISQNFSRLIITGKP
                     GSTPVTLSPTARNRTVSQWIKTLLPEGWKFRQENAATPKLNTKLVSWSANDQWTRSLN
                     RLLEEQHLWGHLDWDNKTLTVTTSAAAPAQDTATTISPAAMVTTSTSPESSTTANSQN
                     KPRNPFRGNSVSPSTPAAIPTPTGSTVKSIPLMTGTPVKPVSQGKEWRAPAGTTLREN
                     IIKWAEETKCESMASTHWMVIWPLSVTDYRLDAPLMFRGSFESAMEQVFELYRTAQKP
                     LYAQASRMQCIITVSDTRDGR"
     misc_feature    complement(30650..30907)
                     /locus_tag="O3K_25727"
                     /note="Toxin co-regulated pilus biosynthesis protein Q;
                     Region: TcpQ; pfam10671"
                     /db_xref="CDD:313808"
     gene            complement(32746..33045)
                     /locus_tag="O3K_25732"
                     /db_xref="GeneID:13703794"
     CDS             complement(32746..33045)
                     /locus_tag="O3K_25732"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781744.1"
                     /db_xref="GeneID:13703794"
                     /translation="MTVQLLLFPFRKESLMPQQHPGRLQILVVDAHCKRRLFSTKTPT
                     DPDELARRFCTPDNCLVVVLRDNRFLFRLERAPGSHCRWHKGSSSRHQHLQDWLS"
     misc_feature    complement(32752..33000)
                     /locus_tag="O3K_25732"
                     /note="Plasmid conjugative transfer protein PilI; Region:
                     PilI; pfam10623"
                     /db_xref="CDD:151143"
     gene            complement(33172..33855)
                     /locus_tag="O3K_25737"
                     /db_xref="GeneID:13703795"
     CDS             complement(33172..33855)
                     /locus_tag="O3K_25737"
                     /codon_start=1
                     /transl_table=11
                     /product="TraC"
                     /protein_id="YP_006781745.1"
                     /db_xref="GeneID:13703795"
                     /translation="MTTTEHPVRQLLWCALNALKTAQENHNITSETGLRHYLLEWLSG
                     ASRHPEFSSLPGEIMALKALTEKDRNIPIIGTLNTLFLSSATVGECPLFRFRAALGKL
                     QKAGWRTYVCPWPEMVFNESIERACSGKRHLLQLSRTEECFLPTGDMRAPVTLQLITP
                     LHRKTMQLLETAELIFSDEGFQVVRGYEHQFGIERRETLFHTLFIGLPSLPEDVWGAT
                     QEQTTITLH"
     gene            complement(34109..34642)
                     /locus_tag="O3K_25742"
                     /db_xref="GeneID:13703796"
     CDS             complement(34109..34642)
                     /locus_tag="O3K_25742"
                     /note="COG0250 Transcription antiterminator"
                     /codon_start=1
                     /transl_table=11
                     /product="TraB protein"
                     /protein_id="YP_006781746.1"
                     /db_xref="GeneID:13703796"
                     /translation="MNIEHLNNRNWYLAQYNTAGKNRESLFSWLNEQNVVPWTPLITR
                     KIRRADSRCCYRERIFAIFPGYFFILANFDIQPVSALRRHSAFIDFVKFGGEIKPVNK
                     DIVDGLMKIYPDPVLNPGAREELNAASSIWLTKAQYQYLLRMENTLQPESRISLLLEL
                     VSNAEHHGFMERLVNIP"
     misc_feature    complement(34313..34618)
                     /locus_tag="O3K_25742"
                     /note="N-Utilization Substance G (NusG) N-terminal (NGN)
                     domain Superfamily; Region: NGN; cl02766"
                     /db_xref="CDD:322076"
     gene            complement(35084..35371)
                     /locus_tag="O3K_25747"
                     /db_xref="GeneID:13703797"
     CDS             complement(35084..35371)
                     /locus_tag="O3K_25747"
                     /note="COG2197 Response regulator containing a CheY-like
                     receiver domain and an HTH DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="protein TraA"
                     /protein_id="YP_006781747.1"
                     /db_xref="GeneID:13703797"
                     /translation="MSPQMIQKLPAITLLEGMFPELSTNQLKVCVFYAMGVPYDAIAQ
                     NCRLSPETVRTYLKRSLKNLNLEGYDALRSAVLMRTFVFMISNTAKENEKM"
     misc_feature    complement(35174..35317)
                     /locus_tag="O3K_25747"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     gene            complement(35289..35552)
                     /locus_tag="O3K_25752"
                     /db_xref="GeneID:13703798"
     CDS             complement(35289..35552)
                     /locus_tag="O3K_25752"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781748.1"
                     /db_xref="GeneID:13703798"
                     /translation="MPYHKDRNLYFLSSSMVAQAGQALAWPVSDDAGIPTPVWAITNE
                     RRNSVIAFLVVIGDLCYVTSNDTETPGHHSVGRHVSRAINKPA"
     misc_feature    complement(<35409..>35510)
                     /locus_tag="O3K_25752"
                     /note="Ash protein family; Region: Phage_ASH; pfam10554"
                     /db_xref="CDD:313720"
     gene            36525..37556
                     /locus_tag="O3K_25757"
                     /db_xref="GeneID:13703799"
     CDS             36525..37556
                     /locus_tag="O3K_25757"
                     /note="COG1132 ABC-type multidrug transport system, ATPase
                     and permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="YP_006781749.1"
                     /db_xref="GeneID:13703799"
                     /translation="MAGLKNTPYNAVHWSQLAPEEQIRFWEDYEAGRATTFLVEPERK
                     RTKRRRGEHSTKPKCENPSWYRPERYKALSGQLGHAYNRLVKKDPVTGEQSLRMHMSL
                     HPFYVQKRTYAGRKYAFRPEKQRLLDAIWPVLVSFSDAGTHTVGMSVSRLAREISPKD
                     SKGKVIPELEVTVSRLSRLLAEQVRFGVLGVSEETLWDRETRQRLPRYVWITPAGWQM
                     LGVDMVKLHEQQQKRLRESEIRQQLIREGVLREDEDISVHAARKRWYLQRSQDALKHR
                     REKAAASKRARRLKKLPADQQIHEMAEYLRKRLPPDEAYFCSDDHLKRLAIRELRQLE
                     LTLAAPPPH"
     misc_feature    36696..37523
                     /locus_tag="O3K_25757"
                     /note="IncFII RepA protein family; Region: IncFII_repA;
                     cl11495"
                     /db_xref="CDD:299748"
     gene            complement(38626..39135)
                     /locus_tag="O3K_25762"
                     /db_xref="GeneID:13703800"
     CDS             complement(38626..39135)
                     /locus_tag="O3K_25762"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YafA"
                     /protein_id="YP_006781750.1"
                     /db_xref="GeneID:13703800"
                     /translation="MSKSGAEKIQFILNNHEQAYRRLKPVYTFLELASWISVVLLIIY
                     LSGKNHVLTAAFLCFAWTAFWVLFLLHYFPKVFFILDRQSLLNLMEATKDSPDVKQEL
                     LNRLFSGKRMTGRDEMDICRLLRKNEEEKIRQSELNIIRNFIDEQQLTNSDIPKKSTV
                     SNEDKKGIR"
     gene            complement(39191..39793)
                     /locus_tag="O3K_25767"
                     /db_xref="GeneID:13703801"
     CDS             complement(39191..39793)
                     /locus_tag="O3K_25767"
                     /note="COG3109 Activator of osmoprotectant transporter
                     ProP"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781751.1"
                     /db_xref="GeneID:13703801"
                     /translation="MGKNQEERKTPIIVVKKRRTFSPPSLSEKTDIIAPVFTEQTAES
                     APAGINSSAVETHIPEAPARKKKKKRHRFPRPSHWTREYTHECVEKIKALFPHLRAEG
                     GGFIPLKIGINNDISAFLAEHPETELTMDEWLCAVSCITSRRVYLQRTAVAGVPRYGL
                     DGHPKGQVSDSEAQSAGRRLATLEQKLLRMQAQQENISGQ"
     misc_feature    complement(39194..39655)
                     /locus_tag="O3K_25767"
                     /note="FinO bacterial conjugation repressor domain; the
                     basic protein FinO is part of the the two component FinOP
                     system which is responsible for repressing bacterial
                     conjugation; the FinOP system represses the transfer (tra)
                     operon of the F-plasmid which...; Region: FinO_conjug_rep;
                     cd00236"
                     /db_xref="CDD:238145"
     misc_feature    complement(39620..39655)
                     /locus_tag="O3K_25767"
                     /note="putative kissing complex interaction region; other
                     site"
                     /db_xref="CDD:238145"
     misc_feature    complement(order(39212..39214,39227..39229,39323..39325,
                     39398..39403,39455..39457,39584..39586,39596..39601,
                     39620..39622,39629..39631,39641..39643))
                     /locus_tag="O3K_25767"
                     /note="putative RNA binding sites [nucleotide binding];
                     other site"
                     /db_xref="CDD:238145"
     gene            40146..41492
                     /locus_tag="O3K_25772"
                     /db_xref="GeneID:13703802"
     CDS             40146..41492
                     /locus_tag="O3K_25772"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781752.1"
                     /db_xref="GeneID:13703802"
                     /translation="MPMILVKKNPRGKVIRELSSEEETAVKTVCGLKKPATMALHNLA
                     NDILREMREYDAWLQCDCIPGDSPAMNFAALKNNTGTLYLSSFNHEHAPECPMYRQLS
                     GNEEETSSGASRHPVSTRINYRNFLPPDDSNSVIRLQARSAYHNGESSSVRKKRPRLA
                     RLLLSLIDDAGLNKLDSLANPRIRTNYRECLDAIRQVTLQQEYIRGRSLSEIIHFRPG
                     MSERSQERLMETLENSERHWPARRKHMFFQIFMAQHICRDAVEIHWANGNIQVIRPVR
                     GISINGEAQGGIRPPYWVILAFCRSADGRIICSEGYAHALYQLTCPVPVDSKLERNTL
                     TALLNVASWLKRKPGTPELSLERPLFDTEVYVNGEKKYVLPDFIVTARAPDGKTARVV
                     IETMGYEDSDYCARKSRQHTGMKQIGVLHTDPPKWLDNDHPPFEKHMYGVFMHLRY"
     gene            complement(41980..44454)
                     /locus_tag="O3K_25777"
                     /db_xref="GeneID:13703803"
     CDS             complement(41980..44454)
                     /locus_tag="O3K_25777"
                     /note="COG4644 Transposase and inactivated derivatives,
                     TnpA family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781753.1"
                     /db_xref="GeneID:13703803"
                     /translation="MRLWNKLALIPSAEQRSQLEMLLGPTDCSRLSLLESLKKGPVTI
                     SGPAFNEAIERWKTLNDFGLHAENLSTLPAVRLKNLARYAGMTSVFNIARMSPQKRMA
                     VLVAFVLAWETLALDDALDVLDAMLAVIIRDARKIGQKKRLRSLKDLDKSALALASAC
                     SYLLKEETPDESIRAEVFSYIPRQKLAEIITLVREIARPSDDNFHEEMVEQYGRVRRF
                     LPHLLNTVKFSSAPAGVTTLNACDYLSREFSSRRQFFDDAPTEIISRSWKRLVINKEK
                     HITRRGYTLCFLSKLQDSLRRRDVYVTGSNRWGDPRARLLQGADWQANRIKVYRSLGH
                     PTDPQEAIKSLGHQLDSRYRQVAARLCENEAVELDVSGPKPRLTISPLASLDEPDSLK
                     RLSKMISDLLPPVDLTELLLEINAHTGFADEFFHASEASARVDDLPVSISAVLMAEAC
                     NIGLEPLIRSNVPALTRHRLNWTKANYLRAETITSANARLVDFQATLPLAQIWGGGEV
                     ASADGMRFVTPVRTINAGPNRKYFGNNRGITWYNFVSDQYSGFHGIVIPGTLRDSIFV
                     LEGLLEQETGLNPTEIMTDTAGASELVFGLFWLLGYQFSPRLADAGASVFWRMDHDAD
                     YGVLNDIARGQSDPRKIVLQWDEMIRTAGSLKLGKVQVSVLVRSLLKSERPSGLTQAI
                     IEVGRINKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICHGQKGEIRKRYTDGQ
                     EDQLGTLGLVTNAVVLWNTIYMQAALDHLRAQGETLNDEDIARLSPLCHGHINMLGHY
                     SFTLAELVTKGHLRPLKEASEAENVA"
     misc_feature    complement(42061..43230)
                     /locus_tag="O3K_25777"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     pfam01526"
                     /db_xref="CDD:307598"
     gene            44849..45121
                     /locus_tag="O3K_25782"
                     /db_xref="GeneID:13703804"
     CDS             44849..45121
                     /locus_tag="O3K_25782"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781754.1"
                     /db_xref="GeneID:13703804"
                     /translation="MVLNFDDRGTVTHRAILGETCTVLEMAAGTWHAVLSLDTGGIIF
                     EVKHGGYQPVAADDYAHWAPAEGEPGTTELMAWYAQAQVGDSTFAV"
     misc_feature    <44852..45040
                     /locus_tag="O3K_25782"
                     /note="Conserved domain found in cupin and related
                     proteins; Region: cupin_like; cl21464"
                     /db_xref="CDD:328732"
     gene            complement(45168..46043)
                     /locus_tag="O3K_25787"
                     /db_xref="GeneID:13703805"
     CDS             complement(45168..46043)
                     /locus_tag="O3K_25787"
                     /note="COG2367 Beta-lactamase class A"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="YP_006781755.1"
                     /db_xref="GeneID:13703805"
                     /translation="MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQS
                     GGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKK
                     SDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGD
                     ETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNT
                     TGAASIQAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESR
                     RDVLASAAKIVTDGL"
     misc_feature    complement(45201..45938)
                     /locus_tag="O3K_25787"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; cl21491"
                     /db_xref="CDD:328749"
     gene            complement(46196..46318)
                     /locus_tag="O3K_25792"
                     /db_xref="GeneID:13703806"
     CDS             complement(46196..46318)
                     /locus_tag="O3K_25792"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781756.1"
                     /db_xref="GeneID:13703806"
                     /translation="MKNVWYNKNIINKIECCSVDNLQSLLSIIAAKMKSMIYQK"
     gene            complement(46299..47561)
                     /locus_tag="O3K_25797"
                     /db_xref="GeneID:13703807"
     CDS             complement(46299..47561)
                     /locus_tag="O3K_25797"
                     /codon_start=1
                     /transl_table=11
                     /product="ISEcp1 transposase"
                     /protein_id="YP_006781757.1"
                     /db_xref="GeneID:13703807"
                     /translation="MINKIDFKAKNLTSNAGLFLLLENAKSNGIFDFIENDLVFDNDS
                     TNKIKMNHIKTMLCGHFIGIDKLERLKLLQNDPLVNEFDISVKEPETVSRFLGNFNFK
                     TTQMFRDINFKVFKKLLTKSKLTSITIDIDSSVINVEGHQEGASKGYNPKKLGNRCYN
                     IQFAFCDELKAYVTGFVRSGNTYTANGAAEMIKEIVANIKSDDLEILFRMDSGYFDEK
                     IIETIESLGCKYLIKAKSYSTLTSQATNSSIVFVKGEEGRETTELYTKLVKWEKDRRF
                     VVSRVLKPEKERAQLSLLEGSEYDYFFFVTNTTLLSEKVVIYYEKRGNAENYIKEAKY
                     DMAVGHLLLKSFWANEAVFQMMMLSYNLFLLFKFDSLDSSEYRQQIKTFRLKYVFLAA
                     KIIKTARYVIMKLSENYPYKGVYEKCLV"
     misc_feature    complement(46305..47552)
                     /locus_tag="O3K_25797"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:316242"
     gene            complement(47743..47961)
                     /locus_tag="O3K_25802"
                     /db_xref="GeneID:13703808"
     CDS             complement(47743..47961)
                     /locus_tag="O3K_25802"
                     /note="COG4644 Transposase and inactivated derivatives,
                     TnpA family"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006781758.1"
                     /db_xref="GeneID:13703808"
                     /translation="MPVDFLTTEQTESYGRFTGEPDELQLARYFHLDEADKEFIGKSR
                     GDHNRLGIALQIGCVRFLGTFLTDMNHT"
     misc_feature    complement(<47758..47949)
                     /locus_tag="O3K_25802"
                     /note="Domain of unknown function (DUF4158); Region:
                     DUF4158; pfam13700"
                     /db_xref="CDD:316241"
     gene            48125..48682
                     /locus_tag="O3K_25807"
                     /db_xref="GeneID:13703809"
     CDS             48125..48682
                     /locus_tag="O3K_25807"
                     /note="COG1961 Site-specific recombinases, DNA invertase
                     Pin homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="Tn3 resolvase"
                     /protein_id="YP_006781759.1"
                     /db_xref="GeneID:13703809"
                     /translation="MRLFGYARVSTSQQSLDLQVRALKDAGVKANRIFTDKASGSSTD
                     REGLDLLRMKVEEGDVILVKKLDRLGRDTADMIQLIKEFDAQGVAVRFIDDGISTDGD
                     MGQMVVTILSAVAQAERRRILERTNEGRQEAKLKGIKFGRRRTVDRNVVLTLHQKGTG
                     ATEIAHQLSIARSTVYKILEDERAS"
     misc_feature    48131..48511
                     /locus_tag="O3K_25807"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(48146..48148,48152..48154,48323..48328,48335..48337)
                     /locus_tag="O3K_25807"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    48152..48154
                     /locus_tag="O3K_25807"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(48320..48322,48452..48457,48461..48466,48476..48478)
                     /locus_tag="O3K_25807"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(48338..48340,48353..48358,48440..48442,48449..48454,
                     48461..48466,48473..48475,48482..48484)
                     /locus_tag="O3K_25807"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(48407..48415,48440..48445,48452..48457,48464..48466,
                     48476..48478,48485..48487,48497..48499)
                     /locus_tag="O3K_25807"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(48407..48409,48455..48457,48464..48466,48476..48478,
                     48485..48487,48497..48499)
                     /locus_tag="O3K_25807"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(48479..48481,48497..48502)
                     /locus_tag="O3K_25807"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    48545..48670
                     /locus_tag="O3K_25807"
                     /note="Helix-turn-helix domain of resolvase; Region:
                     HTH_7; pfam02796"
                     /db_xref="CDD:308441"
     STS             48746..48934
                     /standard_name="D8S433"
                     /db_xref="UniSTS:44253"
     gene            48865..49725
                     /locus_tag="O3K_25812"
                     /db_xref="GeneID:13703810"
     CDS             48865..49725
                     /locus_tag="O3K_25812"
                     /EC_number="3.5.2.6"
                     /note="COG2367 Beta-lactamase class A"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase TEM"
                     /protein_id="YP_006781760.1"
                     /db_xref="GeneID:13703810"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY
                     IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVE
                     YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL
                     DRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA
                     EIGASLIKHW"
     misc_feature    48871..49722
                     /locus_tag="O3K_25812"
                     /note="beta-lactamase TEM; Provisional; Region: PRK15442"
                     /db_xref="CDD:185339"
     gene            complement(49994..50296)
                     /locus_tag="O3K_25817"
                     /db_xref="GeneID:13703811"
     CDS             complement(49994..50296)
                     /locus_tag="O3K_25817"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781761.1"
                     /db_xref="GeneID:13703811"
                     /translation="MRNRANTSPRDEAAFINGGTAGLDNTKKSSDKSSVVSKAKPVSI
                     SFFEENLKDIDALITAEMVSGKGRVNRSDVVRAAVEALKTLSKTEVSRLIAEVKQR"
     gene            complement(50293..50826)
                     /locus_tag="O3K_25822"
                     /db_xref="GeneID:13703812"
     CDS             complement(50293..50826)
                     /locus_tag="O3K_25822"
                     /note="COG1192 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II plasmid partioning protein"
                     /protein_id="YP_006781762.1"
                     /db_xref="GeneID:13703812"
                     /translation="MIIVDADDQKSVLTWYNNRPEDLPHIPVTGATGNIKAMLKEHEK
                     SYDFVIADCAGRDSAEMRSGLMAADVFISPLRPSQMDLDVVPHTCSVFTAAKDFNEDV
                     RGYLVLNMTPTNMFVNEANEAAEVLKDYPEMHLANSRVCDRKAHRDAWAESMTIFETQ
                     NDKAQQEIEALVKEVIL"
     misc_feature    complement(50296..50823)
                     /locus_tag="O3K_25822"
                     /note="plasmid-partitioning protein RepA; Provisional;
                     Region: PRK13869; cl27523"
                     /db_xref="CDD:332344"
     gene            complement(51123..52394)
                     /gene="umuC"
                     /locus_tag="O3K_25827"
                     /db_xref="GeneID:13703813"
     CDS             complement(51123..52394)
                     /gene="umuC"
                     /locus_tag="O3K_25827"
                     /EC_number="2.7.7.7"
                     /note="COG0389 Nucleotidyltransferase/DNA polymerase
                     involved in DNA repair"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="YP_006781763.1"
                     /db_xref="GeneID:13703813"
                     /translation="MFALADINSFYASCEKVFRPDLRNEPVIVLSNNDGCVIARSPEA
                     KALGIRMGQPWFQVRQMRLEKKIHVFSSNYALYHSMSQRVMAVLESLSPAVEPYSIDE
                     MFIDLRGINHCISPEIFGHQLREQVKSWTGLTMGVGIAPTKTLAKSAQWATKQWPQFS
                     GVVALTAENRNRTLKLLGLQPVGEVWGVGRRLTEKLNALGINTALQLAQANTAFIRKN
                     FSVILERTVRELNGESCISLEEAPPAKQQIVCSRSFGERITDKDAMHQAVVQYAERAA
                     EKLRGERQYCRQVTTFVRTSPFAVKEPCYSNAAVEKLPLPTQDSRDIIAAACRALNHV
                     WREGYRYMKAGVMLADFTPSGIAQPGLFDEIQPRKNSEKLMKTLDELNQSGKGKVWFA
                     GRGTAPEWQMKREMLSPAYTTRWTDLPVAQL"
     misc_feature    complement(51129..52394)
                     /gene="umuC"
                     /locus_tag="O3K_25827"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     misc_feature    complement(order(51933..51935,52089..52094,52260..52262,
                     52269..52271,52362..52367,52374..52379))
                     /gene="umuC"
                     /locus_tag="O3K_25827"
                     /note="active site"
                     /db_xref="CDD:176454"
     misc_feature    complement(order(51486..51488,51492..51506,51561..51563,
                     51642..51659,51732..51734,51819..51839,52089..52091,
                     52098..52100))
                     /gene="umuC"
                     /locus_tag="O3K_25827"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176454"
     gene            complement(52394..52831)
                     /locus_tag="O3K_25832"
                     /db_xref="GeneID:13703814"
     CDS             complement(52394..52831)
                     /locus_tag="O3K_25832"
                     /note="COG1974 SOS-response transcriptional repressors
                     (RecA-mediated autopeptidases)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit ImpA"
                     /protein_id="YP_006781764.1"
                     /db_xref="GeneID:13703814"
                     /translation="MSTVYHRPADPSGDDSYVRPLFADRCQAGFPSPATDYAEQELDL
                     NSYCISRPAATFFLRASGESMNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKR
                     LLLRPRPALEPVSDSPEFRTLYPENICIFGVVTHVIHRTRELR"
     misc_feature    complement(52406..52774)
                     /locus_tag="O3K_25832"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cl10465"
                     /db_xref="CDD:324586"
     misc_feature    complement(order(52529..52531,52640..52642))
                     /locus_tag="O3K_25832"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            complement(52828..53076)
                     /locus_tag="O3K_25837"
                     /db_xref="GeneID:13703815"
     CDS             complement(52828..53076)
                     /locus_tag="O3K_25837"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781765.1"
                     /db_xref="GeneID:13703815"
                     /translation="MIRIEILFDRQSTKNLKSGTLQALQNEIEQRLKPHYPEIWLRID
                     QGSAPSVSVTGARNDKDKERILSLLEEIWQDDSWLPAA"
     misc_feature    complement(52840..53022)
                     /locus_tag="O3K_25837"
                     /note="DinI-like family; Region: DinI; pfam06183"
                     /db_xref="CDD:310639"
     gene            53471..54397
                     /locus_tag="O3K_25842"
                     /db_xref="GeneID:13703816"
     CDS             53471..54397
                     /locus_tag="O3K_25842"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781766.1"
                     /db_xref="GeneID:13703816"
                     /translation="MPNWCSNRMYFSGEPAQIAEIKRLASGAVTPFYRRATNEGIQLF
                     LAGSAGLLQTTEDVQFEPCPGLTAAGRGVVSPENIAFTRWLTHLQNGVLLDEQNCLML
                     HELWLQSGTGQRRWEGLPDDVRDTITALFTAKRGDWCGFWSNEDVSVWWNRLCDNVLP
                     EKTMPFDLLTVLPTRLDIEVNGFNGGVLNGVPSAYHWYTERYGVKWPCGYDLNISSQG
                     ENFIQVDFDTPWCQPESDVVAELSRLFGCTLEHWYAEQGCDFCGWQLYERGELVDVLW
                     GELEWSSPTDDDELPEVTGPAWIVDNVAHYGG"
     misc_feature    53516..53887
                     /locus_tag="O3K_25842"
                     /note="Protein of unknown function (DUF1281); Region:
                     DUF1281; pfam06924"
                     /db_xref="CDD:311089"
     gene            54782..55465
                     /locus_tag="O3K_25847"
                     /db_xref="GeneID:13703817"
     CDS             54782..55465
                     /locus_tag="O3K_25847"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methylase"
                     /protein_id="YP_006781767.1"
                     /db_xref="GeneID:13703817"
                     /translation="MSRFVLGNCIDVMARIPDNAIDFILTDPPYLVGFRDRSGRTIAG
                     DKTDEWLQPACNEMYRVLKKDALMVSFYGWHRIDRFMAAWKRAGFSVAGHLVFTKNYT
                     SKSAYVAYRHECAYILAKGSPARPRNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
                     DDWFMPEAA"
     misc_feature    54782..55462
                     /locus_tag="O3K_25847"
                     /note="putative methylase; Provisional; Region: PRK13699"
                     /db_xref="CDD:184255"
     gene            55466..55687
                     /locus_tag="O3K_25852"
                     /db_xref="GeneID:13703818"
     CDS             55466..55687
                     /locus_tag="O3K_25852"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781768.1"
                     /db_xref="GeneID:13703818"
                     /translation="MNYAGHEKLRAEVAEVANAMCDLRTTMNEMEQRYSFNADTLPER
                     LVRQTLFRANRLLMEAYTEILELDACFKD"
     gene            55701..56135
                     /locus_tag="O3K_25857"
                     /db_xref="GeneID:13703819"
     CDS             55701..56135
                     /locus_tag="O3K_25857"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781769.1"
                     /db_xref="GeneID:13703819"
                     /translation="MYGTCETLCRALAAKYPGDMPLMLVIWSPEEIQALADGMDISLS
                     DHEIRTVLARLEDIPEDQRTESGISSGVAMEIINNVSENRQVTVPAELLASLIQTAEQ
                     ALWKREWAARDHGLAVPECVTRRQAVINQARTLLKNNRHEND"
     misc_feature    55701..56108
                     /locus_tag="O3K_25857"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:311216"
     gene            56181..56957
                     /locus_tag="O3K_25862"
                     /db_xref="GeneID:13703820"
     CDS             56181..56957
                     /locus_tag="O3K_25862"
                     /codon_start=1
                     /transl_table=11
                     /product="YchA"
                     /protein_id="YP_006781770.1"
                     /db_xref="GeneID:13703820"
                     /translation="MNENTTLNALICRHARNLLLAQGWPEETDVDQRNPKYPGWISIY
                     VLLDAPRLAMLLINRHGGVLPPLLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQV
                     FFPYAGEWLTEDEIRAVLDAVRDAVRSVSCRVAEDAQRIRAALTTTGQTLLTRQTRRF
                     RLVVKESDHPCWLDEDDENLPVVLDAILNRGARFSAVEMYLVSDCIEHILSSGLACDV
                     LRIPDEPPRRWFDRGVLREVVREGRAEIRSMADALAKIRG"
     gene            57371..57796
                     /locus_tag="O3K_25867"
                     /db_xref="GeneID:13703821"
     CDS             57371..57796
                     /locus_tag="O3K_25867"
                     /note="COG0587 DNA polymerase III, alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="YP_006781771.1"
                     /db_xref="GeneID:13703821"
                     /translation="MQYAKPVTLNVEECDRLSFLPYLFGNDFLYAEAYVYALAQKMMP
                     EYQGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSADAAGIILTSLVINRQLW
                     LYHDSGDAGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
     misc_feature    57500..57793
                     /locus_tag="O3K_25867"
                     /note="Antirestriction protein; Region: Antirestrict;
                     pfam03230"
                     /db_xref="CDD:308711"
     gene            57843..58265
                     /locus_tag="O3K_25872"
                     /db_xref="GeneID:13703822"
     CDS             57843..58265
                     /locus_tag="O3K_25872"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781772.1"
                     /db_xref="GeneID:13703822"
                     /translation="MYCTVKEIIREVLDTDVPDSECVFAVVLTRGDVRHIAQDWSLTD
                     DELETVMQRLDDAFEHGADVSVVHDVVRELMEEKRASRQVTVPAVMLEKVMALAGSEM
                     KRLYAVGSDNGGDGDAFVREEREAMDVVLQALDGEHMS"
     misc_feature    57843..>58136
                     /locus_tag="O3K_25872"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:311216"
     gene            58262..58453
                     /locus_tag="O3K_25877"
                     /db_xref="GeneID:13703823"
     CDS             58262..58453
                     /locus_tag="O3K_25877"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781773.1"
                     /db_xref="GeneID:13703823"
                     /translation="MNISTETREILRNYKAVINARRREMGQKPLTTAQIVDEICDFVA
                     NQQAVFLGGHYILQGSRNR"
     gene            59222..59749
                     /locus_tag="O3K_25882"
                     /db_xref="GeneID:13703824"
     CDS             59222..59749
                     /locus_tag="O3K_25882"
                     /note="COG0629 Single-stranded DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_006781774.1"
                     /db_xref="GeneID:13703824"
                     /translation="MSARGINKVILVGRLGNDPEVRYIPNGGAVANLQVATSESWRDK
                     QTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
                     VKTTGTVQMLGRAPQQNAQAQPKPQQNGQPQSADATKKGGAKTKGRGRKAAQPEPQPQ
                     PPEGEDYGFSDDIPF"
     misc_feature    59222..59746
                     /locus_tag="O3K_25882"
                     /note="single-stranded DNA-binding protein; Provisional;
                     Region: PRK13732"
                     /db_xref="CDD:184284"
     misc_feature    order(59246..59257,59330..59338,59381..59383,59387..59389,
                     59450..59452,59477..59479,59507..59509,59516..59518)
                     /locus_tag="O3K_25882"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(59261..59269,59285..59287,59315..59317,59336..59341,
                     59375..59380,59384..59386,59390..59392,59396..59398,
                     59402..59404,59441..59446,59468..59470,59474..59476,
                     59480..59485,59519..59521,59525..59527)
                     /locus_tag="O3K_25882"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            59807..60040
                     /locus_tag="O3K_25887"
                     /db_xref="GeneID:13703825"
     CDS             59807..60040
                     /locus_tag="O3K_25887"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781775.1"
                     /db_xref="GeneID:13703825"
                     /translation="MSEYFRILQGLPDGSFTREQAEAVAAQYRNVFIEDDQGTHFRLV
                     VRQDGTLIWRSWNFEDCAGYWMNQYIRDFGILK"
     misc_feature    59834..60037
                     /locus_tag="O3K_25887"
                     /note="Bacterial protein of unknown function (DUF905);
                     Region: DUF905; pfam06006"
                     /db_xref="CDD:310532"
     gene            60099..62057
                     /locus_tag="O3K_25892"
                     /db_xref="GeneID:13703826"
     CDS             60099..62057
                     /locus_tag="O3K_25892"
                     /note="COG1475 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II plasmid partioning protein"
                     /protein_id="YP_006781776.1"
                     /db_xref="GeneID:13703826"
                     /translation="MPVTKCEPETTRKASRKSVKTQETVLSALLAQTEEVSVPLASLI
                     KSPLNVRTVPYSAESVSELAESIKGVGLLQNLVVHTLPGDRYGVAAGGRRLAALNMLA
                     ERGIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIG
                     DLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTTRQVQVFEAACQ
                     SGWGGKPEVQTIRRLVTESEVAVAGNSKFRFVGADAFSPDELRTDLFSDDGDGYVDRV
                     ALDAALLEKLQAVAEHLREAEGWEWCAGRMEPVGECREDAGTYRCLPEPEAVLTEAEE
                     ERLNELMTRYDALENQCEESDLLEAEMKLIDCMAKVRAWTPEMRAGSGVVVSWRYGNV
                     CVQRGVQLRSEDDATDDADRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQPD
                     KSLALLAWTLCLNVFDSGAYSKPAQISLECKHYSLTSDAPSGKEGAAFLALMAEKARL
                     AALLPEGWSRDMTTFLSLSQEVLLSLLSFCTACSLNGVQTRECGRTSRSPLDSLESAI
                     GFHMRDWWQPTKANFFGHLKKPQIIAALNDAGLSGAARDAEKMKKGDAAEHAEFHMKD
                     NRWVPGWMCSPRPQTDATERADNLADAA"
     misc_feature    60204..60824
                     /locus_tag="O3K_25892"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     COG1475"
                     /db_xref="CDD:224392"
     misc_feature    60261..60503
                     /locus_tag="O3K_25892"
                     /note="ParB N-terminal, parA-binding, -like domain of
                     bacterial and plasmid parABS partitioning systems; Region:
                     ParB_N_like; cd16406"
                     /db_xref="CDD:319263"
     misc_feature    order(60369..60371,60375..60380,60384..60389)
                     /locus_tag="O3K_25892"
                     /note="putative ParB Box II [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319263"
     misc_feature    order(60375..60380,60384..60386)
                     /locus_tag="O3K_25892"
                     /note="arginine patch [polypeptide binding]; other site"
                     /db_xref="CDD:319263"
     gene            62112..62546
                     /gene="psiB"
                     /locus_tag="O3K_25897"
                     /db_xref="GeneID:13703827"
     CDS             62112..62546
                     /gene="psiB"
                     /locus_tag="O3K_25897"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein B"
                     /protein_id="YP_006781777.1"
                     /db_xref="GeneID:13703827"
                     /translation="MNTELTLNALQSMNAQEYEEIRAAGSDMRRNLTHEVMRKVDAPA
                     NWMMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQLWMLVLVNGGGQPFAVV
                     QVQHIFTPAAISHTLALAATLDAQGYSVNDIIHILMAEGGQA"
     misc_feature    62112..62543
                     /gene="psiB"
                     /locus_tag="O3K_25897"
                     /note="plasmid SOS inhibition protein B; Provisional;
                     Region: psiB; PRK13701"
                     /db_xref="CDD:237477"
     gene            62543..63262
                     /locus_tag="O3K_25902"
                     /db_xref="GeneID:13703828"
     CDS             62543..63262
                     /locus_tag="O3K_25902"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="YP_006781778.1"
                     /db_xref="GeneID:13703828"
                     /translation="MSARSRALIPLSAEQQAAMQAVAVTEQRRRQGRTLSAWPYATAF
                     FRCLNGSRRISLTDLRFFAPALTKEEFHGNRLLWLAAVDKLIESFGEVCVLPLPSDAG
                     HRLFPSVPFREGERRRQKTTLTEQKYSRQREREAERRELEYQTCFAQAQIDLAFHTPA
                     TVGSWLSRWSGVVEEHDLETIFWGWCGRFPSLSSFDRFFWQEEPLWRLIFEAGEAGRG
                     APVQVRALEQWMIPNKLENVI"
     misc_feature    62543..63259
                     /locus_tag="O3K_25902"
                     /note="plasmid SOS inhibition protein A; Provisional;
                     Region: PRK13704"
                     /db_xref="CDD:184260"
     gene            63259..63855
                     /locus_tag="O3K_25907"
                     /db_xref="GeneID:13703829"
     CDS             63259..63855
                     /locus_tag="O3K_25907"
                     /codon_start=1
                     /transl_table=11
                     /product="YgaA"
                     /protein_id="YP_006781779.1"
                     /db_xref="GeneID:13703829"
                     /translation="MMKSDEKYQVPAWMRPLLPLLCNTGGNDPEELLNDTETTASANV
                     VRYVLIVAVRSQVDLLQLLYRKGLLRTEIPGGFSPEEAQALLDNLVRSHISKALSGER
                     MAARDRNADLAWIGQQLVDAAWFVRATLEAHGMSVGNESPPAPPETMPDIQTRELVML
                     IKRLASSLKAVKPDSCVVREAQDWLRDRKLVDITDILR"
     gene            64317..64817
                     /locus_tag="O3K_25912"
                     /db_xref="GeneID:13703830"
     CDS             64317..64817
                     /locus_tag="O3K_25912"
                     /note="COG4734 Antirestriction protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-restriction protein"
                     /protein_id="YP_006781780.1"
                     /db_xref="GeneID:13703830"
                     /translation="MSVVAPAVYVGTWHKYNCGSIAGRWFDLTTFDDERDFFAACRAL
                     HQDEADPELMFQDYEGFPGNMASECHINWAWVEGFRLARDEGCEEAYRLWVEDTGETD
                     FDTFRDAWWGEADSEEAFAVEFASDTGLLADVPETVALYFDYEAYARDLFLDSFTFID
                     GHVFRR"
     misc_feature    64338..64808
                     /locus_tag="O3K_25912"
                     /note="Antirestriction protein (ArdA); Region: ArdA;
                     pfam07275"
                     /db_xref="CDD:311301"
     gene            65546..65980
                     /locus_tag="O3K_25917"
                     /db_xref="GeneID:13703831"
     CDS             65546..65980
                     /locus_tag="O3K_25917"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781781.1"
                     /db_xref="GeneID:13703831"
                     /translation="MTVSSTISVFCRDGVFRTVYCHLHGEPTWNGRILHTHYATGQQA
                     EALVEHGDIRCLGPRCDKPAGHTLQNPVDGVTAYYGRDSGFRMDSEAREYRSFMEAIA
                     TESTEEVRFHYVFIDGYWKVMYRTPEGWKMKALALALRRCPK"
     gene            66074..66340
                     /locus_tag="O3K_25922"
                     /db_xref="GeneID:13703832"
     CDS             66074..66340
                     /locus_tag="O3K_25922"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781782.1"
                     /db_xref="GeneID:13703832"
                     /translation="MKPSIIFATAEYVKRLREECLRENKPLHRHTRFRRQELAQDEIN
                     PDVLAMSGHIARRCSEQKRVRIPAMKVSEWGHLLRALEIERVCH"
     misc_feature    <66236..>66319
                     /locus_tag="O3K_25922"
                     /note="sensory histidine kinase CreC; Provisional; Region:
                     PRK11100"
                     /db_xref="CDD:236846"
     gene            66517..66906
                     /locus_tag="O3K_25927"
                     /db_xref="GeneID:13703833"
     CDS             66517..66906
                     /locus_tag="O3K_25927"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781783.1"
                     /db_xref="GeneID:13703833"
                     /translation="MKSCFDTDKAFHMSFDEVTFNADRIRSKLELLSEELMPRCGLVY
                     ELYQRRLSAAIDNFVATLPTEQHLLVLELAREEFDYLSAEEIAEEIRRDSERGYCCHG
                     FERNCCPLGCGDFGDDCCDAADLMEEP"
     gene            66903..67817
                     /locus_tag="O3K_25932"
                     /db_xref="GeneID:13703834"
     CDS             66903..67817
                     /locus_tag="O3K_25932"
                     /note="COG5464 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781784.1"
                     /db_xref="GeneID:13703834"
                     /translation="MSKKKNTTTPTPHDAAFRSFLANPDVARDFLELHLPAEYRQLCD
                     LSTLKLEPATFVEPDLHQYASDILWSVKTTGSKDGYVYTLIEHQSTENLYMPFRMLRY
                     SVAAMQRHLEQHKTLPLVIPVLFYHGERSPYPYSMNWLDCFENPALAAKIYTKPFPLV
                     DITVVDDNEIMNHRRMAALTLLMKHIRHRDMMELLDKLPQVMVEISDEQVRVLIHYIV
                     NAGDSVSPEFMRALAERLPQHEDKLMTIAERLEQKGRQEGRMEGRMEGALEKALAIAC
                     QLQKMGMTPEQIKQATGLSDDELKKIIH"
     misc_feature    66921..67799
                     /locus_tag="O3K_25932"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; cl27121"
                     /db_xref="CDD:331942"
     gene            67879..68085
                     /locus_tag="O3K_25937"
                     /db_xref="GeneID:13703835"
     CDS             67879..68085
                     /locus_tag="O3K_25937"
                     /note="COG5464 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781785.1"
                     /db_xref="GeneID:13703835"
                     /translation="MTIAERLIQKGFDEGFDEGFKEGFKKGALEVAREAACRLRDMGW
                     TPERIQEAAGLSGEELKKLFPDEQ"
     misc_feature    <67888..68067
                     /locus_tag="O3K_25937"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; cl27121"
                     /db_xref="CDD:331942"
     gene            complement(68116..68367)
                     /locus_tag="O3K_25942"
                     /db_xref="GeneID:13703836"
     CDS             complement(68116..68367)
                     /locus_tag="O3K_25942"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781786.1"
                     /db_xref="GeneID:13703836"
                     /translation="MTGWELRIWRKSMLWSREKAAREFGVTQRTWHAWENAEQVDVTV
                     WRTTQALSVRDLLPHMQGMRKADIIRRLENELGETAEDV"
     misc_feature    complement(<68260..68361)
                     /locus_tag="O3K_25942"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(68260..68262,68335..68337,68347..68349))
                     /locus_tag="O3K_25942"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(68263..68265,68338..68340))
                     /locus_tag="O3K_25942"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(68260..68262,68272..68274,68281..68283,
                     68314..68319))
                     /locus_tag="O3K_25942"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            68947..69795
                     /locus_tag="O3K_25947"
                     /db_xref="GeneID:13703837"
     CDS             68947..69795
                     /locus_tag="O3K_25947"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781787.1"
                     /db_xref="GeneID:13703837"
                     /translation="MNQTLPTADLNTAGTTDVIPSVAIDRIIAQRNEGIALFMQAMEC
                     LATARRILLDASGDIFLYGFEDCVTDSVRRMDKPEEAKRNITRLADRKIWDRLMTDTG
                     MYTFMSSCQRDEWNSQLMSDTCPEITLDNVLATFRHLNASKMQTFEQGLIDVYRKLSW
                     DYRTNNPCRLGKKIIIENLLYRWSNGRVTLDCSGREALDDLVRPFYLLEGRNVPDFRN
                     SIGAQYGEFLGNGDNVGKLLEGEYFTVRGYQKGTVHIVFKRSDLVEKLNDIIARHYPG
                     ALPPRV"
     misc_feature    69214..69771
                     /locus_tag="O3K_25947"
                     /note="Domain of unknown function (DUF4942); Region:
                     DUF4942; pfam13708"
                     /db_xref="CDD:316247"
     gene            complement(69882..70217)
                     /locus_tag="O3K_25952"
                     /db_xref="GeneID:13703838"
     CDS             complement(69882..70217)
                     /locus_tag="O3K_25952"
                     /codon_start=1
                     /transl_table=11
                     /product="protein YggA"
                     /protein_id="YP_006781788.1"
                     /db_xref="GeneID:13703838"
                     /translation="MASKKFYSDDDIQLAKAALSELPDLTAQRKTLRDFLDAIRDDII
                     VLVRTKGYTLADVRDTLKNAGYEVGEKALRDIIREAESKKPSRRSSSKTAPKKTDSGR
                     KDGIDMNNN"
     gene            70451..70783
                     /locus_tag="O3K_25957"
                     /db_xref="GeneID:13703839"
     CDS             70451..70783
                     /locus_tag="O3K_25957"
                     /codon_start=1
                     /transl_table=11
                     /product="relaxosome component"
                     /protein_id="YP_006781789.1"
                     /db_xref="GeneID:13703839"
                     /translation="MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSA
                     YIRNAALNKRINSRTDDAFLKELMRLGRMQKHLFVQGKRTGDKEYAEVLVAITELTNT
                     LRKQLMEG"
     misc_feature    70523..70732
                     /locus_tag="O3K_25957"
                     /note="conjugal transfer relaxosome component TraJ;
                     Provisional; Region: PRK13877"
                     /db_xref="CDD:184361"
     gene            70794..73493
                     /locus_tag="O3K_25962"
                     /db_xref="GeneID:13703840"
     CDS             70794..73493
                     /locus_tag="O3K_25962"
                     /codon_start=1
                     /transl_table=11
                     /product="relaxase"
                     /protein_id="YP_006781790.1"
                     /db_xref="GeneID:13703840"
                     /translation="MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQ
                     PHRNRFSRLVDYATRLRNESFVALVDVMKDGCEWVNFYGVTCFHNCTSLETAAADMEY
                     IAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVRHTLKSLGLGEHQYVSAVHTD
                     TDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCWVHAPGNRI
                     VRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQ
                     MDGKFLVMDGWDRNRGGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNP
                     DFIAADVRPEKIAETESLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRV
                     QHGHLVICDGYDHNQTPVRADSVWSLLTLDNVNQLDGGWQPVPTDIFRQVTPTERFRG
                     RRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGYSISHCSPQIEEMITQGEF
                     TWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEPQAGPFV
                     SAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAW
                     REQWRKPDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLK
                     EDIRDERQKLIADGKWYPPSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTT
                     DRCVVLCEPGGTPVYGNTGDLEARLQKNGSVRFRDRRTGEFVCTDYGDRVVFRNHHDR
                     NALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAWHNVTGRTGHEDYRITR
                     PDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG"
     misc_feature    70974..71738
                     /locus_tag="O3K_25962"
                     /note="Relaxase/Mobilisation nuclease domain; Region:
                     Relaxase; pfam03432"
                     /db_xref="CDD:308822"
     misc_feature    <72246..>73160
                     /locus_tag="O3K_25962"
                     /note="conjugal transfer relaxase TraI; Provisional;
                     Region: PRK13878"
                     /db_xref="CDD:237539"
     gene            complement(73530..75821)
                     /locus_tag="O3K_25967"
                     /db_xref="GeneID:13703841"
     CDS             complement(73530..75821)
                     /locus_tag="O3K_25967"
                     /codon_start=1
                     /transl_table=11
                     /product="IcmO-like type IV secretion system protein"
                     /protein_id="YP_006781791.1"
                     /db_xref="GeneID:13703841"
                     /translation="MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIW
                     PLALPACLLFTLITMLVFSLQRWRCPLRMPMTLECADPSQDRMIKRSLFSFWPTLFQY
                     EVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIMFFATTGGGKTETIFAWAINP
                     LCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEIILSGEKTR
                     PQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGK
                     TMSLQMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWT
                     EEPRKQHAYLSGQFSETFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTS
                     AHTTSALGRMFITQKSMILARDLGYRLEGTDSDALEVKKYKGRFPYLCFLDEVGAYYT
                     DRIAVEATQVRSLDFALILTAQDQERIEGQTTATNTATLMQNTGTKFAGRIVSEGSTA
                     RTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELHPGEFFS
                     IFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPE
                     NVSAIIGVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESA
                     LWETAVNTLKTTTREERRIRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNH
                     PTGRPVNGFHHKKNNRPDWDGMY"
     gene            complement(75814..76884)
                     /locus_tag="O3K_25972"
                     /db_xref="GeneID:13703842"
     CDS             complement(75814..76884)
                     /locus_tag="O3K_25972"
                     /note="COG1651 Protein-disulfide isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781792.1"
                     /db_xref="GeneID:13703842"
                     /translation="MTIEYFATRIAKHISVQAIWPDGRTEIIAVLPRDALSGLVTRNN
                     QLIHIAFDAMGTRNRETVLIDNQEHNADQILTAIDSCLRLEYLMERRFSRTPLFRGII
                     ASVVLFVMATIGFSLFRYVDRVFWDDTTPEAVQTAGEPRLLPPHLNHTVPLNEGIQLP
                     VPPKKDVQVPEKTITSKNPEAAAARHNLATVLKRNADRGMFTINLSSGHERTLFAFLD
                     PACPNCRLLEPALKRLASDFNVVIYPVSVIGGEESTDRVAPLLCEKDAQKRAAGWHRL
                     YSADNGMMTPSEETTPADETCLKAARAAIDVNNVAFRKFGFAGTPWVLSDTGWHLPTG
                     ILQETGTLNLFLKTTDSESGHE"
     misc_feature    complement(75847..76500)
                     /locus_tag="O3K_25972"
                     /note="DsbA family, DsbC and DsbG subfamily; V-shaped
                     homodimeric proteins containing a redox active CXXC motif
                     imbedded in a TRX fold. They function as protein disulfide
                     isomerases and chaperones in the bacterial periplasm to
                     correct non-native disulfide bonds...; Region:
                     DsbA_DsbC_DsbG; cd03020"
                     /db_xref="CDD:239318"
     misc_feature    complement(order(76363..76410,76432..76467,76474..76500))
                     /locus_tag="O3K_25972"
                     /note="dimerization domain [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239318"
     misc_feature    complement(76363..76386)
                     /locus_tag="O3K_25972"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239318"
     misc_feature    complement(order(76213..76215,76222..76224))
                     /locus_tag="O3K_25972"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239318"
     gene            complement(76903..78111)
                     /locus_tag="O3K_25977"
                     /db_xref="GeneID:13703843"
     CDS             complement(76903..78111)
                     /locus_tag="O3K_25977"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781793.1"
                     /db_xref="GeneID:13703843"
                     /translation="MSYNRQPVAEDPMQIWGAVGVLLILLLFVIWLFLPEVVYASCLI
                     LHTLWGLVDWGPFHNYAAPRYNLLAMTGNNAANISYSQWINVMEQTIGILWMYLLPVT
                     LWCLWEWYQHPGQSRFTRRPVDITRLPHIFASLSPAIAPVLADGDPEKLFHGGKRPER
                     RVALTPEAFVEQHALITNMQLDVAAARRCFMAQLGKPLTSWKDMAPHEKALFAIFGLQ
                     YFLDDRKAALKLMDTLNLSCRIKSKRDSGKFCTPVYSLAKSAFQRVIKSNGAQQWLKQ
                     HRYVRSGLVWLYAHDLRLTPPNWIWLKGVDRTLFYALHRANTTKGFIEGAGVVAVARA
                     EAEAMRFGLPCPEPCVDEAVEGLRRDMLSLGLIWDEPQPDRDRKRRILTNWSLTDDIL
                     PRTPATDNEF"
     gene            complement(78418..79503)
                     /locus_tag="O3K_25982"
                     /db_xref="GeneID:13703844"
     CDS             complement(78418..79503)
                     /locus_tag="O3K_25982"
                     /codon_start=1
                     /transl_table=11
                     /product="fertility inhibition protein"
                     /protein_id="YP_006781794.1"
                     /db_xref="GeneID:13703844"
                     /translation="MSQLKQPIFLKKIKKVINTIPGLEEQIFACRNKKRSDNPLLFID
                     RKDEERILMSRLQSQQKNEELASKLESLFHGNELSSPHSILCFIYWRYTKKIYRLSED
                     IISDVANTYVDNIPAQILKELPSWSIYVSAENLHTILPTSYPIHGFFFYPFLDNNGNI
                     IRLFIIDDLKQSQGTTGLKEKDVDVVNNIIRIKDSREGLLDSRKMECIDGEVVVTVNE
                     KLKDFRDREFNLLNAQISMVLYICSQINDIKEKNQFKRSEKHKKHVHTHHELPAQNIR
                     EWDVGIRMGQAIRQYRQAEPTGKERTTIGSKRPHIRRGHWHTYWTGSKKPELAHERKP
                     RLIWLPPVPVNLEDVNKLPVVITPIDK"
     gene            79821..79976
                     /locus_tag="O3K_25987"
                     /db_xref="GeneID:13703845"
     CDS             79821..79976
                     /locus_tag="O3K_25987"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781795.1"
                     /db_xref="GeneID:13703845"
                     /translation="MMPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVAT
                     LAYEVKR"
     misc_feature    79824..79973
                     /locus_tag="O3K_25987"
                     /note="Hok/gef family; Region: HOK_GEF; cl27487"
                     /db_xref="CDD:332308"
     gene            complement(80048..80299)
                     /locus_tag="O3K_25992"
                     /db_xref="GeneID:13703846"
     CDS             complement(80048..80299)
                     /locus_tag="O3K_25992"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781796.1"
                     /db_xref="GeneID:13703846"
                     /translation="MSEKWSKEFDSCFQVGSIEEIADALEKRSGSEENALAMLAMTAF
                     TLMTRRGICEMQNVAPDGKGIRLELIGFRENETIPDTLH"
     gene            80599..80895
                     /locus_tag="O3K_25997"
                     /db_xref="GeneID:13703847"
     CDS             80599..80895
                     /locus_tag="O3K_25997"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781797.1"
                     /db_xref="GeneID:13703847"
                     /translation="MSALRHVLSGILFSGKNRLQVLAKTSGGAGFGALVGEELSITDT
                     IETVVTGSVRANNGVLSPVMEKRMINLLIIVLRAVVAVANALIAVLELIRELID"
     gene            complement(80960..81136)
                     /locus_tag="O3K_26002"
                     /db_xref="GeneID:13703848"
     CDS             complement(80960..81136)
                     /locus_tag="O3K_26002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781798.1"
                     /db_xref="GeneID:13703848"
                     /translation="MNLVDAFVKKVISGPYEEYGKWWIDVEYISWGVPGKTRLMFDSK
                     EQALEVKEGYKFLT"
     gene            complement(81133..81276)
                     /locus_tag="O3K_26007"
                     /db_xref="GeneID:13703849"
     CDS             complement(81133..81276)
                     /locus_tag="O3K_26007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006781799.1"
                     /db_xref="GeneID:13703849"
                     /translation="MNKHIQYIPMRRNNLRRIPHEKNIIWEKIAIITASALIIFNTKR
                     KKQ"
     gene            complement(81319..81528)
                     /locus_tag="O3K_26012"
                     /db_xref="GeneID:13703850"
     CDS             complement(81319..81528)
                     /locus_tag="O3K_26012"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulator protein"
                     /protein_id="YP_006781800.1"
                     /db_xref="GeneID:13703850"
                     /translation="MAKTKQEWLYQLRRCSSLKTLEKIIAKNQGTLASDKIEAFNSAV
                     DHRLAELTMNKLYDKVPASVWKHVK"
     misc_feature    complement(81322..81519)
                     /locus_tag="O3K_26012"
                     /note="Haemolysin expression modulating protein; Region:
                     HHA; cl11501"
                     /db_xref="CDD:325062"
     gene            complement(81626..82240)
                     /locus_tag="O3K_26017"
                     /db_xref="GeneID:13703851"
     CDS             complement(81626..82240)
                     /locus_tag="O3K_26017"
                     /codon_start=1
                     /transl_table=11
                     /product="surface exclusion protein"
                     /protein_id="YP_006781801.1"
                     /db_xref="GeneID:13703851"
                     /translation="MIGAYANRGGTHSKKETCVIAFALFYIIFAVPLLIIWNTPTSWG
                     LAVIPTGFLLYSGYKNGRKKRAIVNNILEQIKTEYHDVFDPDPSYEHKSIPSLYFGID
                     IKKGTALYIRLYPNKTLDVIGIDIDNFTRTVVRENCMEIHTKYVNMPMLELPIGVNSA
                     RSIANTLHAMASRGYDYPVDFPRLIQEKRKEWEQIAGMPVAEVF"
     gene            complement(82316..84553)
                     /locus_tag="O3K_26022"
                     /db_xref="GeneID:13703852"
     CDS             complement(82316..84553)
                     /locus_tag="O3K_26022"
                     /codon_start=1
                     /transl_table=11
                     /product="TraY integral membrane protein"
                     /protein_id="YP_006781802.1"
                     /db_xref="GeneID:13703852"
                     /translation="MSPSPLIKSCVAFAHTQFYSGVTVKILLRALCAGLAISSLPAMA
                     SVTYQDIVSAATNPDDLSRQALVTIFGDVVTNPLSTSAPTLIGSMFGAFNSIIAVLAV
                     VWFMFIGIRHVVRSGHQGQVFSTGRDVVGTLSVVAGFLMIVPTGNGWSLAQLIMLWGA
                     SIMGVGSANVMVQLAADNIANGYSMTVQPVQASTRTAARGIFEMELCKYAVNAGLNDF
                     NQTAKSSTSLMTESAKTASGNYTVTVSNGSGICGTASLSVEGNGTTDQSTIGKFFNPF
                     SKNEYSGVISAQRAAMDNMISDMDNAASEFVTTFLEKRNSGNGTLPDIETRIQRAADE
                     YERAVQKSLPIDNGEQSRKEALKSYLTTYGWVTLGAWYQTFATANQRLAELADRAPAV
                     TSMSSLGEVGDTDLFSAVMGAYKTQLQNSTYTPPLGTITSADEQLLSKTSTPQDALIK
                     PTEKFGQWLTNNIATEWTDSGTSSNQVNPLIKMKNIGDKTMVAAEGIWITYTSARVIT
                     SGTGSSIFGKFIDLTTSAISTLNALLEALAPPVYFLLLLLFCAGFSLSIYLPFIPFIF
                     WMTGIGNWVISVLIGCTAGPLWGATHLGTSQDRGSRAAYGYIYLIDSMIRPPIMVFGF
                     FFASVAIIAIGTILNFLFGAALTNVQISSFTGIFSLAGFLLLYARSCTTIVAAAFALQ
                     AYLPDHVINFLGGRDGVNTLGNMAGSIKEIFAGSNRNIRHAPNIREEQIKRMNNDNNK
                     DGIKG"
     misc_feature    complement(82472..84373)
                     /locus_tag="O3K_26022"
                     /note="conjugal transfer/type IV secretion protein
                     DotA/TraY; Region: DotA_TraY; TIGR04346"
                     /db_xref="CDD:275142"
     gene            complement(84581..85165)
                     /locus_tag="O3K_26027"
                     /db_xref="GeneID:13703853"
     CDS             complement(84581..85165)
                     /locus_tag="O3K_26027"
                     /codon_start=1
                     /transl_table=11
                     /product="F pilin acetylation protein"
                     /protein_id="YP_006781803.1"
                     /db_xref="GeneID:13703853"
                     /translation="MNKLPENSDQTKNVKKSLSITRIATRGIINIFVPLMETRLITNS
                     VQHMLEQQKRRLDRFRQVNNKKAQLHLTWEEALQASHMSVDDLDRRFRRRRTVWRFCC
                     WSLLAIALFLSGMLFAASSLPLTTLVRAISTLVLILSGVALCASRALIVTYRLWQLHE
                     RKVSEPEQGTFRDFLNTRNGWRNATLIAVTSKQY"
     gene            complement(85194..86396)
                     /locus_tag="O3K_26032"
                     /db_xref="GeneID:13703854"
     CDS             complement(85194..86396)
                     /locus_tag="O3K_26032"
                     /codon_start=1
                     /transl_table=11
                     /product="F pilus assembly"
                     /protein_id="YP_006781804.1"
                     /db_xref="GeneID:13703854"
                     /translation="MQRKTLLAALIATLSGTACQAHAYSVTVVASRPVEEQVIPRMEA
                     IKDVLGNILSTQTATGTAINQNSEKLASVIAQNGQATRQQMIFSNETQRLEEARKSFT
                     VPDSICSESASGIATESKSASASAASKLSKGGGVSNRSLRDRLASAANSPVREAYDGA
                     AIHASYCTEAEYARFGGTAVCPSVGEIPGGDSQVRSIYHGAGTADTPAALTWDQKQID
                     AATAYMKNTSRPSAGRALGKGEVNTQSGRTYVGLQNEYNGIIDSASNPQLTLIADSTP
                     NESTRKALAETLQSDSAAAYFDQVASSEAKARGYMSTREFEAFEAGRRYANTAYLVDL
                     QEMQGDNLLRELVRITAQMNWQLNDLKEQIRQGNVISGQQLALTARQYYEKQLGSLEK
                     TINQANAR"
     gene            complement(86363..86977)
                     /locus_tag="O3K_26037"
                     /db_xref="GeneID:13703855"
     CDS             complement(86363..86977)
                     /locus_tag="O3K_26037"
                     /codon_start=1
                     /transl_table=11
                     /product="F pilus assembly"
                     /protein_id="YP_006781805.1"
                     /db_xref="GeneID:13703855"
                     /translation="MCTIHITPRCRRPARGQVFLKKLEVKGDSFSFTLPSRVFRLHPA
                     PNHRVIYASDARTQGKVTGMRLLLPSSTDELITTAIWQVSVPDEAPFDVQHVIQWILP
                     SPLASLMSDDTWLWPSVPGTPALSAGDWPVMDTDPSTLRRVRRRSFSIIDNRNRKGYI
                     TRRYQCFPLAPLPEDRKYDSLPDLVLHPEQETIKCKEKHYSQPL"
     misc_feature    complement(86525..>86752)
                     /locus_tag="O3K_26037"
                     /note="Amidase; Region: Amidase; cl18951"
                     /db_xref="CDD:327489"
CONTIG      join(CP003290.1:1..88544)
//
DBGET integrated database retrieval system