GenomeNet

Database: RefSeq
Entry: NC_018660
LinkDB: NC_018660
Original site: NC_018660 
LOCUS       NC_018660               1549 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Escherichia coli O104:H4 str. 2011C-3493 plasmid pG-EA11, complete
            sequence.
ACCESSION   NC_018660
VERSION     NC_018660.1
DBLINK      BioProject: PRJNA176127
            Assembly: GCF_000299455.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli O104:H4 str. 2011C-3493
  ORGANISM  Escherichia coli O104:H4 str. 2011C-3493
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 1549)
  AUTHORS   Ahmed,S.A., Awosika,J., Baldwin,C., Bishop-Lilly,K.A., Biswas,B.,
            Broomall,S., Chain,P.S., Chertkov,O., Chokoshvili,O., Coyne,S.,
            Davenport,K., Detter,J.C., Dorman,W., Erkkila,T.H., Folster,J.P.,
            Frey,K.G., George,M., Gleasner,C., Henry,M., Hill,K.K., Hubbard,K.,
            Insalaco,J., Johnson,S., Kitzmiller,A., Krepps,M., Lo,C.C., Luu,T.,
            McNew,L.A., Minogue,T., Munk,C.A., Osborne,B., Patel,M.,
            Reitenga,K.G., Rosenzweig,C.N., Shea,A., Shen,X., Strockbine,N.,
            Tarr,C., Teshima,H., van Gieson,E., Verratti,K., Wolcott,M.,
            Xie,G., Sozhamannan,S. and Gibbons,H.S.
  CONSRTM   Threat Characterization Consortium
  TITLE     Genomic Comparison of Escherichia coli O104:H4 Isolates from 2009
            and 2011 Reveals Plasmid, and Prophage Heterogeneity, Including
            Shiga Toxin Encoding Phage stx2
  JOURNAL   PLoS ONE 7 (11), E48228 (2012)
   PUBMED   23133618
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1549)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1549)
  AUTHORS   Johnson,S.L., Teshima,H., Chertov,O., Gibbons,H.S.,
            Bishop-Lily,K.A., Strockbine,N., Minogue,T., Rosenzweig,N.,
            Sozhamannan,S. and Detter,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2012) Genome Science B6, Los Alamos National
            Laboratory, PO Box 1663 M888, Los Alamos, NM 87545, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003292.
            RefSeq Category: Reference Genome
                        PHY: Based on Phylogenetics
            DNA and stock bacterial strain for this genome may be available
            upon request made to the authors.
            Annotation was added by the NCBI Prokaryotic Genomes Automatic
            Annotation Pipeline Group. Information about the Pipeline can be
            found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
            aware that the annotation is done automatically with little or no
            manual curation.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1549
                     /organism="Escherichia coli O104:H4 str. 2011C-3493"
                     /mol_type="genomic DNA"
                     /strain="2011C-3493"
                     /host="Homo sapiens"
                     /db_xref="taxon:1133852"
                     /plasmid="pG-EA11"
                     /collection_date="2011"
                     /note="isolated from US citizen afflicted with HUS after
                     travel to Germany during the 2011 Escherichia coli
                     oubreak"
     gene            join(1313..1549,1..240)
                     /locus_tag="O3K_26522"
                     /db_xref="GeneID:13703859"
     CDS             join(1313..1549,1..240)
                     /locus_tag="O3K_26522"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication protein"
                     /protein_id="YP_006781806.1"
                     /db_xref="GeneID:13703859"
                     /translation="MFIDSEKRLKQLSDEAKKNTEDLEEAKKNSRFTQVSPKGWERVR
                     ELLKDSQGISALKLYSFLAEHIDPTCGAVVADQQFLAEKLGVSRSTIIRWLNYLESKN
                     ALVRIPVAGKVCAYALDPHEVWKGYNTTKNHAAFVTKTLVNKDGDIQRRIMAMFSN"
     misc_feature    join(1472..1549,1..75)
                     /locus_tag="O3K_26522"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:316269"
CONTIG      join(CP003292.1:1..1549)
//
DBGET integrated database retrieval system