GenomeNet

Database: RefSeq
Entry: NC_018666
LinkDB: NC_018666
Original site: NC_018666 
LOCUS       NC_018666              74217 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Escherichia coli O104:H4 str. 2011C-3493 plasmid pAA-EA11, complete
            sequence.
ACCESSION   NC_018666
VERSION     NC_018666.1
DBLINK      BioProject: PRJNA176127
            Assembly: GCF_000299455.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli O104:H4 str. 2011C-3493
  ORGANISM  Escherichia coli O104:H4 str. 2011C-3493
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 74217)
  AUTHORS   Ahmed,S.A., Awosika,J., Baldwin,C., Bishop-Lilly,K.A., Biswas,B.,
            Broomall,S., Chain,P.S., Chertkov,O., Chokoshvili,O., Coyne,S.,
            Davenport,K., Detter,J.C., Dorman,W., Erkkila,T.H., Folster,J.P.,
            Frey,K.G., George,M., Gleasner,C., Henry,M., Hill,K.K., Hubbard,K.,
            Insalaco,J., Johnson,S., Kitzmiller,A., Krepps,M., Lo,C.C., Luu,T.,
            McNew,L.A., Minogue,T., Munk,C.A., Osborne,B., Patel,M.,
            Reitenga,K.G., Rosenzweig,C.N., Shea,A., Shen,X., Strockbine,N.,
            Tarr,C., Teshima,H., van Gieson,E., Verratti,K., Wolcott,M.,
            Xie,G., Sozhamannan,S. and Gibbons,H.S.
  CONSRTM   Threat Characterization Consortium
  TITLE     Genomic Comparison of Escherichia coli O104:H4 Isolates from 2009
            and 2011 Reveals Plasmid, and Prophage Heterogeneity, Including
            Shiga Toxin Encoding Phage stx2
  JOURNAL   PLoS ONE 7 (11), E48228 (2012)
   PUBMED   23133618
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 74217)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-DEC-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 74217)
  AUTHORS   Johnson,S.L., Teshima,H., Chertov,O., Gibbons,H.S.,
            Bishop-Lily,K.A., Strockbine,N., Minogue,T., Rosenzweig,N.,
            Sozhamannan,S. and Detter,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-2012) Genome Science B6, Los Alamos National
            Laboratory, PO Box 1663 M888, Los Alamos, NM 87545, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP003291.
            RefSeq Category: Reference Genome
                        PHY: Based on Phylogenetics
            DNA and stock bacterial strain for this genome may be available
            upon request made to the authors.
            Annotation was added by the NCBI Prokaryotic Genomes Automatic
            Annotation Pipeline Group. Information about the Pipeline can be
            found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
            aware that the annotation is done automatically with little or no
            manual curation.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..74217
                     /organism="Escherichia coli O104:H4 str. 2011C-3493"
                     /mol_type="genomic DNA"
                     /strain="2011C-3493"
                     /host="Homo sapiens"
                     /db_xref="taxon:1133852"
                     /plasmid="pAA-EA11"
                     /collection_date="2011"
                     /note="isolated from US citizen afflicted with HUS after
                     travel to Germany during the 2011 Escherichia coli
                     oubreak"
     gene            complement(757..1737)
                     /locus_tag="O3K_26057"
                     /db_xref="GeneID:13715097"
     CDS             complement(757..1737)
                     /locus_tag="O3K_26057"
                     /note="COG3039 Transposase and inactivated derivatives,
                     IS5 family"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006792544.1"
                     /db_xref="GeneID:13715097"
                     /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPF
                     YPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDR
                     TTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQR
                     DPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVS
                     ADAGYQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRAKVE
                     HPFRIIKRQFGFVKARYKGLLENDNQLAMLFTLANLFRVDQMIRQWERSH"
     misc_feature    complement(1372..1587)
                     /locus_tag="O3K_26057"
                     /note="Transposase domain (DUF772); Region: DUF772;
                     pfam05598"
                     /db_xref="CDD:283292"
     misc_feature    complement(772..1551)
                     /locus_tag="O3K_26057"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [Mobilome: prophages, transposons]; Region: IS5; COG3039"
                     /db_xref="CDD:225581"
     misc_feature    complement(856..1314)
                     /locus_tag="O3K_26057"
                     /note="DDE superfamily endonuclease; Region: DDE_Tnp_4;
                     cl21562"
                     /db_xref="CDD:304434"
     gene            1736..1870
                     /locus_tag="O3K_26062"
                     /db_xref="GeneID:13715016"
     CDS             1736..1870
                     /locus_tag="O3K_26062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792545.1"
                     /db_xref="GeneID:13715016"
                     /translation="MMSLWDALRMNMMISYQELVRTFLSIVKLLFNIMEIRMQTITNG
                     "
     gene            complement(3211..4734)
                     /locus_tag="O3K_26077"
                     /db_xref="GeneID:13715017"
     CDS             complement(3211..4734)
                     /locus_tag="O3K_26077"
                     /note="COG3344 Retron-type reverse transcriptase"
                     /codon_start=1
                     /transl_table=11
                     /product="reverse transcriptase-like protein, CP4-6
                     prophage (modular protein)"
                     /protein_id="YP_006792546.1"
                     /db_xref="GeneID:13715017"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRIVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAIRTVKLQLTDCGETRGR
                     WVIEGDLSSYFDTVHHRLLMKAVRRRISDARFMTLLWKTIKAGHIDVGLFRAASEGVP
                     QGGVISPLLSNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPA
                     VAYCRYADDFVLIVKGTKAQAEAIREECRGVLEGSLKLRLNMDKTKITHVNDGFIFLG
                     HRIIRKRSRYGEMRVVSTIPQEKARNFAASLTALLSGNYSESKVDMAEQLNRKLKGWA
                     MFYQFVDFKAKVFSYIDRVVFWKLAHWLARKYRTGIASLMRWWCKSPKPGQSKTWVLF
                     GKTNHGKLSGEILYRLVGQGKKLFRWRLPEGNPYLRTETRNTYTSRFTEVAMAFASI"
     misc_feature    complement(3463..4632)
                     /locus_tag="O3K_26077"
                     /note="group II intron reverse transcriptase/maturase;
                     Region: group_II_RT_mat; TIGR04416"
                     /db_xref="CDD:275209"
     gene            complement(5326..5808)
                     /locus_tag="O3K_26082"
                     /db_xref="GeneID:13715018"
     misc_feature    complement(5326..5808)
                     /locus_tag="O3K_26082"
                     /note="COG2801 Transposase and inactivated derivatives"
     gene            complement(5805..6131)
                     /locus_tag="O3K_26087"
                     /db_xref="GeneID:13715019"
     CDS             complement(5805..6131)
                     /locus_tag="O3K_26087"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS629 protein"
                     /protein_id="YP_006792547.1"
                     /db_xref="GeneID:13715019"
                     /translation="MTKNTRFSPEVRQRAVRIVLESQGEYDSQWATICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKEEF
                     DRLWKK"
     misc_feature    complement(5871..6131)
                     /locus_tag="O3K_26087"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:304362"
     misc_feature    complement(5808..6128)
                     /locus_tag="O3K_26087"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            6865..7662
                     /locus_tag="O3K_26097"
                     /db_xref="GeneID:13715020"
     CDS             6865..7662
                     /locus_tag="O3K_26097"
                     /note="COG2207 AraC-type DNA-binding domain-containing
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional activator aggR
                     (AAF-III) regulatory protein"
                     /protein_id="YP_006792548.1"
                     /db_xref="GeneID:13715020"
                     /translation="MKLKQNIEKEIIKINNIRIHQYTVLYTSNCTIDVYTKEGSNTYL
                     RNELIFLERGINISVRLQKKKSTVNPFIAIRLSSDTLRRLKDALMIIYGISKVDACSC
                     PNWSKGIIVADADDSVLDTFKSIDHNDDSRITSDLIYLISKIENNRKIIESIYISAVS
                     FFSDKVRNTIEKDLSKRWTLAIIADEFNVSEITIRKRLESEYITFNQILMQSRMSKAA
                     LLLLDNSYQISQISNMIGFSSTSYFIRLFVKHFGITPKQFLTYFKSQ"
     misc_feature    7393..7641
                     /locus_tag="O3K_26097"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            7763..8167
                     /locus_tag="O3K_26102"
                     /db_xref="GeneID:13715021"
     CDS             7763..8167
                     /locus_tag="O3K_26102"
                     /note="COG3677 Transposase and inactivated derivatives;
                     IS1"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase ORF A, IS1"
                     /protein_id="YP_006792549.1"
                     /db_xref="GeneID:13715021"
                     /translation="MSSVNIHCPRCQSAQVYRHGQNPKGRDRFRYRDCHRVFQLTYTY
                     QARKPGMKELITEMAFNEPRMMLARMARLHGIQPCQLFKWKKQYLEGTLNAVAAGEDV
                     VPASELAAAIKQINQVQRLLGKNLWSPPFLQH"
     misc_feature    7763..>7969
                     /locus_tag="O3K_26102"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: InsA; COG3677"
                     /db_xref="CDD:226202"
     misc_feature    7763..7867
                     /locus_tag="O3K_26102"
                     /note="InsA N-terminal domain; Region: Zn_Tnp_IS1;
                     pfam03811"
                     /db_xref="CDD:281762"
     misc_feature    7886..>7945
                     /locus_tag="O3K_26102"
                     /note="InsA C-terminal domain; Region: HTH_Tnp_IS1;
                     pfam12759"
                     /db_xref="CDD:289525"
     misc_feature    7925..>8134
                     /locus_tag="O3K_26102"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:304362"
     gene            complement(8410..9234)
                     /locus_tag="O3K_26107"
                     /db_xref="GeneID:13715022"
     CDS             complement(8410..9234)
                     /locus_tag="O3K_26107"
                     /note="COG3547 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006792550.1"
                     /db_xref="GeneID:13715022"
                     /translation="MARRIADLGHEAKLISPQFVRPFVKSNKNDFVDAEAICEAASRP
                     SMRFVQPRTEAQQAMRALHRVRESLVSDKVKTTNQMHAFLLEFGISMPTGVAVVKRLS
                     TVLAENELPPYLAQLLMRLHAHYIYLVGQITELEIALEQELSRDEVGQRLQTIPGIGP
                     ITASVLSSQLGGGKQYSCSRDFAASTGLVPRQYSTGGKNTLLGISKRGDKNLRRLLVQ
                     CARSFIQRIENQSGRLADWVRALLARKHSSVVCCALANKLARIAWAITTQQTVFER"
     misc_feature    complement(8443..9231)
                     /locus_tag="O3K_26107"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(9013..>9210)
                     /locus_tag="O3K_26107"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:279837"
     misc_feature    complement(8557..8787)
                     /locus_tag="O3K_26107"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:280523"
     gene            complement(9596..10576)
                     /locus_tag="O3K_26112"
                     /db_xref="GeneID:13715023"
     CDS             complement(9596..10576)
                     /locus_tag="O3K_26112"
                     /note="COG3039 Transposase and inactivated derivatives,
                     IS5 family"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006792551.1"
                     /db_xref="GeneID:13715023"
                     /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPF
                     YPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDR
                     TTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQR
                     DPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVS
                     ADAGYQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRAKVE
                     HPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSH"
     misc_feature    complement(9611..10390)
                     /locus_tag="O3K_26112"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [Mobilome: prophages, transposons]; Region: IS5; COG3039"
                     /db_xref="CDD:225581"
     gene            10575..10736
                     /locus_tag="O3K_26117"
                     /db_xref="GeneID:13715024"
     CDS             10575..10736
                     /locus_tag="O3K_26117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792552.1"
                     /db_xref="GeneID:13715024"
                     /translation="MMSLWDALRMNMMISYQELVRTFLRTAINYCYNNIYFLFYFVLA
                     CKNLEKGGV"
     gene            10736..10888
                     /locus_tag="O3K_26122"
                     /db_xref="GeneID:13715025"
     CDS             10736..10888
                     /locus_tag="O3K_26122"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792553.1"
                     /db_xref="GeneID:13715025"
                     /translation="MIDIVTYVMNADFDNIIKIASDMDLSLIKDIVRETQEDINSNGP
                     AWSSWS"
     gene            complement(11391..11678)
                     /locus_tag="O3K_26127"
                     /db_xref="GeneID:13715026"
     CDS             complement(11391..11678)
                     /locus_tag="O3K_26127"
                     /note="IPP:Isopentenyl pyrophosphate isomerase; IPP:DMAPP
                     isomerase; COG1443 Isopentenyldiphosphate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Isopentenyl-diphosphate
                     delta-isomerase"
                     /protein_id="YP_006792554.1"
                     /db_xref="GeneID:13715026"
                     /translation="MGIECPLSKLLKIYYNVYVGGDLTEHEIAHIFYGISDDEPDLNS
                     LEAMSYKYVSLTELSSEIKFNNDAFSRWFVYCFPYIKNAFLNESNYTNLLI"
     misc_feature    complement(11445..>11678)
                     /locus_tag="O3K_26127"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:294304"
     gene            complement(11687..11911)
                     /locus_tag="O3K_26132"
                     /db_xref="GeneID:13715027"
     CDS             complement(11687..11911)
                     /locus_tag="O3K_26132"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792555.1"
                     /db_xref="GeneID:13715027"
                     /translation="MTIMIVKRGLPKNYIPTKKVFYIGLFLFIYVIAMENYCYSKEHL
                     ENIILPAFGAIPLVHIPSRENRIYLQLTED"
     gene            complement(11934..12962)
                     /locus_tag="O3K_26137"
                     /db_xref="GeneID:13715028"
     CDS             complement(11934..12962)
                     /locus_tag="O3K_26137"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792556.1"
                     /db_xref="GeneID:13715028"
                     /translation="MKVVSDSFNDMHKRRYFNDTMDIINYNRKTIRYTDIIFYFRTLK
                     EIRLKYPFKELESLFEPLNVYPFYYFMPFLFISDLHDKGQYIERIRYVGIISTLIARR
                     AILTDLFVDEQYEQLISRNMGDLKKEYLGYYLQIIDVEINNIASKIFIEPSSFYAFYN
                     RRFNEYVNTMLMEKDISPLIGMDEGAFKKYAVGKSILHLLVSDMVLHIIKKQELTHQF
                     DNMMKSFIMYLTLQDDVLDIMEDIQKQQPSHFYPWISDGKIIESIDENVEKAVLLKFY
                     LGGGIERCEDLINKYVEDIITAVKKINHPLKSWLEVIERMSLKTKDKLDSFKAVRDEL
                     HFFLSQQG"
     misc_feature    complement(12057..>12497)
                     /locus_tag="O3K_26137"
                     /note="Isoprenoid Biosynthesis enzymes, Class 1; Region:
                     Isoprenoid_Biosyn_C1; cd00385"
                     /db_xref="CDD:173830"
     misc_feature    complement(12240..12266)
                     /locus_tag="O3K_26137"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173830"
     gene            13398..13898
                     /locus_tag="O3K_26147"
                     /db_xref="GeneID:13715029"
     CDS             13398..13898
                     /locus_tag="O3K_26147"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ISRSO11-transposase orfA protein"
                     /protein_id="YP_006792557.1"
                     /db_xref="GeneID:13715029"
                     /translation="MSKFSLEFKREVSEKYLEGELSLKSVGKMYNIDSSTVRKWAYVY
                     RKHGLKTLTGQKRHYDDNFRLNVVRDVIDNSLSIREAAVKYGIPAFNTISKWIKKYSE
                     IDFSMKGQKEDLRPKTPAVYQRNRSTQLTISEREELEFLRVENAYLKKLKALAQEKLR
                     LEQRKK"
     misc_feature    13419..13568
                     /locus_tag="O3K_26147"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:316076"
     misc_feature    13554..>13703
                     /locus_tag="O3K_26147"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            14141..14329
                     /locus_tag="O3K_26152"
                     /db_xref="GeneID:13715030"
     CDS             14141..14329
                     /locus_tag="O3K_26152"
                     /note="COG2801 Transposase and inactivated derivatives;
                     IS150 ORF B"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006792558.1"
                     /db_xref="GeneID:13715030"
                     /translation="MKELGISSLIRRKKYRAYRGEQGRTCNNLLKRQFYADRPNQKWV
                     TDVTEFKVDGRKLEVYWQ"
     misc_feature    <14141..>14284
                     /locus_tag="O3K_26152"
                     /note="HTH-like domain; Region: HTH_21; cl26233"
                     /db_xref="CDD:331054"
     gene            complement(14354..14578)
                     /locus_tag="O3K_26157"
                     /db_xref="GeneID:13715031"
     CDS             complement(14354..14578)
                     /locus_tag="O3K_26157"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792559.1"
                     /db_xref="GeneID:13715031"
                     /translation="MSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYI
                     EIFYNRQRRHSRLGNISPAAFREKYHQMAA"
     misc_feature    complement(14372..>14578)
                     /locus_tag="O3K_26157"
                     /note="HTH-like domain; Region: HTH_21; cl26233"
                     /db_xref="CDD:331054"
     gene            14623..14880
                     /locus_tag="O3K_26162"
                     /db_xref="GeneID:13715032"
     CDS             14623..14880
                     /locus_tag="O3K_26162"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="ISEhe3 orfB"
                     /protein_id="YP_006792560.1"
                     /db_xref="GeneID:13715032"
                     /translation="MRSTVNLDLIGWSMQSRMTKDIVLNALLMAVWRRNPEKQMLVHS
                     DQGSQYTSVGMVLANRCHRQNMKTSIINGSEVSRLSVAIQL"
     misc_feature    <14647..>14778
                     /locus_tag="O3K_26162"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    complement(14914..16453)
                     /note="potential frameshift: common BLAST hit:
                     gi|218706542|ref|YP_002414061.1| putative transposase ORF
                     1, IS66 family"
     STS             14936..15018
                     /standard_name="RH124512"
                     /db_xref="UniSTS:161334"
     gene            complement(16503..16850)
                     /locus_tag="O3K_26177"
                     /db_xref="GeneID:13715033"
     CDS             complement(16503..16850)
                     /locus_tag="O3K_26177"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_006792561.1"
                     /db_xref="GeneID:13715033"
                     /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVF
                     IFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDW
                     RQPKRLLTSLTML"
     misc_feature    complement(16530..16829)
                     /locus_tag="O3K_26177"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:310376"
     STS             16733..16961
                     /db_xref="UniSTS:234311"
     gene            complement(16847..17248)
                     /locus_tag="O3K_26182"
                     /db_xref="GeneID:13715034"
     CDS             complement(16847..17248)
                     /locus_tag="O3K_26182"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792562.1"
                     /db_xref="GeneID:13715034"
                     /translation="MGTKVSDMQKNVTPGRRKDCPNYPPEFKQQLVAASCEPGISISK
                     LALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPKTLSI
                     SCEVTFRHGTLRFNGNVSEKLLTLLIQELKR"
     misc_feature    complement(16859..17209)
                     /locus_tag="O3K_26182"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(<17027..17206)
                     /locus_tag="O3K_26182"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:279821"
     gene            17434..17595
                     /locus_tag="O3K_26187"
                     /db_xref="GeneID:13715035"
     CDS             17434..17595
                     /locus_tag="O3K_26187"
                     /note="COG3464 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792563.1"
                     /db_xref="GeneID:13715035"
                     /translation="MEADAAAICEAISSRWSNGVVEGHVNRLKMLKRQMYGRAGFELL
                     RQRVMSPLA"
     misc_feature    <17434..17580
                     /locus_tag="O3K_26187"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3464"
                     /db_xref="CDD:225995"
     gene            complement(17564..17884)
                     /locus_tag="O3K_26192"
                     /db_xref="GeneID:13715036"
     CDS             complement(17564..17884)
                     /locus_tag="O3K_26192"
                     /note="COG4584 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_006792564.1"
                     /db_xref="GeneID:13715036"
                     /translation="METSFKILQLKFDKKLTNRCIGLTLHISASTVFEVLARFKASSL
                     SWPLPADISHDTLEKLIFPPKDTFASELVMPDMLYFCQRRMKSGSSATWVEIFMPVDS
                     LPSA"
     gene            complement(18021..18524)
                     /locus_tag="O3K_26197"
                     /db_xref="GeneID:13715037"
     CDS             complement(18021..18524)
                     /locus_tag="O3K_26197"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792565.1"
                     /db_xref="GeneID:13715037"
                     /translation="MKTLKNMRRKNLYITLGLVSLLSGGANAASQQTTQTIRLTVTND
                     CPVTITTTPPQTVGVSSTTPIGFSAKVTTSDQCIKAGAKVWLWGTGPANKWVLQHAKV
                     AKQKYTLNPSIDGGADFVNQGTDAKIYKKLTSGNKFLNASVSVNPKTQVLIPGEYTMI
                     LHAAVDF"
     gene            complement(18626..19063)
                     /locus_tag="O3K_26202"
                     /db_xref="GeneID:13715038"
     CDS             complement(18626..19063)
                     /locus_tag="O3K_26202"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein Agg3B, putative invasin"
                     /protein_id="YP_006792566.1"
                     /db_xref="GeneID:13715038"
                     /translation="MLKKSILPMSCGVLVMVMSGLLDAAEITLISHKTLESQLRDGMK
                     LATGRIACREPHNGFYIWINASQNGKVGHYIVQNNRETKHELKVKIGGGGWSSSLREG
                     QRGVYRQGEEKQAIFDIMSDGNQYSAPGEYIFSVSGECITSRG"
     misc_feature    complement(18689..18943)
                     /locus_tag="O3K_26202"
                     /note="Enterobacteria AfaD invasin protein; Region: AfaD;
                     cl05376"
                     /db_xref="CDD:296991"
     gene            complement(19077..21461)
                     /locus_tag="O3K_26207"
                     /db_xref="GeneID:13715039"
     CDS             complement(19077..21461)
                     /locus_tag="O3K_26207"
                     /note="COG3188 P pilus assembly protein, porin PapC"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane usher protein Agg3C"
                     /protein_id="YP_006792567.1"
                     /db_xref="GeneID:13715039"
                     /translation="MPGIYPVDIILNGSRIDSRDIFFYTKKNRHGEYYLKPCLTRDIL
                     INYGVKIEEYPNLFRQNSEKNRDSSDCADLSVIPQATEDYHFIKQQLILGIPQVAIHP
                     PLTGIAHETMWDDGISAFLLNWQVEGGHWEYRSNTRNSSDNFWASLEPGINLGSWRIR
                     NLTTWNKSSGQSGKWESSYIRVERGLNNIKSRLTFGDDYTPSDIFDSVPFRGGMLGSD
                     ENMVPYNQREFAPVVRGIARTQARIEVRQNGYLIQSRIVSPGAFALTDLPVTGNGGDL
                     QVWVLESDGTIQTFNVPFTTPAIALREGYLKYNVTVGEYRPSDDSIEGAYLGQLTAMY
                     GLPWSLTAFGGIQVSEHYQGNALGLGLSLGGFGSISLDTIYSRGQQKGYSNEIGKTWR
                     VRYDKSFELTGTSFAAGYQDSSAGYHSLADVLDTYRNGTAYRSYDNRIRRTTINISQA
                     LGEWGSVALNGGRDEYRDKVKQDYIGASYSNSWKGITFAVNWSRNNNIGDYYSNSLRT
                     ENNLNLWMSIPMKRWLGGDDKGVTATAQIQRITGQNTLYETGLNGRAFGQKLYWDIRE
                     QIVPGSKYDADTSLLNLRWSGGYGELTGMYSYNRNTRQMNVGTSGSMAIHSGGIAFGQ
                     KTDDTMALIAAPGIAGASVGGWPGVSTDFRGYTLVGHVSPYQENIITLDPTTFPDNTE
                     VSQTDRRVIPTKGALVQAEFKTRVGNRALVTLTRKDGTLLPFGTVVTLERKTGEAFES
                     AGVVDDKGKVYLSGLSEAGKLKAQWGTNSQCYADYKLPLKKGMSGIFLTRAVCM"
     misc_feature    complement(21084..21461)
                     /locus_tag="O3K_26207"
                     /note="PapC N-terminal domain; Region: PapC_N; pfam13954"
                     /db_xref="CDD:290663"
     misc_feature    complement(19080..21458)
                     /locus_tag="O3K_26207"
                     /note="pilin outer membrane usher protein SafC;
                     Provisional; Region: PRK15223"
                     /db_xref="CDD:185145"
     misc_feature    complement(19356..21026)
                     /locus_tag="O3K_26207"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:278974"
     misc_feature    complement(19128..19325)
                     /locus_tag="O3K_26207"
                     /note="PapC C-terminal domain; Region: PapC_C; pfam13953"
                     /db_xref="CDD:290662"
     gene            complement(21619..22248)
                     /locus_tag="O3K_26212"
                     /db_xref="GeneID:13715040"
     CDS             complement(21619..22248)
                     /locus_tag="O3K_26212"
                     /note="COG3121 P pilus assembly protein, chaperone PapD"
                     /codon_start=1
                     /transl_table=11
                     /product="Chaperone protein Agg3D"
                     /protein_id="YP_006792568.1"
                     /db_xref="GeneID:13715040"
                     /translation="MLYKPNSSGETLAVINEHNYPILVQANVLSEDQKNIAPFIITPP
                     LFRLDALQSSRLRIVKTEGAFPIDRESLQWICVKAIPPKYEDKWAKEEVSGKKSDEAT
                     MNIQVSVSSCIKLFVRPADVKGQPDDVAGKIKWQKVGNKLKGVNPTPFYMDIAELRVG
                     EKEITETHYIAPFSSYEYPMPVNGGGDVRWKVVTDYGGISKTFETGLNI"
     misc_feature    complement(21880..22242)
                     /locus_tag="O3K_26212"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; pfam00345"
                     /db_xref="CDD:278760"
     misc_feature    complement(21646..21813)
                     /locus_tag="O3K_26212"
                     /note="Pili assembly chaperone PapD, C-terminal domain;
                     Region: PapD_C; pfam02753"
                     /db_xref="CDD:280849"
     gene            complement(22524..22727)
                     /locus_tag="O3K_26217"
                     /db_xref="GeneID:13715041"
     CDS             complement(22524..22727)
                     /locus_tag="O3K_26217"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792569.1"
                     /db_xref="GeneID:13715041"
                     /translation="MVQEIVHIPLTDFGGKRVFFVILFTSFREFSFQDFRDGLANNVI
                     NNYLYAKSVIFGENGGGILVLED"
     gene            complement(23226..23837)
                     /locus_tag="O3K_26222"
                     /db_xref="GeneID:13715042"
     CDS             complement(23226..23837)
                     /locus_tag="O3K_26222"
                     /note="COG1961 Site-specific recombinases, DNA invertase
                     Pin homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="Resolvase"
                     /protein_id="YP_006792570.1"
                     /db_xref="GeneID:13715042"
                     /translation="MVSVSRLSAAHHYGVLRPFPPKVSLLAHQISELKNAGVREDRIF
                     TDIMTGATDEREGLQRLLARAEKDDVIICTKMDRLGRNTADMIRVVDSCYKKGIAIRF
                     LENGLSTEGTMGKMVIQILAAVAEAERECILERTNDGRIAALAAGVKFGRKKHPRTPT
                     ALELISQGESLGSVTEKTGISRSTYFRLKRTIKNDAKIATFSK"
     misc_feature    complement(23229..23801)
                     /locus_tag="O3K_26222"
                     /note="Site-specific DNA recombinase related to the DNA
                     invertase Pin [Replication, recombination and repair];
                     Region: PinE; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(23421..23762)
                     /locus_tag="O3K_26222"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(23454..23456,23466..23471,23475..23480,
                     23610..23612))
                     /locus_tag="O3K_26222"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(23448..23450,23457..23459,23466..23471,
                     23478..23483,23490..23492,23574..23579,23592..23594))
                     /locus_tag="O3K_26222"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(23433..23435,23445..23447,23454..23456,
                     23466..23468,23475..23480,23487..23492,23517..23525))
                     /locus_tag="O3K_26222"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(23433..23435,23445..23447,23454..23456,
                     23466..23468,23475..23477,23523..23525))
                     /locus_tag="O3K_26222"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(23430..23435,23451..23453))
                     /locus_tag="O3K_26222"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     gene            23924..24301
                     /locus_tag="O3K_26227"
                     /db_xref="GeneID:13715043"
     CDS             23924..24301
                     /locus_tag="O3K_26227"
                     /note="COG1974 SOS-response transcriptional repressors
                     (RecA-mediated autopeptidases)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative UV protection protein"
                     /protein_id="YP_006792571.1"
                     /db_xref="GeneID:13715043"
                     /translation="MFADRCQAGFPSPATDYAEQELDLNSYCISRPAATFFLRASGES
                     MNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKRLLLRPRPALEPVSDSPEFRT
                     LYPENICIFGVVTHVIHRTRELR"
     misc_feature    23924..24289
                     /locus_tag="O3K_26227"
                     /note="The S24, S26 LexA/signal peptidase superfamily
                     contains LexA-related and type I signal peptidase
                     families. The S24 LexA protein domains include: the lambda
                     repressor CI/C2 family and related bacterial prophage
                     repressor proteins; LexA (EC 3.4.21.88), the...; Region:
                     Peptidase_S24_S26; cl10465"
                     /db_xref="CDD:324586"
     misc_feature    order(24053..24055,24164..24166)
                     /locus_tag="O3K_26227"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     gene            24301..25497
                     /gene="umuC"
                     /locus_tag="O3K_26232"
                     /db_xref="GeneID:13715044"
     CDS             24301..25497
                     /gene="umuC"
                     /locus_tag="O3K_26232"
                     /EC_number="2.7.7.7"
                     /note="COG0389 Nucleotidyltransferase/DNA polymerase
                     involved in DNA repair"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="YP_006792572.1"
                     /db_xref="GeneID:13715044"
                     /translation="MFALADINSFYASCEKVFRPDLRNEPVIVLSNNDGCVIARSPEA
                     KALGIRMGQPWFQVRQMRLEKKIHVFSSNYALYHSMSQRVMAVLESLSPAVEPYSIDE
                     MFIDLRGINHYISPEFFGHQLREQVKSWTGLTMGVGIAPTKTLAKSAQWATKQWPQFS
                     GVVALTAENRNRTLKLLGLQPVGEVWGVGRRLTEKLNALGINTALQLAQANTAFIRKN
                     FSVILERTVRELNGESCISLEEAPPAKQQIVCSRSFGERITDKDAMHQAVVQYAERAA
                     EKLRGERQYCRQVTTFVRTSPFAVKEPCYSNAAVEKLPLPTQDSRDIIAAACRALNHV
                     WREGYRYMKAGVMLADFTPSGIAQPGLFDEIQPRKNSEKLMKTLDELNLSGKGKVWFT
                     GRGTAP"
     misc_feature    24301..25494
                     /gene="umuC"
                     /locus_tag="O3K_26232"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     misc_feature    24307..25350
                     /gene="umuC"
                     /locus_tag="O3K_26232"
                     /note="umuC subunit of DNA Polymerase V; Region:
                     PolY_Pol_V_umuC; cd01700"
                     /db_xref="CDD:176454"
     misc_feature    order(24316..24321,24328..24333,24424..24426,24433..24435,
                     24601..24606,24760..24762)
                     /gene="umuC"
                     /locus_tag="O3K_26232"
                     /note="active site"
                     /db_xref="CDD:176454"
     misc_feature    order(24595..24597,24604..24606,24856..24876,24961..24963,
                     25036..25053,25132..25134,25189..25203,25207..25209)
                     /gene="umuC"
                     /locus_tag="O3K_26232"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176454"
     gene            complement(25577..25993)
                     /locus_tag="O3K_26237"
                     /db_xref="GeneID:13715045"
     CDS             complement(25577..25993)
                     /locus_tag="O3K_26237"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792573.1"
                     /db_xref="GeneID:13715045"
                     /translation="MSDENKSRRCSFELFPDERTGDKIADELIANEKLKERGRFMRAM
                     LVTGAAFAAIDKRLPLLISELLTENTTLDDINKVISSVIPGAFSVEKKLLELLEKQSG
                     LHSSVDCCTPLTEQSLSRNDGEDQTRRNAENMFGDD"
     misc_feature    complement(25757..25972)
                     /locus_tag="O3K_26237"
                     /note="Plasmid stability protein; Region: Plasmid_stab_B;
                     pfam10784"
                     /db_xref="CDD:119304"
     gene            complement(25986..26966)
                     /locus_tag="O3K_26242"
                     /db_xref="GeneID:13715046"
     CDS             complement(25986..26966)
                     /locus_tag="O3K_26242"
                     /note="COG0443 Molecular chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="Plasmid segregation protein (ParA locus)"
                     /protein_id="YP_006792574.1"
                     /db_xref="GeneID:13715046"
                     /translation="MKIFIDDGSTNIKLAWLEDGDVKTLISPNSFKPEWSFSLLDDAA
                     PANYEIDGEKFSFDPLSADAVVTTETRYQYSDVNVVAIQHALQQTGLKAQPVDVIVTL
                     PISEYLDANNQKNKKNIERKKKNVMREVLVQGSDAFVIRSVSVLPESIPAGFSVLAGL
                     EDDESLLIVDLGGTTLDVSHVRSKMTGITKTWCDPNIGVSLITSGVKEQMAVHANTRV
                     SSFQADNIIVHRNEPDYLSRRIYNAEQRESIINVINERQKLLIKRVNDVISRFTDYTH
                     VMCVGGGAEIVAEAVKNLTKVPDERFYLSSSPQFDLVMGMIKMKGGVTNE"
     misc_feature    complement(26010..26966)
                     /locus_tag="O3K_26242"
                     /note="StbA protein; Region: StbA; pfam06406"
                     /db_xref="CDD:310773"
     misc_feature    complement(order(26457..26459,26949..26951))
                     /locus_tag="O3K_26242"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(26109..26111,26121..26126,26448..26456,
                     26928..26930,26934..26945))
                     /locus_tag="O3K_26242"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(26421..26423,26472..26474,26529..26531,
                     26712..26714,26784..26792,26799..26801,26865..26867,
                     26871..26873))
                     /locus_tag="O3K_26242"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            complement(27380..27688)
                     /locus_tag="O3K_26247"
                     /db_xref="GeneID:13715047"
     CDS             complement(27380..27688)
                     /locus_tag="O3K_26247"
                     /codon_start=1
                     /transl_table=11
                     /product="putative chaperonin"
                     /protein_id="YP_006792575.1"
                     /db_xref="GeneID:13715047"
                     /translation="MSKAKFSAQAEKLKNLVDSARLQTSSSAVTATVPSQPNEGAEEV
                     SGRPVAARTKAKNLKAIPLSYFEAHAELKATSKTSLDFSSYIIEAIREKLERDGAIGQ
                     "
     gene            complement(27775..28419)
                     /locus_tag="O3K_26252"
                     /db_xref="GeneID:13715048"
     CDS             complement(27775..28419)
                     /locus_tag="O3K_26252"
                     /note="COG1192 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase involved in chromosome partitioning"
                     /protein_id="YP_006792576.1"
                     /db_xref="GeneID:13715048"
                     /translation="MPVIANTHPKGGVGKTTSSVNIVGEMKSDAVDLDTHTGLSIILG
                     LRPEGKEISVKVPKTVDELIEIMTPYKNSDKTLLIDCGGFDSDLTRTAIAFADCVIVP
                     SKDSLTERIGLMHFDGVLDEISSIMGTDITAHLYLCKVNPNKKKFPKLDAILPSFKHL
                     KLMKSRISARAEFEDVIETGMGITESVHGRYSAGGKEVIALIEEINHLIENNKQ"
     misc_feature    complement(27787..28419)
                     /locus_tag="O3K_26252"
                     /note="Cellulose biosynthesis protein BcsQ [Cell
                     motility]; Region: BcsQ; COG1192"
                     /db_xref="CDD:224113"
     gene            complement(28598..29404)
                     /locus_tag="O3K_26257"
                     /db_xref="GeneID:13715049"
     CDS             complement(28598..29404)
                     /locus_tag="O3K_26257"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative resolvase"
                     /protein_id="YP_006792577.1"
                     /db_xref="GeneID:13715049"
                     /translation="MSGSVIHSQSAAMVPAVYSAGQFPQLPVVIDYPAALALRQMSMV
                     HDELPKYLLAPEVSALLHYVPDLRRKMLLATLWNTGARINEALALTRGDFSLAPPYPF
                     VQLATLKQRTEKAARTAGRMPAGQQTHRLVPLSDTGYVSQLQTMVATLKIPLERRNKR
                     TGRTEKARIWEVTDRTVRTWIGEAVVAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIP
                     LKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFSMPESDAVSMLKRIP"
     misc_feature    complement(28679..29254)
                     /locus_tag="O3K_26257"
                     /note="Phage integrase family; Region: Phage_integrase;
                     pfam00589"
                     /db_xref="CDD:278986"
     misc_feature    complement(order(28694..28696,28799..28801,28871..28873,
                     28877..28879,29156..29161,29201..29203))
                     /locus_tag="O3K_26257"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    complement(order(28694..28696,28721..28723,28790..28792,
                     28799..28801,29159..29161))
                     /locus_tag="O3K_26257"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(29405..29710)
                     /locus_tag="O3K_26262"
                     /db_xref="GeneID:13715050"
     CDS             complement(29405..29710)
                     /locus_tag="O3K_26262"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdB"
                     /protein_id="YP_006792578.1"
                     /db_xref="GeneID:13715050"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHWENDIKNAINLMFWGI"
     misc_feature    complement(29408..29710)
                     /locus_tag="O3K_26262"
                     /note="plasmid maintenance protein CcdB; Provisional;
                     Region: PRK13708"
                     /db_xref="CDD:184264"
     gene            complement(29712..29930)
                     /locus_tag="O3K_26267"
                     /db_xref="GeneID:13715051"
     CDS             complement(29712..29930)
                     /locus_tag="O3K_26267"
                     /note="COG5302 Post-segregation antitoxin (ccd killing
                     mechanism protein) encoded by the F plasmid"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdA"
                     /protein_id="YP_006792579.1"
                     /db_xref="GeneID:13715051"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     QAENQEGMAEVAKFIEMNGSFADENRDW"
     misc_feature    complement(29715..29930)
                     /locus_tag="O3K_26267"
                     /note="plasmid maintenance protein CcdA; Provisional;
                     Region: PRK13710"
                     /db_xref="CDD:184266"
     gene            30525..30755
                     /locus_tag="O3K_26272"
                     /db_xref="GeneID:13715052"
     CDS             30525..30755
                     /locus_tag="O3K_26272"
                     /note="COG4456 Virulence-associated protein and related
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792580.1"
                     /db_xref="GeneID:13715052"
                     /translation="MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVR
                     PTWSSFAALEKADADFMAEREDIVSDEGRFDL"
     misc_feature    30531..30719
                     /locus_tag="O3K_26272"
                     /note="Antidote-toxin recognition MazE, bacterial
                     antitoxin; Region: MazE_antitoxin; cl00877"
                     /db_xref="CDD:321225"
     gene            30752..31180
                     /locus_tag="O3K_26277"
                     /db_xref="GeneID:13715053"
     CDS             30752..31180
                     /locus_tag="O3K_26277"
                     /note="COG1487 Predicted nucleic acid-binding protein,
                     contains PIN domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792581.1"
                     /db_xref="GeneID:13715053"
                     /translation="MKQTRTKTYMLDTNICSFIMREQPAAVIKRLEQAVLRNHRIVVS
                     AITYAEMRFDATGPKASPRHIALVDAFCARLDAILPWDRAAVDATTEIKMALRLAETP
                     IGPNNTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK"
     misc_feature    30776..31171
                     /locus_tag="O3K_26277"
                     /note="PIN (PilT N terminus) domain: Superfamily; Region:
                     PIN_SF; cl14812"
                     /db_xref="CDD:301351"
     misc_feature    order(30782..30790,30797..30802,30806..30814,30836..30838,
                     30845..30847,30872..30874,30884..30889,30893..30901,
                     30905..30913,30947..30949,30956..30958,30983..30985,
                     30989..30997,31010..31012,31016..31021,31028..31033,
                     31040..31042,31061..31063,31067..31072,31076..31081,
                     31136..31138)
                     /locus_tag="O3K_26277"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    order(30785..30787,30899..30901,31070..31072,31124..31126)
                     /locus_tag="O3K_26277"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    order(30884..30889,30896..30901,30905..30910,30950..30955,
                     30962..30964,30992..30994,31007..31012,31016..31024,
                     31028..31033,31064..31069,31073..31075)
                     /locus_tag="O3K_26277"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(31263..31418)
                     /locus_tag="O3K_26282"
                     /db_xref="GeneID:13715054"
     CDS             complement(31263..31418)
                     /locus_tag="O3K_26282"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792582.1"
                     /db_xref="GeneID:13715054"
                     /translation="MCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPW
                     NVVLTNK"
     misc_feature    complement(31287..31397)
                     /locus_tag="O3K_26282"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:290531"
     gene            32504..33481
                     /locus_tag="O3K_26287"
                     /db_xref="GeneID:13715055"
     CDS             32504..33481
                     /locus_tag="O3K_26287"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RepFIB replication protein A"
                     /protein_id="YP_006792583.1"
                     /db_xref="GeneID:13715055"
                     /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNT
                     LSRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVTGDKVE
                     LPFVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSA
                     YYDTERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
                     PISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPR
                     LKAPNDESKENPLPPSPVEKVSPEMAEKLALLEKLGITLDDLEKLFKSR"
     misc_feature    32534..>32905
                     /locus_tag="O3K_26287"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:307271"
     gene            complement(33760..34500)
                     /locus_tag="O3K_26292"
                     /db_xref="GeneID:13715056"
     CDS             complement(33760..34500)
                     /locus_tag="O3K_26292"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative resolvase (protein D)"
                     /protein_id="YP_006792584.1"
                     /db_xref="GeneID:13715056"
                     /translation="MNNVIPLQNSPERVSLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGVRPFVRIQSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWAVTDETMRNWLKQAV
                     RRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLK"
     misc_feature    complement(33862..34332)
                     /locus_tag="O3K_26292"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain; Region: DNA_BRE_C; cd00397"
                     /db_xref="CDD:271175"
     misc_feature    complement(order(33865..33867,33970..33972,34030..34032,
                     34036..34038,34273..34278,34318..34320))
                     /locus_tag="O3K_26292"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    complement(order(33865..33867,33892..33894,33961..33963,
                     33970..33972,34276..34278))
                     /locus_tag="O3K_26292"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(34869..34955)
                     /locus_tag="O3K_26297"
                     /db_xref="GeneID:13715057"
     CDS             complement(34869..34955)
                     /locus_tag="O3K_26297"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792585.1"
                     /db_xref="GeneID:13715057"
                     /translation="MVYFLQTDTEIVIIRILSQHQDASRHFN"
     gene            complement(35232..35477)
                     /locus_tag="O3K_26302"
                     /db_xref="GeneID:13715058"
     CDS             complement(35232..35477)
                     /locus_tag="O3K_26302"
                     /note="COG3609 Predicted transcriptional regulators
                     containing the CopG/Arc/MetJ DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792586.1"
                     /db_xref="GeneID:13715058"
                     /translation="MWGQLNIACRVKFKLTITRLDMARTMTVALGDELWEYIESLIES
                     GDYRTQSEVIRESLRLLREKQAESRLQVSCGIYWQKA"
     misc_feature    complement(<35265..35405)
                     /locus_tag="O3K_26302"
                     /note="Ribbon-helix-helix protein, copG family; Region:
                     RHH_1; cl22901"
                     /db_xref="CDD:304625"
     gene            complement(35483..35758)
                     /locus_tag="O3K_26307"
                     /db_xref="GeneID:13715059"
     CDS             complement(35483..35758)
                     /locus_tag="O3K_26307"
                     /note="COG3668 Plasmid stabilization system protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792587.1"
                     /db_xref="GeneID:13715059"
                     /translation="MELKWTSKALSDLSRLYDFLVLASKPAAARTVQSLTQAPVILLT
                     HPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIYVLRLWHTRENR"
     misc_feature    complement(35489..35752)
                     /locus_tag="O3K_26307"
                     /note="ParE toxin of type II toxin-antitoxin system,
                     parDE; Region: ParE_toxin; pfam05016"
                     /db_xref="CDD:309933"
     gene            complement(35758..36042)
                     /locus_tag="O3K_26312"
                     /db_xref="GeneID:13715060"
     CDS             complement(35758..36042)
                     /locus_tag="O3K_26312"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792588.1"
                     /db_xref="GeneID:13715060"
                     /translation="MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQA
                     LSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAWSDSLSTDNPLPVPR"
     misc_feature    complement(35770..36009)
                     /locus_tag="O3K_26312"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG3905; cl22964"
                     /db_xref="CDD:277679"
     gene            complement(36950..37621)
                     /locus_tag="O3K_26317"
                     /db_xref="GeneID:13715061"
     CDS             complement(36950..37621)
                     /locus_tag="O3K_26317"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_006792589.1"
                     /db_xref="GeneID:13715061"
                     /translation="MPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLATE
                     SGAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDVSEDA
                     VAAARRSRVEWENRQRKKQGLDTLGMDELIAKAWRFVRERFRSYRTELKSRGIKRARA
                     RRDANRERQDIVTLVKRQLTREISEGRFTANGEAVKREVERRMKERMILSRNRNYSRL
                     ATASP"
     misc_feature    complement(36953..>37621)
                     /locus_tag="O3K_26317"
                     /note="IncFII RepA protein family; Region: IncFII_repA;
                     cl11495"
                     /db_xref="CDD:299748"
     gene            complement(37590..37778)
                     /locus_tag="O3K_26322"
                     /db_xref="GeneID:13715062"
     CDS             complement(37590..37778)
                     /locus_tag="O3K_26322"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_006792590.1"
                     /db_xref="GeneID:13715062"
                     /translation="MTDLQQTYYRQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSR
                     FDFAIHVAHATGAASTGY"
     misc_feature    complement(<37617..37778)
                     /locus_tag="O3K_26322"
                     /note="IncFII RepA protein family; Region: IncFII_repA;
                     cl11495"
                     /db_xref="CDD:299748"
     gene            complement(37771..37845)
                     /locus_tag="O3K_26327"
                     /db_xref="GeneID:13715063"
     CDS             complement(37771..37845)
                     /locus_tag="O3K_26327"
                     /codon_start=1
                     /transl_table=11
                     /product="leader peptide RepL"
                     /protein_id="YP_006792591.1"
                     /db_xref="GeneID:13715063"
                     /translation="MTGKVQDFFLCSLLLRIVSAGWCD"
     misc_feature    complement(37774..37845)
                     /locus_tag="O3K_26327"
                     /note="leader peptide RepL; Provisional; Region: PRK13716"
                     /db_xref="CDD:106657"
     gene            complement(38083..38337)
                     /locus_tag="O3K_26332"
                     /db_xref="GeneID:13715064"
     CDS             complement(38083..38337)
                     /locus_tag="O3K_26332"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_006792592.1"
                     /db_xref="GeneID:13715064"
                     /translation="MSQTENTVTSSSGAKRAYRKGNPLSDAEKQRLSVARKRASFKEV
                     KVFLEPKYKAMLMQMCNEDGLTQAEVLTALIKSEAQKRCM"
     misc_feature    complement(38086..38337)
                     /locus_tag="O3K_26332"
                     /note="replication protein; Provisional; Region: PRK13702"
                     /db_xref="CDD:184258"
     gene            38618..39598
                     /locus_tag="O3K_26337"
                     /db_xref="GeneID:13715065"
     CDS             38618..39598
                     /locus_tag="O3K_26337"
                     /note="COG3039 Transposase and inactivated derivatives,
                     IS5 family"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006792593.1"
                     /db_xref="GeneID:13715065"
                     /translation="MSHQLTFADSEFSTKRRQTRKEIFLSRMEQILPWQNMTAVIEPF
                     YPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDR
                     TTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQR
                     DPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVS
                     ADAGYQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRAKVE
                     HPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSH"
     misc_feature    38804..39583
                     /locus_tag="O3K_26337"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [Mobilome: prophages, transposons]; Region: IS5; COG3039"
                     /db_xref="CDD:225581"
     gene            complement(40006..40176)
                     /locus_tag="O3K_26342"
                     /db_xref="GeneID:13715066"
     CDS             complement(40006..40176)
                     /locus_tag="O3K_26342"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792594.1"
                     /db_xref="GeneID:13715066"
                     /translation="MDAGWKLQKHGDGLPVLRPGQTGSSLPEKGLNTATGAAGEGCNE
                     KSSLHYSRDSEG"
     gene            40326..41003
                     /locus_tag="O3K_26347"
                     /db_xref="GeneID:13715067"
     CDS             40326..41003
                     /locus_tag="O3K_26347"
                     /note="COG4584 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase orfA"
                     /protein_id="YP_006792595.1"
                     /db_xref="GeneID:13715067"
                     /translation="MSIIFNGHYRMKHRTWITEALRLHFEEHLPRVVAGRRLGVPKST
                     VCSMFVRFRRAGLSWPLPAGMSEQELDACLYGQFSTVPVVRPESTVISEAPVVKKRPR
                     RPNFPYEFKIALVEQSLQPGACVAQIARENGINDNLLFNWRHQYRKGGLLPSGKNMPA
                     LLPVTLTPEPDNKIPAPAQEPEQINTPSDSLCCELVLPAGTLRLKGKLTPALLQTLIR
                     EIKGSSH"
     misc_feature    40617..40835
                     /locus_tag="O3K_26347"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:307599"
     gene            41003..41350
                     /locus_tag="O3K_26352"
                     /db_xref="GeneID:13715068"
     CDS             41003..41350
                     /locus_tag="O3K_26352"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family element, orf2"
                     /protein_id="YP_006792596.1"
                     /db_xref="GeneID:13715068"
                     /translation="MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLF
                     IFRGRRGDQIKVLWADSDGLCLFTKRLERGRFVWPVTRDGKVHLTPAQLSMLLEGINW
                     KHPKRTERAGIRI"
     misc_feature    41027..41323
                     /locus_tag="O3K_26352"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:310376"
     gene            41370..42941
                     /locus_tag="O3K_26357"
                     /db_xref="GeneID:13715069"
     CDS             41370..42941
                     /locus_tag="O3K_26357"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792597.1"
                     /db_xref="GeneID:13715069"
                     /translation="MDTSLAHENARLRALLQTQQDTIRQMAEYNRLLSQRVAAYASEI
                     NRLKALVAKLQRMQFGKSSEKLRAKTERQIQEAQERISALQEEMAETLGEQYDPVLPS
                     ALRQSSARKPLPASLPRETRVIRPEEECCPACGGELSSLGCDVSEQLELISSAFKVIE
                     TQRPKQACCRCDHIVQAPVPSKPIARSYAGAGLLAHVVTGKYADHLPLYRQSEIYRRQ
                     GVELSRATLGRWTGAVAELLEPLYDVLRQYVLMPGKVHADDIPVPVQEPGSGKTRTAR
                     LWVYVRDDRNAGSQMPPAVWFAYSPDRKGIHPQNHLAGYSGVLQADAYGGYRALYESG
                     RITEAACMAHARRKIHDVHARAPTYITTEALQRIGELYAIEAEVRGCSAEQRLAARKA
                     RAAPLMQSLYDWIQQQMKTLSRHSDTAKAFAYLLKQWDALNVYCSNGWVEIDNNIAEN
                     VLRGVAVGRKNWMFAGSDSGGEHAAVLYSLIGTCRLNNVEPEKWLRYVIEHIQDWPAN
                     RVRDLLPWKVDLSSQ"
     misc_feature    41505..41735
                     /locus_tag="O3K_26357"
                     /note="Transposase C of IS166 homeodomain; Region:
                     LZ_Tnp_IS66; pfam13007"
                     /db_xref="CDD:315644"
     misc_feature    41682..42155
                     /locus_tag="O3K_26357"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    41925..42785
                     /locus_tag="O3K_26357"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:281099"
     misc_feature    42804..42914
                     /locus_tag="O3K_26357"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:316346"
     gene            complement(42995..43180)
                     /locus_tag="O3K_26362"
                     /db_xref="GeneID:13715070"
     CDS             complement(42995..43180)
                     /locus_tag="O3K_26362"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_006792598.1"
                     /db_xref="GeneID:13715070"
                     /translation="MFFGSDHGGERGALLYGLIGTCRLNGIDPEAYLRHILSVLPEWP
                     SNRVDELLPWNVVLTNK"
     misc_feature    complement(43022..43129)
                     /locus_tag="O3K_26362"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:316346"
     gene            complement(43254..43550)
                     /locus_tag="O3K_26367"
                     /db_xref="GeneID:13715071"
     CDS             complement(43254..43550)
                     /locus_tag="O3K_26367"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792599.1"
                     /db_xref="GeneID:13715071"
                     /translation="MISLPSGTRIWLVAGVTDMRKSFNGLGEQIQHVLDDNPFSGHLF
                     IFRGRRGDTIKILWADADGLCLFTKRLEEGQFIWPAVRDGKIYQEALGCVVQLL"
     misc_feature    complement(<43293..43529)
                     /locus_tag="O3K_26367"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:310376"
     gene            complement(43547..43981)
                     /locus_tag="O3K_26372"
                     /db_xref="GeneID:13715072"
     CDS             complement(43547..43981)
                     /locus_tag="O3K_26372"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792600.1"
                     /db_xref="GeneID:13715072"
                     /translation="MDKPTDWRFGTRRIFSNEFKLHMVELASKPNANVAQLAREHGVD
                     NNLIFKWLRLWQREGRISRRMPPTIVGPTVSQSFPASPTLVPVELIDTPRCATDAPAP
                     EALSVACAASCHVEFHYGKMMLENPSPELLTVLIRELTGRGR"
     misc_feature    complement(43568..43948)
                     /locus_tag="O3K_26372"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            complement(44210..44770)
                     /locus_tag="O3K_26377"
                     /db_xref="GeneID:13715073"
     CDS             complement(44210..44770)
                     /locus_tag="O3K_26377"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer fertility inhibition protein
                     FinO"
                     /protein_id="YP_006792601.1"
                     /db_xref="GeneID:13715073"
                     /translation="MTEQKRPVLTLKRKTEGETPVRRRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELAAKKAQARQGLSIYLNLPSLDEAVNTLKPWWPGLFDGDTPQLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEA
                     YAAARLDKIRRQNRIKAELQAVLYEK"
     misc_feature    complement(44216..44770)
                     /locus_tag="O3K_26377"
                     /note="conjugal transfer fertility inhibition protein
                     FinO; Provisional; Region: PRK13754"
                     /db_xref="CDD:184304"
     gene            complement(44825..45571)
                     /locus_tag="O3K_26382"
                     /db_xref="GeneID:13715074"
     CDS             complement(44825..45571)
                     /locus_tag="O3K_26382"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylation protein
                     TraX"
                     /protein_id="YP_006792602.1"
                     /db_xref="GeneID:13715074"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLM
                     VLDHINLIFQLKQEWMFLAGRGAFPLFALVWGLNLSRHANIRQPAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSHRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTVLTVGLVSC
                     AGKSLPRFWPGDFFPVFYACHLAVLGVLAL"
     misc_feature    complement(44828..45571)
                     /locus_tag="O3K_26382"
                     /note="conjugal transfer pilus acetylation protein TraX;
                     Provisional; Region: PRK13706"
                     /db_xref="CDD:184262"
     gene            complement(45591..45728)
                     /locus_tag="O3K_26387"
                     /db_xref="GeneID:13715075"
     CDS             complement(45591..45728)
                     /locus_tag="O3K_26387"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer nickase/helicase TraI"
                     /protein_id="YP_006792603.1"
                     /db_xref="GeneID:13715075"
                     /translation="MLRESQREREAVREIARENLLQERLQQMERDMVRDLQKEKTLGG
                     D"
     misc_feature    complement(45594..>45728)
                     /locus_tag="O3K_26387"
                     /note="DNA helicase TraI; Region: TraI; cl26921"
                     /db_xref="CDD:331742"
     gene            complement(45804..49517)
                     /locus_tag="O3K_26392"
                     /db_xref="GeneID:13715076"
     CDS             complement(45804..49517)
                     /locus_tag="O3K_26392"
                     /note="COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer nickase/helicase TraI"
                     /protein_id="YP_006792604.1"
                     /db_xref="GeneID:13715076"
                     /translation="MAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGRRQ
                     LQDGMTFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAM
                     KDAGVNTYRWQGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQA
                     ILTQAIRSELKTQGVLGHPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSH
                     DRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKT
                     PGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKLENGWVETPGHSV
                     SDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
                     KARAGETSLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEG
                     TGFTELGGEINAQIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTP
                     LMERVPGELMETLTSGQRAATRMILEASDRFTVVQGYAGVGKTTQFRAVMSAVNMLPA
                     SERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDES
                     SMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIV
                     RQTPELREAVYSLINRDVERALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLA
                     EAQQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHD
                     AREKAGELGKEQVMVPVLNTANIRDGELRRLSTWEKNPDALALVDSVYHRIAGISKDD
                     GLITLQDAEGNTRLISPREAVAEGVTLYTPDKIRVGTGDRMRFTKSDRERGYVANSVW
                     TVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAITAHGAQGASETFAIALEGTE
                     GNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVFEPKPDREV
                     MNAQRLFSTARELRDVAAGRAVLRQAGLSGGDSPARFIAPGRKYPQPYVALPAFDRNG
                     RSAGIWLNPLTTDDGNGLRGFSGEGRVKGSEDAQFVALQGSRNGESLLADNMQDGVRI
                     ARDNPDSGVVVRIAGEGRPWNPGAITGGRVWGDIPDSSVQPGAGNGEPVTAEVLAQRQ
                     AEEAIRRETERRADEIVRKMAENKPDLPDGKTE"
     misc_feature    complement(45807..49517)
                     /locus_tag="O3K_26392"
                     /note="conjugal transfer nickase/helicase TraI;
                     Provisional; Region: PRK14712"
                     /db_xref="CDD:237796"
     misc_feature    complement(47403..47960)
                     /locus_tag="O3K_26392"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:290335"
     misc_feature    complement(46203..46562)
                     /locus_tag="O3K_26392"
                     /note="DNA helicase TraI; Region: TraI; pfam07057"
                     /db_xref="CDD:284471"
     gene            complement(49522..50196)
                     /locus_tag="O3K_26397"
                     /db_xref="GeneID:13715077"
     CDS             complement(49522..50196)
                     /locus_tag="O3K_26397"
                     /note="COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer nickase/helicase TraI"
                     /protein_id="YP_006792605.1"
                     /db_xref="GeneID:13715077"
                     /translation="MWEIPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQ
                     HVDPEVRMAEWMQMLKETGFDIRAYRDAVDQRVETRTQAPGPASQDGPDVQQAVTQAI
                     AGLSERKVQFTYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTS
                     GIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQG
                     GSRRAA"
     misc_feature    complement(<49537..50196)
                     /locus_tag="O3K_26397"
                     /note="DNA helicase TraI; Region: TraI; cl26921"
                     /db_xref="CDD:331742"
     gene            50318..50617
                     /locus_tag="O3K_26402"
                     /db_xref="GeneID:13715078"
     CDS             50318..50617
                     /locus_tag="O3K_26402"
                     /note="COG3677 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1 orfA"
                     /protein_id="YP_006792606.1"
                     /db_xref="GeneID:13715078"
                     /translation="MASVSISYPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFT
                     YTASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKTQAAVGNLAHTAGQ"
     misc_feature    50318..50572
                     /locus_tag="O3K_26402"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: InsA; COG3677"
                     /db_xref="CDD:226202"
     misc_feature    50318..50425
                     /locus_tag="O3K_26402"
                     /note="InsA N-terminal domain; Region: Zn_Tnp_IS1;
                     pfam03811"
                     /db_xref="CDD:281762"
     misc_feature    50444..50575
                     /locus_tag="O3K_26402"
                     /note="InsA C-terminal domain; Region: HTH_Tnp_IS1;
                     pfam12759"
                     /db_xref="CDD:289525"
     gene            50737..51003
                     /locus_tag="O3K_26407"
                     /db_xref="GeneID:13715079"
     misc_feature    50737..51003
                     /locus_tag="O3K_26407"
                     /note="COG1662 Transposase and inactivated derivatives,
                     IS1 family"
     gene            complement(51661..52044)
                     /locus_tag="O3K_26412"
                     /db_xref="GeneID:13715080"
     CDS             complement(51661..52044)
                     /locus_tag="O3K_26412"
                     /note="COG1082 Sugar phosphate isomerases/epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraM"
                     /protein_id="YP_006792607.1"
                     /db_xref="GeneID:13715080"
                     /translation="MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLE
                     LGLRVYEAQMERKESAFNQAEFNKVLLECAVKTQSTVAKILGIESLSPHVSGNPKFEY
                     ANMVEDIRDKVSSEMERFFPENDEE"
     misc_feature    complement(order(51682..51687,51694..51699,51706..51711,
                     51715..51720,51730..51732,51778..51849,51895..51900,
                     51904..51921,51925..51930,51937..51939,51997..52002,
                     52006..52008,52015..52017,52021..52041))
                     /locus_tag="O3K_26412"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271351"
     misc_feature    complement(order(51937..51945,52006..52008,52015..52017,
                     52021..52032,52036..52038))
                     /locus_tag="O3K_26412"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271351"
     misc_feature    complement(51670..52023)
                     /locus_tag="O3K_26412"
                     /note="conjugal transfer protein TraM; Provisional;
                     Region: PRK13713"
                     /db_xref="CDD:184269"
     gene            52468..52977
                     /locus_tag="O3K_26417"
                     /db_xref="GeneID:13715081"
     CDS             52468..52977
                     /locus_tag="O3K_26417"
                     /note="COG0741 Soluble lytic murein transglycosylase and
                     related regulatory proteins (some contain LysM/invasin
                     domains)"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="YP_006792608.1"
                     /db_xref="GeneID:13715081"
                     /translation="MKKWMLAICLMFINGICEAADCFDLAGRDYKIDPDLLRAISWKE
                     SRYRVNAIGINPVTGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLAI
                     AFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASEVYRIYTWIKSSKGIRVPTTKKSL
                     SQINSVQNN"
     misc_feature    52468..52974
                     /locus_tag="O3K_26417"
                     /note="lytic transglycosylase; Provisional; Region:
                     PRK13722"
                     /db_xref="CDD:184274"
     misc_feature    order(52597..52599,52669..52671,52762..52764,52816..52818)
                     /locus_tag="O3K_26417"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    52597..52599
                     /locus_tag="O3K_26417"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(53295..54095)
                     /locus_tag="O3K_26422"
                     /db_xref="GeneID:13715082"
     CDS             complement(53295..54095)
                     /locus_tag="O3K_26422"
                     /codon_start=1
                     /transl_table=11
                     /product="YubP"
                     /protein_id="YP_006792609.1"
                     /db_xref="GeneID:13715082"
                     /translation="MRLASRFGRYNSIRRERPLTDDELMQFVPSVFSGDKHESRSERY
                     TYIPTINIINKLRDEGFQPFFACQSRVHDLGRREYSKHMLRLRREGYINGKEVPEIIL
                     LNSHDGSSSYQMIPGIFRFVCTNGLVCGNNFGEIRVPHKGDIVGQVIEGAYEVLGVFD
                     KVTENMETMKEIHLNSDEQHLFGRAALMARYEDENKTPVTPEQIITPRRWEDKQNDFW
                     TTWQRVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWMIAE"
     misc_feature    complement(53310..53990)
                     /locus_tag="O3K_26422"
                     /note="Domain of unknown function (DUF932); Region:
                     DUF932; pfam06067"
                     /db_xref="CDD:310569"
     gene            54890..55147
                     /locus_tag="O3K_26427"
                     /db_xref="GeneID:13715083"
     CDS             54890..55147
                     /locus_tag="O3K_26427"
                     /note="COG1961 Site-specific recombinases, DNA invertase
                     Pin homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="putative recombinase"
                     /protein_id="YP_006792610.1"
                     /db_xref="GeneID:13715083"
                     /translation="MDSHRNDILLVEQIDRLTRFSNNDRITLKKQIEQHELRIVSLDV
                     PTSWQALSDRDPSQSDPITRTVITAINNMLIDLMSAMSHKD"
     misc_feature    <54890..55144
                     /locus_tag="O3K_26427"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cl02788"
                     /db_xref="CDD:322093"
     gene            55669..59763
                     /locus_tag="O3K_26432"
                     /db_xref="GeneID:13715084"
     CDS             55669..59763
                     /locus_tag="O3K_26432"
                     /note="COG3468 Type V secretory pathway, adhesin AidA"
                     /codon_start=1
                     /transl_table=11
                     /product="protease IgA1"
                     /protein_id="YP_006792611.1"
                     /db_xref="GeneID:13715084"
                     /translation="MNKIYYLKYCHITKSLIAVSELARRVTCKSHRRLSRRVILTSVA
                     ALSLSSAWPALSATVSAEIPYQIFRDFAENKGQFTPGTTNISIYDKQGNLVGKLDKAP
                     MADFSSATITTGSLPPGNHTLYSPQYVVTAKHVSGSDTMSFGYAKNTYTAVGTNNNSG
                     LDIKTRRLSKLVTEVAPAEVSDIGAVSGAYQAGGRFTAFYRLGGGMQYVKDKNGNRTQ
                     VYTNGGFLVGGTVSALNSYNNGQMITAQTGDIFNPANGPLANYLNMGDSGSPLFAYDS
                     LQKKWVLIGVLSSGTNYGNNWVVTTQDFLGQQPQNDFDKTIAYTSGEGVLQWKYDAAN
                     GTGTLTQGNTTWDMHGKKGNDLNAGKNLLFTGNNGEVVLQNSVNQGAGYLQFAGDYRV
                     SALNGQTWMGGGIITDKGTHVLWQVNGVAGDNLHKTGEGTLTVNGTGVNAGGLKVGDG
                     TVILNQQADADGKVQAFSSVGIASGRPTVVLSDSQQVNPDNISWGYRGGRLELNGNNL
                     TFTRLQAADYGAIITNNSEKKSTVTLDLQTLKASDINVPVNTVSIFGGRGAPGDLYYD
                     SSTKQYFILKASSYSPFFSDLNNSSVWQNVGKDRNKAIDTVKQQKIEASSQPYMYHGQ
                     LNGNMDVNIPQLSGKDVLALDGSVNLPEGSITKKSGTLIFQGHPVIHAGTTTSSSQSD
                     WETRQFTLEKLKLDAATFHLSRNGKMQGDINATNGSTVILGSSRVFTDRSDGTGNAVS
                     SVEGSATATTVGDQSDYSGNVTLENKSSLQIMERFTGGIEAYDSTVSVTSQNAVFDRV
                     GSFVNSSLTLGKGAKLTAQSGIFSTGAVDVKENASLTLTGMPSAQKQGYYSPVISTTE
                     GINLEDKASFSVKNMGYLSSDIHAGTTAATINLGDSDADAGKTDSPLFSSLMKGYNAV
                     LRGSITGAQSTVNMINALWYSDGKSEAGALKAKGSRIELGDGKHFATLQVKELSADNT
                     TFLMHTNNSWADQLNVTDKLSGSNNSVLVDFLNKPASEMSVTLITAPKGSDEKTFTAG
                     TQQIGFSNVTPVISTEKTNDATKWVLTGYQTTADAGASKAAKDFMASGYKSFLTEVNN
                     LNKRMGDLRDTQGDAGVWARIMNGTGSADGDYSDNYTHVQIGVDRKHELDGVDLFTGA
                     LLTYTDSNASSHAFSGKTKSVGGGLYASALFNSGAYFDLIGKYLHHDNQHTANFASLG
                     TKDYSSHSWYAGAEVGYRYHLTKESWVEPQIELVYGSVSGKAFSWEDRGMALSMKDKD
                     YNPLIGRTGVDVGRAFSGDDWKITARAGLGYQFDLLANGETVLQDASGEKRFEGEKDS
                     RMLMTVGMNAEIKDNMRLGLELEKSAFGKYNVDNAINANFRYVF"
     misc_feature    55837..57975
                     /locus_tag="O3K_26432"
                     /note="Immunoglobulin A1 protease; Region: Peptidase_S6;
                     pfam02395"
                     /db_xref="CDD:280543"
     misc_feature    58135..58857
                     /locus_tag="O3K_26432"
                     /note="Pertactin-like passenger domains (virulence
                     factors), C-terminal, subgroup 1, of autotransporter
                     proteins of the type V secretion system of Gram-negative
                     bacteria. This subgroup includes the passenger domains of
                     Neisseria and Haemophilus IgA1 proteases; Region:
                     PL1_Passenger_AT; cd01343"
                     /db_xref="CDD:238653"
     misc_feature    58531..59760
                     /locus_tag="O3K_26432"
                     /note="outer membrane autotransporter barrel domain;
                     Region: autotrans_barl; TIGR01414"
                     /db_xref="CDD:273608"
     gene            complement(60058..60243)
                     /locus_tag="O3K_26437"
                     /db_xref="GeneID:13715085"
     CDS             complement(60058..60243)
                     /locus_tag="O3K_26437"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792612.1"
                     /db_xref="GeneID:13715085"
                     /translation="MFFGSDHGGERGALLYGMIGTCRLNGIDPEAYLRHILSVLPEWP
                     SNRVDELLPWNVVLTNK"
     misc_feature    complement(60082..60192)
                     /locus_tag="O3K_26437"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:290531"
     gene            60357..60791
                     /locus_tag="O3K_26442"
                     /db_xref="GeneID:13715086"
     CDS             60357..60791
                     /locus_tag="O3K_26442"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792613.1"
                     /db_xref="GeneID:13715086"
                     /translation="MDKPTDWRFGTRRIFSNEFKLHMVELASKPNANVAQLAREHGVD
                     NNLIFKWLRLWQREGRISRRMPPTIVGPTVSQSFPASPTLVPVELIDTPRCATDAPAP
                     EALSVACAASCHVEFHYGKMMLENPSPELLTVLIRELTGRGR"
     misc_feature    60390..60770
                     /locus_tag="O3K_26442"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            60788..61138
                     /locus_tag="O3K_26447"
                     /db_xref="GeneID:13715087"
     CDS             60788..61138
                     /locus_tag="O3K_26447"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792614.1"
                     /db_xref="GeneID:13715087"
                     /translation="MISLPSGTRIWLVAGVTDMRKSFNGLGEQVQYVLNDNPFSGHLF
                     IFRGRRGDTIKILWADADGLCLFTKRLEEGQFIWPAVRDGKISITRSQLAMLLDKLDW
                     RQPKTSRLNALTML"
     misc_feature    60809..61105
                     /locus_tag="O3K_26447"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:310376"
     gene            61169..62668
                     /locus_tag="O3K_26452"
                     /db_xref="GeneID:13715088"
     CDS             61169..62668
                     /locus_tag="O3K_26452"
                     /note="COG3436 Transposase and inactivated derivatives;
                     IS66 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase ORF1, IS66 family protein"
                     /protein_id="YP_006792615.1"
                     /db_xref="GeneID:13715088"
                     /translation="MSQKYLIRIAELERLLSEQAEALRQKDQQLSLVEETEAFLRSAL
                     ARAEEKIEEDEREIEHLRAQIEKLRRMLFGTRSEKLRREVEQAEALLKQREQESDRYS
                     GREDDPLVPRQLRQSRHRRPLPAHLPREIYRLEPEESCCPECGGELDYLGEVSAEQLE
                     LVSSALKVIRTERVKKACTKCDCIVEAPAPSRPIERGIAGPGLLARVLTGKYCEHLPL
                     YRQSEIFARQGVELSRALLSNWVDACCQLMTPLNDALYSYVMNTRKVHTDDTPVKVLA
                     PGRKKAKTGYIWTYVRDDRNAGSPEPPAVWFAYSPDHQGKHPEQHLRPFRGILQADAF
                     AGYDRLFSAEREGGALTEAGCWAHARRKIHDVYISTKSATAEEALKLIGELYAIEHEI
                     RGLPVSERLAVRQMQSKPLLTSLYKLMQEKEHTLSKKCRLRDAFRYIRKHWVALCNFC
                     DDGLAEADNNTAERALRAVCLGKKNSYDLCQILSPKRPTQLRELRYIAD"
     misc_feature    61346..61558
                     /locus_tag="O3K_26452"
                     /note="Transposase C of IS166 homeodomain; Region:
                     LZ_Tnp_IS66; pfam13007"
                     /db_xref="CDD:315644"
     misc_feature    61502..61984
                     /locus_tag="O3K_26452"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    61754..62599
                     /locus_tag="O3K_26452"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:281099"
     gene            complement(62938..63978)
                     /locus_tag="O3K_26457"
                     /db_xref="GeneID:13715089"
     CDS             complement(62938..63978)
                     /locus_tag="O3K_26457"
                     /note="COG3547 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS110 family protein"
                     /protein_id="YP_006792616.1"
                     /db_xref="GeneID:13715089"
                     /translation="MHSENIAAYIGLDVHKETLAVAIAAPERLGEVRYYGTINNEAQA
                     VRRLFQKLQGLYGNILSCYEAGPCGFGLYHQLTAMNIKCQVIAPSRIPKSPTDRIKND
                     HRDAISLARLLRAGELTPVWIPDLTHEAMRDLIRARAAAKRDSRVARQRILSMLLRTD
                     KRYAGKHWTGKHRTWLANQSFSQPSQQIAFQHYCQSLEQIEDRILQLDQKISRLLPEW
                     SLCNLVCQLQALKGVGQLIAITLVAELGDFSRFSNPKQLMAFLGLVPGEYSSGNSIRP
                     RGITKVGNSELRRLLYEAAWSYRTPAKVGAWLIYYRPDSVTQYSKDIAWKAQQRLCSR
                     YRSLTAKGKNHK"
     misc_feature    complement(62971..63954)
                     /locus_tag="O3K_26457"
                     /note="Transposase [Mobilome: prophages, transposons];
                     Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(63547..63951)
                     /locus_tag="O3K_26457"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:279837"
     misc_feature    complement(63088..63300)
                     /locus_tag="O3K_26457"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:280523"
     STS             63327..63827
                     /standard_name="D1S3691"
                     /db_xref="UniSTS:474269"
     gene            complement(64953..66164)
                     /locus_tag="O3K_26462"
                     /db_xref="GeneID:13715090"
     CDS             complement(64953..66164)
                     /locus_tag="O3K_26462"
                     /note="COG0815 Apolipoprotein N-acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="AatD"
                     /protein_id="YP_006792617.1"
                     /db_xref="GeneID:13715090"
                     /translation="MKFTIVLLYFFAYYLAARKRRVSLFFTILLYSIIFSGMYFSSGF
                     LEYYGSSNLYLSFGLLCYNMITLVIYGFLSSYGVLGACLHALLLTSLSAFGMFIPLNP
                     LIVLYYDFPDILPRTDIPVLNLLILNLIPAVTFSLKISFFLRSLMLLLFPLIWKTPVN
                     ITHPPLNIVIVQVGLYFKKVGVRGNFYTDLNEFVRNKKVDLVILSENVFFGYKNDYIK
                     ERTKHLLKQLKDNRFHYKYGILMNLYGYQDINNVVSAFWHKEEFLLHQKSKLIPFFEK
                     KSFYNSPEPSTSPFLYYKKKYNEQDILDFNNIKMSIHICYEGLFPEGESRRKDISIVQ
                     SDYSWLSDNHKYDNTLINGSILSKFSVSPNTPLINIQNYGGTVLIDKNWKIDMDLFNR
                     SKTEPFLFTQI"
     misc_feature    complement(65136..>65771)
                     /locus_tag="O3K_26462"
                     /note="Nitrilase superfamily, including nitrile- or
                     amide-hydrolyzing enzymes and amide-condensing enzymes;
                     Region: nitrilase; cl11424"
                     /db_xref="CDD:325025"
     gene            complement(66181..66810)
                     /locus_tag="O3K_26467"
                     /db_xref="GeneID:13715091"
     CDS             complement(66181..66810)
                     /locus_tag="O3K_26467"
                     /note="COG1136 ABC-type antimicrobial peptide transport
                     system, ATPase component"
                     /codon_start=1
                     /transl_table=11
                     /product="AatC ATB binding protein of ABC transporter"
                     /protein_id="YP_006792618.1"
                     /db_xref="GeneID:13715091"
                     /translation="MIRVKIHKKPIENRTILNNSTIEIKEGSFNIITGPSGVGKTSLL
                     NIIGLLDNAFVGEYEFFGKKVEIKDNSITTYIRRKYFGFIFQDSLINVKQNVLRNILC
                     SVDSQNIIAARERINDILVSVGLSNINNNVSFLSGGEKQRLALARALIKKPSILLADE
                     PTASLDIKNKKLVMNILSEYNNQGGTVVMVTHDLELIDENMTLIQLLNT"
     misc_feature    complement(66223..66801)
                     /locus_tag="O3K_26467"
                     /note="ABC-type lipoprotein export system, ATPase
                     component [Cell wall/membrane/envelope biogenesis];
                     Region: LolD; COG1136"
                     /db_xref="CDD:224059"
     gene            complement(66803..67441)
                     /locus_tag="O3K_26472"
                     /db_xref="GeneID:13715092"
     CDS             complement(66803..67441)
                     /locus_tag="O3K_26472"
                     /codon_start=1
                     /transl_table=11
                     /product="AatB"
                     /protein_id="YP_006792619.1"
                     /db_xref="GeneID:13715092"
                     /translation="MIEGNVVTVERKLFSVLNHEYTAKKDIVAMKRNMEEKKLARLKG
                     VKTHSTSMFSKGLISRESLHDIDEKISNTELTIMGLDIESKNLEQLLKLSSPFLHTPF
                     IIRNIFVTNEQYVNAGDDIMSVELLDNFYIDVKFDPVSITGNIRDKRIRYRSLVNSLM
                     GAATVVKNIRASGESTQGEDTSGLRSITLLIDGDRNELSNLLDTAFEIIIDD"
     gene            complement(67521..68759)
                     /locus_tag="O3K_26477"
                     /db_xref="GeneID:13715093"
     CDS             complement(67521..68759)
                     /locus_tag="O3K_26477"
                     /codon_start=1
                     /transl_table=11
                     /product="AatA outermembrane protein"
                     /protein_id="YP_006792620.1"
                     /db_xref="GeneID:13715093"
                     /translation="MRHILYSFLAINAYLFSTQTLAKDCIIDNFFQKSIQFNSYSLDI
                     EELDINKHNNIKTMLPDINIGLGQYINNNQWFSSITDSHFYLSLSYNLLSAYEAKMQN
                     NKLDIANYLKYIEMLSERNNYIINLFSEIINYKIKKSHLMLMFERYRKLNKEYEIAKR
                     KMSIGLISVLDVEMIYNILQKIRFDIDVLEEEESLLSDKISREYHVPESAIPDITYHK
                     LKECKTADFYTLLAENKKLKIKAADIDNDIRKLSEIPSFYLSFGLTPKQGGALGNMSL
                     RKMDYSASLGISFPLMGLFSSSVNQKEKIISMSRTRNESLKENIKLDLLEKEIRQKID
                     RLEKNLAMMKNELTLKKRKVEYINYRLKNGQDDVISYLSSVENLHETENEFQKIGYEI
                     EYYSLYHYFLLQHISNTGEM"
     misc_feature    complement(<67689..>67865)
                     /locus_tag="O3K_26477"
                     /note="Protein of unknown function (DUF460); Region:
                     DUF460; cl27170"
                     /db_xref="CDD:331991"
     gene            complement(68756..69886)
                     /locus_tag="O3K_26482"
                     /db_xref="GeneID:13715094"
     CDS             complement(68756..69886)
                     /locus_tag="O3K_26482"
                     /note="COG0577 ABC-type antimicrobial peptide transport
                     system, permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="AatP permease"
                     /protein_id="YP_006792621.1"
                     /db_xref="GeneID:13715094"
                     /translation="MTTLHYYLKEALLNIIENRRQNFAFLVFLSLSFIGIIITDSLIY
                     SVSLKAEEELKVHSDKVIFVKLYRPKTVGYITEKFITVSKVLSFSKNAFLYVSDTPFS
                     GELFSVSGIDKLGLNTEYSGDLNDKYNGNVAIVNESSPFFSKKQIFINGVPFKIIGVR
                     LNSKTDFLDSLGLKANQSDEHIFIPLETMFKMKLDNRVNAVKIFLDNIVTKRDINNVK
                     RVLYDNDIRKFDIVTSLNAKEAVDRVLERFSLLTNSVYVILTLSASVTCFILSKRSFY
                     SRRVELSLKIIHGTEKKEITVLIIIESLIMLSVCLFISLIHAGVIMHIIKYFLDVTIS
                     IRTTMITISLANVLLVFIFANIIFSRLFFSINPVNAIKGKIE"
     gene            70508..70600
                     /locus_tag="O3K_26492"
                     /db_xref="GeneID:13715095"
     CDS             70508..70600
                     /locus_tag="O3K_26492"
                     /note="ISSfl4 ORF3"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006792622.1"
                     /db_xref="GeneID:13715095"
                     /translation="MLTLEVIRKINDWPSNRVHELLPWNLSAVK"
     gene            70657..70893
                     /locus_tag="O3K_26497"
                     /db_xref="GeneID:13715096"
     CDS             70657..70893
                     /locus_tag="O3K_26497"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006792623.1"
                     /db_xref="GeneID:13715096"
                     /translation="MVKLALQPRDSVARIAREHDINDNLLFKWLRIWLIKGRISRRLP
                     LTNSSGIGVELLPVEMTLDERPYPVFTRGNYEDQ"
     misc_feature    70657..>70749
                     /locus_tag="O3K_26497"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     misc_feature    complement(70865..72539)
                     /note="potential frameshift: common BLAST hit:
                     gi|13449013|ref|NP_085229.1| secreted protease"
CONTIG      join(CP003291.1:1..74217)
//
DBGET integrated database retrieval system