GenomeNet

Database: RefSeq
Entry: NC_031346
LinkDB: NC_031346
Original site: NC_031346 
LOCUS       NC_031346              43869 bp    DNA     circular PLN 13-OCT-2016
DEFINITION  Sugiyamaella lignohabitans strain CBS 10342 mitochondrion genome.
ACCESSION   NC_031346
VERSION     NC_031346.1
DBLINK      BioSample: SAMN04417247
KEYWORDS    RefSeq.
SOURCE      mitochondrion Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 43869)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 43869)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-OCT-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 43869)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP014499.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..43869
                     /organism="Sugiyamaella lignohabitans"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Sugiyamaella
                     lignohabitans"
                     /db_xref="taxon:796027"
     gene            332..862
                     /locus_tag="AWJ20_5347"
                     /db_xref="GeneID:28928576"
     CDS             332..862
                     /locus_tag="AWJ20_5347"
                     /inference="similar to AA sequence:KEGG_Orthology:K03881"
                     /codon_start=1
                     /transl_table=3
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="YP_009305700.1"
                     /db_xref="GeneID:28928576"
                     /translation="MSVCILGVFANNIIGIEGSYLLSIAHGLVSPGLFMAVGGILYDR
                     YHTRMVAYYNGLLSFMPLFSLYFMVLSFANIGTPLSANFIGEFFSIYGAFKTSPILAT
                     MATFSVLLSATYQMKLTNRMTGGYSPNISNIGDLTSRESVMLVSLILPTLFMGMYPQF
                     IMNDLYHIVSSTIYTL"
     gene            complement(928..999)
                     /locus_tag="AWJ20_5348"
                     /db_xref="GeneID:28928577"
     tRNA            complement(928..999)
                     /locus_tag="AWJ20_5348"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:28928577"
     gene            5522..5593
                     /locus_tag="AWJ20_5349"
                     /db_xref="GeneID:28928578"
     tRNA            5522..5593
                     /locus_tag="AWJ20_5349"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:28928578"
     gene            5617..5703
                     /locus_tag="AWJ20_5350"
                     /db_xref="GeneID:28928580"
     tRNA            5617..5703
                     /locus_tag="AWJ20_5350"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:28928580"
     gene            5948..6021
                     /locus_tag="AWJ20_5351"
                     /pseudo
                     /db_xref="GeneID:28928581"
     tRNA            5948..6021
                     /locus_tag="AWJ20_5351"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928581"
     gene            6066..6137
                     /locus_tag="AWJ20_5352"
                     /db_xref="GeneID:28928582"
     tRNA            6066..6137
                     /locus_tag="AWJ20_5352"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:28928582"
     gene            6141..6211
                     /locus_tag="AWJ20_5353"
                     /db_xref="GeneID:28928583"
     tRNA            6141..6211
                     /locus_tag="AWJ20_5353"
                     /product="tRNA-Sec"
                     /db_xref="GeneID:28928583"
     gene            7847..7918
                     /locus_tag="AWJ20_5354"
                     /db_xref="GeneID:28928584"
     tRNA            7847..7918
                     /locus_tag="AWJ20_5354"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:28928584"
     gene            7932..8004
                     /locus_tag="AWJ20_5355"
                     /db_xref="GeneID:28928585"
     tRNA            7932..8004
                     /locus_tag="AWJ20_5355"
                     /product="tRNA-Met"
                     /db_xref="GeneID:28928585"
     gene            12558..12628
                     /locus_tag="AWJ20_5356"
                     /db_xref="GeneID:28928586"
     tRNA            12558..12628
                     /locus_tag="AWJ20_5356"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:28928586"
     gene            14700..14770
                     /locus_tag="AWJ20_5357"
                     /db_xref="GeneID:28928587"
     tRNA            14700..14770
                     /locus_tag="AWJ20_5357"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:28928587"
     gene            complement(14795..14866)
                     /locus_tag="AWJ20_5358"
                     /pseudo
                     /db_xref="GeneID:28928588"
     tRNA            complement(14795..14866)
                     /locus_tag="AWJ20_5358"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928588"
     gene            14954..15025
                     /locus_tag="AWJ20_5359"
                     /db_xref="GeneID:28928589"
     tRNA            14954..15025
                     /locus_tag="AWJ20_5359"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:28928589"
     gene            15991..16062
                     /locus_tag="AWJ20_5360"
                     /db_xref="GeneID:28928591"
     tRNA            15991..16062
                     /locus_tag="AWJ20_5360"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:28928591"
     gene            16081..16153
                     /locus_tag="AWJ20_5361"
                     /db_xref="GeneID:28928592"
     tRNA            16081..16153
                     /locus_tag="AWJ20_5361"
                     /product="tRNA-Met"
                     /db_xref="GeneID:28928592"
     gene            16170..16240
                     /locus_tag="AWJ20_5362"
                     /db_xref="GeneID:28928593"
     tRNA            16170..16240
                     /locus_tag="AWJ20_5362"
                     /product="tRNA-Met"
                     /db_xref="GeneID:28928593"
     gene            16265..16345
                     /locus_tag="AWJ20_5363"
                     /pseudo
                     /db_xref="GeneID:28928594"
     tRNA            16265..16345
                     /locus_tag="AWJ20_5363"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928594"
     gene            16501..16572
                     /locus_tag="AWJ20_5364"
                     /db_xref="GeneID:28928595"
     tRNA            16501..16572
                     /locus_tag="AWJ20_5364"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:28928595"
     gene            complement(16627..16698)
                     /locus_tag="AWJ20_5365"
                     /pseudo
                     /db_xref="GeneID:28928596"
     tRNA            complement(16627..16698)
                     /locus_tag="AWJ20_5365"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928596"
     gene            16725..16797
                     /locus_tag="AWJ20_5366"
                     /pseudo
                     /db_xref="GeneID:28928597"
     tRNA            16725..16797
                     /locus_tag="AWJ20_5366"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928597"
     gene            17208..17438
                     /gene="OLI1"
                     /locus_tag="AWJ20_5367"
                     /db_xref="GeneID:28928598"
     CDS             17208..17438
                     /gene="OLI1"
                     /locus_tag="AWJ20_5367"
                     /inference="similar to AA sequence:KEGG_Orthology:K02128"
                     /codon_start=1
                     /transl_table=3
                     /product="F0 ATP synthase subunit c"
                     /protein_id="YP_009305701.1"
                     /db_xref="GeneID:28928598"
                     /translation="MQLVLAGKYMGSGMATMGLLGAGMGIALVFAALINGTARNPSVR
                     STLFTYAMLGFALSEATGLFCLMISFLLLYAV"
     gene            17878..19890
                     /locus_tag="AWJ20_5368"
                     /db_xref="GeneID:28928599"
     CDS             17878..19890
                     /locus_tag="AWJ20_5368"
                     /codon_start=1
                     /transl_table=3
                     /product="NADH dehydrogenase subunit 5"
                     /protein_id="YP_009305702.1"
                     /db_xref="GeneID:28928599"
                     /translation="MVLLMLLLPLLGSLISGLLGRLLGYNSSKYMATLCMMMPCMYSW
                     YLYYNVMVLNMMYSMNLFNWMSIDNIEIDWAFTIDELSMTLLVAVCTISSLVHLYATS
                     YMSHDPHQQRFFSMLSLFTGFMMMLVTANNYLVMFVGWEMMGVSSYLLMSHWHTRLAA
                     MKSGLSAFLMNKFGDTFMTMGLFLILMTFGSLNYSTIYSLSSYINTDMLTLIMLCLLI
                     GAVAKSAQLGLHTWLLNSMEGPTPVSSLLHAACLVCAGIYLLMRSSYLLEYTPTVLLI
                     ILWLGGLTTLMAGIMAMVSNDLKKIMALSTMSQLGLMVLAMGLSSYQVSIYHLFTHAM
                     FKALLFMSAGSIIHSVVYESQDIRTFGGLIHYLPVTYISILIASLSLMAIPGLSGFYS
                     KDLIIESAYGVYSLSGFTLYWFAMTSATLTSIYSFRLLYLVFYNTPNANRYTYHIIHE
                     SDYKMLIPMIILAMFSMFIGYITRDIYLGFGSPFNSMFTHPSNLSIVDIELSLPTSYK
                     LLPLILTMLSVSSVLFIYEYKYNWLPDIKNNYIYNLYLYANSKFMMDQIINNIILRST
                     LSISILSSQFIDKGILQIYGPNGLYNSLNYLSYNIIQLSSLNSYNIANNDSIFNQTNT
                     TMRHYGIYLLTLLITISFIYYISIIIGYNIGYNLMLLLLLTLPFAL"
     gene            20013..20084
                     /locus_tag="AWJ20_5370"
                     /pseudo
                     /db_xref="GeneID:28928601"
     tRNA            20013..20084
                     /locus_tag="AWJ20_5370"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928601"
     gene            20342..20413
                     /locus_tag="AWJ20_5371"
                     /db_xref="GeneID:28928602"
     tRNA            20342..20413
                     /locus_tag="AWJ20_5371"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:28928602"
     gene            21320..21727
                     /gene="COB"
                     /locus_tag="AWJ20_5372"
                     /db_xref="GeneID:28928603"
     CDS             21320..21727
                     /gene="COB"
                     /locus_tag="AWJ20_5372"
                     /inference="similar to AA sequence:KEGG_Orthology:K00412"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome b"
                     /protein_id="YP_009305703.1"
                     /db_xref="GeneID:28928603"
                     /translation="MLGDTENYMEGNPLVTPAAIVPEFYLLPFYAMLRSMPSKLGGVM
                     TMLAAMLILLALPFVDFSIIRGNAFKVISKLLYGLFVCNFILLGLLGAQHIEVPFILL
                     GQVATVMYFGYFMVLLPAVSMLENMLFYLAIKK"
     gene            23426..23866
                     /locus_tag="AWJ20_5373"
                     /db_xref="GeneID:28928604"
     CDS             23426..23866
                     /locus_tag="AWJ20_5373"
                     /inference="similar to AA sequence:KEGG_Orthology:K03880"
                     /codon_start=1
                     /transl_table=3
                     /product="NADH dehydrogenase subunit 3"
                     /protein_id="YP_009305704.1"
                     /db_xref="GeneID:28928604"
                     /translation="MLFTSYTMYIYFMLMPIVSQLLLGINLLLSYNNTYNDKTIPFEC
                     GLSSFNQTRSAFSVSFILIAILFLPFDLEVSSILPYSLALNPSQGGGSYGLSIIIIFI
                     SILAIGFIYEYRTNALHIKNPSRDTRIPSLYNVKSMSNDISSTK"
     gene            26254..26784
                     /locus_tag="AWJ20_5374"
                     /db_xref="GeneID:28928605"
     CDS             26254..26784
                     /locus_tag="AWJ20_5374"
                     /inference="similar to AA sequence:KEGG_Orthology:K03881"
                     /codon_start=1
                     /transl_table=3
                     /product="NADH dehydrogenase subunit 4"
                     /protein_id="YP_009305705.1"
                     /db_xref="GeneID:28928605"
                     /translation="MSVCILGVFANNIIGIEGSYLLSIAHGLVSPGLFMAVGGILYDR
                     YHTRMVAYYNGLLSFMPLFSLYFMVLSFANIGTPLSANFIGEFFSIYGAFKTSPILAT
                     MATFSVLLSATYQMKLTNRMTGGYSPNISNIGDLTSRESVMLVSLILPTLFMGMYPQF
                     IMNDLYHIVSSTIYTL"
     gene            complement(26850..26921)
                     /locus_tag="AWJ20_5375"
                     /db_xref="GeneID:28928606"
     tRNA            complement(26850..26921)
                     /locus_tag="AWJ20_5375"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:28928606"
     gene            31444..31515
                     /locus_tag="AWJ20_5376"
                     /db_xref="GeneID:28928607"
     tRNA            31444..31515
                     /locus_tag="AWJ20_5376"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:28928607"
     gene            31539..31625
                     /locus_tag="AWJ20_5377"
                     /db_xref="GeneID:28928608"
     tRNA            31539..31625
                     /locus_tag="AWJ20_5377"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:28928608"
     gene            31870..31943
                     /locus_tag="AWJ20_5378"
                     /pseudo
                     /db_xref="GeneID:28928609"
     tRNA            31870..31943
                     /locus_tag="AWJ20_5378"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928609"
     gene            31988..32059
                     /locus_tag="AWJ20_5379"
                     /db_xref="GeneID:28928610"
     tRNA            31988..32059
                     /locus_tag="AWJ20_5379"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:28928610"
     gene            32063..32133
                     /locus_tag="AWJ20_5380"
                     /db_xref="GeneID:28928612"
     tRNA            32063..32133
                     /locus_tag="AWJ20_5380"
                     /product="tRNA-Sec"
                     /db_xref="GeneID:28928612"
     gene            33769..33840
                     /locus_tag="AWJ20_5381"
                     /db_xref="GeneID:28928613"
     tRNA            33769..33840
                     /locus_tag="AWJ20_5381"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:28928613"
     gene            33854..33926
                     /locus_tag="AWJ20_5382"
                     /db_xref="GeneID:28928614"
     tRNA            33854..33926
                     /locus_tag="AWJ20_5382"
                     /product="tRNA-Met"
                     /db_xref="GeneID:28928614"
     gene            38480..38550
                     /locus_tag="AWJ20_5383"
                     /db_xref="GeneID:28928615"
     tRNA            38480..38550
                     /locus_tag="AWJ20_5383"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:28928615"
     gene            40622..40692
                     /locus_tag="AWJ20_5384"
                     /db_xref="GeneID:28928616"
     tRNA            40622..40692
                     /locus_tag="AWJ20_5384"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:28928616"
     gene            complement(40717..40788)
                     /locus_tag="AWJ20_5385"
                     /pseudo
                     /db_xref="GeneID:28928617"
     tRNA            complement(40717..40788)
                     /locus_tag="AWJ20_5385"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928617"
     gene            40876..40947
                     /locus_tag="AWJ20_5386"
                     /db_xref="GeneID:28928618"
     tRNA            40876..40947
                     /locus_tag="AWJ20_5386"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:28928618"
     gene            41913..41984
                     /locus_tag="AWJ20_5387"
                     /db_xref="GeneID:28928619"
     tRNA            41913..41984
                     /locus_tag="AWJ20_5387"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:28928619"
     gene            42003..42075
                     /locus_tag="AWJ20_5388"
                     /db_xref="GeneID:28928620"
     tRNA            42003..42075
                     /locus_tag="AWJ20_5388"
                     /product="tRNA-Met"
                     /db_xref="GeneID:28928620"
     gene            42092..42162
                     /locus_tag="AWJ20_5389"
                     /db_xref="GeneID:28928621"
     tRNA            42092..42162
                     /locus_tag="AWJ20_5389"
                     /product="tRNA-Met"
                     /db_xref="GeneID:28928621"
     gene            42187..42267
                     /locus_tag="AWJ20_5390"
                     /pseudo
                     /db_xref="GeneID:28928623"
     tRNA            42187..42267
                     /locus_tag="AWJ20_5390"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928623"
     gene            42423..42494
                     /locus_tag="AWJ20_5391"
                     /db_xref="GeneID:28928624"
     tRNA            42423..42494
                     /locus_tag="AWJ20_5391"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:28928624"
     gene            complement(42549..42620)
                     /locus_tag="AWJ20_5392"
                     /pseudo
                     /db_xref="GeneID:28928625"
     tRNA            complement(42549..42620)
                     /locus_tag="AWJ20_5392"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928625"
     gene            42647..42719
                     /locus_tag="AWJ20_5393"
                     /pseudo
                     /db_xref="GeneID:28928626"
     tRNA            42647..42719
                     /locus_tag="AWJ20_5393"
                     /product="tRNA-OTHER"
                     /pseudo
                     /db_xref="GeneID:28928626"
     gene            43129..43359
                     /gene="OLI1"
                     /locus_tag="AWJ20_5394"
                     /db_xref="GeneID:28928627"
     CDS             43129..43359
                     /gene="OLI1"
                     /locus_tag="AWJ20_5394"
                     /inference="similar to AA sequence:KEGG_Orthology:K02128"
                     /codon_start=1
                     /transl_table=3
                     /product="F0 ATP synthase subunit c"
                     /protein_id="YP_009305706.1"
                     /db_xref="GeneID:28928627"
                     /translation="MQLVLAGKYMGSGMATMGLLGAGMGIALVFAALINGTARNPSVR
                     STLFTYAMLGFALSEATGLFCLMISFLLLYAV"
ORIGIN      
        1 tttagtatta tcaattgata ttcaaactat attatgatta ggattattta tagctattat
       61 gataaaatca ccattatatc cattacatat ttgattacct gttgttcatt ctgaatctcc
      121 attagctggt agtatattat tagctggttt agtattaaaa ttaacagttt atttaataat
      181 acgttgatta ttaccagtat tatcagaagg tactttatta tttactccta ttgtttatgt
      241 tatatgtgta ttaactataa taatagttag tttaataact atagttcaag ttgatttaaa
      301 agttattatt gcttacagtt ctgtttctca tatgagtgtt tgtattttag gtgtatttgc
      361 taataatatt attggtattg aaggttctta tttattaagt attgctcatg gtttagtttc
      421 tcctggttta tttatagctg taggtggtat tttatatgat cgttatcata ctcgtatagt
      481 tgcttattat aatggtttat tatcatttat gccattattt agtttatact ttatagtatt
      541 atcttttgct aatattggta ctcctttatc agctaacttt attggtgaat tctttagtat
      601 ttatggtgca tttaaaacat ctcctatttt agcaactata gctacattta gtgttttatt
      661 atctgctaca tatcaaatga aattaactaa tcgtataact ggtggttatt ctccaaatat
      721 ttcaaatatt ggtgatttaa cttctagaga atctgttatg ttagtttctt taattttacc
      781 tacattattt ataggtatat atcctcaatt tattataaat gatttatatc atattgtttc
      841 ttcaacaatt tatacattat aataatttta tatatttatt attatataac tatactatta
      901 tttatatata ttatattaat tataatatgg aaccaatggg agttgaaccc atgtttttaa
      961 cgtgcaaagt taatgtacta ccaactatac tataatccct tataaattac ttatattaaa
     1021 taaataaaga catcaatgag agtcgaactc aaataggtaa gatttgcaat cttccttgta
     1081 accgttacat gatgtcatat tatacttata atatataata aatattataa atttaataaa
     1141 aatatataag taagtgagta catatgatat gaagtgagtt atatagtact atataagaaa
     1201 tcattgactg taagaataaa actacataat agaaaggtat aaaatattta aaaataaatt
     1261 taaattaaaa ccaaaataga aaactatata attaaataac atagtgaact gaaacatctt
     1321 agtaactata ggtaaaataa attaacaaag ttaatataga gtagtggtga acgaaatata
     1381 taaatataat cttaaagtag tgtgttatat atattaatac atgaatatag tgatactttc
     1441 actaagatta aatagtatta tgtaagttaa tagtactgtg aaggaagtct attatcagtg
     1501 attttataag caatacggaa tcttaaatta aagataaact gtaggtacct tttgtataat
     1561 gggttagcaa gttcataata ttagcaagat tttaaaaata aaatcataat gaaaatatta
     1621 aatatttata atattataaa tataagttaa tattatgaga cccgatagtg tgtgatctta
     1681 ctatgtgcaa gtattataat acttttaata aaatatttat atattttaaa gagggataat
     1741 attataatga ctgaactggt tggtgttgca ataccatcag aggacatgtg gtaagccgag
     1801 aaagtcaaat ctgacacaca ggtagctggt ttgctgcgaa acatatattc gtatggtcta
     1861 tatataatat cttagtaggt atagctctta gtatttaaag tatataaaat atatatattt
     1921 taatacaggg aagatataat cttttactga caatacttaa tctcataata attaattgat
     1981 aatttatata gaatcagact attagtgata aggttaatag tcaaaaggga aacagcccaa
     2041 aacaaataat aaatttatta ttaaataaat tttataaagg ttcttaattt atatataaaa
     2101 tattaatata ttttaattaa taagtggaca aaaaatatat aatttattat acaattagtt
     2161 ggtaggtttg atagtaacca tcctttaata atagtgtaac aacatactaa tttatatcaa
     2221 aatatttgat atatataaaa tattatattt attttatata aatagattat atattgacaa
     2281 tgtaacggac ctaatttata aacctataat ttgtcataat atatatatat taaatatata
     2341 tatttgggta gcagcataat caatgaatta ttgtatatta tataagtaca aatataataa
     2401 ctaaattaaa aaaatttaat ataattgatc aaagaatgct aacatgagta acgaaaataa
     2461 ggtatttata tttatataaa taataaacct tatcatctaa aacataaggt tttactataa
     2521 atacagtact taagctaaat atctgaaagg atatagcgat agataaaata gataatatat
     2581 atatatatat taataataat aaacattaat gtaattaacc tttataaaaa taggggcaat
     2641 aattaactag aaaagtgatg tttaaatata tactgtaatg taaaccgaca ctggtatgtg
     2701 agctcgtaat gggttaagat gaataagtta actgtttata atgaactcgg caaaaaattc
     2761 ctagtgctta ggccatagga tatttaatat atataatata tatattaatg taaaatatag
     2821 tagtacgact gtttactaaa aacacagcac tatgcaaaaa caatagttat agtatatagt
     2881 gtgagaactg ctccatagtg atatataaaa atatagatta aataatatat atttgaaact
     2941 attgctaaat agcggtctta ctctgaggat cataatgtag cgaaattcat tgaccactaa
     3001 ttatggccct gcatgaatga cgtaacgata ctacaactgt atcataaaca gacttagtga
     3061 aattggaata atagtgaaga tactatttac ccgtagtaag acatgaagac cctaacacct
     3121 tcactgtata cagtatattg tataataatt aatatatatt tctaagataa tatatatcag
     3181 aaatattgtt aaattattaa acttaactat aaaaaattat aataatttaa ttaaatatta
     3241 tttattaaat atttataata tagtgacagt tactgtatga cagtttaatt ggggcgatta
     3301 cctcagccat agtatctgag gtgtccataa tacaaataac cataatatat tttaatataa
     3361 atacataata tattattatg tataatgtat atagttatac gaaattaatt tattaatttt
     3421 gttcaatgtt atacaacgtg atgtgtcata taacttagca gtaatactaa gtaacatatt
     3481 aaataatgtt aatattaagt gtaatagcgt aatggcactc aaatcataag acatacaggt
     3541 caaatgagca cataagtgtg gtatagtgaa caattattgt tgatagtaag acataatgat
     3601 aacggataaa ggtacgttag ggataaattt gttgtcctcc tagataatat attttattaa
     3661 atattaataa tagattaata tattatattt ataattatct ttggatatta aattatccac
     3721 atttaagata ttataatcat aataatgttg gataattaat acattgggtg aattgtaggg
     3781 aactccttaa ttaaaaaata ttattaagga caatctacag cgaagcttat gtcgatatac
     3841 attattaata tataataata atgatgatat aagaacgttt aacgactaga aagtgagtag
     3901 tatcaacaat aatctttcaa acaatcatat agataagttc tctcatagat tctatataga
     3961 actatattat taagttaata acttatctat aacattacaa tatattttta atatattaag
     4021 attgtagcgc ccaacatatt aagacaataa atttcaaaaa taaatattaa aaccatgaac
     4081 aataaaatat taaaatcaga tttattacat ttaaagtcac caaatcataa attatataaa
     4141 gaatataaaa aacaattacc tgatttaaca aatatacaat ttgaaacatt aataggttta
     4201 atgttaggtg atgctagcat taatactcaa aataatggta aaacacatcg tataaaattt
     4261 gaatgaagta ataaatattt agattatata aaccatattg ttaaagtatt tgatgatttt
     4321 ataatttctg aaccacatcc taaaaataga gaaagtaaag taacacctgg taaaattgta
     4381 tcaaattgag gatttcaaac attatcagtt gtacaattta atcaaatagc taatttattt
     4441 attaatccag atacgaataa aaaatatgta cctaaaggat taatagaaaa acatttaacg
     4501 gctagaggtt tagcttattg atttatggat gatggtggtt gattatatta tcataatcat
     4561 gttaaacaaa gaaattttgt attaaatact caatcattta caattgaaga tgtgaatcaa
     4621 atgataattg agttaaatca gaaatttaat ttaaattctt atataaaatt agaacgaggt
     4681 aaacctatta tagttatacc tcatagttca tatgatttat ttcatagtta tgtctatgaa
     4741 tatataaaaa atattgaatg tatgaagtat aaattatata tggatacata attcatagta
     4801 tttaactata cattggttaa atagtttata tgtaaggttt tatagattat taatattttt
     4861 gaaatttatt agataaatat gatgaaatag tctgaactaa atagtaatat ttagagatat
     4921 aatcagtaat gtgattatcg aatatataac taatatattc ggttttatac caaattataa
     4981 cggataaaat atcataacaa ttgaacaggc ttatttcccg agagagtaca tattgtaagg
     5041 gaagtttggc acctcgatgt cgactcagcg tatcctacag gttgtagttg cttgtaaggg
     5101 tttgactgtt cgtcaaataa aacgctacgt gagttgggtt aagaacgtcg caagacagtt
     5161 cggttcttat ctgctatggg atcatgtaaa tttagactta atagttagta cgaaaggatt
     5221 actattactt taccaatggt gtatttctaa aattattttt tatatttaga taatagctaa
     5281 gtagagagat tcatattaat ttttaaattg acgtagtact gatagcatat caagtacgaa
     5341 tcggttctaa atatacattt atttgtgtta aagactataa cattaatatc ataaattttt
     5401 tatgataaat atggtttata cttaattatt aagtaataat ttaccaaatt aaattatact
     5461 atatatatct cttatcattg tactcattat ttatatatta taaatatata atatatatat
     5521 tgctgaattg gcttaactgg taaagcagtc gttttgtaat cgacagttag tggttcgagt
     5581 ccactattca gcatatttat tatttataaa tttataggac gtgtgactga gtggtctaaa
     5641 gtgtgactct tgagtagtta tgtttcatta ttgaaaccgt aagttcgaat cttaccgcgt
     5701 ccgtaatatt taccattaaa tatgaatata aagataaata atatatatta ttttactaaa
     5761 aagtctattc tattaaatta attatatggt actttatagg aatatattaa atattatatc
     5821 catataatat agttttatat ttaatataag ataaacatta tataatatat agcttattaa
     5881 aatatataaa tattattata tattattaaa ttaataataa tatatcttta taagagtaaa
     5941 ataattattg attgtgacga aatggttaac gtattaagtt taggtcttaa ttaattatga
     6001 gttcgattct catcaatcat attaatataa aaaataaaaa tgatataaga aaaataaatt
     6061 taatagcacc tatagtttaa gcggtaaaat attagtccac gatactaatg acataagttc
     6121 gactcttatt aggtgtttat aagagcatag tataatggta atacttctga cttcaaatca
     6181 gacattagtg gttcgaatcc gcttgttctt gaataaatat ttaaaaatat ataagtaata
     6241 ttgtagtgaa taaaaataat atttgagctt gatgttggct cagtgtaacc gctagttaga
     6301 tacataatac atgcgaatga aacgatataa taatattatt aaaaataata tatattatat
     6361 taatgtcgtg aaaacgtgag taaagaatga taatatgaac tattgtttca gttaaatact
     6421 gatataaatt aaataaaatt aaaaaataaa gaatataaat atatatttga taatagtcaa
     6481 gtcattaata acattaggta gttggtagta taatagacta ccaagccaat actatgttta
     6541 gctgacaatg aaagttggaa cagtcacgtt aaccttgaaa taatggttaa tatctattag
     6601 atacagcagt aagtaacatt tgtcaatgga cgaaagtctg aacgagtaat ctaacaagat
     6661 gaataataaa tattatttaa taaacaatga ttattaaatt attaataatt ataaataata
     6721 tacctcagta gaggaaaatg ttaaagtata aaatcttaat atataattga cataatgagt
     6781 aaaattatat aaatagtcct aactaattta tgtgccagcc gttgcggtta gacatatagg
     6841 acaagtggta cacattaatg gtataaaggg tcagtagtat ggattaaaaa aaatctagaa
     6901 tattattatt taaattataa tgaagtacat gagtaagggt taaatctata gatacatgta
     6961 tgacaaccaa tatatgaagg tatttaatta taataatatt gacattgagt gacgaaacct
     7021 atagtatcaa attggactag tcaaccaatt agttataggt gtaaacaatg tatgttaata
     7081 aaaatataaa tttattttta taaagttaat atgagaacat accacctgag gagtactaca
     7141 cagtgtagaa actcaaaaca atagaccgtt taggttatta acagtggatc atgtagttta
     7201 atgcgataat acacgctaat cttaccataa tttgcatatt taattttata ttatttacaa
     7261 gtgctacata actgtctcta gttcatgctg taaagtatta ggttaagtcc gttaatgaac
     7321 gtaatctatc taaatttaat aaaaaattta gatttttcat agaacgaaaa atattaaata
     7381 gattaagaca agtcttcatg gcctttatat tatgggctac atacgtgata caattaaaca
     7441 tacaaagtct aataaaataa ttattaatta ttaaattaat tgacttaaaa tgtttaatat
     7501 attatattat aattatcttt ttaagatatg tatattatat atatattatg tgaattatat
     7561 actgaaattt gtatatatta aatcggaatt gtcagtaatg gtgtattagt atgacaccgt
     7621 gaagttgttt cctaagggta ctaattactc atcatttggc tgaaacacat agtcattcac
     7681 ttattattat tatttattat aatttataat tatttatatt attattttat ttttataata
     7741 tggtaataaa tactatgagt gacagctgag aagttgaaat atagttgtgg tagatgaatc
     7801 tgctgcggtt aattatcctc tttactatcc cccccccttt ctttttgtcc acatagctta
     7861 aatggtagag cactagattg aagctctggt tgtataggtt caattcctgt tgaggacatt
     7921 ttttttttat tacttagata gttcaaatgg ttagaacgat tgtctcatat acaatcaatg
     7981 taggttcaat ccctgctcta agtatatttt attatattaa atataatata aatatctata
     8041 ttttatttta ttaataaaat aaataatata tcaataataa taatatatta taattataat
     8101 tataatataa ttatgacaat aattaaataa tataaaaata tatgaataaa aatttatata
     8161 ataaacgttt acaaataatt aaagaattaa tatatcaatt attaaataat atatccgaaa
     8221 ataataataa taaatcttta aataataaat tagctaaaat aaatttatat aataaatata
     8281 ataatataat taatataaat aataataaaa tattaaataa taaattagct aaatataata
     8341 atagtttaga ttttaataat aatatatata attataatac aaataattta ttaaaaacat
     8401 tacataaaga taaaattgtt gaaatattaa ttaataatat aatgacacaa tatatattta
     8461 ataatatatt aaatattcat tataatggtc caatatttaa tcatacaatg aataaattaa
     8521 atataataat atttatatat aaaccaaaaa taataaataa aaataatatt tatacaacta
     8581 atatatcatt atgaaataga ttaataagta aaatgataaa taaaaataat aatattaata
     8641 aattattaag taaattatat aataaagatg ttattattga acctatatat ttaacatatg
     8701 attatttaga tagtacaata ttaagtaaaa ctataagtca taatatatat aaatataatc
     8761 aatataaagg attatatagt aatataatat taaaaaatat accatcagca tcaggacaaa
     8821 taaatataaa taatattata aataataaaa ttaataatat aaaatattta aataaattat
     8881 taatattaaa agatatatct aatttatcta ataatattga tattagaaat attggatata
     8941 ttaataataa taatactatt gaacaattat tattatatca atatattatt ggttatgatt
     9001 gagtatataa aggtaaatta gctaaatcag atagtaatgc tagatcagta tattcattaa
     9061 aacaatcagg tactttaaat tatagtaatt taacatcaat tattaataat aatagttatc
     9121 gtttaaatag taaatcaagt catttaacaa ctaataataa aacattaatt aataaaaatg
     9181 gtaaatttaa tattagtgta acattaagtc atatttaatt atattaaata tataaatata
     9241 taactatact ataaaaaaaa atatatatat ttataagtaa taaataaaaa ttttatcgaa
     9301 aaaaaaataa aaatataatt aaagtgaaca atctattaat aagaaatata aaatatataa
     9361 atataggaaa atatataaat aaaaataaag ttatgcataa taatacacat aacataacaa
     9421 catgagcatg aatacaacgt tgattatttt caacaaattg taaagagatt gctatattat
     9481 atataatatt tgctgtattt gctggattaa taggtactgc tttaagtata ataatacgtt
     9541 tagaattagc aggaccaagt ccacaaatat tattccataa tggtcaatta tttaatgtag
     9601 taatatcagc acatgcagta atgatgatat tctttttagt aatgccaatg acaatgggat
     9661 tctttgcaaa ctatttagtt ccattaatgt taggtgcttt agatatgagt ttccctcgta
     9721 ttaataatgt agcattctga ttattagttc catcattatt attagctgta tcatcaacta
     9781 tagtagaaag tggagcagga acagggtgaa cagtataccc acccttatct agtatacaat
     9841 cacatagtgg tccatctgta gatatgttaa tattctcatt acatttatct ggtatttcat
     9901 cattattagg tgctattaat ttaatggtta ctataattaa tatgagagct aatggtatgg
     9961 attatagtaa aatgacatta tttacatgat ctgtattaat tacagctgta ttattattat
    10021 tatcattacc agtattagct tcaggtttaa caatgttatt aactgatcgt aattttaata
    10081 caagtttctt tgaagttagt ggtggtggtg atcctatttt atatcagcat attttctgat
    10141 ttttcggtca tcctgaggtt ataattaaaa tataagcctc attatgttgt tatatgtggg
    10201 aatatatgtc tattaaaatt aatatagact aataaataaa tccacaggta gtatatatta
    10261 tatataataa tatatattgc ttaagagact atatacaaca gtataatatt attataaaat
    10321 attatataag agatagtcca ttttttttta ttaaaatata aatatgttat attttaatta
    10381 tacctggttt tggtatggta tcacaaataa tagctgtata tgctaaaaaa ccaatatttg
    10441 gtacaatggg tatgatatat gctatggcat caattggatt cttagggttc tgtgtttgaa
    10501 gccatcatat gtttactgtt ggattagatg cagattctcg tgcatacttt acagcagcaa
    10561 cattaattat tgctatacct actggtgtta aaatatttag ttgattagca tcattatatg
    10621 gtggatcatt gagatttaca acatcattat tatttactgt aggttttata ttcttattta
    10681 cagttggtgg tgttacaggt gttgtattag ctaatgctag tttagatata gcattccatg
    10741 atacatatta tgttgtagct cacttccact atgtattaag tttaggtgct atatttagta
    10801 tatttgctgg ttattatttc tgaagtacta aaatattagg tttatattat aatgaattat
    10861 taggtcaaat ccaattctga acattattta taggtacaaa cttaacattt atgccacaac
    10921 acttcttagg tttacaacaa atgcctcgta gaatacctaa ttatcctgat gcattctatg
    10981 gttgaaattt agtaagtagt tttggttcta taatatcatt agtgtcatta ttcttattct
    11041 tctatatagt atatgatcaa ttagttaatg gtttatctaa taaagataca gtagctgtat
    11101 caacattata tgatccagac tttactgagt caaacttaat ttataatgag tttaatacac
    11161 atagagcacc aagtattgaa tgagctgcag ataatcctcc ttcattacat acatttaata
    11221 ctccagtaat acaatcataa tatattataa taatataatt ataatttatt attttagtat
    11281 aattatatat cactatacat tatatttaat atatatacat tattaggtaa aattattata
    11341 tatatgccta tatatttata aattaacata aatgccacaa ttagtaccat tttattttgt
    11401 aaatcaatta gtatgaggat atggtatatt attaattata atatatttag tatctaaaat
    11461 catattacca agattattag tagtatattt aagtagaata tttatatcaa aattataata
    11521 tatatttaat ataatattaa aataataata aattaataat aacaaattta tataaattat
    11581 ttaataataa tattttataa taatataaaa tatattttta atatataata tttatataaa
    11641 taataataat aattaaagat aaaaaataaa aatgttatat ttaataaatt caccattaga
    11701 tcaatttgaa attagatcat atgtaggaat atattcacca tttagtgata tttctgcatt
    11761 aagtttaaca acatttagtg tatatactat tatagtatta tttataatat atgttttaca
    11821 tatagtaaca acaaataatg taggtataat acctacaaga tgaacaatag ttgtagaagc
    11881 attatatagt acaatatata atatggtagc aacacaaata ggaaataaag gacaaatatt
    11941 tataccattt atttatagtt tatttatatt tatattattt agtaatttaa ttagtttagt
    12001 tccatataat tttgctatta tggcacaatt agtatttact gtttcattaa gtatgacttt
    12061 atgaattggt attactattt taggttttaa tactcaaaaa ttaggttatt ttggtttatt
    12121 tgttccatca ggtactagtt taccattagt tccagtttta gttattattg aaggtttatc
    12181 taatgctgct cgtagtatca gtttaggttt acgtttaggt tctaatatat tagctggtca
    12241 cttattatta gttatattaa gtggtttaat atttgacttt atggcttctt cagctttatt
    12301 atttgttatt ggtattttac ctttaggttt aatattaggt attatgtgtt tagaaagtgc
    12361 tatagcttgt atacaatctt atgtattctg tattttagtt tgtagttata ttaaagatgc
    12421 tttatatgct cattaatatt atattctttt aactattata tatttttaac tatacataac
    12481 ttattttata agtaaatata ttaatatata ttatattaat taattattat tattaataat
    12541 attatattaa taattatgtc cttatagttt atcggtaaaa catagtactg ttaatactaa
    12601 tagataggtt cgactcctat taaggactag attagatttt atttttttat tttattttta
    12661 tcctttaatt tataaggtat ataatatata ataatatgtt atgatatgat acaatagtta
    12721 atttaaatca attaggttta gatttattat attatttatt aataggtaca ggtatagcta
    12781 tattaagtag aagaaatgct atagttagta ttttatattt aatattatta tatgtatgat
    12841 taagtttata tttatataat attggtttag gtgttatagg tttattatat ttattaatat
    12901 atgtaggtgc tatagcaata ttatttttat ttatattatc attaatgaat ttaaaattat
    12961 ctgaattaac ttctgctaat agtaaaccag attatatttt aataattatg acaatattaa
    13021 atataacatt tatatttagt tatatttata ctaaattaac tttaaataca tcaatatcta
    13081 ctgatatatt tattaaatta tttaataata tattttttat tgatagttct aatttattag
    13141 attttaattc attatttact attaataatt tattagttac taattgatct aatattaatc
    13201 aattaactga aatgcgtgtt attggtgagt tattatatac tgaatatgca ttattattta
    13261 taatattagg tttaatatta ttattatcaa tattaagtgc aataatatta ttatataact
    13321 catcaatatt aaataataat aaaaatatat aattattatt atattagtat tcaataatta
    13381 aataatataa attaaatatt ttaaatataa ctttacataa tattataata tattatatat
    13441 agaataaata tatataataa aattataatt aaatatagta tatataataa tatataataa
    13501 attaataata tttattattt agataattaa tttattagta ttataattaa attatgtata
    13561 atatggcatt aatattagat attatagaag tattattatt tttagtatgt gtattatttt
    13621 cagtagctta tttaacagtt gcagaaagaa aaaccttggg atatatgcaa cgtagattag
    13681 gaccaaatgc agtaggttat tatggtttat tacaagcatt tgctgatgct gtaaaattat
    13741 taattaaaga aataataata ccaaaagaag caaatggtat tatattagtt attagtccta
    13801 taataacatt aataacagca ttattaggat gattagttat tccattagga ccatcattaa
    13861 cattaggaga tatagataat ggtatattat tttcattagc tataggtagt attggagtat
    13921 ttggtacatt attatcaggt tgaagttcta atagtaaata ttcattttta ggatctatac
    13981 gttctacagc tcaattaata agttatgaat tagtattaac aacaatatat attatatgtt
    14041 taatgatagc tagtgatatg aatgttagtg gtgttataga aatacaacgt ataatatgat
    14101 tagttatacc atttttacca ttaggtttaa tattttttat tagtactata gctgaaacta
    14161 atcgtcctcc atttgattta gttgaagctg aaagtgaatt agttgctggt ttctttactg
    14221 aatatagtgc tagtcctttt gttttcttct ttttagctga atatagtaat attattttaa
    14281 tgtgtgctgc tactacatta ttatttttag gtggttattt atatccagaa attattaata
    14341 atattttata tttattattt gattcttatc aatattcttt attatttagt ttagttgaag
    14401 gttcatttta tggtatagct ttaggtatta aattaattat tttaatgttt acatttattt
    14461 gagttagagc ttctttccct cgttttactt atgataattt attacattta tgttgaacta
    14521 ttttcttacc tttattattt ggtttcttat tatttatacc ttctatttta tatatttttg
    14581 atggtttacc attatcaata taattatata tatatttata atatatataa taataataat
    14641 tttttattta actttacatt tattaatttt ttataagtag ttatatatta tattttatta
    14701 agcctttaac ttaatggtag agtgctaact tgataagtta gttgtactag ttcaattcta
    14761 gtaaggctta tataataata tatattatat attacattct agtaaggact cgaaccttaa
    14821 ttagggtatt agaagtaccc tgtcttaccg gttaaacgac tagaatattt attttaataa
    14881 taaaacttac ttatagttaa aatatatatt atatattatt ataagtaatt aatattattt
    14941 tatattatta atagcggcta taggttaact ggtagaccta gtgacttcca atcattgagc
    15001 atctgttcga gtcagattag ccgtatataa aaatatagta tatataaaaa taatatatat
    15061 aaaataaaaa tatataatat aaaaatatat aataattaaa aataaaatat gaaatatgat
    15121 atattaacaa taatatcaaa tattaatata tttacatcat taggtataga aaatatatca
    15181 ttaatagcta atgatgttgc aacaccatga ggtatgtatt ttcaagattc agcaacacca
    15241 atagctgaag gaatacaaga attacatgat acaataatgt attatatggt aatagtatta
    15301 tgtttagtaa catatatatt agtaagttta attaaagtat ttaaaaataa tccaataagt
    15361 tataaatatt taatacatgg aacaacatta gaagtaattt gaacaatatt cccagctgta
    15421 atattagtat taatagcttt cccatcattt gtattattat atttaagtga tgatgttgta
    15481 aatccagcta tgactattaa agctataggt taccaatgat attgagtata tgaatatagt
    15541 gattttatta atgatagtgg tgaaactgta caattagaat catatattat acctgatgat
    15601 ttattagaag ttggacaatt acgtttatta gatgttgata accgtgttgt tgttccagtt
    15661 gatactcata taagatttat agttactgct ggtgatgtta tccattgttt ctctatacct
    15721 tcattaggtg ttaaaattga tgctgtacct ggtcgtttaa atcaaattag tacattaata
    15781 caaagagaag gtattttcta tggtcaatgt caagaaatct gtggacaagg tcattcagaa
    15841 atgcctatag ttattgaatc agtaaattta gataattttt tagagtgatt aaatgaacaa
    15901 taatatatta atatatatat tttttataac tatacaaata ttattattta ttataagtaa
    15961 ttggtattat tatatataat tataatatat gaccttatag tcaaatggtt atgacattag
    16021 ttcttcatac taatagtact ggttcgaatc cagttaaggt tgataaaaat aaataattat
    16081 cgcagtatgg tgtaattggc taacacatga gactcatgat ctcatactac gtgttcgaat
    16141 cgcgttattg caatattaat attatattaa gaattatagc ttaagggtaa agccgaccac
    16201 tcataatggt ttgatcagag ttcgagtctc tgtaattcta taaaagtaaa tataatatag
    16261 ttatatcaat ctggtggaat ggtagacacg actcacttaa aatgagttgc aatatagcat
    16321 aaaggttcaa gtcctttgat tgatattaat aaatatattc ttatttatat ttgtcctaat
    16381 aaaaattccc tttatgaata ttttattata aattgtggac taatagggaa gtcggcctga
    16441 atttgagtta ggatcatgtg agttcgaatc tcaccaattt aaattatatt aattatatat
    16501 gagtgtatag ttcagtggta gaacaactac cttttaagta gttttgcgtg agttcgagtc
    16561 tcattacact tattattata aaatagatta ttaattattt tatatattta ttaatataaa
    16621 tatttatcag atatgttaga gtcgaactaa ccgtatctac ttcccaaaag tagcgcctca
    16681 ccgtttggct tatatctgta tataaatata tttatttaaa atcaagggta ttagcttaat
    16741 tggcaaagcg actatcttac acatagtaga gtggtagttc aaatctatca taccccatat
    16801 attaataata tatatatttt ctattatata ttaatatata tatatattat atattattaa
    16861 ctttacataa aattataatt aataatactt tatattctta tatataattt attattttaa
    16921 tataattata tgaataggat gagaatcgaa ctcataacgg ccgtttgcca ttaagtctac
    16981 agcttaactc gatgtaccaa taatcgaaac ctatccatta taattaaaat aataattaat
    17041 tagaatatta cttatatcta atatatataa tatatataag tagaccaatc ctcacctaga
    17101 actttatatt tttatataag atcatattta tggtgtagtg ttttatatat tggttttata
    17161 tttaaaaata caaaggtcat tattatgaat tattataaaa tatagatatg caattagtat
    17221 tagcaggaaa atatataggt agtggtatag ctactatagg attattaggt gccggaatag
    17281 gtatcgcttt agtattcgca gctttaatta atggtacagc tcgtaaccca tcagtaagat
    17341 caacattatt tacatatgca atattaggtt ttgcattaag tgaagctaca ggattattct
    17401 gtttaatgat ctcattctta ttattatatg ctgtttaatt aatataaaat attatttaat
    17461 aagtataata tataactata cataaatatt aattatttaa ttataaatat ttttatcatg
    17521 taatagaata tgaataaata ttaattatat attatatata aaatatataa taaaaataaa
    17581 tataaaatta aaataaataa aaaaaaatgt taataagtca ttatatatta ataataggtt
    17641 tattaggatt tatattaaat agaaaaagtg taatattatt atttatagct atagaaataa
    17701 tgttattagg tggtacattt aatatattat taagtagtaa ttattttgat gatagtatag
    17761 gtttaatatg aacaatagtt atattaataa tagcaggtgc agaatcagct ataggattaa
    17821 gtatattagt ttgttattat agagtaaaag gtaatattaa tatagatagt atataatatg
    17881 gtattattaa tattattatt acctttatta ggttcattaa tttccggatt attaggtcgt
    17941 ttattaggat ataatagttc aaaatatata gcaacattat gtataataat accatgtata
    18001 tattcatgat atttatatta taatgttatg gtattaaata taatatatag tataaattta
    18061 tttaattgaa taagtattga taatattgaa attgattgag cttttactat tgatgaatta
    18121 tcaataacat tattagttgc tgtttgtact atttcttctt tagtacattt atatgctaca
    18181 agttatatga gtcatgatcc acatcaacaa cgtttcttta gtatattatc attatttaca
    18241 ggatttatga taatattagt aacagctaat aattatttag ttatgtttgt tggttgagaa
    18301 atgataggtg tatcatctta tttattaata agtcattgac atacaagatt agctgctatg
    18361 aaaagtggtt tatcagcatt tttaatgaat aaatttggtg atacttttat gacaataggt
    18421 ttatttttaa ttttaataac atttggttct ttaaattata gtactattta tagtttaagt
    18481 tcatatatta atactgatat attaacatta attatgttat gtttattaat tggtgctgtt
    18541 gctaaaagtg ctcaattagg tttacatact tgattattaa atagtatgga agggccaaca
    18601 ccagtaagtt cattattaca tgctgcttgt ttagtttgtg caggtattta tttattaata
    18661 cgtagtagtt atttattaga atatacacct acagtattat taattatttt atgattaggt
    18721 ggtttaacta ctttaatagc tggtattata gctatagtat ctaatgattt aaaaaaaatt
    18781 atagctttat ctactatgag tcaattaggt ttaatggtat tagctatagg tttatcaagt
    18841 tatcaagtta gtatttatca tttatttaca catgctatgt ttaaagcttt attatttatg
    18901 tcagctggtt caattattca tagtgttgta tatgaaagtc aagatattag aacttttggt
    18961 ggtttaattc attatttacc agtaacttat atttctattt taattgcttc tttatcttta
    19021 atggctattc ctggtttaag tggtttctat tctaaagatt taattattga atctgcttat
    19081 ggtgtttatt ctttatctgg ttttacttta tattgatttg ctataacttc agctacttta
    19141 acatctattt atagttttag attattatat ttagttttct ataatactcc taatgctaat
    19201 cgttatacat atcatattat tcatgaatca gattataaaa tgttaattcc tatgattatt
    19261 ttagctatat tctctatatt tattggttat attactcgtg atatttattt aggttttggt
    19321 tctccattta atagtatatt tactcatcct tcaaatttat ctattgttga tattgaatta
    19381 agtttaccta catcttataa attattacct ttaattttaa ctatattatc agtatcttca
    19441 gttttattta tttatgaata taaatataat tgattacctg atattaaaaa taattatatt
    19501 tataatttat atttatatgc taatagtaaa tttatgatag atcaaattat taataatatt
    19561 attttaagat ctactttatc tattagtatt ttatctagtc aatttattga taaaggtatt
    19621 ttacaaattt atggtcctaa tggtttatat aatagtttaa attatttaag ttataatatt
    19681 attcaattat cttcattaaa ttcttataat attgctaata atgattctat ctttaatcaa
    19741 actaatacta ctataagaca ttatggtatt tatttattaa ctttattaat tactattagt
    19801 tttatttatt atatttctat tattattggt tataatattg gttataattt aatattatta
    19861 ttattattaa cattaccatt tgctttataa ttattttata tatttatata ttttttttta
    19921 actttactct tatttttaat ataattttat atattatgtt tataatataa tatttattat
    19981 tataagtata atagtttata ttattatata tggtggttat agtttaagtg gtaaaactgg
    20041 tgtttgtggt acacctaatt agagttcaag tctctattat caccctttaa tataatatat
    20101 tatataatat gtatggttct taataggtaa taattaagac tttgaactta aatacaaatt
    20161 attttaaaat tttttgtgtt agagttcaag tctcttccta gaagggaccc ccactggata
    20221 gggattatca cacttttaaa aaagtaataa ttaatattta aatattatat cttttataat
    20281 atttttataa tgtttctatt attaccttta aaaaagtaat catattgata tattttttat
    20341 aggactaata gcttaacggt aaagtgtcta cttgtcacgt agaaggatgt ctgttcaaat
    20401 cagacctagt tcgtattatt tttatatata attatataat aattataaaa gtttaaatat
    20461 ttatatctaa ctaacttatt taagatttag tatatacaaa tatataaaaa atatatataa
    20521 taaatatata taataatata ttagtatata tataataata tatatatata ttatggcaat
    20581 acgtaaaagt aatatatttt taggattagt taatagttat gttattgata gtccacaacc
    20641 tagtaatatt tcatattgat gaaatttagg ttcattatta gcattaatgt tagtaataca
    20701 attagctaca ggaatatttt tagctatgca ttatagttca aatattaatt tagctttcta
    20761 ttcagtacaa catattatga tggatgttaa ttatggttga gtagtaagat actgtcatag
    20821 taatggtgca gcattcttct ttatatttgt atatgctcat atggctcgtg gattatatta
    20881 tggttcatat agagcaccac gtatagcagt atgatatata ggagtagtaa tattcttatt
    20941 aatgataata acaggtttct tgggatactg tttagtttat ggtcaaatgt cacattgagg
    21001 tgcaactgta ataactaatt tagttacagc aataccatta attggtcaat caatagctga
    21061 atttatttga ggtagtagtt ctgtaagtaa tccaacaata caacgtttct ttagtttaca
    21121 ttatttatta ccatttattt tagctgctgt atcatgttta catttattag ctttacatga
    21181 gcatggaagt agtaatcctt taggtataac aggtaatata gatcgtatac ctatggcacc
    21241 atatttctta tttaaagatt taattactat atttgtattc ttatttgttt atagtacatt
    21301 agtattctat ttccctaata tgttaggtga tactgaaaat tatatagaag gtaatccatt
    21361 agtaactcca gctgctattg tacctgaatt ctatttatta ccattctatg ctatattaag
    21421 atctatacct tctaaattag gtggtgttat aactatgtta gcagctatat taattttatt
    21481 agctttacct tttgttgatt ttagtattat tagaggtaat gcttttaaag ttatttctaa
    21541 attattatat ggtttatttg tatgtaactt tattttatta ggtttattag gtgcacaaca
    21601 tattgaagta ccatttattt tattaggtca agtagctaca gttatatatt ttggatactt
    21661 tatagtttta ttaccagctg taagtatatt agaaaacata ttattctatt tagctattaa
    21721 aaaataataa ataatattat tattatttat tttaataata tttaactata ctaatatatt
    21781 atatattaat atatataata tatataaatt ataaattaat aaaatgttat tagttggaat
    21841 attaagttta gtattatata gttcatataa agaatacact ataaaagaat ttaaagaatt
    21901 tttagtaaca tctattttat tagtattata tagtttaata atattatgaa atagttcatc
    21961 attaataatt attggaaaag gattatcaat atttaataat acatttatta taacacctta
    22021 tacaataagt ataaaaatat tattattaat aatagttata ttatatttaa tagtaattta
    22081 tcattctaat actaataaat cattattaat acaagataat attaataata ttaaacgttt
    22141 attatcaagt aatccaggat tagaatatat agtattaata ttattaaata tatttgctat
    22201 gtcattattt atagaagcag gtaatagttt aataatattt atagctattg aattacaaag
    22261 ttatacttta tatattatta ctacatcata ttataatatt aatactacat catatagtcc
    22321 taaaggtata ggtatttata gtgctaaatc aggattaata tattttttat taggtagttt
    22381 agcatctatt atgatattaa taggtttagc attattatat agtgaaacag gtttatataa
    22441 tataacagat ataatgatat atttatatac agtaaatatt aatacagata ttaataatac
    22501 aataataaca ttaagtttat tattaatatt tattggttta atatttaaaa taggtttagc
    22561 tccattacat aattgattaa ttaatattta taataatgta ccaacaatag taacaatatg
    22621 aataagttta gttactaaaa taagtatatt aacatttata tatacattat tacatttatt
    22681 taattcaatt tatattaata atatatttat tataaatata ttacaattta tagctatatt
    22741 atctatgata attggtggta taggtggatt aagtcaaata agtttaaaaa aattattagc
    22801 ttatagtggt ttagctaatt caggttatat gttatatggt ataatagcta ataatcaata
    22861 tactatatta gcatatatat ttaatatata tcaatatagt ataacacata taaatatatt
    22921 tttaataata atatttacaa tattatatat accaataata aaatcaaata taaatacaca
    22981 aaaagaaatt gaggtaacaa caagacgtaa tcattttgta tatatatatg atttatataa
    23041 tttattaact aaaaatagaa gtttaacatt atgttatatt gtttcattag cttcatttat
    23101 gggtatacca cctttagctg gtttctatgg taaatattat ttattaatta ctggtttatt
    23161 aagtggttat tgatttagtt cattaatatt aataatagta agttgtataa cagcatatta
    23221 ttatggatat gtaataaaaa cattaaatca aaattcagaa gatattttat tatctaaaaa
    23281 tactaatatt ttaaatatta atattagttt tactttaagt tatgtaataa gtttattaac
    23341 attattaata ttaatgcctt tattaatatt agatttatat ataaatggtt cagttatatt
    23401 agactattat caatgaataa tataaatgtt atttactagt tatactatat atatttattt
    23461 tatattaata cctattgtta gtcaattatt attaggtatt aatttattat taagttataa
    23521 taatacatat aatgataaaa ctattccttt tgaatgtggt ttaagtagtt ttaatcaaac
    23581 acgttcagct ttctcagtat catttatttt aattgctatt ttatttttac cttttgattt
    23641 agaagtttct agtattttac cttatagttt agctttaaat ccttctcaag gtggtggtag
    23701 ttatggttta tctattatta ttatttttat ttctatttta gctattggtt ttatttatga
    23761 atatcgtact aatgctttac atattaaaaa tccttcacgt gatactagaa ttccttcatt
    23821 atataatgtt aaatctatat ctaatgatat ttcttccact aaataaatat taataattta
    23881 ttaattatta ttataattat ttatttttaa ctttactctt tttattatat tattttatat
    23941 aagtatatta tatatattat atggatatat agtcattggt aagacaagct acttgctaag
    24001 tagtgggtga aagccgtatg agttcgattc tcattgtatc cgtttataaa tatatatata
    24061 tgatataata atatatataa gtaatgataa taataattaa acaattatta taaaagaata
    24121 catatatatt atatatatat gttaatataa tataatcact aaataaatcc atttctagga
    24181 taaagaaaat aaatagggta ataatttata aggataaaat aataaaatta tgaataataa
    24241 tataataaat aataataata atattgctat tgatagttta gttaataaaa ctatatctaa
    24301 tatacaagct catccatatc atttagtaga accatcacca tgaccaatat ttactgcatt
    24361 tagtttattt ggtttagtat ttaatacagc attagttatg catcaatata taccatcagc
    24421 atcaataata ccattaaata taataatatt aatatatagt atgggattat gaggtagaga
    24481 tattattagt gaagctactt atgaaggtcg tcatacttta gctgttcgta atggtttatt
    24541 tgtaggatat gttttattta ttattagtga agctatgttc tttgttggtg ttttctgagc
    24601 ttatggtcat tcatcattaa accctaatat tgaaataggt gctatgtgac ctcctattgg
    24661 tataacagct attggtccat tagaattacc tttatttaat actataattt tattaagttc
    24721 aggtgctact ataacttata gtcatcatgc tttaatagct aataattgat cacatgctgt
    24781 tattagttta ttaattactg taattttagc tatattattt actatatgtc aatatattga
    24841 atatatatat gctacattta ctattagtga tggtgtttat ggatcatgtt tctattttgg
    24901 gacaggatta catggtgtac atataattgt aggtattatt ttcttatctt tatcattatg
    24961 aagattatat agtttacatt atacagatac tcatcatatt ggttatgaaa caactatttt
    25021 attatgacat tttttagata tcgtatgatt attcttattc gtagtattct attgatgagg
    25081 ttcataatat aatattatat aatttaataa aattataatt atctaactat acatatatat
    25141 attatatatt aataatatta ttataagtaa taataattta aattattatt taaattaatt
    25201 gtataataaa agaataaaat aagtaaaaat aaataaaaat aaaatatgtt aaatataaca
    25261 aattatatta taaatggatc aataatatat ataggtatat atatgttaat attaagttga
    25321 ttaatattat tattagtatc taaaaattat agtcatttaa gttatgttaa aaatgtaata
    25381 gttggaccaa ctatagcacc attaataata agaaaatcaa gtttattaat aagtataata
    25441 ttattttata tagtattatt atgatgatat tataatgatc catatgtaac aacaataata
    25501 acaacagaaa gtatagataa tgtaataaat aaatcatata gtacaatagg aaatataata
    25561 ataggattag atggaatatc attatatttt gctatattaa taggaataat attaccaata
    25621 tcaatattat caggatgata ttttaaaagt atagaatcta atttatatta tataatagta
    25681 ttaggattag gaatattatt attaataaat tttttatgtt tagaattatt atcattttat
    25741 gtattatttg aatcaacatt aataccatta tttatattaa taggtttata tggtagttca
    25801 aataaagaaa aagcagcata ttatgtatta ttatatacat tatttggatc attatttatg
    25861 ttattatcag tatgtataac atcatatatg ttaaaatcaa catcatatta tgtatatagt
    25921 aatttagtat tatcaattga tattcaaact atattatgat taggattatt tatagctatt
    25981 atgataaaat caccattata tccattacat atttgattac ctgttgttca ttctgaatct
    26041 ccattagctg gtagtatatt attagctggt ttagtattaa aattaacagt ttatttaata
    26101 atacgttgat tattaccagt attatcagaa ggtactttat tatttactcc tattgtttat
    26161 gttatatgtg tattaactat aataatagtt agtttaataa ctatagttca agttgattta
    26221 aaagttatta ttgcttacag ttctgtttct catatgagtg tttgtatttt aggtgtattt
    26281 gctaataata ttattggtat tgaaggttct tatttattaa gtattgctca tggtttagtt
    26341 tctcctggtt tatttatagc tgtaggtggt attttatatg atcgttatca tactcgtata
    26401 gttgcttatt ataatggttt attatcattt atgccattat ttagtttata ctttatagta
    26461 ttatcttttg ctaatattgg tactccttta tcagctaact ttattggtga attctttagt
    26521 atttatggtg catttaaaac atctcctatt ttagcaacta tagctacatt tagtgtttta
    26581 ttatctgcta catatcaaat gaaattaact aatcgtataa ctggtggtta ttctccaaat
    26641 atttcaaata ttggtgattt aacttctaga gaatctgtta tgttagtttc tttaatttta
    26701 cctacattat ttataggtat atatcctcaa tttattataa atgatttata tcatattgtt
    26761 tcttcaacaa tttatacatt ataataattt tatatattta ttattatata actatactat
    26821 tatttatata tattatatta attataatat ggaaccaatg ggagttgaac ccatgttttt
    26881 aacgtgcaaa gttaatgtac taccaactat actataatcc cttataaatt acttatatta
    26941 aataaataaa gacatcaatg agagtcgaac tcaaataggt aagatttgca atcttccttg
    27001 taaccgttac atgatgtcat attatactta taatatataa taaatattat aaatttaata
    27061 aaaatatata agtaagtgag tacatatgat atgaagtgag ttatatagta ctatataaga
    27121 aatcattgac tgtaagaata aaactacata atagaaaggt ataaaatatt taaaaataaa
    27181 tttaaattaa aaccaaaata gaaaactata taattaaata acatagtgaa ctgaaacatc
    27241 ttagtaacta taggtaaaat aaattaacaa agttaatata gagtagtggt gaacgaaata
    27301 tataaatata atcttaaagt agtgtgttat atatattaat acatgaatat agtgatactt
    27361 tcactaagat taaatagtat tatgtaagtt aatagtactg tgaaggaagt ctattatcag
    27421 tgattttata agcaatacgg aatcttaaat taaagataaa ctgtaggtac cttttgtata
    27481 atgggttagc aagttcataa tattagcaag attttaaaaa taaaatcata atgaaaatat
    27541 taaatattta taatattata aatataagtt aatattatga gacccgatag tgtgtgatct
    27601 tactatgtgc aagtattata atacttttaa taaaatattt atatatttta aagagggata
    27661 atattataat gactgaactg gttggtgttg caataccatc agaggacatg tggtaagccg
    27721 agaaagtcaa atctgacaca caggtagctg gtttgctgcg aaacatatat tcgtatggtc
    27781 tatatataat atcttagtag gtatagctct tagtatttaa agtatataaa atatatatat
    27841 tttaatacag ggaagatata atcttttact gacaatactt aatctcataa taattaattg
    27901 ataatttata tagaatcaga ctattagtga taaggttaat agtcaaaagg gaaacagccc
    27961 aaaacaaata ataaatttat tattaaataa attttataaa ggttcttaat ttatatataa
    28021 aatattaata tattttaatt aataagtgga caaaaaatat ataatttatt atacaattag
    28081 ttggtaggtt tgatagtaac catcctttaa taatagtgta acaacatact aatttatatc
    28141 aaaatatttg atatatataa aatattatat ttattttata taaatagatt atatattgac
    28201 aatgtaacgg acctaattta taaacctata atttgtcata atatatatat attaaatata
    28261 tatatttggg tagcagcata atcaatgaat tattgtatat tatataagta caaatataat
    28321 aactaaatta aaaaaattta atataattga tcaaagaatg ctaacatgag taacgaaaat
    28381 aaggtattta tatttatata aataataaac cttatcatct aaaacataag gttttactat
    28441 aaatacagta cttaagctaa atatctgaaa ggatatagcg atagataaaa tagataatat
    28501 atatatatat attaataata ataaacatta atgtaattaa cctttataaa aataggggca
    28561 ataattaact agaaaagtga tgtttaaata tatactgtaa tgtaaaccga cactggtatg
    28621 tgagctcgta atgggttaag atgaataagt taactgttta taatgaactc ggcaaaaaat
    28681 tcctagtgct taggccatag gatatttaat atatataata tatatattaa tgtaaaatat
    28741 agtagtacga ctgtttacta aaaacacagc actatgcaaa aacaatagtt atagtatata
    28801 gtgtgagaac tgctccatag tgatatataa aaatatagat taaataatat atatttgaaa
    28861 ctattgctaa atagcggtct tactctgagg atcataatgt agcgaaattc attgaccact
    28921 aattatggcc ctgcatgaat gacgtaacga tactacaact gtatcataaa cagacttagt
    28981 gaaattggaa taatagtgaa gatactattt acccgtagta agacatgaag accctaacac
    29041 cttcactgta tacagtatat tgtataataa ttaatatata tttctaagat aatatatatc
    29101 agaaatattg ttaaattatt aaacttaact ataaaaaatt ataataattt aattaaatat
    29161 tatttattaa atatttataa tatagtgaca gttactgtat gacagtttaa ttggggcgat
    29221 tacctcagcc atagtatctg aggtgtccat aatacaaata accataatat attttaatat
    29281 aaatacataa tatattatta tgtataatgt atatagttat acgaaattaa tttattaatt
    29341 ttgttcaatg ttatacaacg tgatgtgtca tataacttag cagtaatact aagtaacata
    29401 ttaaataatg ttaatattaa gtgtaatagc gtaatggcac tcaaatcata agacatacag
    29461 gtcaaatgag cacataagtg tggtatagtg aacaattatt gttgatagta agacataatg
    29521 ataacggata aaggtacgtt agggataaat ttgttgtcct cctagataat atattttatt
    29581 aaatattaat aatagattaa tatattatat ttataattat ctttggatat taaattatcc
    29641 acatttaaga tattataatc ataataatgt tggataatta atacattggg tgaattgtag
    29701 ggaactcctt aattaaaaaa tattattaag gacaatctac agcgaagctt atgtcgatat
    29761 acattattaa tatataataa taatgatgat ataagaacgt ttaacgacta gaaagtgagt
    29821 agtatcaaca ataatctttc aaacaatcat atagataagt tctctcatag attctatata
    29881 gaactatatt attaagttaa taacttatct ataacattac aatatatttt taatatatta
    29941 agattgtagc gcccaacata ttaagacaat aaatttcaaa aataaatatt aaaaccatga
    30001 acaataaaat attaaaatca gatttattac atttaaagtc accaaatcat aaattatata
    30061 aagaatataa aaaacaatta cctgatttaa caaatataca atttgaaaca ttaataggtt
    30121 taatgttagg tgatgctagc attaatactc aaaataatgg taaaacacat cgtataaaat
    30181 ttgaatgaag taataaatat ttagattata taaaccatat tgttaaagta tttgatgatt
    30241 ttataatttc tgaaccacat cctaaaaata gagaaagtaa agtaacacct ggtaaaattg
    30301 tatcaaattg aggatttcaa acattatcag ttgtacaatt taatcaaata gctaatttat
    30361 ttattaatcc agatacgaat aaaaaatatg tacctaaagg attaatagaa aaacatttaa
    30421 cggctagagg tttagcttat tgatttatgg atgatggtgg ttgattatat tatcataatc
    30481 atgttaaaca aagaaatttt gtattaaata ctcaatcatt tacaattgaa gatgtgaatc
    30541 aaatgataat tgagttaaat cagaaattta atttaaattc ttatataaaa ttagaacgag
    30601 gtaaacctat tatagttata cctcatagtt catatgattt atttcatagt tatgtctatg
    30661 aatatataaa aaatattgaa tgtatgaagt ataaattata tatggataca taattcatag
    30721 tatttaacta tacattggtt aaatagttta tatgtaaggt tttatagatt attaatattt
    30781 ttgaaattta ttagataaat atgatgaaat agtctgaact aaatagtaat atttagagat
    30841 ataatcagta atgtgattat cgaatatata actaatatat tcggttttat accaaattat
    30901 aacggataaa atatcataac aattgaacag gcttatttcc cgagagagta catattgtaa
    30961 gggaagtttg gcacctcgat gtcgactcag cgtatcctac aggttgtagt tgcttgtaag
    31021 ggtttgactg ttcgtcaaat aaaacgctac gtgagttggg ttaagaacgt cgcaagacag
    31081 ttcggttctt atctgctatg ggatcatgta aatttagact taatagttag tacgaaagga
    31141 ttactattac tttaccaatg gtgtatttct aaaattattt tttatattta gataatagct
    31201 aagtagagag attcatatta atttttaaat tgacgtagta ctgatagcat atcaagtacg
    31261 aatcggttct aaatatacat ttatttgtgt taaagactat aacattaata tcataaattt
    31321 tttatgataa atatggttta tacttaatta ttaagtaata atttaccaaa ttaaattata
    31381 ctatatatat ctcttatcat tgtactcatt atttatatat tataaatata taatatatat
    31441 attgctgaat tggcttaact ggtaaagcag tcgttttgta atcgacagtt agtggttcga
    31501 gtccactatt cagcatattt attatttata aatttatagg acgtgtgact gagtggtcta
    31561 aagtgtgact cttgagtagt tatgtttcat tattgaaacc gtaagttcga atcttaccgc
    31621 gtccgtaata tttaccatta aatatgaata taaagataaa taatatatat tattttacta
    31681 aaaagtctat tctattaaat taattatatg gtactttata ggaatatatt aaatattata
    31741 tccatataat atagttttat atttaatata agataaacat tatataatat atagcttatt
    31801 aaaatatata aatattatta tatattatta aattaataat aatatatctt tataagagta
    31861 aaataattat tgattgtgac gaaatggtta acgtattaag tttaggtctt aattaattat
    31921 gagttcgatt ctcatcaatc atattaatat aaaaaataaa aatgatataa gaaaaataaa
    31981 tttaatagca cctatagttt aagcggtaaa atattagtcc acgatactaa tgacataagt
    32041 tcgactctta ttaggtgttt ataagagcat agtataatgg taatacttct gacttcaaat
    32101 cagacattag tggttcgaat ccgcttgttc ttgaataaat atttaaaaat atataagtaa
    32161 tattgtagtg aataaaaata atatttgagc ttgatgttgg ctcagtgtaa ccgctagtta
    32221 gatacataat acatgcgaat gaaacgatat aataatatta ttaaaaataa tatatattat
    32281 attaatgtcg tgaaaacgtg agtaaagaat gataatatga actattgttt cagttaaata
    32341 ctgatataaa ttaaataaaa ttaaaaaata aagaatataa atatatattt gataatagtc
    32401 aagtcattaa taacattagg tagttggtag tataatagac taccaagcca atactatgtt
    32461 tagctgacaa tgaaagttgg aacagtcacg ttaaccttga aataatggtt aatatctatt
    32521 agatacagca gtaagtaaca tttgtcaatg gacgaaagtc tgaacgagta atctaacaag
    32581 atgaataata aatattattt aataaacaat gattattaaa ttattaataa ttataaataa
    32641 tatacctcag tagaggaaaa tgttaaagta taaaatctta atatataatt gacataatga
    32701 gtaaaattat ataaatagtc ctaactaatt tatgtgccag ccgttgcggt tagacatata
    32761 ggacaagtgg tacacattaa tggtataaag ggtcagtagt atggattaaa aaaaatctag
    32821 aatattatta tttaaattat aatgaagtac atgagtaagg gttaaatcta tagatacatg
    32881 tatgacaacc aatatatgaa ggtatttaat tataataata ttgacattga gtgacgaaac
    32941 ctatagtatc aaattggact agtcaaccaa ttagttatag gtgtaaacaa tgtatgttaa
    33001 taaaaatata aatttatttt tataaagtta atatgagaac ataccacctg aggagtacta
    33061 cacagtgtag aaactcaaaa caatagaccg tttaggttat taacagtgga tcatgtagtt
    33121 taatgcgata atacacgcta atcttaccat aatttgcata tttaatttta tattatttac
    33181 aagtgctaca taactgtctc tagttcatgc tgtaaagtat taggttaagt ccgttaatga
    33241 acgtaatcta tctaaattta ataaaaaatt tagatttttc atagaacgaa aaatattaaa
    33301 tagattaaga caagtcttca tggcctttat attatgggct acatacgtga tacaattaaa
    33361 catacaaagt ctaataaaat aattattaat tattaaatta attgacttaa aatgtttaat
    33421 atattatatt ataattatct ttttaagata tgtatattat atatatatta tgtgaattat
    33481 atactgaaat ttgtatatat taaatcggaa ttgtcagtaa tggtgtatta gtatgacacc
    33541 gtgaagttgt ttcctaaggg tactaattac tcatcatttg gctgaaacac atagtcattc
    33601 acttattatt attatttatt ataatttata attatttata ttattatttt atttttataa
    33661 tatggtaata aatactatga gtgacagctg agaagttgaa atatagttgt ggtagatgaa
    33721 tctgctgcgg ttaattatcc tctttactat ccccccccct ttctttttgt ccacatagct
    33781 taaatggtag agcactagat tgaagctctg gttgtatagg ttcaattcct gttgaggaca
    33841 tttttttttt attacttaga tagttcaaat ggttagaacg attgtctcat atacaatcaa
    33901 tgtaggttca atccctgctc taagtatatt ttattatatt aaatataata taaatatcta
    33961 tattttattt tattaataaa ataaataata tatcaataat aataatatat tataattata
    34021 attataatat aattatgaca ataattaaat aatataaaaa tatatgaata aaaatttata
    34081 taataaacgt ttacaaataa ttaaagaatt aatatatcaa ttattaaata atatatccga
    34141 aaataataat aataaatctt taaataataa attagctaaa ataaatttat ataataaata
    34201 taataatata attaatataa ataataataa aatattaaat aataaattag ctaaatataa
    34261 taatagttta gattttaata ataatatata taattataat acaaataatt tattaaaaac
    34321 attacataaa gataaaattg ttgaaatatt aattaataat ataatgacac aatatatatt
    34381 taataatata ttaaatattc attataatgg tccaatattt aatcatacaa tgaataaatt
    34441 aaatataata atatttatat ataaaccaaa aataataaat aaaaataata tttatacaac
    34501 taatatatca ttatgaaata gattaataag taaaatgata aataaaaata ataatattaa
    34561 taaattatta agtaaattat ataataaaga tgttattatt gaacctatat atttaacata
    34621 tgattattta gatagtacaa tattaagtaa aactataagt cataatatat ataaatataa
    34681 tcaatataaa ggattatata gtaatataat attaaaaaat ataccatcag catcaggaca
    34741 aataaatata aataatatta taaataataa aattaataat ataaaatatt taaataaatt
    34801 attaatatta aaagatatat ctaatttatc taataatatt gatattagaa atattggata
    34861 tattaataat aataatacta ttgaacaatt attattatat caatatatta ttggttatga
    34921 ttgagtatat aaaggtaaat tagctaaatc agatagtaat gctagatcag tatattcatt
    34981 aaaacaatca ggtactttaa attatagtaa tttaacatca attattaata ataatagtta
    35041 tcgtttaaat agtaaatcaa gtcatttaac aactaataat aaaacattaa ttaataaaaa
    35101 tggtaaattt aatattagtg taacattaag tcatatttaa ttatattaaa tatataaata
    35161 tataactata ctataaaaaa aaatatatat atttataagt aataaataaa aattttatcg
    35221 aaaaaaaaat aaaaatataa ttaaagtgaa caatctatta ataagaaata taaaatatat
    35281 aaatatagga aaatatataa ataaaaataa agttatgcat aataatacac ataacataac
    35341 aacatgagca tgaatacaac gttgattatt ttcaacaaat tgtaaagaga ttgctatatt
    35401 atatataata tttgctgtat ttgctggatt aataggtact gctttaagta taataatacg
    35461 tttagaatta gcaggaccaa gtccacaaat attattccat aatggtcaat tatttaatgt
    35521 agtaatatca gcacatgcag taatgatgat attcttttta gtaatgccaa tgacaatggg
    35581 attctttgca aactatttag ttccattaat gttaggtgct ttagatatga gtttccctcg
    35641 tattaataat gtagcattct gattattagt tccatcatta ttattagctg tatcatcaac
    35701 tatagtagaa agtggagcag gaacagggtg aacagtatac ccacccttat ctagtataca
    35761 atcacatagt ggtccatctg tagatatgtt aatattctca ttacatttat ctggtatttc
    35821 atcattatta ggtgctatta atttaatggt tactataatt aatatgagag ctaatggtat
    35881 ggattatagt aaaatgacat tatttacatg atctgtatta attacagctg tattattatt
    35941 attatcatta ccagtattag cttcaggttt aacaatgtta ttaactgatc gtaattttaa
    36001 tacaagtttc tttgaagtta gtggtggtgg tgatcctatt ttatatcagc atattttctg
    36061 atttttcggt catcctgagg ttataattaa aatataagcc tcattatgtt gttatatgtg
    36121 ggaatatatg tctattaaaa ttaatataga ctaataaata aatccacagg tagtatatat
    36181 tatatataat aatatatatt gcttaagaga ctatatacaa cagtataata ttattataaa
    36241 atattatata agagatagtc catttttttt tattaaaata taaatatgtt atattttaat
    36301 tatacctggt tttggtatgg tatcacaaat aatagctgta tatgctaaaa aaccaatatt
    36361 tggtacaatg ggtatgatat atgctatggc atcaattgga ttcttagggt tctgtgtttg
    36421 aagccatcat atgtttactg ttggattaga tgcagattct cgtgcatact ttacagcagc
    36481 aacattaatt attgctatac ctactggtgt taaaatattt agttgattag catcattata
    36541 tggtggatca ttgagattta caacatcatt attatttact gtaggtttta tattcttatt
    36601 tacagttggt ggtgttacag gtgttgtatt agctaatgct agtttagata tagcattcca
    36661 tgatacatat tatgttgtag ctcacttcca ctatgtatta agtttaggtg ctatatttag
    36721 tatatttgct ggttattatt tctgaagtac taaaatatta ggtttatatt ataatgaatt
    36781 attaggtcaa atccaattct gaacattatt tataggtaca aacttaacat ttatgccaca
    36841 acacttctta ggtttacaac aaatgcctcg tagaatacct aattatcctg atgcattcta
    36901 tggttgaaat ttagtaagta gttttggttc tataatatca ttagtgtcat tattcttatt
    36961 cttctatata gtatatgatc aattagttaa tggtttatct aataaagata cagtagctgt
    37021 atcaacatta tatgatccag actttactga gtcaaactta atttataatg agtttaatac
    37081 acatagagca ccaagtattg aatgagctgc agataatcct ccttcattac atacatttaa
    37141 tactccagta atacaatcat aatatattat aataatataa ttataattta ttattttagt
    37201 ataattatat atcactatac attatattta atatatatac attattaggt aaaattatta
    37261 tatatatgcc tatatattta taaattaaca taaatgccac aattagtacc attttatttt
    37321 gtaaatcaat tagtatgagg atatggtata ttattaatta taatatattt agtatctaaa
    37381 atcatattac caagattatt agtagtatat ttaagtagaa tatttatatc aaaattataa
    37441 tatatattta atataatatt aaaataataa taaattaata ataacaaatt tatataaatt
    37501 atttaataat aatattttat aataatataa aatatatttt taatatataa tatttatata
    37561 aataataata ataattaaag ataaaaaata aaaatgttat atttaataaa ttcaccatta
    37621 gatcaatttg aaattagatc atatgtagga atatattcac catttagtga tatttctgca
    37681 ttaagtttaa caacatttag tgtatatact attatagtat tatttataat atatgtttta
    37741 catatagtaa caacaaataa tgtaggtata atacctacaa gatgaacaat agttgtagaa
    37801 gcattatata gtacaatata taatatggta gcaacacaaa taggaaataa aggacaaata
    37861 tttataccat ttatttatag tttatttata tttatattat ttagtaattt aattagttta
    37921 gttccatata attttgctat tatggcacaa ttagtattta ctgtttcatt aagtatgact
    37981 ttatgaattg gtattactat tttaggtttt aatactcaaa aattaggtta ttttggttta
    38041 tttgttccat caggtactag tttaccatta gttccagttt tagttattat tgaaggttta
    38101 tctaatgctg ctcgtagtat cagtttaggt ttacgtttag gttctaatat attagctggt
    38161 cacttattat tagttatatt aagtggttta atatttgact ttatggcttc ttcagcttta
    38221 ttatttgtta ttggtatttt acctttaggt ttaatattag gtattatgtg tttagaaagt
    38281 gctatagctt gtatacaatc ttatgtattc tgtattttag tttgtagtta tattaaagat
    38341 gctttatatg ctcattaata ttatattctt ttaactatta tatattttta actatacata
    38401 acttatttta taagtaaata tattaatata tattatatta attaattatt attattaata
    38461 atattatatt aataattatg tccttatagt ttatcggtaa aacatagtac tgttaatact
    38521 aatagatagg ttcgactcct attaaggact agattagatt ttattttttt attttatttt
    38581 tatcctttaa tttataaggt atataatata taataatatg ttatgatatg atacaatagt
    38641 taatttaaat caattaggtt tagatttatt atattattta ttaataggta caggtatagc
    38701 tatattaagt agaagaaatg ctatagttag tattttatat ttaatattat tatatgtatg
    38761 attaagttta tatttatata atattggttt aggtgttata ggtttattat atttattaat
    38821 atatgtaggt gctatagcaa tattattttt atttatatta tcattaatga atttaaaatt
    38881 atctgaatta acttctgcta atagtaaacc agattatatt ttaataatta tgacaatatt
    38941 aaatataaca tttatattta gttatattta tactaaatta actttaaata catcaatatc
    39001 tactgatata tttattaaat tatttaataa tatatttttt attgatagtt ctaatttatt
    39061 agattttaat tcattattta ctattaataa tttattagtt actaattgat ctaatattaa
    39121 tcaattaact gaaatgcgtg ttattggtga gttattatat actgaatatg cattattatt
    39181 tataatatta ggtttaatat tattattatc aatattaagt gcaataatat tattatataa
    39241 ctcatcaata ttaaataata ataaaaatat ataattatta ttatattagt attcaataat
    39301 taaataatat aaattaaata ttttaaatat aactttacat aatattataa tatattatat
    39361 atagaataaa tatatataat aaaattataa ttaaatatag tatatataat aatatataat
    39421 aaattaataa tatttattat ttagataatt aatttattag tattataatt aaattatgta
    39481 taatatggca ttaatattag atattataga agtattatta tttttagtat gtgtattatt
    39541 ttcagtagct tatttaacag ttgcagaaag aaaaaccttg ggatatatgc aacgtagatt
    39601 aggaccaaat gcagtaggtt attatggttt attacaagca tttgctgatg ctgtaaaatt
    39661 attaattaaa gaaataataa taccaaaaga agcaaatggt attatattag ttattagtcc
    39721 tataataaca ttaataacag cattattagg atgattagtt attccattag gaccatcatt
    39781 aacattagga gatatagata atggtatatt attttcatta gctataggta gtattggagt
    39841 atttggtaca ttattatcag gttgaagttc taatagtaaa tattcatttt taggatctat
    39901 acgttctaca gctcaattaa taagttatga attagtatta acaacaatat atattatatg
    39961 tttaatgata gctagtgata tgaatgttag tggtgttata gaaatacaac gtataatatg
    40021 attagttata ccatttttac cattaggttt aatatttttt attagtacta tagctgaaac
    40081 taatcgtcct ccatttgatt tagttgaagc tgaaagtgaa ttagttgctg gtttctttac
    40141 tgaatatagt gctagtcctt ttgttttctt ctttttagct gaatatagta atattatttt
    40201 aatgtgtgct gctactacat tattattttt aggtggttat ttatatccag aaattattaa
    40261 taatatttta tatttattat ttgattctta tcaatattct ttattattta gtttagttga
    40321 aggttcattt tatggtatag ctttaggtat taaattaatt attttaatgt ttacatttat
    40381 ttgagttaga gcttctttcc ctcgttttac ttatgataat ttattacatt tatgttgaac
    40441 tattttctta cctttattat ttggtttctt attatttata ccttctattt tatatatttt
    40501 tgatggttta ccattatcaa tataattata tatatattta taatatatat aataataata
    40561 attttttatt taactttaca tttattaatt ttttataagt agttatatat tatattttat
    40621 taagccttta acttaatggt agagtgctaa cttgataagt tagttgtact agttcaattc
    40681 tagtaaggct tatataataa tatatattat atattacatt ctagtaagga ctcgaacctt
    40741 aattagggta ttagaagtac cctgtcttac cggttaaacg actagaatat ttattttaat
    40801 aataaaactt acttatagtt aaaatatata ttatatatta ttataagtaa ttaatattat
    40861 tttatattat taatagcggc tataggttaa ctggtagacc tagtgacttc caatcattga
    40921 gcatctgttc gagtcagatt agccgtatat aaaaatatag tatatataaa aataatatat
    40981 ataaaataaa aatatataat ataaaaatat ataataatta aaaataaaat atgaaatatg
    41041 atatattaac aataatatca aatattaata tatttacatc attaggtata gaaaatatat
    41101 cattaatagc taatgatgtt gcaacaccat gaggtatgta ttttcaagat tcagcaacac
    41161 caatagctga aggaatacaa gaattacatg atacaataat gtattatatg gtaatagtat
    41221 tatgtttagt aacatatata ttagtaagtt taattaaagt atttaaaaat aatccaataa
    41281 gttataaata tttaatacat ggaacaacat tagaagtaat ttgaacaata ttcccagctg
    41341 taatattagt attaatagct ttcccatcat ttgtattatt atatttaagt gatgatgttg
    41401 taaatccagc tatgactatt aaagctatag gttaccaatg atattgagta tatgaatata
    41461 gtgattttat taatgatagt ggtgaaactg tacaattaga atcatatatt atacctgatg
    41521 atttattaga agttggacaa ttacgtttat tagatgttga taaccgtgtt gttgttccag
    41581 ttgatactca tataagattt atagttactg ctggtgatgt tatccattgt ttctctatac
    41641 cttcattagg tgttaaaatt gatgctgtac ctggtcgttt aaatcaaatt agtacattaa
    41701 tacaaagaga aggtattttc tatggtcaat gtcaagaaat ctgtggacaa ggtcattcag
    41761 aaatgcctat agttattgaa tcagtaaatt tagataattt tttagagtga ttaaatgaac
    41821 aataatatat taatatatat attttttata actatacaaa tattattatt tattataagt
    41881 aattggtatt attatatata attataatat atgaccttat agtcaaatgg ttatgacatt
    41941 agttcttcat actaatagta ctggttcgaa tccagttaag gttgataaaa ataaataatt
    42001 atcgcagtat ggtgtaattg gctaacacat gagactcatg atctcatact acgtgttcga
    42061 atcgcgttat tgcaatatta atattatatt aagaattata gcttaagggt aaagccgacc
    42121 actcataatg gtttgatcag agttcgagtc tctgtaattc tataaaagta aatataatat
    42181 agttatatca atctggtgga atggtagaca cgactcactt aaaatgagtt gcaatatagc
    42241 ataaaggttc aagtcctttg attgatatta ataaatatat tcttatttat atttgtccta
    42301 ataaaaattc cctttatgaa tattttatta taaattgtgg actaataggg aagtcggcct
    42361 gaatttgagt taggatcatg tgagttcgaa tctcaccaat ttaaattata ttaattatat
    42421 atgagtgtat agttcagtgg tagaacaact accttttaag tagttttgcg tgagttcgag
    42481 tctcattaca cttattatta taaaatagat tattaattat tttatatatt tattaatata
    42541 aatatttatc agatatgtta gagtcgaact aaccgtatct acttcccaaa agtagcgcct
    42601 caccgtttgg cttatatctg tatataaata tatttattta aaatcaaggg tattagctta
    42661 attggcaaag cgactatctt acacatagta gagtggtagt tcaaatctat cataccccat
    42721 atattaataa tatatatatt ttctattata tattaatata tatatatatt atatattatt
    42781 aactttacat aaaattataa ttaataatac tttatattct tatatataat ttattatttt
    42841 aatataatta tatgaatagg atgagaatcg aactcataac ggccgtttgc cattaagtct
    42901 acagcttaac tcgatgtacc aataatcgaa acctatccat tataattaaa ataataatta
    42961 attagaatat tacttatatc taatatatat aatatatata agtagaccaa tcctcaccta
    43021 gaactttata tttttatata agatcatatt tatggtgtag tgttttatat attggtttta
    43081 tatttaaaat acaaaggtca ttattatgaa ttattataaa atatagatat gcaattagta
    43141 ttagcaggaa aatatatagg tagtggtata gctactatag gattattagg tgccggaata
    43201 ggtatcgctt tagtattcgc agctttaatt aatggtacag ctcgtaaccc atcagtaaga
    43261 tcaacattat ttacatatgc aatattaggt tttgcattaa gtgaagctac aggattattc
    43321 tgtttaatga tctcattctt attattatat gctgtttaat taatataaaa tattatttaa
    43381 taagtataat atataactat acataaatat taattattta attataatat ttttatcatg
    43441 taatagaata tgaataaata ttaattatat attatatata aaatatataa taaaaataaa
    43501 tataaaatta aaataaataa aaaaaaatgt taataagtca ttatatatta ataataggtt
    43561 tattaggatt tatattaaat agaaaagtgt aatattatta tttatagcta tagaaataat
    43621 gttattaggt ggtacattta atatattatt aagtagtaat tattttgatg atagtatagg
    43681 tttaatatga acaatagtta tattaataat agcaggtgca gaatcagcta taggattaag
    43741 tatattagtt tgttattata gagtaaaagg taatattaat atagatagta tataatatgg
    43801 tattattaat attattatta cctttattag gttcattaat ttccggatta ttaggtcgtt
    43861 tattaggat
//
DBGET integrated database retrieval system