GenomeNet

Database: RefSeq
Entry: NC_031671
LinkDB: NC_031671
Original site: NC_031671 
LOCUS       NC_031671            2773601 bp    DNA     linear   CON 25-OCT-2016
DEFINITION  Sugiyamaella lignohabitans strain CBS 10342 chromosome C, complete
            sequence.
ACCESSION   NC_031671
VERSION     NC_031671.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
            Assembly: GCF_001640025.1
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 2773601)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2773601)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2773601)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP014500.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2773601
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="genomic DNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Sugiyamaella
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="C"
     gene            <2548..>3243
                     /gene="RIP1"
                     /locus_tag="AWJ20_3707"
                     /db_xref="GeneID:30035758"
     mRNA            <2548..>3243
                     /gene="RIP1"
                     /locus_tag="AWJ20_3707"
                     /product="ubiquinol--cytochrome-c reductase catalytic
                     subunit RIP1"
                     /transcript_id="XM_018880729.1"
                     /db_xref="GeneID:30035758"
     CDS             2548..3243
                     /gene="RIP1"
                     /locus_tag="AWJ20_3707"
                     /inference="similar to AA sequence:KEGG_Orthology:K00411"
                     /note="Ubiquinol-cytochrome-c reductase; a Rieske
                     iron-sulfur protein of the mitochondrial cytochrome bc1
                     complex; transfers electrons from ubiquinol to cytochrome
                     c1 during respiration; during import, Rip1p is first
                     imported into the mitochondrial matrix where it is
                     processed, acquires its Fe-S cluster, and is folded, then
                     is translocated into the inner membrane by the action of a
                     homo-oligomer of Bcs1p, and finally is delivered by Bcs1p
                     to Complex III for assembly; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005750 -
                     mitochondrial respiratory chain complex III [Evidence IDA]
                     [PMID 10873857]; GO_component: GO:0005750 - mitochondrial
                     respiratory chain complex III [Evidence IDA] [PMID
                     3036836]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IPI] [PMID 16962558];
                     GO_component: GO:0070469 - respiratory chain [Evidence
                     IEA]; GO_function: GO:0051537 - 2 iron, 2 sulfur cluster
                     binding [Evidence IEA,IEA]; GO_function: GO:0051536 -
                     iron-sulfur cluster binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016679 -
                     oxidoreductase activity, acting on diphenols and related
                     substances as donors [Evidence IEA]; GO_function:
                     GO:0008121 - ubiquinol-cytochrome-c reductase activity
                     [Evidence IEA,IEA]; GO_process: GO:0009060 - aerobic
                     respiration [Evidence IMP] [PMID 3036836]; GO_process:
                     GO:1902600 - hydrogen ion transmembrane transport
                     [Evidence IEA,IEA]; GO_process: GO:0006122 - mitochondrial
                     electron transport, ubiquinol to cytochrome c [Evidence
                     IDA] [PMID 3036836]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="ubiquinol--cytochrome-c reductase catalytic
                     subunit RIP1"
                     /protein_id="XP_018733390.1"
                     /db_xref="GeneID:30035758"
                     /translation="MNTLLRATSSAARAALRTSQQSSAFAMASGSSRFVSNNNKPVGG
                     ASSYKVPDFTPYMKENRNEDSNRAFSYFMVGTMGVISAAAARATVQDFLTTMSASADV
                     LALAKVEVALGNIPEGKNIIVKWRGKPVFIRHRTPAEIHEANEVNVASLRDPQTDDQR
                     VKMPEWLVMVGICTHLGCVPIGESGDYGGWFCPCHGSHYDISGRIRKGPAPLNLEIPE
                     YEFIDNNEKVVIG"
     gene            <4851..>7451
                     /gene="STE11"
                     /locus_tag="AWJ20_3708"
                     /db_xref="GeneID:30035759"
     mRNA            <4851..>7451
                     /gene="STE11"
                     /locus_tag="AWJ20_3708"
                     /product="mitogen-activated protein kinase kinase kinase
                     STE11"
                     /transcript_id="XM_018880730.1"
                     /db_xref="GeneID:30035759"
     CDS             4851..7451
                     /gene="STE11"
                     /locus_tag="AWJ20_3708"
                     /inference="similar to AA sequence:KEGG_Orthology:K11228"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase
                     STE11"
                     /protein_id="XP_018733391.1"
                     /db_xref="GeneID:30035759"
                     /translation="MLTNRTWSSTDIKQWLESLHCGEYFQSFEDNHITGDVLLECDQT
                     ALKYMGIRKVGDRIKINQSLKELRSDYVKSLAEARGHSLFRYGPQSLEDLNRNSVSPF
                     AALSSSQPSKPEHSTPAEGYFSPKHSSSAGPGSALGILSGLSLGVPPNSSSSSRFPFR
                     RTAPNSAKSQYSTATTTTTVLSKTDSNGVQEIFSMDVVKQNNVKFIYPQGESKTVNIA
                     GCTTADEIKRKALQKIMADNVVNPVEWIVFVLLEDKFRHLGDVELMSIAQSSDSSERK
                     RLMLCAIGTSPSTKQLEKSKQIQVNSHLKLSSLSNIDSADSIAQATKPESKSISTNRL
                     SLAQSIAATSYDDDDLDDDDLEQDGASVTANARPRKVGRLSEHRPPSELISSNLAHFF
                     PSAPANDLEETIRNSRRFSKRMSRMSRISHRMSVASSTWGIPEDEEAPPPVPALPDHG
                     EQGTIMPGSLPSPYTSTTPTIPKPTTPTTAPVPTTEAPAAPEAKRPSLRSSIRKSVMP
                     RRYSSYESGNTNMLTALSNRISTMSLSKGGFSKSHNGGSEDQIHDGPTSDNEPETDAN
                     QEQHAPEVEDEDDEEDDNTFLDTVRKEESCPSKWIKGRLIGSGSFGTVYLGMNSFTGE
                     LMAVKQVEIPTEDTENGQRKKSMVDALQREMNLLRELQHKNIVQYLGSNSEGQFLNIF
                     LEYVPGGSVAMLLSNYGIFEESLIRNFVRQILEGLKYLHGQNIIHRDIKGANVLVDNK
                     GCIKISDFGISKKIETKLLTNNRVSLQGSVFWMAPEVVKQLPYTLKADIWSLGCLIVE
                     MFSGTHPFPEFTQMQVIFRLGNSGTPAIPDDCSDDAKDFLAKTFAIDHQKRPTAAELL
                     SHKFMDPIPQ"
     gene            complement(<7585..>9435)
                     /locus_tag="AWJ20_3709"
                     /db_xref="GeneID:30035760"
     mRNA            complement(<7585..>9435)
                     /locus_tag="AWJ20_3709"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880731.1"
                     /db_xref="GeneID:30035760"
     CDS             complement(7585..9435)
                     /locus_tag="AWJ20_3709"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733392.1"
                     /db_xref="GeneID:30035760"
                     /translation="MNTDKTGGSTVYGPDHPDSQHYEDSDSAMATAIQQSIDSSNNNF
                     KAVEGNYYQKYGEQESGELQKFGPATRESYDSKQWGIVPYSEASSSTSTVAAGLQQAQ
                     GSTTPIIYEFRNGIPIVLPADDAIYIAPLMMIIHSIPLGRKALLNGGVDLVPDYGFDP
                     LWWLGEKLIDLQDGPIHNRERLMIEIQRYTAFLDGESRRPCALIAGVISEAGPRASKL
                     ILKSNSQDEKPIGRFLQDLVKFWGPDSEFANVFQSTAMQERPSSFEEEDGEVIQKFTN
                     LVTDVTVALQQSIYDFIDDLMSADGGAPTTFIKDISDIVNITIKRDDGNSGTGIEIPA
                     IWYPDRYSEEYFECVNLLHRRRTEFRKQLTDLNARRLEISSTKGKDISKLLNISYDYI
                     KEISEKASDEDKENFSLVEKELADVKNLYKHRKESIVEQVTQTQQIMLREANLFKGLL
                     SDEDKKYLAEIYPAAQSLPAMRPYRLRGLIISPTEFCFLRSQPADDDVDLVDLGNDGD
                     SEKSFRDPTWTKIVWGDLSENGSSELYVGQITQQDAINWAKQGSSGYKWQEVVAFYAN
                     DYATNVEAHKVALSEGLRKFIQADKQCLEDQVANVKEDEEIKVEHEEKSR"
     gene            complement(<10076..>13597)
                     /locus_tag="AWJ20_3710"
                     /db_xref="GeneID:30035762"
     mRNA            complement(<10076..>13597)
                     /locus_tag="AWJ20_3710"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880733.1"
                     /db_xref="GeneID:30035762"
     CDS             complement(10076..13597)
                     /locus_tag="AWJ20_3710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733393.1"
                     /db_xref="GeneID:30035762"
                     /translation="MGEEHGFKNGIDSQTDQPAYSPVEEGAYARPDGSRPGSRNRTED
                     STDGDVDSVPDSPSQALADFHDEWSISDPLLIKQAVIFPPSFFNPLRARNHDTEWDKK
                     IAQLRSLLTNDSSLLTSNNRNDSALDHVQLPYAHFIPSPQQSDISQYAVNSQVAQSLL
                     LSPKIKENRFQYSRGLLISYLSRDKRSSTWSDAITTVCCESPSLGTLQPTSKTHDNPI
                     NVIPNFPRAFLPPLFIYSAFAIYKDVVFTDTRCVRSRTGLVIAQVVQIMLSVFSAATI
                     TSVFFPQFCFSALYSFSALPAIIIMGSIENTLTLINSVSGTRPEISPTSRVAIAAQQA
                     FPKTVKAKLITAFLLSLVIMANLDKVINSIFLFSTLSVLIDLALHVTYFTAVLSVDIR
                     RLELAEVLLNPLDDEEPIVKHDSGTSSIPFFRQYQQLKGFRLRTFLYLNYLNPRQRYP
                     IVMASIVVIHMWLSLAGPLKDTATLQISSHFLDRTILFMNDLLNVHNYTVNIGSDVVP
                     LVIYNPIVLSFDDNSNCFHFSPFLSTTSSIIGGYSLFILFEFVLSLAIILLAAALILK
                     LLLPKRDCAEEDRAGLHSDSENKFSSKDLAGYHTLDVIQIVVNKSWIATVSLDHGICV
                     WNVCDGKRSGSKQDCKFRTLPPRLWPVSRVLVGLNSMLVIISAHNHVIEAWDFKNNKI
                     LYSIKDDELFPANSLLLLSFIVADQVVIITRSGAFVTISRTGTKETICPDLTFGRDVE
                     LIAATLLVTPKINDKVVCLFSDNSIVVVTHVAGTQWSFRSLDLLESLTAVSERRRGSK
                     DTVFYRPYPAYPPIEIAEASSPSFLVASNMNRASIPCTRPMEMKEKAHSVVSVPAIHM
                     VLVVSELKASLFDVHTGVIVRHFQLGLYKPDTIRVFHAQPTHCRFCGCASIESISVAY
                     YDQEDKGLVICHTVQIENRAKNNICLRVERDPRETRCLGFEAATEQVHWIDRVEGWDT
                     TDINMMMGVRRKENPQSSGSPSPDSGRRSPATGTERRDLSMSATTSVLRRISNKLSQG
                     ASSTSSASYSTPQPPTHGQKKPPLNITWEGWAMTGKGKVSYYNIPDVPGKPGSYNIQN
                     LSRDDYIPQASSRLLIRTVGPAVKYGKKSIAVAFGNVIKIMYFGNEEFHDEIIYGNRL
                     VGIPSYESAPPSNTPSASRRWKREIAY"
     gene            <16767..>17999
                     /gene="YDJ1"
                     /locus_tag="AWJ20_3711"
                     /db_xref="GeneID:30035763"
     mRNA            <16767..>17999
                     /gene="YDJ1"
                     /locus_tag="AWJ20_3711"
                     /product="type I HSP40 co-chaperone YDJ1"
                     /transcript_id="XM_018880734.1"
                     /db_xref="GeneID:30035763"
     CDS             16767..17999
                     /gene="YDJ1"
                     /locus_tag="AWJ20_3711"
                     /inference="similar to AA sequence:KEGG_Orthology:K09503"
                     /note="Type I HSP40 co-chaperone; involved in regulation
                     of HSP90 and HSP70 functions; critical for determining
                     cell size at Start as a function of growth rate; involved
                     in protein translocation across membranes; member of the
                     DnaJ family; GO_component: GO:0072380 - TRC complex
                     [Evidence IDA] [PMID 20850366]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 1869583]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 8144572];
                     GO_component: GO:0048471 - perinuclear region of cytoplasm
                     [Evidence IEA]; GO_component: GO:0048471 - perinuclear
                     region of cytoplasm [Evidence IDA] [PMID 1869583];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0001671 - ATPase activator activity
                     [Evidence IDA] [PMID 1400408]; GO_function: GO:0001671 -
                     ATPase activator activity [Evidence IDA] [PMID 15342786];
                     GO_function: GO:0031072 - heat shock protein binding
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0051082 - unfolded
                     protein binding [Evidence IEA]; GO_function: GO:0051082 -
                     unfolded protein binding [Evidence IDA] [PMID 9774392];
                     GO_process: GO:0006458 - 'de novo' protein folding
                     [Evidence IMP] [PMID 10567418]; GO_process: GO:0030433 -
                     ER-associated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 15252059]; GO_process:
                     GO:0030433 - ER-associated ubiquitin-dependent protein
                     catabolic process [Evidence IGI,IMP] [PMID 15342786];
                     GO_process: GO:0006457 - protein folding [Evidence IEA];
                     GO_process: GO:0042026 - protein refolding [Evidence IDA]
                     [PMID 9674429]; GO_process: GO:0045047 - protein targeting
                     to ER [Evidence IMP] [PMID 1473150]; GO_process:
                     GO:0006626 - protein targeting to mitochondrion [Evidence
                     IMP] [PMID 1729605]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0009408 -
                     response to heat [Evidence IEA]; GO_process: GO:0006950 -
                     response to stress [Evidence IEA]; GO_process: GO:0006810
                     - transport [Evidence IEA]"
                     /codon_start=1
                     /product="type I HSP40 co-chaperone YDJ1"
                     /protein_id="XP_018733394.1"
                     /db_xref="GeneID:30035763"
                     /translation="MVKDTKLYDILGVSPDATDSQIKKAYRVNALKYHPDKNQHSPEA
                     ADKFKEVSSAYEVLSDEQKRQVYDTYGMEGLSGQGGPDMGNAEDLFSHFFGGMGGMGG
                     MGGMFGGGAPSGPRKSKDIMHAIRATLEDLYKGKVSKLALKKTVICKTCDGKGGKEGA
                     VKTCPGCKGQGMKFVTRQMGNVIQRFQTVCPDCNGEGQIIDPKDRCKTCLGKKTTEEK
                     KILQVHIDKGMANGQKIVFQGEGDQGPGIIPGDVIFVVNEQPHEKFERRGDDLLYKVK
                     IDLLTALAGGSFGIKHLDGEWLKVEIIPGEVIAPGSFKLIEGKGMPSYRHHNFGNMIV
                     EFEVEFPKDNFATPEQLAALETVLPPRAKLEIPADVHAEEVILADLDPSKYQSGGAME
                     EDDDDMHAGGERVQCASQ"
     gene            complement(<18485..>19930)
                     /gene="MSG5"
                     /locus_tag="AWJ20_3712"
                     /db_xref="GeneID:30035764"
     mRNA            complement(<18485..>19930)
                     /gene="MSG5"
                     /locus_tag="AWJ20_3712"
                     /product="tyrosine/serine/threonine protein phosphatase
                     MSG5"
                     /transcript_id="XM_018880735.1"
                     /db_xref="GeneID:30035764"
     CDS             complement(18485..19930)
                     /gene="MSG5"
                     /locus_tag="AWJ20_3712"
                     /inference="similar to AA sequence:KEGG_Orthology:K11240"
                     /codon_start=1
                     /product="tyrosine/serine/threonine protein phosphatase
                     MSG5"
                     /protein_id="XP_018733395.1"
                     /db_xref="GeneID:30035764"
                     /translation="MKSPHISPPISPNSFSNPKSHRSSTRNRNASSLSISIPISPQKI
                     PPLESATYRRSSGASSFPEYSSGCTGTSSTSTDTCSGAGSGAGSNITPNVVYLDSDSN
                     SIYRASSSSSSTTTTTTLHYQQFPQFSSGSSLPNIGSTEPQNSNSYYYYQQPLKTSTN
                     TNFEVMPAENPYPNGPVLVREPNIYLYSEPSIQTASQFDVIVNVAREVPNPFEQTSRL
                     SKEISSPMAPPPPAPFVKGARSSSSSSSSFTSNLSCSPLSSTSTHTEDTCFSPTGYPE
                     NSPPSSVNSTPNLNEELSSENDCEEETDEMTLRDLSSPITQSSTTAAFGLASSESLNG
                     RTTPEYIYVPWDHTSKLTPDLARLTDLISSRSAEGKKILVHCQCGVSRSASLVVAYVM
                     RQDKCDLNTAYDHVKKRSPNISPNMTLMFQLIDWARMLKRNPENPGVSTSLGPSLSSP
                     PSSYDDDLIPSASGYSLASPPPSTPTTAVNH"
     gene            complement(<23143..>23877)
                     /gene="MIC26"
                     /locus_tag="AWJ20_3713"
                     /db_xref="GeneID:30035765"
     mRNA            complement(<23143..>23877)
                     /gene="MIC26"
                     /locus_tag="AWJ20_3713"
                     /product="Mic26p"
                     /transcript_id="XM_018880736.1"
                     /db_xref="GeneID:30035765"
     CDS             complement(23143..23877)
                     /gene="MIC26"
                     /locus_tag="AWJ20_3713"
                     /inference="similar to AA sequence:KEGG_Orthology:K17786"
                     /note="Component of the MICOS complex; MICOS (formerly
                     MINOS or MitOS) is a mitochondrial inner membrane complex
                     that extends into the intermembrane space and has a role
                     in the maintenance of crista junctions, inner membrane
                     architecture, and formation of contact sites to the outer
                     membrane; Mic26p is a non-essential component of the
                     complex; GO_component: GO:0061617 - MICOS complex
                     [Evidence IDA] [PMID 21944719]; GO_component: GO:0061617 -
                     MICOS complex [Evidence IDA] [PMID 21987634];
                     GO_component: GO:0061617 - MICOS complex [Evidence IDA]
                     [PMID 22009199]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0044284 - mitochondrial crista junction [Evidence IDA]
                     [PMID 22009199]; GO_component: GO:0005743 - mitochondrial
                     inner membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0042407 -
                     cristae formation [Evidence IMP] [PMID 21987634];
                     GO_process: GO:0042407 - cristae formation [Evidence IMP]
                     [PMID 22009199]"
                     /codon_start=1
                     /product="Mic26p"
                     /protein_id="XP_018733396.1"
                     /db_xref="GeneID:30035765"
                     /translation="MKLLTGQKQLLTLLGAGIVSYSAIPVAMADSKKPIYDDEEKNEE
                     TVVVVQPEETQLINTEYVGNTPIKSSKFLEENIEVARKWVYEQSQTVQAKVDDSFQTY
                     LQAERSVTSTVSNLKDENEDILPGGIYILIGALSGSIFARRRGFVLRTVTPVIFGLGA
                     FSYFLPKTFNNTRALVWSFEQKSPAIADTHIQIQNQVESLAESAKSAAEQSQSSLESG
                     VHSVRQFVAESTGLQIGSSSSSNNKK"
     gene            complement(<24512..>26161)
                     /gene="FRE3"
                     /locus_tag="AWJ20_3714"
                     /db_xref="GeneID:30035766"
     mRNA            complement(<24512..>26161)
                     /gene="FRE3"
                     /locus_tag="AWJ20_3714"
                     /product="Fre3p"
                     /transcript_id="XM_018880737.1"
                     /db_xref="GeneID:30035766"
     CDS             complement(24512..26161)
                     /gene="FRE3"
                     /locus_tag="AWJ20_3714"
                     /note="Ferric reductase; reduces siderophore-bound iron
                     prior to uptake by transporters; expression induced by low
                     iron levels; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence ISS] [PMID 9726978]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 11120744]; GO_function: GO:0052851 - ferric-chelate
                     reductase (NADPH) activity [Evidence IEA]; GO_function:
                     GO:0000293 - ferric-chelate reductase activity [Evidence
                     IGI] [PMID 11120744]; GO_function: GO:0000293 -
                     ferric-chelate reductase activity [Evidence ISA] [PMID
                     9726978]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_process: GO:0006879 -
                     cellular iron ion homeostasis [Evidence IEP,IMP] [PMID
                     10341420]; GO_process: GO:0006879 - cellular iron ion
                     homeostasis [Evidence IEP,IMP] [PMID 9726978]; GO_process:
                     GO:0006811 - ion transport [Evidence IEA]; GO_process:
                     GO:0055072 - iron ion homeostasis [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0015891 - siderophore
                     transport [Evidence IMP] [PMID 9726978]"
                     /codon_start=1
                     /product="Fre3p"
                     /protein_id="XP_018733397.1"
                     /db_xref="GeneID:30035766"
                     /translation="MLAFWGIIILFKSIHNLFHRMGPYVLKYLDFPLSRRLRAEFFLP
                     PTGRYHHSTPKSLLGFTFNIPARIETIIISLFFIQNILLAFVGIETIENSVFYDSMSD
                     QYADSIGYRAGVICMAELVLLIVFAGRNNLLIYITGWEMNTFNVFHKWVARMTAMQAV
                     IHSIGYTIEYVQEDYYTEYFSGEPGTAWFIWGVVATILMCALITHSVHFFRSINYELF
                     LYGHITLTAVAIAGVWLHVIGMEGMNYTYAAIAIWAFDHVARIVRLLWSGVTSKASMK
                     LHGEHILEIKIDYSKRWKFYPGCHVYLHILRTNRFWQSHPFTVVTSPRPDDQGKLVIF
                     ARVKKGLTKHTANYLKDKPDQSAQVRVLVEGPYGGRHPLHHYETVVLIAGGVGITSIY
                     PYAAQLRENKDKAQRMVFIWVIRNEQPLSWFQDQLRHISEDPRIEVILFITGSNALVS
                     NEGSATSSTTNLDKSPLESEASSQTEKKSPLVSSSVFDIRAGTPDLRSRVAHDISEAA
                     GTVAFLVCGPNRMNDDVRMGIVDNIADSKHRVDYFEDSFSW"
     gene            <28670..>29821
                     /locus_tag="AWJ20_3715"
                     /db_xref="GeneID:30035767"
     mRNA            <28670..>29821
                     /locus_tag="AWJ20_3715"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880738.1"
                     /db_xref="GeneID:30035767"
     CDS             28670..29821
                     /locus_tag="AWJ20_3715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733398.1"
                     /db_xref="GeneID:30035767"
                     /translation="MSQLFSSSDSCGPVNPLQNLGKHTGPTNSSQHERFVRENSAGPS
                     SFRSTPSPSLVNGTNTDFQAFASRGSPSQSGFNFHPGQGQAASQVPGQLPGQLPVQLA
                     RNGAPLDQRNIGFQAPQTTSSDWASEFSKLSVGSRPSQDLRMATSPLSMTAASSSYQQ
                     YQPQQPMLRSDLMYYQTSASVSQQPEHHQIHKLNEEQASFENAFAEVERSLNSESISQ
                     QDTTIQKETEQVESLQKVNNTELSGVAQDIINSINESSQSTNSSTASKMKSSNFMALM
                     DQLSKKNVVLEGTKFVDGVSGAEISADQLARQEDTANYKEPSLPEHLQPQNMSKAPQI
                     PLQDPFSFINQLNIDPSKSTPFELAQLMSPGVALSDWEEKYEEDPDWTQ"
     gene            complement(<31853..>32113)
                     /locus_tag="AWJ20_3716"
                     /db_xref="GeneID:30035768"
     mRNA            complement(<31853..>32113)
                     /locus_tag="AWJ20_3716"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880739.1"
                     /db_xref="GeneID:30035768"
     CDS             complement(31853..32113)
                     /locus_tag="AWJ20_3716"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733399.1"
                     /db_xref="GeneID:30035768"
                     /translation="MTELARDMILKSQQIEVLIDSLPGIGISEQEQMARVRSLEEELK
                     QVNNEKADVLTEREELLKKCDELILEVAREKVNLEKSQSMHS"
     gene            complement(<40106..>41998)
                     /gene="POP2"
                     /locus_tag="AWJ20_3717"
                     /db_xref="GeneID:30035769"
     mRNA            complement(<40106..>41998)
                     /gene="POP2"
                     /locus_tag="AWJ20_3717"
                     /product="CCR4-NOT core DEDD family RNase subunit POP2"
                     /transcript_id="XM_018880740.1"
                     /db_xref="GeneID:30035769"
     CDS             complement(40106..41998)
                     /gene="POP2"
                     /locus_tag="AWJ20_3717"
                     /inference="similar to AA sequence:KEGG_Orthology:K12581"
                     /codon_start=1
                     /product="CCR4-NOT core DEDD family RNase subunit POP2"
                     /protein_id="XP_018733400.1"
                     /db_xref="GeneID:30035769"
                     /translation="MMRASGNYNNRSNGPNAGLMSLQMLQGQGGQIQGQPQNQLQQQQ
                     QHQQQGVMPLQQQQYINAGAGYKQMLPDQRDDHGDDQQQMLQAQAQAQAQAQAQAQAQ
                     AHAHAQQAHVHQAQAHAHAHAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
                     AQAQAQAQAQAQAQAQAQGQPNLMFQRMQARNQNINQMAAASLQAFGGVPNVGAGADI
                     GVGAGGLGNGLMSSSTGGGPLSNYNNTTDINAFNGSLPNLGLAGGMMNIANTGGAGGA
                     LGGPTGNLAAAGGLSAAAAGGSMKSSTIVNVWKWNLEDQMAAIRDLVERYKYISVDCK
                     FPGIVARPIGTFKSTSEYHYQTLRSNVDILQVIQIGLTFADEYGNHPVGVASTFQFNF
                     KFNVNEDMCSADGVELLRQSGIDFAKHETDGIDPFAFGELILTSGLTLDDTVSWITFH
                     SGYDLGYILSIMLNNEVPVEERGFLSTLRTYFPNVWDVKCITKTFKLSNKSQLSEVAD
                     DFQVRRLPMPQSSVNGGLSSLGGLSQAGNDAFVTSGCFFEIKRLIGDANINKVRNYLF
                     GLGDGFEDDPSQQSNNGTNNAAAAASAAILNAISGGATASASASHGVTNAANIFQFGK
                     MGGGAL"
     gene            <46241..>49117
                     /gene="SSK2"
                     /locus_tag="AWJ20_3718"
                     /db_xref="GeneID:30035770"
     mRNA            <46241..>49117
                     /gene="SSK2"
                     /locus_tag="AWJ20_3718"
                     /product="mitogen-activated protein kinase kinase kinase
                     SSK2"
                     /transcript_id="XM_018880741.1"
                     /db_xref="GeneID:30035770"
     CDS             46241..49117
                     /gene="SSK2"
                     /locus_tag="AWJ20_3718"
                     /inference="similar to AA sequence:KEGG_Orthology:K11230"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase
                     SSK2"
                     /protein_id="XP_018733401.1"
                     /db_xref="GeneID:30035770"
                     /translation="MSKEKKFATPPLKIDLSSARAAVPINQGFRSTTPTIHSPFLLSP
                     GSQSLPSSTSSSSTSLHALAGGSFLGTSHGANHGYNNNVNGTSTGNNTGSNTGNGNGT
                     GNGNSSIASIGHSNGISGPSSPGGVSHGSVGPGNSNGSTGLSRHRSIGSIPTTHRSRR
                     DSGKSLGASGSMHTGLTAPARVSPRQSPRSSPRSSPRPRDGTGKEEDGGSYFTLSRPG
                     TASSPVNIPGTSSSSNSKMSLSSQTSYSGSSFDFDGQVQRVNSSLRKYDAATAGSPTG
                     TQPINASSPSMQSNNNALLSPTVSPRPHSPIRALSNSYAPARGPSHQNVSSVKTKGKA
                     PQSPIQDDSLTSNKSNNSPKQQQQQQQQQSNSFHHRSTAHASGATTAAAAVTAAANSD
                     ESPIFAKRKDAHLSYLAQEPVYIHKMTNAAGDDYVKGLIGDNTNYEYLSDDDDTDSIT
                     EVQPEVIGFGGVGTSFDDEYTELGSSYPFLETTYNSNGPSTSSATNNEPAGSNSHKDR
                     DKATASIESDGSTPERWRERLEWQAMLASVLTGEVFRAEKRRIKQPKKSGNGIDEEEM
                     WLALRAKVSGRTMNEQKRVLEYSRSTVTDALERVQNFKIENPANITAEDALKQLNPVL
                     QLLYRCESLYRTLAVLKGENAIYGNADFQTKVDCLLSWKSITEAINQELELLRKWTGN
                     YDIDPSRVPEKSSPSEEGSRLSMIQEEKQTLVESILKQDNLSNIFDRRISNRLGPLIE
                     KAREATIKYSDMFLELGLPLFNNSLLHVMVFPITLIREIIQMRLTYARRLVNPTLMIV
                     DQMILDFQSIISHALVVMDRNLQYTSPILDKGWIFPTQIDESFNSTLLDSVNFYLDLL
                     NKKFLDGGRSSKSLFRAYKETEQLEQHYTFLLGVGRLVEGGDLAVAELITSLESKILT
                     RLLTYWEHQMKGPQSWAPTEIERWFTTTMEIIRSFQRKLLRFHK"
     gene            <49255..>51228
                     /gene="SSK2"
                     /locus_tag="AWJ20_3719"
                     /db_xref="GeneID:30035771"
     mRNA            <49255..>51228
                     /gene="SSK2"
                     /locus_tag="AWJ20_3719"
                     /product="mitogen-activated protein kinase kinase kinase
                     SSK2"
                     /transcript_id="XM_018880742.1"
                     /db_xref="GeneID:30035771"
     CDS             49255..51228
                     /gene="SSK2"
                     /locus_tag="AWJ20_3719"
                     /inference="similar to AA sequence:KEGG_Orthology:K11230"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase
                     SSK2"
                     /protein_id="XP_018733402.1"
                     /db_xref="GeneID:30035771"
                     /translation="MSLLRLSGHFLVYTGTFEKYGIYAIADPYLKDRPETVRAILSGY
                     SRIPKKDVEHVSYVMIFCIEEPLVWEGEIVNLDMPYFDIDMKPGRMRLITEGGSQELK
                     RTRKEVSALTGGGDVFDIAVDTKSHITRVDHEMARVRKLFFKLSTSVITSCILFRRRC
                     KPYGCQETVHNMFVFAREFGQRGISVMDANRRGTVAIKLINLCIEWVTFICDDCVPTE
                     NKTFRWTVVALEFAMVMTRGVNIVAISGDQFAKLRVKVADCMTLLISHFDITGAKSRA
                     AQQGNSDVLRRGKALNISVDDDDELVAMLREDMVKKLELLEQQRQDTHSVGKVLDDSS
                     GDTEFLTYLASAFSNLQIRWQQGRYIGGGTFGSVYAAVNLDTGGVMAVKEIRLQDTQS
                     IRHILKSIKDEMTVLEILSHPNVVQYYGVEVHRDRVFIFMEYCQGGSLAGLLEYGRIE
                     DEQVIQVYTLQMLEGLAYLHQSGIVHRDIKPENILLDHNGVIKFVDFGAAKVIAKTGK
                     TRQASATNKSNATTGGNKTKLNSMTGTPMYMSPEVITGADSGRHGSIDIWSLGCCVLE
                     MATGRRPWANLDNEWAIMYHIAAGHLPQLPSADQLSIEGQQFLMKTLERDPKKRPSAV
                     DLLSDPWMVSIRNVVLGYSAGSDDSAVSSPSEG"
     gene            <53001..>55439
                     /gene="GEF1"
                     /locus_tag="AWJ20_3720"
                     /db_xref="GeneID:30035773"
     mRNA            <53001..>55439
                     /gene="GEF1"
                     /locus_tag="AWJ20_3720"
                     /product="Gef1p"
                     /transcript_id="XM_018880744.1"
                     /db_xref="GeneID:30035773"
     CDS             53001..55439
                     /gene="GEF1"
                     /locus_tag="AWJ20_3720"
                     /inference="similar to AA sequence:KEGG_Orthology:K05012"
                     /note="Voltage-gated chloride channel; localized to the
                     golgi, the endosomal system, and plasma membrane; involved
                     in cation homeostasis; highly homologous to vertebrate
                     voltage-gated chloride channels; modulates TBSV model (+)
                     RNA virus replication by regulating copper metabolism;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IDA]
                     [PMID 15710404]; GO_component: GO:0005797 - Golgi medial
                     cisterna [Evidence IDA] [PMID 9614122]; GO_component:
                     GO:0000139 - Golgi membrane [Evidence IEA]; GO_component:
                     GO:0034707 - chloride channel complex [Evidence IEA];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 17662057]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0005768 - endosome [Evidence IEA];
                     GO_component: GO:0005768 - endosome [Evidence IDA] [PMID
                     15710404]; GO_component: GO:0010008 - endosome membrane
                     [Evidence IEA]; GO_component: GO:0000324 - fungal-type
                     vacuole [Evidence IDA] [PMID 17662057]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 17662057]; GO_component: GO:0005774 - vacuolar
                     membrane [Evidence IEA]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA]; GO_function: GO:0030554 - adenyl
                     nucleotide binding [Evidence IEA]; GO_function: GO:0005254
                     - chloride channel activity [Evidence IEA]; GO_function:
                     GO:0005216 - ion channel activity [Evidence IEA];
                     GO_function: GO:0005247 - voltage-gated chloride channel
                     activity [Evidence IEA]; GO_function: GO:0005247 -
                     voltage-gated chloride channel activity [Evidence IDA]
                     [PMID 12074596]; GO_process: GO:0006878 - cellular copper
                     ion homeostasis [Evidence IMP] [PMID 9520490]; GO_process:
                     GO:0006878 - cellular copper ion homeostasis [Evidence
                     IMP] [PMID 9614122]; GO_process: GO:0006879 - cellular
                     iron ion homeostasis [Evidence IMP] [PMID 9520490];
                     GO_process: GO:1902476 - chloride transmembrane transport
                     [Evidence IEA]; GO_process: GO:0006821 - chloride
                     transport [Evidence IEA,IEA]; GO_process: GO:0034220 - ion
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006811 - ion transport [Evidence IEA]; GO_process:
                     GO:0044070 - regulation of anion transport [Evidence IEA];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Gef1p"
                     /protein_id="XP_018733403.1"
                     /db_xref="GeneID:30035773"
                     /translation="MSSDSRVHLESLPSGTSVANDSIPDSLVTEIRRYEDFSTIDWVE
                     AASRENTLRIRTYKNAYGKSINSRRPSGPIDPVSENAEDSNAFGFDVLKGTGARYGLL
                     VRQMYSAAQSWLVLALVGACIGLIAGFLSIVTELLSDFKTGYCTAGLYLNENFCCSGY
                     DESDICPEWHRWSSFSGINYVIYIVFSTFFAFLAAFFVYSFAPYAAGSGISEIKCIIA
                     GFIMNGFLDAKTLFIKSVTLPLTIASGLSVGKEGPSVHYAVCVGNTVAGLFPKYRVYK
                     TKMREVLSSCAAAGVAVAFGSPMGGVLFSLEEMTSSFQLKSMWRSYFCALVATATLAS
                     VNPFRTGQLVLFSVKYDHDWHFFEIIFFILIGLFGGFGGLFIIKWNLRVQAFRKKYLG
                     NYAIQEATLLAFITAVICYFNEFLRIDMTESMQILFHECDHGFEDNVTCQPSHRMYLA
                     TTLIFGMVIRTILTIISYGSKVPAGIFVPSLAIGALFGRFVGTVVWWLHDTFPDATFF
                     SSCPPDAPCITPGTYALLGSAALLSGVMNITVTVVVIIFEVTGALRYILPTMIVVGVT
                     KAVGDYFGPGGGGIADRTIVANGYPFLEDDGDDEHNHYANDPIELAMTKDPIQIPSKK
                     FTISHIQSLLDGSSHQSYPVVDIDDEDASITSSIPTKSSTTATTINQTTNYTNNYLIG
                     YIWRSELEYIVAHNRDTPDRYVSFDSLESSEDSLNFSRLVNFSPVVVQNNTPLSKVIA
                     LFSKVGPRIVYVERNKSGTLCGLLTRKDILKYQHKSDYAMAPPDRSAAEEMDRKIWEL
                     LSQAISKVQELVRR"
     gene            complement(<56054..>57070)
                     /locus_tag="AWJ20_3721"
                     /db_xref="GeneID:30035774"
     mRNA            complement(<56054..>57070)
                     /locus_tag="AWJ20_3721"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880745.1"
                     /db_xref="GeneID:30035774"
     CDS             complement(56054..57070)
                     /locus_tag="AWJ20_3721"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733404.1"
                     /db_xref="GeneID:30035774"
                     /translation="MADTEEYSSRRSASPDRYDRQRSLSPRRDSAQDGSNEAGLPDDR
                     ERNGDSGAANDSSNGNDAATSGSASGPVDDDEAAKNEGTNLFVSGLARQVTEAKLEEL
                     FSKYGTVVKCQIMVDPHTRDSRGFGFVDMADVEGADAAIAGINGQDLLDRVVSVEKAK
                     RKRPRTPTPGKYFGPPKTRGAGSFRRGGYGGPSRYGGGDYRGGYRPRYDDRDRYGGPP
                     PPGGYDRYDRYDRYDRYDRYDRYDDRFRGPPPPRGPPGPSRYDDRDGYRDREYSSRYD
                     EGPRDRYAPPHRRGDNYRDRERRGPPPSGGPGGDSRDYDRPSYRDEPRGAGYSPERED
                     YRRD"
     gene            <58198..>59196
                     /gene="WHI2"
                     /locus_tag="AWJ20_3722"
                     /db_xref="GeneID:30035775"
     mRNA            <58198..>59196
                     /gene="WHI2"
                     /locus_tag="AWJ20_3722"
                     /product="Whi2p"
                     /transcript_id="XM_018880746.1"
                     /db_xref="GeneID:30035775"
     CDS             58198..59196
                     /gene="WHI2"
                     /locus_tag="AWJ20_3722"
                     /note="Protein required for full activation of the general
                     stress response; required with binding partner Psr1p,
                     possibly through Msn2p dephosphorylation; regulates growth
                     during the diauxic shift; negative regulator of G1 cyclin
                     expression; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0019211 - phosphatase
                     activator activity [Evidence IMP] [PMID 12090248];
                     GO_process: GO:0007015 - actin filament organization
                     [Evidence IMP] [PMID 15020461]; GO_process: GO:0007049 -
                     cell cycle [Evidence IEA]; GO_process: GO:0006897 -
                     endocytosis [Evidence IMP] [PMID 15020461]; GO_process:
                     GO:0000422 - mitochondrion degradation [Evidence IMP]
                     [PMID 21429936]; GO_process: GO:0040008 - regulation of
                     growth [Evidence IMP] [PMID 2204680]; GO_process:
                     GO:0009408 - response to heat [Evidence IMP] [PMID
                     12090248]; GO_process: GO:0009651 - response to salt
                     stress [Evidence IMP] [PMID 12090248]"
                     /codon_start=1
                     /product="Whi2p"
                     /protein_id="XP_018733405.1"
                     /db_xref="GeneID:30035775"
                     /translation="MSIQPSSVITQVSATVPSAALHPFVSYDEQEKSENIQLNLRGVI
                     FNISREELLRLPESILIGITNGALYDQNTIGGASLADANAATANTLSPECFKYTLDVF
                     RSAAKGLPRTLLSIEGSEEQGFDDAILGVDEDTEGKSANSGVAMDADGNPKTETVSDI
                     SEILRRRPAIIVLREDLDYYCLPNGPNVDAEGMRQIKHSCGEAILNQRRIFGGLRKGE
                     SENSPEHHLIAMLCSSGFQIDDDWGFRAREPHKTVVSSLALIRLKMVDEQHHEQSPET
                     QQELSTPQKLLLFWRKPARKCWWDSIELNDVPGVDGPVRVHIRRVWTLELSVIGVR"
     gene            complement(<59408..>60247)
                     /gene="COQ3"
                     /locus_tag="AWJ20_3723"
                     /db_xref="GeneID:30035776"
     mRNA            complement(<59408..>60247)
                     /gene="COQ3"
                     /locus_tag="AWJ20_3723"
                     /product="hexaprenyldihydroxybenzoate methyltransferase"
                     /transcript_id="XM_018880747.1"
                     /db_xref="GeneID:30035776"
     CDS             complement(59408..60247)
                     /gene="COQ3"
                     /locus_tag="AWJ20_3723"
                     /note="O-methyltransferase; catalyzes two different
                     O-methylation steps in ubiquinone (Coenzyme Q)
                     biosynthesis; component of a mitochondrial
                     ubiquinone-synthesizing complex; phosphoprotein;
                     GO_component: GO:0019898 - extrinsic component of membrane
                     [Evidence IDA] [PMID 10419476]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IDA] [PMID 10419476]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 10760477];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0008425 -
                     2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase
                     activity [Evidence IEA]; GO_function: GO:0061543 -
                     3-demethylubiquinone-6 3-O-methyltransferase activity
                     [Evidence IMP] [PMID 10419476]; GO_function: GO:0008689 -
                     3-demethylubiquinone-9 3-O-methyltransferase activity
                     [Evidence IEA]; GO_function: GO:0004395 -
                     hexaprenyldihydroxybenzoate methyltransferase activity
                     [Evidence IEA]; GO_function: GO:0004395 -
                     hexaprenyldihydroxybenzoate methyltransferase activity
                     [Evidence IMP] [PMID 1885593]; GO_function: GO:0008168 -
                     methyltransferase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0032259 - methylation [Evidence IEA];
                     GO_process: GO:0006744 - ubiquinone biosynthetic process
                     [Evidence IEA,IEA,IEA]; GO_process: GO:0006744 -
                     ubiquinone biosynthetic process [Evidence IDA] [PMID
                     10419476]; GO_process: GO:0006744 - ubiquinone
                     biosynthetic process [Evidence IMP] [PMID 1885593]"
                     /codon_start=1
                     /product="hexaprenyldihydroxybenzoate methyltransferase"
                     /protein_id="XP_018733406.1"
                     /db_xref="GeneID:30035776"
                     /translation="MSHHEKVIAANLSSFKDKAAEYDNENTQLISRVVATKVLQFRFD
                     NAPDTEETEFASNDFDFNDLDIPNVADELWDPESTRVLDFACGTGLVSQSLAPYCKEI
                     VGVDISPDMVGIFNQKIENQGIPESEMRALVLDLLATDDDSLGQFDAVVTSLSYHHIH
                     DTDKCTKRLAGKLAPNGRLYVIDIEKGSGGSVHGRMTDEEALKEGVAHRGGLEADELV
                     QTFKNAGLDQVKVTRAFRVKLWVPEDKVKSFSGITGETKVVNGKTLHCSKVNLMLVTG
                     RRK"
     gene            complement(<61623..>61943)
                     /locus_tag="AWJ20_3724"
                     /db_xref="GeneID:30035777"
     mRNA            complement(<61623..>61943)
                     /locus_tag="AWJ20_3724"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880748.1"
                     /db_xref="GeneID:30035777"
     CDS             complement(61623..61943)
                     /locus_tag="AWJ20_3724"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733407.1"
                     /db_xref="GeneID:30035777"
                     /translation="MSGSRGEANFVFRCKMCKRESSATIKLTGKTYGPDNSGKPVKVA
                     EVDNRGLEFVEFIADGVFKCQGEESGYKFPEVNLDDGEWFDYDEKAGEEVSITEVKWE
                     FVKA"
     gene            complement(<62521..>65175)
                     /gene="PMT1"
                     /locus_tag="AWJ20_3725"
                     /db_xref="GeneID:30035778"
     mRNA            complement(<62521..>65175)
                     /gene="PMT1"
                     /locus_tag="AWJ20_3725"
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase PMT1"
                     /transcript_id="XM_018880749.1"
                     /db_xref="GeneID:30035778"
     CDS             complement(62521..65175)
                     /gene="PMT1"
                     /locus_tag="AWJ20_3725"
                     /inference="similar to AA sequence:KEGG_Orthology:K00728"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose-protein
                     mannosyltransferase PMT1"
                     /protein_id="XP_018733408.1"
                     /db_xref="GeneID:30035778"
                     /translation="MDVHPPLAKMLYAVVGWFAGYDGEFEFSDIGVEYTTSENYVPYI
                     AMRTFPAVLGVLTIMLSYSTLRASGVKPLIALFGSALMTFDNALATQSRYILLDSPLV
                     FFIAITAYGFKKFENEVPFTKDWYRYLFLTGLGLGATVSSKWVGLFTIGWVGALTLYQ
                     LWWLLGDLNVSYKKFLAHFGARVVFLIIVPIVFYVGMFALHFICLSNTGDGASFMSPE
                     FQSTLQHTNLAHDIPADVAFGSEIALRHWNTQGGYLHSHDHMYATGSKQQQVTLYPHK
                     DHNNAWVLENATALEEYETDAHGNITATNYLKPPVFIKDGAIVKLRHKSTFRRLHSHD
                     VRPPVSEQEHHNEVSAYGYEGFDGDANDNFRVEILEKYSEPGVARERVRTLQTKFRLV
                     HTMTGCHLFSHAVKLPKWAFEQQEVTCIKGGTLPNTIWYVEDNVNAELGPDAELVSYR
                     KPSFFEKFIELNKVMWKVNAGLTDTHAWQSRPESWPLMQRGINFWVKDYRQVYLIGNG
                     VTWWTLSLLVVLYVSYKAFWVLSWQRNVIQFYNDPDYALYDSNVGSYLLGWAFHYFPS
                     FLMDRQLFLHHYLGSVFFGILALAQAWQFLTTRLIRNKLVGHALTVIFFSGALAWYIW
                     YSPLIYGLPWTKDLCNQSKFFDMDFSCDSFHGTYAEYDIITRKRSVHYNEKSSSSSPE
                     VAESVAAPEEAAAQNVEPVAQPNESSGIIEQPEYKEYDYDVENPSPVENPIPSETAED
                     EDNLRESSNDGEGVSEFEAAKSEAPSEFETTPAPVIKESPVSFTRTLKKITYRDEDGN
                     PIDRAAAEKLIEKYKKGAVSPAPAAPAAGSPAPEPESSEPAAEPAAEPVPEPVPEPEP
                     VEPAVEEAVVPEDVPDNVPEEETGAAEV"
     gene            <70237..>71922
                     /gene="HOL1"
                     /locus_tag="AWJ20_3726"
                     /db_xref="GeneID:30035779"
     mRNA            <70237..>71922
                     /gene="HOL1"
                     /locus_tag="AWJ20_3726"
                     /product="Hol1p"
                     /transcript_id="XM_018880750.1"
                     /db_xref="GeneID:30035779"
     CDS             70237..71922
                     /gene="HOL1"
                     /locus_tag="AWJ20_3726"
                     /note="Putative transporter in the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; mutations in membrane-spanning domains permit
                     cation and histidinol uptake; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005886 - plasma
                     membrane [Evidence ISS] [PMID 8955402]; GO_function:
                     GO:0015665 - alcohol transmembrane transporter activity
                     [Evidence IMP] [PMID 2405251]; GO_function: GO:0022890 -
                     inorganic cation transmembrane transporter activity
                     [Evidence IMP] [PMID 8955402]; GO_process: GO:0006812 -
                     cation transport [Evidence IMP] [PMID 8955402];
                     GO_process: GO:0015850 - organic hydroxy compound
                     transport [Evidence IMP] [PMID 2405251]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Hol1p"
                     /protein_id="XP_018733409.1"
                     /db_xref="GeneID:30035779"
                     /translation="MGLLYFPRNDTHLDDGTEIPGTVKLVDVDHNLDVQHQGEKDVIL
                     VPQPTNSPDDPLNWTPFRKIITLIWPCYYTFMVAVLAAVPAISYPEMVTDLGIPLGNL
                     VSGTGYLFLFFGLGCLFWQPIALNFGRRPVYIYTLLIGGIACPLWLNHVSSSGEYYAN
                     RIICGFFLSSVESLGEVVVGDLYFTHQRGMGINIYMMSLLSGTFLGPLAGSFITGSMT
                     WKWLNNFLAIFCGMGVILSYIFMEETMFFRPAAAEDILSRAGVVHHAEEQEADMSTTS
                     SSNGNEKNVASTVQLNSGAGSIEELAPPARKTYFQRYPILFYRSPGQPNLFFQSVIRP
                     LQIFVYFLPVAWSGLVVSLALAWWSVAGGTIAAILAEPPYNFGSSALGLVYISPLVSS
                     IICGYIGGPLSDRFCLWMARHNNGVREPEFRFYIGILALILTPAGLWMYGIGAAHQAP
                     WPVIVIGYGFSTVGSTLGQSLPYTYIMDCYPRIGGDSMVTVILVRNIIGGFAFAYAIT
                     PWIATDGYQTTFIILGLLSIFFWLTCIPIIIFGKSLRRKTAQRYHQYAQTSSH"
     gene            <75187..>76836
                     /gene="MNN10"
                     /locus_tag="AWJ20_3727"
                     /db_xref="GeneID:30035780"
     mRNA            <75187..>76836
                     /gene="MNN10"
                     /locus_tag="AWJ20_3727"
                     /product="Mnn10p"
                     /transcript_id="XM_018880751.1"
                     /db_xref="GeneID:30035780"
     CDS             75187..76836
                     /gene="MNN10"
                     /locus_tag="AWJ20_3727"
                     /inference="similar to AA sequence:KEGG_Orthology:K05531"
                     /note="Subunit of a Golgi mannosyltransferase complex;
                     complex mediates elongation of the polysaccharide mannan
                     backbone; membrane protein of the mannosyltransferase
                     family; other members of the complex are Anp1p, Mnn9p,
                     Mnn11p, and Hoc1p; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence IEA,IEA]; GO_component: GO:0000136 -
                     alpha-1,6-mannosyltransferase complex [Evidence IDA] [PMID
                     10037752]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0000009 -
                     alpha-1,6-mannosyltransferase activity [Evidence IDA]
                     [PMID 10037752]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016757 -
                     transferase activity, transferring glycosyl groups
                     [Evidence IEA]; GO_function: GO:0016758 - transferase
                     activity, transferring hexosyl groups [Evidence IEA];
                     GO_process: GO:0000917 - barrier septum assembly [Evidence
                     IMP] [PMID 16034811]; GO_process: GO:0000032 - cell wall
                     mannoprotein biosynthetic process [Evidence IMP] [PMID
                     10037752]; GO_process: GO:0006487 - protein N-linked
                     glycosylation [Evidence IMP] [PMID 23210626]; GO_process:
                     GO:0006487 - protein N-linked glycosylation [Evidence IMP]
                     [PMID 8991513]"
                     /codon_start=1
                     /product="Mnn10p"
                     /protein_id="XP_018733410.1"
                     /db_xref="GeneID:30035780"
                     /translation="MRLPQAAFLACASFAILATIWYMATFSTVDATKWKLPSSVGNSK
                     PNKVKIQKTATAPVDPILLPPKTKTLAKVPIPTTTTEVLTDTEMQIERLQEALRSKDK
                     KIADSVQQLKDKDRLYNEEQEKKDKEVAAKLDALKKAQASLNDQKEKVQKEKEEERKK
                     KEEEERKKKELEEEKKKKEEEEKKKEEEDRKSLTDAYYIIRDRMLLEEHKLLEPIEIP
                     DEERHNHYDKDNKLMPNGKKILLLSAFDGAGSTDNDLTDLFMSNREEYANYHGYTHLF
                     VNTTKYKKNDKLKRPAVWFKLPAIKEAFEKFPEVEWIWWVDTDIIIMNEEIDLAAHVL
                     NPYVLSNRLTYERPVNDLGDHFSGSLYPARDHVDVDNIDIIFTQDHLGINAGSFFIKR
                     SWFAEFVLDMWGDKFLIESKFPREEQDAFIYLFTNHKTVFHHTGLVPQRMMNAYHGYY
                     LHTANWQEGDLCIHFAGHNKGLGFEKNFAHYWGLRKRVPKEFQINVPEEEAKLKVIAD
                     KAQKEKEEQERQKKEKEEQEKKEKEEKEKQEKEEKEKNGKQ"
     gene            <78829..>81855
                     /gene="FPK1"
                     /locus_tag="AWJ20_3728"
                     /db_xref="GeneID:30035781"
     mRNA            <78829..>81855
                     /gene="FPK1"
                     /locus_tag="AWJ20_3728"
                     /product="serine/threonine protein kinase FPK1"
                     /transcript_id="XM_018880752.1"
                     /db_xref="GeneID:30035781"
     CDS             78829..81855
                     /gene="FPK1"
                     /locus_tag="AWJ20_3728"
                     /inference="similar to AA sequence:KEGG_Orthology:K08286"
                     /codon_start=1
                     /product="serine/threonine protein kinase FPK1"
                     /protein_id="XP_018733411.1"
                     /db_xref="GeneID:30035781"
                     /translation="MHRNRSRAMTVPSRPMNGSSPSIVGSINPGGDFESGLNGNGNSN
                     GFRVVSAGSSSSSSNLPQKLKNLFRLSSFSNSNSVGGESSGSGAGHLTTGTHHTGSGT
                     ELSSGNPNTTDSSPAIGSENTPELSLAHTGDDADASDSPDTPNPVANDSTNWGFKSSP
                     GPSDILAKPPKRSFLGRLRSPSSPSPMLLTPDPEEGQESSPPPLPKGLSVSAQASPSL
                     RPVNAPSDTVASANPYFSYQGQPAHAQQREEQQQHLHQGHGQAQKAQLQHSQQHYSSN
                     QHQNDHQHPNQNLHQQHQQQSQPTQNTSRPQNRRNNSHSLFSFSSFLGDHSNSNHNHG
                     RNTNTNKELASSTNDENNGASDLKSDSTVSAGSDGGYIVNGANHSTTNASTPLAENDI
                     TIVALPAEDHEEPLAPPSKGIFSRNLRRVASAPNEIKNMLLNSPQVRPADGPSGTIPS
                     GGINGTGNQASSNTNTSDNATAIGADNSRPDQGTGISSHSISTSNNGLKANKSSSTGL
                     TTTTFSKARSPSTPKVYNRSYSRSSIKICDVEVTPSSFDKIKLLGKGDVGKVYLVREK
                     KTNHLYAMKVLSKREMIKRNKIKRALAEQEILATSNHPFIVTLYHSFQSDEHLYLCME
                     YCMGGEFFRALQTREGKSLKEDDARFYAAEVTAALEYLHLMGYIYRDLKPENILLHQS
                     GHIMLSDFDLSKQSGSEAAPTIVNGSGRSGGGSSSNLPAIDTKACIADFRTNSFVGTE
                     EYIAPEVIRGNGHTSAVDWWTLGILLFEMLFGTTPFKGKNRNATFANILKSDVNFYDV
                     QPVSSNCKSIIRKLLIKDENKRLGSRAGASDIKGHPFFKTTQWALLRNRVPPIIPVQG
                     KGRDAVNFRKMKESGSVDFDEETPYDANANSTHSSAGDPSEPSNFAPDPFSNFNSITL
                     HHDGGDADGNAYYDDSDAEEEETTTAAPSGRQSPLANPSSTHTSVPGSPKVYNGFGSD
                     METDISTHHSVFSGAGSSSPSLFKPYFKGFTTSLKN"
     gene            complement(<81989..>83152)
                     /gene="FEX2"
                     /locus_tag="AWJ20_3729"
                     /db_xref="GeneID:30035782"
     mRNA            complement(<81989..>83152)
                     /gene="FEX2"
                     /locus_tag="AWJ20_3729"
                     /product="Fex2p"
                     /transcript_id="XM_018880753.1"
                     /db_xref="GeneID:30035782"
     CDS             complement(81989..83152)
                     /gene="FEX2"
                     /locus_tag="AWJ20_3729"
                     /note="Protein involved in fluoride export; nearly
                     identical to FEX1, and deletion of both proteins results
                     in a large increase in fluoride sensitivity compared with
                     the single mutant; contains two FEX domains connected by a
                     linker; part of a widespread family of conserved fluoride
                     export proteins; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Fex2p"
                     /protein_id="XP_018733412.1"
                     /db_xref="GeneID:30035782"
                     /translation="MDEVAESSDPSTGSSVRGHVEPKGEEQYRRFRRHVFVTVISNKY
                     IDVVVLHLLLAFFGITGVLARVGLTRLTSFPGSQNGGVLWSNFGGCLLMGILVRSEAL
                     FGDLIVIEQMAPLDVVEHGASGNVLRRTYTRKEKIPLYIGLATGVCGSITSFSTFMIE
                     LFQLSALQPPTGVSYPNPGYGVMAFLSYLIITLTVSFGGYFCGFHVADGIEKFFPISL
                     ATYTLIIEVLGAMLGLTAWVAVIVLAILIPQWRYWTFACIFGPFGVYARFWSARLFNK
                     ITHKFLVGTFIANMIATAILCALIILQRGQTPSHGLIIKSKLQCQAISALQDGFCGNF
                     STISSFIAELVAFRSKRNAYIYGGISIGGGFSIVVVILGSYAWTRGISAVAAC"
     gene            <84401..>84823
                     /gene="GCN3"
                     /locus_tag="AWJ20_3730"
                     /db_xref="GeneID:30035784"
     mRNA            <84401..>84823
                     /gene="GCN3"
                     /locus_tag="AWJ20_3730"
                     /product="translation initiation factor eIF2B subunit
                     alpha"
                     /transcript_id="XM_018880755.1"
                     /db_xref="GeneID:30035784"
     CDS             84401..84823
                     /gene="GCN3"
                     /locus_tag="AWJ20_3730"
                     /inference="similar to AA sequence:KEGG_Orthology:K03239"
                     /note="Alpha subunit of translation initiation factor
                     eIF2B; guanine-nucleotide exchange factor for eIF2;
                     activity subsequently regulated by phosphorylated eIF2;
                     positive regulator of GCN4 expression; assembles into
                     filaments with Gcd2p, Gcd6p, Gcd7p, and Sui2p as cells
                     approach stationary phase and under cytosolic
                     acidification and starvation conditions; GO_component:
                     GO:0005851 - eukaryotic translation initiation factor 2B
                     complex [Evidence IMP] [PMID 8099443]; GO_component:
                     GO:0005851 - eukaryotic translation initiation factor 2B
                     complex [Evidence IDA] [PMID 8336705]; GO_component:
                     GO:0005851 - eukaryotic translation initiation factor 2B
                     complex [Evidence IDA,IPI] [PMID 8506384]; GO_component:
                     GO:0032045 - guanyl-nucleotide exchange factor complex
                     [Evidence IDA] [PMID 8506384]; GO_function: GO:0030234 -
                     enzyme regulator activity [Evidence IMP] [PMID 8099443];
                     GO_function: GO:0030234 - enzyme regulator activity
                     [Evidence IGI,IMP,IPI] [PMID 8887689]; GO_function:
                     GO:0030234 - enzyme regulator activity [Evidence IMP]
                     [PMID 9032257]; GO_function: GO:0005085 -
                     guanyl-nucleotide exchange factor activity [Evidence IDA]
                     [PMID 8506384]; GO_function: GO:0003743 - translation
                     initiation factor activity [Evidence IEA]; GO_function:
                     GO:0003743 - translation initiation factor activity
                     [Evidence IMP] [PMID 8099443]; GO_function: GO:0003743 -
                     translation initiation factor activity [Evidence IDA]
                     [PMID 8336705]; GO_process: GO:0044237 - cellular
                     metabolic process [Evidence IEA]; GO_process: GO:0006417 -
                     regulation of translation [Evidence IEA]; GO_process:
                     GO:0006446 - regulation of translational initiation
                     [Evidence IMP] [PMID 8099443]; GO_process: GO:0006446 -
                     regulation of translational initiation [Evidence IDA]
                     [PMID 8506384]; GO_process: GO:0006446 - regulation of
                     translational initiation [Evidence IGI,IPI] [PMID
                     8887689]; GO_process: GO:0006446 - regulation of
                     translational initiation [Evidence IMP] [PMID 9032257];
                     GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0006413 - translational initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="translation initiation factor eIF2B subunit
                     alpha"
                     /protein_id="XP_018733413.1"
                     /db_xref="GeneID:30035784"
                     /translation="MARILRENGIPVCQIPDSAVGYVIDKVDKIFFGAEGVAESGGVI
                     NQMGSYQIAVLAKTTNTPVYVLAESHKFVRLYPLSPDDLPTEYPLEFTTKVDGERDIS
                     ESPQVDFTPHQYVTALITDLGTLTPSGVSEELIKIWFD"
     gene            complement(<85030..>85836)
                     /gene="RPC37"
                     /locus_tag="AWJ20_3731"
                     /db_xref="GeneID:30035785"
     mRNA            complement(<85030..>85836)
                     /gene="RPC37"
                     /locus_tag="AWJ20_3731"
                     /product="Rpc37p"
                     /transcript_id="XM_018880756.1"
                     /db_xref="GeneID:30035785"
     CDS             complement(85030..85836)
                     /gene="RPC37"
                     /locus_tag="AWJ20_3731"
                     /inference="similar to AA sequence:KEGG_Orthology:K14721"
                     /note="RNA polymerase III subunit C37; GO_component:
                     GO:0005666 - DNA-directed RNA polymerase III complex
                     [Evidence IDA] [PMID 10611227]; GO_component: GO:0005666 -
                     DNA-directed RNA polymerase III complex [Evidence IDA]
                     [PMID 3905793]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0003899 -
                     DNA-directed RNA polymerase activity [Evidence IEA,IEA];
                     GO_function: GO:0001056 - RNA polymerase III activity
                     [Evidence IDA] [PMID 3905793]; GO_process: GO:0042797 -
                     tRNA transcription from RNA polymerase III promoter
                     [Evidence IDA] [PMID 3905793]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Rpc37p"
                     /protein_id="XP_018733414.1"
                     /db_xref="GeneID:30035785"
                     /translation="MAAEDEETGLFMDDNESDDMAAVAESDVDMKDEEDPVSEAKQDA
                     GLDDEDDPVVREFPVYSSQVLGKKLHILQYPTRSALRPLVAAQGTGIINSRLKPKSGI
                     IEVDIPIDTSKFYDAEKGDRWNKVDRQTFSGVLKKGQGRYMAGVFRDGELHVSSIESV
                     AQLRPQFKYFDKHVNSEKEANRMIRTDPTKPREARTIQMSAKSSGDFAPKYSGALGAR
                     KIADEESFVDIQWFDRDSNESWDMADKFVTTNKRILDSSTTLKDYTDKLQ"
     gene            <86579..>88897
                     /gene="DBP7"
                     /locus_tag="AWJ20_3732"
                     /db_xref="GeneID:30035786"
     mRNA            <86579..>88897
                     /gene="DBP7"
                     /locus_tag="AWJ20_3732"
                     /product="Dbp7p"
                     /transcript_id="XM_018880757.1"
                     /db_xref="GeneID:30035786"
     CDS             86579..88897
                     /gene="DBP7"
                     /locus_tag="AWJ20_3732"
                     /inference="similar to AA sequence:KEGG_Orthology:K14806"
                     /note="Putative ATP-dependent RNA helicase of the DEAD-box
                     family; involved in ribosomal biogenesis; required at
                     post-transcriptional step for efficient
                     retrotransposition; essential for growth under anaerobic
                     conditions; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 9582098]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004004 -
                     ATP-dependent RNA helicase activity [Evidence ISS] [PMID
                     10322435]; GO_function: GO:0008026 - ATP-dependent
                     helicase activity [Evidence IEA]; GO_function: GO:0003723
                     - RNA binding [Evidence IEA]; GO_function: GO:0004386 -
                     helicase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0006200 - ATP catabolic
                     process [Evidence IEA]; GO_process: GO:0000463 -
                     maturation of LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     9582098]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Dbp7p"
                     /protein_id="XP_018733415.1"
                     /db_xref="GeneID:30035786"
                     /translation="MSDDGMLLNFSTEPSTSAVRKPVGSKVQGGRWKDRLNAKRAQVK
                     QYEKENPEVRVARVAKERAIKEKAEIVRQKRTAGRNGGKKPPGTGTSEASGSGAGAGA
                     GSGSGSNGSSRARMTNFKKPTAAQQKQHPGVNLNPEDKNTFVSSLFSSNPSLAENDAE
                     DKPVESHEASNAPLKDDTTFEGLGVNSALTLQLSTKMKIPTPTRIQRAALPPLISSNR
                     DLFIQAQTGSGKTLAYALPIIHRLMSTPDLTRESGLFALILTPTRELSTQIYSVLEKL
                     VGACHWLVPGIVIGGEKKKSEKARIRKGINILVATPGRLCDHFDNTESLDLSQIRWVV
                     LDEGDRLMELGFEEAITKILTKIGKTSMIHDTAKRWPQLPNKRVNILCSATMRDDVKR
                     LGELSLSHAEWVTPDSVGEDSKKHLRSDANDNHEHIAPAQLIQQSAIVPAKLRLVTLA
                     GLLKAITSAEKGSRTIVFFSCSDSVDFHFKAFTKGGTNRLKQRTSNNHDSDDEDDTSS
                     ATQPTVMTSVDLDNTVIHKLHGSLNQQLRTSTLSSFSAKDGAANGESYILFCTDVASR
                     GLDLPHITQVIEYDPPFGMDDHLHRVGRTARAGKEGTSILFLLPGAEEKYLDVIKPNH
                     PNGIHPRSYEDILKKGFGSKWDVDATTWHLNIERWLLEDASALQLAKRGYTSHIRAYT
                     THLSSEREIFNLRALHLGHLAKSFALRETPGKMSKQPSSKTDKTKPSSKKTKSSSGVA
                     KPQPRGDADGNRRRMLAVAKSHAGMSEFNIGY"
     gene            <93699..>95492
                     /locus_tag="AWJ20_3733"
                     /db_xref="GeneID:30035787"
     mRNA            <93699..>95492
                     /locus_tag="AWJ20_3733"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880758.1"
                     /db_xref="GeneID:30035787"
     CDS             93699..95492
                     /locus_tag="AWJ20_3733"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733416.1"
                     /db_xref="GeneID:30035787"
                     /translation="MATLIPQFPVGNNSNHNTSGTSAPSENQILARLDAYLPALNTGL
                     MDGKIQDVIIKHPLVRTLLVPECDLEARRRCIALISKALAAATPVLPLILQDHQAKQD
                     QKKKRQKSNAGSRKADANAQADSPRIPKLSLDAQSRLITIVASMAERDPLIRFWMNHH
                     VQYQARSQAQAQAQSATPEEGSRKRKYSTPAGSGAAAAAAASSAVGGSGMSKHLEMST
                     FDLYLKIKTSKELLADLADRIQGAVCKAFWDCWDEIFITLAEVIGAENLQQADKGRIF
                     RPCGDAAIYLNNLKVTKKRQVEQKRRLSMLEGNTSANTRPGHQAFYMGNNNMTTVSPK
                     NILGQQPGASPIQVTGQIPSQFSSQNQNIPPLVPASPFSPDQFLNEFTLNSSIPGTTA
                     TTTAAASSIPTPSASGASMAFPFPLSPEKSSGSPDSTSSMILGINTASAVSNVPTPPG
                     STNGSTSSHPNPFNIASASTSVNGSKPLSGSDANDLEFMMQDISYDSKFDQYLGAFTT
                     LDDADQQSGHQANPSHTPSSNTAANSSTSPAATTKPLPSNASDISTPQTSAGSPTNTP
                     GGSHLNLRQRIKLMEEGRMPEENPSPSNIVW"
     gene            <98087..>100627
                     /locus_tag="AWJ20_3734"
                     /db_xref="GeneID:30035788"
     mRNA            <98087..>100627
                     /locus_tag="AWJ20_3734"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880759.1"
                     /db_xref="GeneID:30035788"
     CDS             98087..100627
                     /locus_tag="AWJ20_3734"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733417.1"
                     /db_xref="GeneID:30035788"
                     /translation="MSSSIAASGGSSRTFSKSELDHSTSSYAVLGTSPISDGGLLNSK
                     GFGPENGQQSRINMEGSNQRGENYDPRKTVNDGGTTVTYKLHKSCDYCRHRKIKCVRR
                     PGSEICDHCRICEVECTFSRKMPSKKRKLRSARIVASLRDRDRLGYEGSGIGSADDTN
                     DSMGMSIRGRGSVSEEAVDNGNFIAKEESTASPKDRNHLTAVKIEPESADSEVGSGEG
                     AIGNATVPGVPSSVKGVSVSTPIMSYTQQGTGMTPLTAGGWYYEPFFDLIYSAKASPM
                     EDPSNGKSGAPSPLPAESVNEESSAFPQASEGLQGNSKTDVFAIHGHEVHSTNHVIPT
                     TNHGVRGDHDDTHANNRKQTENNYPSINGSTDSPHSQYTGSPNIAEMALSGYASRPNT
                     ETNSNNNINTNGNANTSSNEPISASVSVTTPGGTAHALPLDNNSNLTSLAIIATEHNA
                     SLTVPSNHSRRLPEDPQAVRDAYTLYIEPCTPFFPPEFYDASDMSTLARCCMSLASFS
                     SPNSVAPVGSIAMLYEVVDQLVAQETVWNEFSLSAVFCVLVRYKLPYDRVSRAINQFI
                     KKGPQHYPSPGINYNLLIGALSAYAWNSLVAYDNLRPPNNDEAEIIDIYETVTSNISE
                     DTFAYHFLYVSTLLCRFKVLMILPDEVYSPESLASGSPQHDDAWYSTRKSLIRLEYEL
                     LLWPVRLPKHLTVVKDDLIATPGALILHVLHNTVLLAYYIQAIRHKDPYGRMLSILPV
                     PGLLQFLCGMAASSFKCQPDIIEKWPIIRDCLVITARLMLELYNQTEYENCKVALALY
                     QDSQTAPGLYNSIQKVLAAVDWAANDKDGAALYWIFRDVRSMSLQHLL"
     gene            complement(<101761..>102183)
                     /gene="HHT2"
                     /locus_tag="AWJ20_3735"
                     /db_xref="GeneID:30035789"
     mRNA            complement(<101761..>102183)
                     /gene="HHT2"
                     /locus_tag="AWJ20_3735"
                     /product="histone H3"
                     /transcript_id="XM_018880760.1"
                     /db_xref="GeneID:30035789"
     CDS             complement(101761..102183)
                     /gene="HHT2"
                     /locus_tag="AWJ20_3735"
                     /inference="similar to AA sequence:KEGG_Orthology:K11253"
                     /note="Histone H3; core histone protein required for
                     chromatin assembly, part of heterochromatin-mediated
                     telomeric and HM silencing; one of two identical histone
                     H3 proteins (see HHT2); regulated by acetylation,
                     methylation, and phosphorylation; H3K14 acetylation plays
                     an important role in the unfolding of strongly positioned
                     nucleosomes during repair of UV damage; GO_component:
                     GO:0043505 - centromere-specific nucleosome [Evidence IDA]
                     [PMID 22693454]; GO_component: GO:0005694 - chromosome
                     [Evidence IEA,IEA]; GO_component: GO:0000788 - nuclear
                     nucleosome [Evidence TAS] [PMID 2275823]; GO_component:
                     GO:0000786 - nucleosome [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0031298 - replication fork protection
                     complex [Evidence IDA] [PMID 16531994]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence TAS] [PMID 2275823];
                     GO_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]; GO_process: GO:0006281 - DNA
                     repair [Evidence IEA]; GO_process: GO:0006974 - cellular
                     response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0006333 - chromatin assembly or disassembly
                     [Evidence TAS] [PMID 2275823]; GO_process: GO:0070911 -
                     global genome nucleotide-excision repair [Evidence IMP]
                     [PMID 21460225]; GO_process: GO:0007094 - mitotic spindle
                     assembly checkpoint [Evidence IGI] [PMID 19917722];
                     GO_process: GO:0006334 - nucleosome assembly [Evidence
                     IEA]; GO_process: GO:0009303 - rRNA transcription
                     [Evidence IMP] [PMID 16002464]; GO_process: GO:0043935 -
                     sexual sporulation resulting in formation of a cellular
                     spore [Evidence IMP] [PMID 20713519]"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_018733418.1"
                     /db_xref="GeneID:30035789"
                     /translation="MARTKSTVARKSTGGKAPRKQIASKAARKSAPSTAAPGGVKKPH
                     RYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVE
                     AYLVSLFEDTNLCAIHAKRVTIQKKDIQLARRLRGERI"
     gene            <103937..>104248
                     /gene="HHF2"
                     /locus_tag="AWJ20_3736"
                     /db_xref="GeneID:30035790"
     mRNA            <103937..>104248
                     /gene="HHF2"
                     /locus_tag="AWJ20_3736"
                     /product="histone H4"
                     /transcript_id="XM_018880761.1"
                     /db_xref="GeneID:30035790"
     CDS             103937..104248
                     /gene="HHF2"
                     /locus_tag="AWJ20_3736"
                     /inference="similar to AA sequence:KEGG_Orthology:K11254"
                     /note="Histone H4; core histone protein required for
                     chromatin assembly and chromosome function; one of two
                     identical histone proteins (see also HHF2); contributes to
                     telomeric silencing; N-terminal domain involved in
                     maintaining genomic integrity; GO_component: GO:0005694 -
                     chromosome [Evidence IEA,IEA]; GO_component: GO:0000788 -
                     nuclear nucleosome [Evidence TAS] [PMID 2275823];
                     GO_component: GO:0000786 - nucleosome [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0031298 - replication fork protection
                     complex [Evidence IDA] [PMID 16531994]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence TAS] [PMID 2275823];
                     GO_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]; GO_process: GO:0006333 -
                     chromatin assembly or disassembly [Evidence TAS] [PMID
                     2275823]; GO_process: GO:0034729 - histone H3-K79
                     methylation [Evidence IMP] [PMID 18158898]; GO_process:
                     GO:0006334 - nucleosome assembly [Evidence IEA];
                     GO_process: GO:0043935 - sexual sporulation resulting in
                     formation of a cellular spore [Evidence IMP] [PMID
                     20713519]; GO_process: GO:0061587 - transfer RNA
                     gene-mediated silencing [Evidence IMP] [PMID 23707796]"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_018733419.1"
                     /db_xref="GeneID:30035790"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISALIYEETRGVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <104583..>105596
                     /gene="RKI1"
                     /locus_tag="AWJ20_3737"
                     /db_xref="GeneID:30035791"
     mRNA            <104583..>105596
                     /gene="RKI1"
                     /locus_tag="AWJ20_3737"
                     /product="ribose-5-phosphate isomerase RKI1"
                     /transcript_id="XM_018880762.1"
                     /db_xref="GeneID:30035791"
     CDS             104583..105596
                     /gene="RKI1"
                     /locus_tag="AWJ20_3737"
                     /inference="similar to AA sequence:KEGG_Orthology:K01807"
                     /note="Ribose-5-phosphate ketol-isomerase; catalyzes the
                     interconversion of ribose 5-phosphate and ribulose
                     5-phosphate in the pentose phosphate pathway; participates
                     in pyridoxine biosynthesis; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0016853 - isomerase activity [Evidence
                     IEA]; GO_function: GO:0004751 - ribose-5-phosphate
                     isomerase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004751 - ribose-5-phosphate isomerase activity
                     [Evidence IMP,ISS] [PMID 8929392]; GO_process: GO:0006098
                     - pentose-phosphate shunt [Evidence IEA]; GO_process:
                     GO:0006098 - pentose-phosphate shunt [Evidence IGI] [PMID
                     8929392]; GO_process: GO:0009052 - pentose-phosphate
                     shunt, non-oxidative branch [Evidence IEA]; GO_process:
                     GO:0008615 - pyridoxine biosynthetic process [Evidence
                     IMP] [PMID 14690456]"
                     /codon_start=1
                     /product="ribose-5-phosphate isomerase RKI1"
                     /protein_id="XP_018733420.1"
                     /db_xref="GeneID:30035791"
                     /translation="MYGRALGLGQGGGGARAPLSRIGRTPAGLVRPGACAASGLVVSR
                     AGGCGEGLGVKDVSSGGKRPSSIQRSLLHRLRPGPSCVFIRSMSLRLGEISLVEKAKR
                     AAAYKAVDEHFPADAKVVGIGSGSTVIYAVERIAQLAELRGIDLSKVTFVPTGFQSKQ
                     LIIGAGLNVASIDQFSVGDLDIVIDGADEVDDSLNCIKGGGACLFQEKLVGQCARKFV
                     IVADSSKKSHKLGSKWIQGVPIEVIPMAYPKVEADLLRLGAKQITLRQGGKAKAGPVV
                     TDNGNFILDTHFGSIEPSEVRNLDIKIKLLVGVVETGLFDYGAVAYFGETDGTASTFT
                     RPE"
     gene            complement(<108260..>109582)
                     /gene="APM1"
                     /locus_tag="AWJ20_3738"
                     /db_xref="GeneID:30035792"
     mRNA            complement(<108260..>109582)
                     /gene="APM1"
                     /locus_tag="AWJ20_3738"
                     /product="Apm1p"
                     /transcript_id="XM_018880763.1"
                     /db_xref="GeneID:30035792"
     CDS             complement(108260..109582)
                     /gene="APM1"
                     /locus_tag="AWJ20_3738"
                     /inference="similar to AA sequence:KEGG_Orthology:K12393"
                     /note="Mu1-like medium subunit of the AP-1 complex; binds
                     clathrin; involved in clathrin-dependent Golgi protein
                     sorting; the AP-1 complex is the clathrin-associated
                     protein complex; GO_component: GO:0030121 - AP-1 adaptor
                     complex [Evidence IPI,ISS] [PMID 10564262]; GO_component:
                     GO:0030131 - clathrin adaptor complex [Evidence IEA];
                     GO_component: GO:0030665 - clathrin-coated vesicle
                     membrane [Evidence IEA]; GO_component: GO:0005905 - coated
                     pit [Evidence IEA,IEA]; GO_component: GO:0016023 -
                     cytoplasmic membrane-bounded vesicle [Evidence IEA];
                     GO_component: GO:0031410 - cytoplasmic vesicle [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0030276 - clathrin binding [Evidence
                     IPI,ISS] [PMID 10564262]; GO_process: GO:0006896 - Golgi
                     to vacuole transport [Evidence IMP] [PMID 17003107];
                     GO_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA,IEA]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IEA]; GO_process:
                     GO:0016192 - vesicle-mediated transport [Evidence IPI,ISS]
                     [PMID 10564262]"
                     /codon_start=1
                     /product="Apm1p"
                     /protein_id="XP_018733421.1"
                     /db_xref="GeneID:30035792"
                     /translation="MASAIFFLDLKGKHLLSRNYRGDIPMSAVDKFPILLMEAEEETS
                     IVPPTISHEGVNYLYIQHNNLYLLALTKRNSNAAQILLFLHKIVEVLTEYFKELEEES
                     IRDNFVVIYELLDEMMDFGYPQTTDTKILQEYITQESHALDVQARPPVAVTNAVSWRS
                     EGITYRKNEAFLDVVESVNLLISASGQVLRSEILGSVQMKCFLSGMPELRLGLNDKVI
                     FNHQSNTTGQSIGSSSGGGSSGKVIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFEL
                     MSYRLNTNVKPLILVDCRVTNFSSSRIEIIVKARAQFKKRSNANNVEITIPVPDDADS
                     PKFKTTAGNVKWHPEKSAIIWRIKQFGGGREFNMRAELGLPSVKDSDYANAKIKPPIT
                     VNFTIPYFTTSGIQVRYLKIIEPKLQYQSYPWVRYITKSGNDYTIRMS"
     gene            <108522..>108920
                     /locus_tag="AWJ20_3739"
                     /db_xref="GeneID:30035793"
     mRNA            <108522..>108920
                     /locus_tag="AWJ20_3739"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880764.1"
                     /db_xref="GeneID:30035793"
     CDS             108522..108920
                     /locus_tag="AWJ20_3739"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733422.1"
                     /db_xref="GeneID:30035793"
                     /translation="MMADFSGCHFTFPAVVLNLGESASSGTGIVISTLLAFDRFLNCA
                     RALTMISIRDEEKLVTRQSTRISGLTLVFRRYDMSSNSPSGGINEIVRSFSNRDRRTH
                     WWNLTSSISMTFPDEPPPEDDPMLCPVVLD"
     gene            complement(<111418..>113187)
                     /locus_tag="AWJ20_3740"
                     /db_xref="GeneID:30035795"
     mRNA            complement(<111418..>113187)
                     /locus_tag="AWJ20_3740"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880766.1"
                     /db_xref="GeneID:30035795"
     CDS             complement(111418..113187)
                     /locus_tag="AWJ20_3740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733423.1"
                     /db_xref="GeneID:30035795"
                     /translation="MVKIALAPAPPQPLASKRPVAAGTVPQNNVPRIAAKKPLVAPSP
                     RAVLSAAASNAVSSIPTNNPVKPVLTTASALASSTRSRTSVSAASPVAVSSPTATAAS
                     SPVDTTGAAPVSKISTSKVWVLPPRPKPGRKPSVDTPQNKRKAQNRAAQRAFRERRAA
                     MVGELEEKLNELTKERDAREARLEAQLKAVTRENENLKRSVRDMQAQLAKQNVSYQMA
                     SPPMSSHESPMDILDRVLEERLPVPDKSRTNSSSDACGVCIKDDCICESVGIKARRTS
                     NQPVSAVSMSTTRSSISSITGTSSAFKTNDQSNAAATLVASSVTAPAVSLKRNQPESN
                     DDEPYEIDFTEMFSRPAKKQAPPLLVPSPVPVPKHRTSSTRTVLKPPADRCGFCSDGN
                     PCMCAEAEAEAQAAGDGGHFINDIEEDNTLPPIVLNNMWSSSYQNTNKLPALHPGPSR
                     EVPPSQQPPSPQVALPAASVSSITAPSYECTGNPGTCMQCQTDPMSTLFCTTLASRPE
                     KGDSEKKKAVTTPSTPTEKTRAGSSSFISASAAYRTLSRHKDFRSADFGALVGKLNTR
                     GMQVEVNSVANVLRELDRKLYSS"
     gene            <115364..>117727
                     /gene="PET127"
                     /locus_tag="AWJ20_3741"
                     /db_xref="GeneID:30035796"
     mRNA            <115364..>117727
                     /gene="PET127"
                     /locus_tag="AWJ20_3741"
                     /product="Pet127p"
                     /transcript_id="XM_018880767.1"
                     /db_xref="GeneID:30035796"
     CDS             115364..117727
                     /gene="PET127"
                     /locus_tag="AWJ20_3741"
                     /note="Protein with a role in 5'-end processing of
                     mitochondrial RNAs; located in the mitochondrial membrane;
                     GO_component: GO:0005740 - mitochondrial envelope
                     [Evidence IDA] [PMID 9111353]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0000964 - mitochondrial RNA 5'-end
                     processing [Evidence IMP] [PMID 18086665]; GO_process:
                     GO:0000964 - mitochondrial RNA 5'-end processing [Evidence
                     IMP] [PMID 9111353]"
                     /codon_start=1
                     /product="Pet127p"
                     /protein_id="XP_018733424.1"
                     /db_xref="GeneID:30035796"
                     /translation="MLRTGGLGSLRLRIYSEYAPKFLSPGNGLFYTRAFSLSSTVLKD
                     IDGLDSLHLLEKETYRDIKRQRPAKGKKSPPGPNTRPGSITPKHFGKKRPSRAPPSRV
                     TLGQREPGAKPTFRSRREYEKKNEEQVNRNRQNSSAKVPKPSSAEVQEYIAKSPEQWK
                     SRRTLTDPKRFSKDNAGSSSETTNQKISPANSPFPNFFPHETPYFRSFELDSSQLSYE
                     PLEVPDQPPVPKLAHNLDRVLFSPGVHVLKDRRSNVYNFTPYLENIMSIKDFDFDFIA
                     KYVPSGKDSILSKLAKENGKKYTGSTSSLTSVLSQFHHLLSHRRKPHTMALSKYFQSQ
                     QVAFSAIQTQPVSIFLRYNPNTDTHSIDSDKSYSGDIIVSVLGHQLEAMLTTEEEEFR
                     NYHKSLSHKLDSSKKGGLNTYNYTQSGDFLMRSQLDCYDERLPGTGTFDLKTRAVCAV
                     RHDMDYTQIHDGSDYQITKIDGEFESFSREWFELIRSTMFKYSLQARIGRMDGIFLAY
                     HNVRRMFGFQYVPLSEIDQIYHTSDLIESQQDLRDIDPSNVSSFVPLDEQIATSGPII
                     AENEFKLSLKMFNEILDKIVASHEPAASFNLVFHTVSTGRMQVFVKPMLEKDIEVIQE
                     TGCDTEPKTGEEYSNNSDPHTILMHGNKNPEVLPPDVKVYQVDIRTYVNDKFVPGDKY
                     PHLSSDSDVWKVQCEMSQLRQQGAERRFSRTFSMHKIENRITSVPQTERLDEEQEETI
                     RNEALSKLSPPNAKQGYLRFLGAKGERLQREWEAQHGHKEKHVWRPS"
     gene            complement(<117861..>118880)
                     /gene="THI73"
                     /locus_tag="AWJ20_3742"
                     /db_xref="GeneID:30035797"
     mRNA            complement(<117861..>118880)
                     /gene="THI73"
                     /locus_tag="AWJ20_3742"
                     /product="Thi73p"
                     /transcript_id="XM_018880768.1"
                     /db_xref="GeneID:30035797"
     CDS             complement(117861..118880)
                     /gene="THI73"
                     /locus_tag="AWJ20_3742"
                     /note="Putative plasma membrane permease; proposed to be
                     involved in carboxylic acid uptake and repressed by
                     thiamine; substrate of Dbf2p/Mob1p kinase; transcription
                     is altered if mitochondrial dysfunction occurs;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 16850348]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISS] [PMID 10869563];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_function: GO:0005215 -
                     transporter activity [Evidence ISS] [PMID 10869563];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence ISS] [PMID
                     10869563]"
                     /codon_start=1
                     /product="Thi73p"
                     /protein_id="XP_018733425.1"
                     /db_xref="GeneID:30035797"
                     /translation="MWYKKAEQGKRIGAFYVMNSVTLIAAGIISYAASFAKTAFASWR
                     IFLLCMGLVTVFCGICVFLFLPDSIVRSKGFTDEEKVAALLRVKDEQSGTQNSKLKRY
                     QMVEAVSDPKVWFVVLSVFLFSIPNGAITVFNSIIINSYGFGSQETLIVGAPAGVVTG
                     AAVIIIQYYSDKTQNRTLISIWYFIPSIVGLAIMIALGDREKTLSMKAGLLIASYLSQ
                     VFGGGLALFLSWNASNIAGHSKKALVNALTFIAFPLGNILGTQTFQNKDAPMYIPGKI
                     SIMACLCAQVVVSTVWFFVNKYYNKKKQTFLDTLNVYEYEGLRMKMEFSDETDMRNPF
                     FKYTK"
     gene            complement(<120325..>120753)
                     /gene="HHO1"
                     /locus_tag="AWJ20_3743"
                     /db_xref="GeneID:30035798"
     mRNA            complement(<120325..>120753)
                     /gene="HHO1"
                     /locus_tag="AWJ20_3743"
                     /product="histone H1"
                     /transcript_id="XM_018880769.1"
                     /db_xref="GeneID:30035798"
     CDS             complement(120325..120753)
                     /gene="HHO1"
                     /locus_tag="AWJ20_3743"
                     /inference="similar to AA sequence:KEGG_Orthology:K11275"
                     /note="Histone H1, linker histone with roles in meiosis
                     and sporulation; decreasing levels early in sporulation
                     may promote meiosis, and increasing levels during
                     sporulation facilitate compaction of spore chromatin;
                     binds to promoters and within genes in mature spores; may
                     be recruited by Ume6p to promoter regions, contributing to
                     transcriptional repression outside of meiosis; suppresses
                     DNA repair involving homologous recombination;
                     GO_component: GO:0005694 - chromosome [Evidence IEA,IEA];
                     GO_component: GO:0000790 - nuclear chromatin [Evidence
                     IDA] [PMID 22586276]; GO_component: GO:0000788 - nuclear
                     nucleosome [Evidence IPI] [PMID 11574687]; GO_component:
                     GO:0000786 - nucleosome [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     9046096]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA,IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IPI] [PMID 11574687]; GO_process: GO:0030261 - chromosome
                     condensation [Evidence IMP] [PMID 22586276]; GO_process:
                     GO:0045910 - negative regulation of DNA recombination
                     [Evidence IGI,IMP] [PMID 12820979]; GO_process: GO:0031936
                     - negative regulation of chromatin silencing [Evidence
                     IGI] [PMID 19017647]; GO_process: GO:0006334 - nucleosome
                     assembly [Evidence IEA]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence IMP]
                     [PMID 11574687]"
                     /codon_start=1
                     /product="histone H1"
                     /protein_id="XP_018733426.1"
                     /db_xref="GeneID:30035798"
                     /translation="MVKDAILQLKERSGSSRQAIKKYIQSTHSISAANFDSLLNAAIR
                     KGVVSGDFVQPKGPSGPVKLQKKEVVKPAKKPVAKKTETKPAAKAKAKTTTKPKTVAK
                     KPAAKKTEKKPAVKATKAKATASKVKKAAPKKKATATKAK"
     gene            <126947..>128770
                     /gene="SEF1"
                     /locus_tag="AWJ20_3744"
                     /db_xref="GeneID:30035799"
     mRNA            <126947..>128770
                     /gene="SEF1"
                     /locus_tag="AWJ20_3744"
                     /product="Sef1p"
                     /transcript_id="XM_018880770.1"
                     /db_xref="GeneID:30035799"
     CDS             126947..128770
                     /gene="SEF1"
                     /locus_tag="AWJ20_3744"
                     /note="Putative transcription factor; has homolog in
                     Kluyveromyces lactis; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_component: GO:0005634
                     - nucleus [Evidence IEA,IEA,IEA]; GO_function: GO:0003677
                     - DNA binding [Evidence IEA,IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND];
                     GO_function: GO:0000981 - sequence-specific DNA binding
                     RNA polymerase II transcription factor activity [Evidence
                     IEA]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IEA]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA,IEA];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Sef1p"
                     /protein_id="XP_018733427.1"
                     /db_xref="GeneID:30035799"
                     /translation="MKAKACTECRQNKLRCLYPPSGIGSCQRCFKKELACVFDPKFRR
                     VSKRKLAERKSATGSAESEIRSNGVSSSSSTTNLNPSIPSSAPPLHSIAITQDGPTGE
                     PPKTSLDILDMPEQLEVTPCKSDKIIEGSISITSEDVTRLFNIFLKNHLYYMPLDICL
                     DCEAIYARCELLFWTILALAGRDFPLISHIQEKVKQLLKDTLFEAVRSVEVVQALLLI
                     SGWPLPYKTQLDDRSFTCSTLALQYSMRLGLHRPTFAHEFSSRPEVLQFGSFKRMTTW
                     MGCFLADGREAIRLGLPTFLGADYTLRQSFQDVRIPETLRNLCILAEHTASMNKTLGS
                     GGENLTGLLEPSPRLELVKQYIGKLDSLFATDQFLRTRNTYIEVVYLTARLQVLSYIL
                     TEDILSWSVDALEFVNIALHDASRVIRVIAHLPGLEFAPTMVFRYIIYAALVLLRILR
                     TCEAVALDRKSILSDLTSVYQTLDRLHSGLRNDEHILMTKNFLQIYSNLKDVKVTQPI
                     KSRGPANIVYDAVRITREAQANHLRQQEKGLLTRQQGNQTEEHNRQENTSFLASLLQN
                     GGFGAVPNENGETAMLPADPTMVPEIDDQWFNEIFNLVYYM"
     gene            <129030..>129977
                     /gene="HIS2"
                     /locus_tag="AWJ20_3745"
                     /db_xref="GeneID:30035800"
     mRNA            <129030..>129977
                     /gene="HIS2"
                     /locus_tag="AWJ20_3745"
                     /product="histidinol-phosphatase"
                     /transcript_id="XM_018880771.1"
                     /db_xref="GeneID:30035800"
     CDS             129030..129977
                     /gene="HIS2"
                     /locus_tag="AWJ20_3745"
                     /inference="similar to AA sequence:KEGG_Orthology:K04486"
                     /note="Histidinolphosphatase; catalyzes the eighth step in
                     histidine biosynthesis; mutations cause histidine
                     auxotrophy and sensitivity to Cu, Co, and Ni salts;
                     transcription is regulated by general amino acid control;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0004401 -
                     histidinol-phosphatase activity [Evidence IEA,IEA];
                     GO_function: GO:0004401 - histidinol-phosphatase activity
                     [Evidence IMP] [PMID 14190241]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_process: GO:0008652
                     - cellular amino acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0016311 - dephosphorylation [Evidence
                     IEA,IEA]; GO_process: GO:0000105 - histidine biosynthetic
                     process [Evidence IEA,IEA,IEA]; GO_process: GO:0000105 -
                     histidine biosynthetic process [Evidence IMP] [PMID
                     14190241]"
                     /codon_start=1
                     /product="histidinol-phosphatase"
                     /protein_id="XP_018733428.1"
                     /db_xref="GeneID:30035800"
                     /translation="MHSHHSHSSDHCQHASSPLDDMIQRAIDERLLVLCLTEHMPRID
                     PNHLYPEEIKSNTTVEQLKCVFDTYYKRARQAQIEYKDRIDLLVGFESETISDEYLDY
                     IDELRKQYKFDMVVGSVHHVSRIPIDYNEETWIRALDATVGTLHSKTDNISDESLQKY
                     FEEYFDLQYLMLKRLKPSVVGHFDLIKLCAPKGVVPESLQSWPSVWEKITRNVKLAVS
                     QGGLFEVNSAAVRKGWDTPYPGRDIASLIHELGGEFCLSDDSHQVGHVAQNYKACIRY
                     LKELGVERVYYLKTKRLADTISIIKDSVSLQELDEWATL"
     gene            complement(<130088..>131074)
                     /locus_tag="AWJ20_3746"
                     /db_xref="GeneID:30035801"
     mRNA            complement(<130088..>131074)
                     /locus_tag="AWJ20_3746"
                     /product="putative ribonuclease H1"
                     /transcript_id="XM_018880772.1"
                     /db_xref="GeneID:30035801"
     CDS             complement(130088..131074)
                     /locus_tag="AWJ20_3746"
                     /codon_start=1
                     /product="putative ribonuclease H1"
                     /protein_id="XP_018733429.1"
                     /db_xref="GeneID:30035801"
                     /translation="MPSQSQKYASCWAGLRNVSGSNIDNRIKWLDRLDSFRLFSQVCE
                     DDSVSSDDDGTDDGYFSRDEEDYSDNDSFSDDDNLGYEDSGDLFGYSTSRIKIYAVKR
                     GREKGIFSELQTALDATYRFSHCAMKSFTNFQAACDYMKYRYYAVQKGHVKGIFRLWA
                     NAVEASAMYPGSRMKSFKSLKLAKLFLALTDKSSVVFTDGTIVDGPDRGPWYGIFYGP
                     EHPENEFRRQPGKIQTVERAKIKAISRVLTKTLMCGQKYQQIHSSCKSTVDALTSNES
                     PLPNRDLILNCKVKLKDLAAIGVRLQIIGDQNKDKIDEYREVRELINKAARQ"
     gene            complement(<132003..>134147)
                     /locus_tag="AWJ20_3747"
                     /db_xref="GeneID:30035802"
     mRNA            complement(<132003..>134147)
                     /locus_tag="AWJ20_3747"
                     /product="proline--tRNA ligase"
                     /transcript_id="XM_018880773.1"
                     /db_xref="GeneID:30035802"
     CDS             complement(132003..134147)
                     /locus_tag="AWJ20_3747"
                     /inference="similar to AA sequence:KEGG_Orthology:K01881"
                     /note="Prolyl-tRNA synthetase; N-terminal domain shows
                     weak homology to prokaryotic posttransfer editing domain,
                     but does not possess posttransfer editing activity; may
                     interact with ribosomes, based on co-purification
                     experiments; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005840 - ribosome
                     [Evidence IDA] [PMID 16702403]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0002161 -
                     aminoacyl-tRNA editing activity [Evidence IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016874 - ligase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0004827 - proline-tRNA ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004827 - proline-tRNA ligase
                     activity [Evidence IDA] [PMID 16864571]; GO_process:
                     GO:0006433 - prolyl-tRNA aminoacylation [Evidence IEA];
                     GO_process: GO:0006433 - prolyl-tRNA aminoacylation
                     [Evidence IDA] [PMID 16864571]; GO_process: GO:0006450 -
                     regulation of translational fidelity [Evidence IEA];
                     GO_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="proline--tRNA ligase"
                     /protein_id="XP_018733430.1"
                     /db_xref="GeneID:30035802"
                     /translation="MSSLIKDLEGLSLTHEAPANNEEWASILAKSDVAKFAGPYELTK
                     VLVFKPKTAKTATPVPVVVVALNSTQTASNIVAKAAGVKEPRLANKDLINEFFGTEPQ
                     NVSPISITKENASKLKILIDSKAAEKSTLLAIHTDSNAKTAFITGDKLIEAYESIAAD
                     VTVVDFAKEAAAAAASATPTAGSGADKSAKSGSAGAVAKASANEGKIDGAALIGITSD
                     KELDFPGWYQQIVTKAELLDYYDVSGCYIMRPGSYSIWEKVQNYLDTRIKSIGVQNAY
                     FPMFVSSRVLEKEKDHIEGFAPEVAWVTKAGQSDLEEPLAIRPTSETVMYPYYAKWIR
                     SYRDLPLRLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTKEAAAEEVLQILEWY
                     AGVYEELLAVPVIKGTKTDKEKFAGGLYTTTCEGYIPTTGRGIQGATSHALGQNFSKM
                     FNIVVEDPEGSDKPKINVWQNSWGLSTRVIGVMVMIHSDNKGLVLPPRVASNQVAVIP
                     VGITAKTTSDERDAIINGAKNVEKTIGDAGVRVFGDYRDNYSPGWKFADAELKGVPLR
                     VEFGPADLKKNQVVAVRRDNGVKTVIPIASLADEIPKLLETIQADLYTKAKKQFDEHI
                     VPVTTVAEMTPLLNKKNILLAPFCGEEECEDSIKETTARRDDDEEVDEKAPSMGAKSL
                     CIPFEQPELKEGTKCVNCDRLAKAHTLFGRSY"
     gene            <134668..>136368
                     /gene="DED81"
                     /locus_tag="AWJ20_3748"
                     /db_xref="GeneID:30035803"
     mRNA            <134668..>136368
                     /gene="DED81"
                     /locus_tag="AWJ20_3748"
                     /product="asparagine--tRNA ligase DED81"
                     /transcript_id="XM_018880774.1"
                     /db_xref="GeneID:30035803"
     CDS             134668..136368
                     /gene="DED81"
                     /locus_tag="AWJ20_3748"
                     /inference="similar to AA sequence:KEGG_Orthology:K01893"
                     /note="Cytosolic asparaginyl-tRNA synthetase; required for
                     protein synthesis, catalyzes the specific attachment of
                     asparagine to its cognate tRNA; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005829
                     - cytosol [Evidence IC] [PMID 9605503]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0004812 - aminoacyl-tRNA ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004816 - asparagine-tRNA ligase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004816 -
                     asparagine-tRNA ligase activity [Evidence IDA,ISS] [PMID
                     9605503]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_process:
                     GO:0006421 - asparaginyl-tRNA aminoacylation [Evidence
                     IEA]; GO_process: GO:0006421 - asparaginyl-tRNA
                     aminoacylation [Evidence IDA,IGI,ISS] [PMID 9605503];
                     GO_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="asparagine--tRNA ligase DED81"
                     /protein_id="XP_018733431.1"
                     /db_xref="GeneID:30035803"
                     /translation="MSESIEKPLESLSVSGAAVYVNEATGIDGATADGSEKSPYQTAA
                     YALYSSKSENILVAKKLEDGTVSYDKITPSAIKKARKGADGLAKKAEKAAKQAEAQQL
                     RDAEEAKKIEAAKSISLKQDPTLPKAKVIKLRVAEQHRLQRVQVNGWIHRLRVQKGVA
                     FIVLRDGTGFLQCVLSGDLANAYQTSTLTLESTVSIYGVIKPVPEGQSAPGGHELIAD
                     YYDIVGLAPSGDEAFTNKVQESADPSILLDQRHLALRGETLSAVMKVRATLLRAVREV
                     YEEEGLLEVTPPCMVQTQVEGGSTLFGFQYYGEEAYLTQSSQLYLETCVPALGDVYCI
                     QESFRAERSHTRRHLSEYTHIEAELGFLSFEDLLDHIERVISRTVAKVLADPVAGPLV
                     KQLNPNFEPPKTPFMRLEYVKALDWLNEHGIPNEDGEKFKFGDDIAEAAERKMTDIIG
                     VPILLNRFPLEIKSFYMKKCADDPRVTESVDVLMPGVGEITGGSMRIDNLEELLAGFK
                     REGINPEPYYWFSDQRKYGSFPHGGYGLGTERILAWLCDRFTVRDCSLYPRFTGRCKP
                     "
     gene            complement(<137503..>138333)
                     /gene="SPS19"
                     /locus_tag="AWJ20_3749"
                     /db_xref="GeneID:30035804"
     mRNA            complement(<137503..>138333)
                     /gene="SPS19"
                     /locus_tag="AWJ20_3749"
                     /product="Sps19p"
                     /transcript_id="XM_018880775.1"
                     /db_xref="GeneID:30035804"
     CDS             complement(137503..138333)
                     /gene="SPS19"
                     /locus_tag="AWJ20_3749"
                     /inference="similar to AA sequence:KEGG_Orthology:K17738"
                     /note="Peroxisomal 2,4-dienoyl-CoA reductase; auxiliary
                     enzyme of fatty acid beta-oxidation; homodimeric enzyme
                     required for growth and sporulation on petroselineate
                     medium; expression induced during late sporulation and in
                     the presence of oleate; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 9268358];
                     GO_component: GO:0005777 - peroxisome [Evidence IEA,IEA];
                     GO_function: GO:0008670 - 2,4-dienoyl-CoA reductase
                     (NADPH) activity [Evidence IEA]; GO_function: GO:0008670 -
                     2,4-dienoyl-CoA reductase (NADPH) activity [Evidence
                     IDA,ISS] [PMID 9268358]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_process:
                     GO:0030437 - ascospore formation [Evidence IEP,IMP] [PMID
                     7969036]; GO_process: GO:0009062 - fatty acid catabolic
                     process [Evidence IDA,ISS] [PMID 9268358]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence IEA];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="Sps19p"
                     /protein_id="XP_018733432.1"
                     /db_xref="GeneID:30035804"
                     /translation="MTAPVLFKNMFSLAGKTAVITGGSGGLGLSVSKYLLQAGASLAL
                     IDNNLPKLEPAAADLSKWYNEPVNKVEYEHKQIISSWACDISDATQVESTIQAIRAHH
                     AKPLDILINAAGYCENISAVEYPALNIKRIVDVNLNGSLFMAREFAKSLIADNHPGSI
                     ILVASMSGSIINYPQPQTPYNMTKAGVIHLAKSLASEWAAHNIRVNSLSPGYILTPLT
                     KAIIDSDARLKAEWESKVPLGRMADPSEFAGPIIYMSSAASSYMTGHDLVVDGGYTFW
                     "
     gene            complement(<143207..>144166)
                     /locus_tag="AWJ20_3750"
                     /db_xref="GeneID:30035806"
     mRNA            complement(<143207..>144166)
                     /locus_tag="AWJ20_3750"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880777.1"
                     /db_xref="GeneID:30035806"
     CDS             complement(143207..144166)
                     /locus_tag="AWJ20_3750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733433.1"
                     /db_xref="GeneID:30035806"
                     /translation="MPTVVLPNHTLLSFSDTGRPHTGQYETVVLCHGVGSNIRVFESL
                     NEVVRSGQVKIRLLAYNQRGYSGSSPLPKGNLKKEEYALEHATDLVEFLEYANEDLKL
                     PKPPIVVGWSKGTNLLIAIACQSFLPTELRQRGLKYSSAFVLYEPPSSIFALKPDPAF
                     TKAMTPPEGMSKEEQARTLPQRFEKSFGVYYEYPDPNSIEGAKPATNVSEPAAVRELI
                     LSAKEPHMIPHGFTWAIGSAKYQRQAVQEALTAKLDIPVLVVWNGMTAPYCKQAALEA
                     HKMGGRVVQLWNGGNHYAFVGEPRRWLTSILTAVHDSSSSSKL"
     gene            complement(<144714..>145349)
                     /gene="PRE5"
                     /locus_tag="AWJ20_3751"
                     /db_xref="GeneID:30035807"
     mRNA            complement(<144714..>145349)
                     /gene="PRE5"
                     /locus_tag="AWJ20_3751"
                     /product="proteasome core particle subunit alpha 6"
                     /transcript_id="XM_018880778.1"
                     /db_xref="GeneID:30035807"
     CDS             complement(144714..145349)
                     /gene="PRE5"
                     /locus_tag="AWJ20_3751"
                     /inference="similar to AA sequence:KEGG_Orthology:K02725"
                     /note="Alpha 6 subunit of the 20S proteasome; protein
                     abundance increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IC] [PMID
                     9087403]; GO_component: GO:0042175 - nuclear outer
                     membrane-endoplasmic reticulum membrane network [Evidence
                     IC] [PMID 9087403]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IC] [PMID 9087403]; GO_component: GO:0000502 -
                     proteasome complex [Evidence IEA]; GO_component:
                     GO:0005839 - proteasome core complex [Evidence IEA];
                     GO_component: GO:0019773 - proteasome core complex,
                     alpha-subunit complex [Evidence IEA]; GO_component:
                     GO:0019773 - proteasome core complex, alpha-subunit
                     complex [Evidence IDA] [PMID 9087403]; GO_component:
                     GO:0034515 - proteasome storage granule [Evidence IDA]
                     [PMID 18504300]; GO_function: GO:0004175 - endopeptidase
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0003674
                     - molecular_function [Evidence ND]; GO_function:
                     GO:0008233 - peptidase activity [Evidence IEA];
                     GO_function: GO:0004298 - threonine-type endopeptidase
                     activity [Evidence IEA,IEA]; GO_process: GO:0010499 -
                     proteasomal ubiquitin-independent protein catabolic
                     process [Evidence IDA] [PMID 19162040]; GO_process:
                     GO:0043161 - proteasome-mediated ubiquitin-dependent
                     protein catabolic process [Evidence IDA] [PMID 11545745];
                     GO_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 19029916]; GO_process: GO:0006508 - proteolysis
                     [Evidence IEA]; GO_process: GO:0051603 - proteolysis
                     involved in cellular protein catabolic process [Evidence
                     IEA]; GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome core particle subunit alpha 6"
                     /protein_id="XP_018733434.1"
                     /db_xref="GeneID:30035807"
                     /translation="MTAKLVYNRPLAVSRAVYAIADKAQSNTQQYGRRPYGVGLLIAG
                     FDETGPHLYEFLPSGSVLEYVGTAIGARSQAARTYLERNYEKFGDSSLEELVVHGLNA
                     LRDTLAQDKELTSKNTSIAVVGLDTPFKLLDDDEVVPWLEKLDSVSRSSHPVQTEEQP
                     ATETQPEPAAATTSTDAPADADAPADAAGAAGSDSAAEPRPDDDSNMDTTQ"
     gene            complement(<147370..>148341)
                     /gene="ERV29"
                     /locus_tag="AWJ20_3752"
                     /db_xref="GeneID:30035808"
     mRNA            complement(<147370..>148341)
                     /gene="ERV29"
                     /locus_tag="AWJ20_3752"
                     /product="Erv29p"
                     /transcript_id="XM_018880779.1"
                     /db_xref="GeneID:30035808"
     CDS             complement(147370..148341)
                     /gene="ERV29"
                     /locus_tag="AWJ20_3752"
                     /note="Protein localized to COPII-coated vesicles;
                     involved in vesicle formation and incorporation of
                     specific secretory cargo; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0030134 - ER to Golgi transport vesicle [Evidence IDA]
                     [PMID 11157978]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006888 - ER to Golgi vesicle-mediated
                     transport [Evidence IPI] [PMID 11157978]"
                     /codon_start=1
                     /product="Erv29p"
                     /protein_id="XP_018733435.1"
                     /db_xref="GeneID:30035808"
                     /translation="MSNRYQMPLDGGDVKTRRQASGGISGYDSAPMGGANFSSYPGAA
                     ASSPSFARRAHEVSEKIDNFLGTVGTPVKPYLPGIGRFLIIATFVEDAFRIVTQWSDQ
                     VGYIWNVRGLPHIIAVLFLSINVVAMLIGSFSVVFKKRLEIGVGALLFVVVSQALVYG
                     LIFKFSFFFRNVSLVGGLLIVLSDAFVRDRRSLSLPGLPVLEDKDRSKYLQLAGRILL
                     IFLFIAYMVTRNWTVIGGFFNVIGLVACIMVVVGFKARLSASLLVVLLSVQNLLTNPY
                     WRYASRNPARDLLRYEYFQTLSIVGGLILLVSSGAGRISIDEKKKIY"
     gene            <149580..>152039
                     /locus_tag="AWJ20_3753"
                     /db_xref="GeneID:30035809"
     mRNA            <149580..>152039
                     /locus_tag="AWJ20_3753"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880780.1"
                     /db_xref="GeneID:30035809"
     CDS             149580..152039
                     /locus_tag="AWJ20_3753"
                     /inference="similar to AA sequence:KEGG_Orthology:K15631"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733436.1"
                     /db_xref="GeneID:30035809"
                     /translation="MPEAAEVLDGYGYDGKIDEIRKLYYGQLDKNGNDSTVYLDHAGT
                     TLYPTSIVDKFSATLVKNIYGNPHSKSPSSQNTERWIERARGQFLGLFGADVRQYSVV
                     FTANSTAAVKLIGEGLSTLPNSKYTYLKDSHTSLVGLRNLASSFEVTGDIEQYLLSLE
                     RQLEKENSTHSNSDLEVDDFNGNGHKSTSGNSELLSWPAQSNFSGKRYPCEEWLNRVR
                     FINRNNSSSDHRLYTLLDAAAISSSKPIDLLKLNPDFVIISCYKIFGFPDLGALIVKN
                     EVLPQFFANRKYFGGGTLDSLASETDFVARKSLTGSQALEDGTLPFHSIIGLSIAIDE
                     YKRIYGSFDNISLHTSSLAGYLHRQLERLKYSNGQPLVHIYGPNTEEYKIGEHQGPIV
                     AFNLKFPSGEWIGYSDLETIASSQNINLRTGTLCNSGSASTWMNISDSEIISNYSSGH
                     VCGDTNDIMNGKPTGAVRVSLGACSSIGDVDALINCLTDFYLKPFNQELAKAPLTSAK
                     SLTTTARITALSIYPIKSCAAYNISTPWVVGANGLKWDREFCLVNMSSYSVLSLKKYP
                     KMVHILPKIDGDRLLIRYNDNEISVPLRLLPSNSNSETTLKVCGNNIFAQIYTDATVV
                     KFFTSALGIDCTLARIHNDPQPATNTEITREQPGTMVNSSPILLISQSSVNKLSSNTL
                     NSSSSDDDQRSRHQPVDRQIFRANITISGPTPYSEDEWTAIQTDTVNFKVCIKSGIPT
                     PDSSEARGATGSGAEPQPPEATTTRPILTGQLLGKCQRCNMVCVDASTGQRNQAPFKA
                     LHRTRKENVSYSRKKGRKRHC"
     gene            <153893..>154890
                     /gene="UBI4"
                     /locus_tag="AWJ20_3754"
                     /db_xref="GeneID:30035810"
     mRNA            join(<153893..154414,154870..>154890)
                     /gene="UBI4"
                     /locus_tag="AWJ20_3754"
                     /product="ubiquitin"
                     /transcript_id="XM_018880781.1"
                     /db_xref="GeneID:30035810"
     CDS             join(153893..154414,154870..154890)
                     /gene="UBI4"
                     /locus_tag="AWJ20_3754"
                     /inference="similar to AA sequence:KEGG_Orthology:K08770"
                     /note="Ubiquitin; becomes conjugated to proteins, marking
                     them for selective degradation via the ubiquitin-26S
                     proteasome system; essential for the cellular stress
                     response; encoded as a polyubiquitin precursor comprised
                     of 5 head-to-tail repeats; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IC] [PMID 8982460];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0043008 - ATP-dependent protein binding
                     [Evidence TAS] [PMID 8982460]; GO_function: GO:0031386 -
                     protein tag [Evidence ISS] [PMID 3038523]; GO_process:
                     GO:0006281 - DNA repair [Evidence IEA]; GO_process:
                     GO:0030437 - ascospore formation [Evidence TAS] [PMID
                     8982460]; GO_process: GO:0006974 - cellular response to
                     DNA damage stimulus [Evidence IEA]; GO_process: GO:0016579
                     - protein deubiquitination [Evidence TAS] [PMID 8982460];
                     GO_process: GO:0006513 - protein monoubiquitination
                     [Evidence TAS] [PMID 8982460]; GO_process: GO:0000209 -
                     protein polyubiquitination [Evidence TAS] [PMID 8982460];
                     GO_process: GO:0016567 - protein ubiquitination [Evidence
                     IMP] [PMID 8035826]"
                     /codon_start=1
                     /product="ubiquitin"
                     /protein_id="XP_018733437.1"
                     /db_xref="GeneID:30035810"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KTKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTYRQRQD"
     gene            <159786..>161393
                     /gene="INO1"
                     /locus_tag="AWJ20_3755"
                     /db_xref="GeneID:30035811"
     mRNA            <159786..>161393
                     /gene="INO1"
                     /locus_tag="AWJ20_3755"
                     /product="inositol-3-phosphate synthase INO1"
                     /transcript_id="XM_018880782.1"
                     /db_xref="GeneID:30035811"
     CDS             159786..161393
                     /gene="INO1"
                     /locus_tag="AWJ20_3755"
                     /inference="similar to AA sequence:KEGG_Orthology:K01858"
                     /note="Inositol-3-phosphate synthase; involved in
                     synthesis of inositol phosphates and inositol-containing
                     phospholipids; transcription is coregulated with other
                     phospholipid biosynthetic genes by Ino2p and Ino4p, which
                     bind the UASINO DNA element; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0004512 - inositol-3-phosphate synthase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004512 -
                     inositol-3-phosphate synthase activity [Evidence IMP]
                     [PMID 7016881]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA]; GO_process: GO:0006021 - inositol
                     biosynthetic process [Evidence IEA,IEA,IEA]; GO_process:
                     GO:0006021 - inositol biosynthetic process [Evidence IMP]
                     [PMID 7016881]; GO_process: GO:0006629 - lipid metabolic
                     process [Evidence IEA]; GO_process: GO:0008654 -
                     phospholipid biosynthetic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="inositol-3-phosphate synthase INO1"
                     /protein_id="XP_018733438.1"
                     /db_xref="GeneID:30035811"
                     /translation="MAPSVNTHSAATAASQAPGYGKSGFTTVEVQTDKVRVADDAIYS
                     TYAYENAVVEKVDGKYKVKPTVQEYEFKLDTKVPKTGLLLVGLGGNNGSTLTAAVTAN
                     RHNISFNTKNGKIEPNYFGSVTQAATIKLGIDANGKDVYAPFNEIVPLLHPNDFVIGG
                     WDISKLNLAGAMQRAQVLDYDLQRQLVKHLEQIVPLPSIYYPDFIAANQSERADNLIP
                     GEDKWAHVEHIRKDIREFKEKNDLDKVIVLWTANTERYADIIEGVNDTADNLLKAVKE
                     SHSEVSPSTIFAIASILEGVPYINGSPQNTFVPGCIELAEKHNAFIGGDDFKSGQTKL
                     KSVLAQYLVDAGIRPVSVASYNHLGNNDGYNLSAPKQFRSKEISKASVIDDMIESNQI
                     LYNDKYGKTVDHCIVIKYVPAVGDSKVAMDEYHSELMLGGHNTVSIHNVCEDSLLATP
                     LIIDLVVVSEFLSRVTYKKKNSEEDYHQFHSVLSFLSYWLKAPLTRPGFDPVNGLNKQ
                     RAGLENLIRGLVGLAPHNDLKLEERTV"
     gene            complement(<160002..>160460)
                     /locus_tag="AWJ20_3756"
                     /db_xref="GeneID:30035812"
     mRNA            complement(<160002..>160460)
                     /locus_tag="AWJ20_3756"
                     /product="myo-inositol-1-phosphate synthase"
                     /transcript_id="XM_018880783.1"
                     /db_xref="GeneID:30035812"
     CDS             complement(160002..160460)
                     /locus_tag="AWJ20_3756"
                     /codon_start=1
                     /product="myo-inositol-1-phosphate synthase"
                     /protein_id="XP_018733439.1"
                     /db_xref="GeneID:30035812"
                     /translation="MGPLVFTRNQVISTLRLVSGDEIWVVDRRQGNNLLQVLDQLTLK
                     VIVKNLSTLHSTSQIELRDIPTANDEVIRVQKRDNLVERSINILSISINTKLDGSSLS
                     NRTEIVGLNLTILGIERDVVTVGSDSSSQGRTVITTKTNEKQTGLGDLGV"
     gene            complement(<162215..>164302)
                     /gene="KIP2"
                     /locus_tag="AWJ20_3757"
                     /db_xref="GeneID:30035813"
     mRNA            complement(<162215..>164302)
                     /gene="KIP2"
                     /locus_tag="AWJ20_3757"
                     /product="Kip2p"
                     /transcript_id="XM_018880784.1"
                     /db_xref="GeneID:30035813"
     CDS             complement(162215..164302)
                     /gene="KIP2"
                     /locus_tag="AWJ20_3757"
                     /note="Kinesin-related motor protein involved in mitotic
                     spindle positioning; stabilizes microtubules by targeting
                     Bik1p to the plus end; Kip2p levels are controlled during
                     the cell cycle; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005881 - cytoplasmic
                     microtubule [Evidence IDA] [PMID 9693366]; GO_component:
                     GO:0005856 - cytoskeleton [Evidence IEA,IEA];
                     GO_component: GO:0005871 - kinesin complex [Evidence IEA];
                     GO_component: GO:0005871 - kinesin complex [Evidence TAS]
                     [PMID 9153752]; GO_component: GO:0005874 - microtubule
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0008017 - microtubule binding [Evidence IEA];
                     GO_function: GO:0003777 - microtubule motor activity
                     [Evidence IEA]; GO_function: GO:0003777 - microtubule
                     motor activity [Evidence TAS] [PMID 9153752]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0007018 - microtubule-based movement
                     [Evidence IEA]; GO_process: GO:0007067 - mitotic nuclear
                     division [Evidence IEA]; GO_process: GO:0007026 - negative
                     regulation of microtubule depolymerization [Evidence IMP]
                     [PMID 9693366]; GO_process: GO:0030473 - nuclear migration
                     along microtubule [Evidence IMP] [PMID 9693366]"
                     /codon_start=1
                     /product="Kip2p"
                     /protein_id="XP_018733440.1"
                     /db_xref="GeneID:30035813"
                     /translation="MSMSISSSPNKRPPVRPPSVLSLNGMGMPSPSHSRPQTPRLSRR
                     PASSLSLRSPTPSLRRPATPSQYGPMSGSGSAVSPSMSYTGNIKVSVRVKPNVISQQP
                     ESHTAAAVAASSWIVDPANSCISTKEVGDFNFDHVFDGAGLPNSHIYQNSVEPLVEQV
                     MQGFHGTVFAYGMTGSGKTFSMQGTRNDPGIIPLAAESIFNHIDNDPSRSYKVTLGYL
                     EIYNEHLNDLLTPGDKTNPGEETIKLRDDVLRGVRAMGLKEVDVRSSQELLDYIAQGD
                     SIRRTEGTDFNSRSSRSHAVVQISIESIPNSDSTGVRSHQSQHQQLQRLQSTLYLCDL
                     AGSERAVSQSERRKEGAFINKSLLTLGTVIARLSSNNNAGHIPYRDSKLTRLLQPALS
                     GKSLVSVLCTIQTTAYSYIETLSTLRFAARAKNIVVSAKRNDDADPSAKTVERLLQQV
                     AAQKLEIEQLRANGSSGSSSSATSTNGSGLGIGYASSSGSSSGLPSPTLPSMAHMSQL
                     EAENRILHERVEHLSRLCDDSRLEDILGVTADESDLDGDSNKHLQQIEEYKSYIAHLE
                     KQLYNQEINRSINGRETPSESGQSHLSSGSHYNDIIRDLKEEIEELRESNRDKDRIIN
                     ALRASNKRKENLAASLSSTAANSLAYSRYYGSNTVSPPPIAEDRADTAKENIPSDIVP
                     TSKLSEISLETNR"
     gene            <165741..>166356
                     /gene="TPM2"
                     /locus_tag="AWJ20_3758"
                     /db_xref="GeneID:30035814"
     mRNA            join(<165741..165758,165913..>166356)
                     /gene="TPM2"
                     /locus_tag="AWJ20_3758"
                     /product="tropomyosin TPM2"
                     /transcript_id="XM_018880785.1"
                     /db_xref="GeneID:30035814"
     CDS             join(165741..165758,165913..166356)
                     /gene="TPM2"
                     /locus_tag="AWJ20_3758"
                     /inference="similar to AA sequence:KEGG_Orthology:K17945"
                     /note="Minor isoform of tropomyosin; binds to and
                     stabilizes actin cables and filaments, which direct
                     polarized cell growth and the distribution of several
                     organelles; appears to have distinct and also overlapping
                     functions with Tpm1p; TPM2 has a paralog, TPM1, that arose
                     from the whole genome duplication; GO_component:
                     GO:0032432 - actin filament bundle [Evidence IDA] [PMID
                     9864365]; GO_component: GO:0000142 - cellular bud neck
                     contractile ring [Evidence IDA] [PMID 9864365];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005856 - cytoskeleton [Evidence
                     IEA,IEA]; GO_function: GO:0003786 - actin lateral binding
                     [Evidence TAS] [PMID 9153752]; GO_process: GO:0051017 -
                     actin filament bundle assembly [Evidence IGI] [PMID
                     9864365]; GO_process: GO:0007015 - actin filament
                     organization [Evidence TAS] [PMID 10652251]; GO_process:
                     GO:0008154 - actin polymerization or depolymerization
                     [Evidence TAS] [PMID 10652251]; GO_process: GO:0007118 -
                     budding cell apical bud growth [Evidence TAS] [PMID
                     10652251]; GO_process: GO:0007119 - budding cell isotropic
                     bud growth [Evidence TAS] [PMID 10652251]; GO_process:
                     GO:0030010 - establishment of cell polarity [Evidence TAS]
                     [PMID 10652251]; GO_process: GO:0006887 - exocytosis
                     [Evidence TAS] [PMID 10652251]; GO_process: GO:0008298 -
                     intracellular mRNA localization [Evidence TAS] [PMID
                     10652251]; GO_process: GO:0000001 - mitochondrion
                     inheritance [Evidence TAS] [PMID 10652251]; GO_process:
                     GO:0000011 - vacuole inheritance [Evidence TAS] [PMID
                     10652251]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence TAS] [PMID 10652251]"
                     /codon_start=1
                     /product="tropomyosin TPM2"
                     /protein_id="XP_018733441.1"
                     /db_xref="GeneID:30035814"
                     /translation="MDKLRETEAAQEKADEANDKVKTLEQENLQKDQEIASLTHKNSL
                     LEQEVEELESKLNDAKGAAEEGAAHGTQNESLTKKISLLEEELENSDKNLRETTEKLR
                     QTDVKAEHFERKVTSLEQERDDWEKKFEELSEKYSAAKAELDEITQQLESI"
     gene            <166994..>168097
                     /locus_tag="AWJ20_3759"
                     /db_xref="GeneID:30035815"
     mRNA            <166994..>168097
                     /locus_tag="AWJ20_3759"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880786.1"
                     /db_xref="GeneID:30035815"
     CDS             166994..168097
                     /locus_tag="AWJ20_3759"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733442.1"
                     /db_xref="GeneID:30035815"
                     /translation="MEVCTRSGVYRGVGCNNARTGFGFRRFLSSANWSPCNDGNIATI
                     LHVRKLSTLLKKKNRTDSEFTQLTKHSVSRNTLHHSSNIRNGLDQGRRTIDPVGTIRH
                     ARTYATYRGPGRGGLISSVWNLVPAPVRAFTVVAGTAAGFFFISVPLLIICGPPLALG
                     LWLYTRRMKRIANELYHQRWNNLGSYHLTFEDQLDQTAKSQNPADDLFTILMNKAGGA
                     TSDAERIARDRILDAVESDEQNLAGLLNIKNQRDIDNLGLTGLEGIQQDFRGSSQGFQ
                     EKMEIRTLGLVDKAQSPPRRLANVTLVIQSDGYRNKKMRVELEVLAGYLRSSERIILD
                     ANPVGDKSSGSQSSSYAQDTIIEVDPSHYRRTK"
     gene            <173456..>179983
                     /gene="ACC1"
                     /locus_tag="AWJ20_3760"
                     /db_xref="GeneID:30035817"
     mRNA            <173456..>179983
                     /gene="ACC1"
                     /locus_tag="AWJ20_3760"
                     /product="acetyl-CoA carboxylase ACC1"
                     /transcript_id="XM_018880788.1"
                     /db_xref="GeneID:30035817"
     CDS             173456..179983
                     /gene="ACC1"
                     /locus_tag="AWJ20_3760"
                     /inference="similar to AA sequence:KEGG_Orthology:K11262"
                     /note="Acetyl-CoA carboxylase, biotin containing enzyme;
                     catalyzes carboxylation of cytosolic acetyl-CoA to form
                     malonyl-CoA and regulates histone acetylation by
                     regulating the availablity of acetyl-CoA; required for de
                     novo biosynthesis of long-chain fatty acids; ACC1 has a
                     paralog, HFA1, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 9438137]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0003989 - acetyl-CoA
                     carboxylase activity [Evidence IEA,IEA]; GO_function:
                     GO:0003989 - acetyl-CoA carboxylase activity [Evidence
                     IMP,ISS] [PMID 8098706]; GO_function: GO:0004075 - biotin
                     carboxylase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004075 - biotin carboxylase activity [Evidence ISS]
                     [PMID 1350093]; GO_function: GO:0004075 - biotin
                     carboxylase activity [Evidence IMP] [PMID 6108218];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA,IEA]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA,IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006633
                     - fatty acid biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA]; GO_process: GO:0006629 - lipid metabolic
                     process [Evidence IEA]; GO_process: GO:0042759 -
                     long-chain fatty acid biosynthetic process [Evidence IMP]
                     [PMID 6103540]; GO_process: GO:2001295 - malonyl-CoA
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA,IEA];
                     GO_process: GO:0006998 - nuclear envelope organization
                     [Evidence TAS] [PMID 9442897]; GO_process: GO:0006606 -
                     protein import into nucleus [Evidence IMP] [PMID
                     12730220]"
                     /codon_start=1
                     /product="acetyl-CoA carboxylase ACC1"
                     /protein_id="XP_018733443.1"
                     /db_xref="GeneID:30035817"
                     /translation="MATPEDLEANAEYIRMADQYVEVPGGTNNNNYANVELIVDIAER
                     TNVQAVWAGWGHASENPHLPESLAASPKKIVFIGPPGSAMRSLGDKISSTIVAQHAKV
                     PCIPWSGTGVDQVSVDKESGLVSVPDDVYIKGCCTTPEDGLEKAKKIGFPVMIKASEG
                     GGGKGIRKVEHEDKFISLYKQVEAEIPGSPIFIMQLAGNARHLEVQLLADQYGNNISL
                     FGRDCSVQRRHQKIIEEAPVTIARPDTFTAMEKAAVRLGQLVGYVSAGTVEYLYSHAD
                     DKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHNIRDIRLFYGVDPKTQT
                     PIDFDFSTELSKKSQRRPVPKGHTTACRITSEDPGEGFKPSSGMMHELNFRSSSNVWG
                     YFSVGNQGGIHSFSDSQFGHIFAFGENRQASRQHMVVALKELSIRGDFRTTVEYLIKL
                     LETPDFEDNTITTGWLDELISKKLTAERPDPYLAVICGAVTKAHVQCEGIINDYKTSL
                     EKGQAPSKETLKSLFAIDFIYEGERYKFTATRSSQDSYTLFINGSRVDVGVRSLSDGG
                     LLVSIGGKSHSVYWKEEVGATRVSVDAKTCLLEVENDPTQLRTPSPGKLVRFLVESGE
                     RVKAGQPYAEVEVMKMYMPLVAAEDGIVQLIKQPGSTLEAGDILGILALDDPSRVKHA
                     KPFEGQLPEYGPSSLIGNKPSQRFYVLHHILENILSGFDNQVVMNSTLKELIEVLRNP
                     ELPYGEWSQQASALHSRLPAKLDANLSGIVDKAKQRKAEFPAKQLLKAIEKAAPEKAS
                     EAGIYQSVVEPLTKICVRYSEGLVAHEYHVIANLLQEYIDVESLFSGSHSREEDVILR
                     LREENKDNLRKVVMKVWSHSRVGAKNNLILAILSEYQPSKVDSSLIAAHIRPVLKNLV
                     ELESRATAKVVLKAREILIQCALPSLKERSDQLEHILRSSVVESSYGEVGLERRTPSY
                     EVLREVVDSRYTVFDVLIQFFTHPDPYIVLAALELYVRRASRAYVIPELTYHMDSSSP
                     AVCYKFRLPNLNNAAYNALASASAGSSNVSSPDGASSPVRTHFSRAISISDLSFLIGK
                     NDTSPLRTGVVAPAASLDDIDEALSRALELFPRSNGGLEIKVNGGSLAQQRGVPSAAG
                     SNNGSNGQKNPLTNICSVVVSDSDPDASDDDILDRIADVLEDNKDDLVACSVRRLTFL
                     IGGDVGVYPKYFTFRGPDYQEDKTIRHIEPALAFQLELGRLSNFEIKPVFTDNRNIHI
                     YEAVAKNSSSDKRFFTRGIVTPGRIRDDISTPSYLISEANRLMTDILDALEIVETSNT
                     DLNHIFINFTAVFTLDPKQVEDAFGGFLERFGRRLWRLRVTGAEIRIMISDPTSGATF
                     PLRAMINNVSGYVVKTDMYAEVKNNKGDWVYKSLGATPGSMHSRPVNTPYPTKEWLQP
                     KRYKAHLMGTTYCYDFPELFRQAIISQWKKVPNAKVPEDVFSYSELIIDETEQLSEIT
                     REPGANNVGMVAWKCFAKTVEYPAGRKFVVIANDITYKIGSFGPQEDNFFNKVTELAR
                     AEGIPRIYLSANSGARIGVAEEIIPLFSVAWNDAENPSKGFRYLYLTPEHYEQLNKSA
                     KKTVSCEHIVEDGEVRYKIEFIIGAEDGLGVECLKGSGLIAGATSRAYKDIFTITLVT
                     CRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYRNG
                     VSHLTANDDLAGVEKIVNWMSYVPAQRNLPVPILSLGDNWDRDVEFVPSKSEPYDVRW
                     LIAGRENGDHFEAGLFDKGSFQETLSGWAKGVVVGRARLGGIPMGVIGVETRAVENMI
                     PADPANPDSTEVMVQEAGQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSGGQR
                     DMYNEVLKYGSYIVDALVDFKQPIMTYIPPTGELRGGSWVVVDPTINSDMMEMYADAE
                     ARAGVLEPEGMVGIKFRRDKLLSTMKRLDPKYAELCREAERKDITPAETSSIKVKLVE
                     REKLLLPIYQQISVQFADLHDRAGRMEAKNTIRKVLDWQNARRFFFWRVRRRVNEEYL
                     ISRIAKALPKSTRLEQLARLKSLYTGHVENPESDREVAEWLEANAQKLTAAISQLAAD
                     SSVQQIISTLRSATGETAVRAVTEAFKTLSASDREAVLKSLQS"
     gene            complement(<177241..>177642)
                     /locus_tag="AWJ20_3761"
                     /db_xref="GeneID:30035818"
     mRNA            complement(<177241..>177642)
                     /locus_tag="AWJ20_3761"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880789.1"
                     /db_xref="GeneID:30035818"
     CDS             complement(177241..177642)
                     /locus_tag="AWJ20_3761"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733444.1"
                     /db_xref="GeneID:30035818"
                     /translation="MSVLTTYPDTLLIMARRGKVAPEVGSEIMIRISAPVTRRRHRRR
                     PNLSKNPPKASSTCLGSKVKTAVKLMKMWLRSVLEVSTISRASRMSVMRRLASEIRYD
                     GVEISSLIRPGVTIPLVKNLLSEDEFLATAS"
     gene            complement(<180252..>182000)
                     /gene="ERT1"
                     /locus_tag="AWJ20_3762"
                     /db_xref="GeneID:30035819"
     mRNA            complement(<180252..>182000)
                     /gene="ERT1"
                     /locus_tag="AWJ20_3762"
                     /product="Ert1p"
                     /transcript_id="XM_018880790.1"
                     /db_xref="GeneID:30035819"
     CDS             complement(180252..182000)
                     /gene="ERT1"
                     /locus_tag="AWJ20_3762"
                     /note="Transcriptional regulator of nonfermentable carbon
                     utilization; GFP-fusion protein localizes to cytoplasm,
                     nucleus; null mutation affects periodicity of
                     transcriptional and metabolic oscillation; plays role in
                     restricting Ty1 transposition; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19111667]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 19158363]; GO_function: GO:0000981 -
                     sequence-specific DNA binding RNA polymerase II
                     transcription factor activity [Evidence IEA]; GO_function:
                     GO:0004871 - signal transducer activity [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_process: GO:0008150 - biological_process [Evidence ND];
                     GO_process: GO:0006094 - gluconeogenesis [Evidence IEA];
                     GO_process: GO:0006357 - regulation of transcription from
                     RNA polymerase II promoter [Evidence IEA]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA,IEA]; GO_process: GO:0007165 - signal
                     transduction [Evidence IEA]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Ert1p"
                     /protein_id="XP_018733445.1"
                     /db_xref="GeneID:30035819"
                     /translation="MNNTSLQRDTRAVVSLGLGNNGQGPKNDTGLRPQLQSQPLVEDW
                     DTSSSNSMTPILDSSVGMMSSDNSNGNTDRKEVQKNSTHNNSSGGVRKERKEKRPKTS
                     RACIHCQTAHVTCDSGRPCKRCIKKGLESSCRDGNRKRAKYLAGEDPTLIPESNVGIP
                     NIANASLSPLNPLSSSDNRLLPSIPDNLLTGNPGNMGPMAGVTGQLGNGLTGTIPLSA
                     NGQNNGSPPIGPVGSSQNQNSFTPIPQSLEDPFLHNDMSQYSFGSRATNLEYSILSNI
                     LRTNIESQHPQLGNQGNQTTTSTPESDISLQGTYFPELKISDFEALDSGSNPLLLPGS
                     QQQQQQQPHQRQSLQKQQQKPQQTQQQELPLPQQKTELNQSNSVLQTQLSNDVIPHRF
                     NSPEEVYQYVRSPFPYTQGFHELIAYLRSRFDKRHLMHMARAMAAYRPSFIATTKLLK
                     EQDLIFMEQCFQRTLMEFEKIIASSGTPTIIWRRTGQIAAVGKEFCILTGWSPERLVS
                     NTTFIVELMDDKSVTDYFDVFSRLAFGDSRGVSMTECTLLKPNGEKVPTACTWTVKRD
                     VFDIPMMIIGNFLPIL"
     gene            <185275..>187482
                     /gene="AAP1"
                     /locus_tag="AWJ20_3763"
                     /db_xref="GeneID:30035820"
     mRNA            <185275..>187482
                     /gene="AAP1"
                     /locus_tag="AWJ20_3763"
                     /product="Aap1p"
                     /transcript_id="XM_018880791.1"
                     /db_xref="GeneID:30035820"
     CDS             185275..187482
                     /gene="AAP1"
                     /locus_tag="AWJ20_3763"
                     /inference="similar to AA sequence:KEGG_Orthology:K13721"
                     /note="Arginine/alanine amino peptidase; overproduction
                     stimulates glycogen accumulation; AAP1 has a paralog,
                     APE2, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0004177 -
                     aminopeptidase activity [Evidence IEA]; GO_function:
                     GO:0004177 - aminopeptidase activity [Evidence ISS] [PMID
                     8100228]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0008237 -
                     metallopeptidase activity [Evidence IEA,IEA]; GO_function:
                     GO:0008233 - peptidase activity [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_process: GO:0005977 - glycogen metabolic process
                     [Evidence IMP] [PMID 8100228]; GO_process: GO:0006508 -
                     proteolysis [Evidence IEA,IEA]; GO_process: GO:0006508 -
                     proteolysis [Evidence IMP] [PMID 8100228]"
                     /codon_start=1
                     /product="Aap1p"
                     /protein_id="XP_018733446.1"
                     /db_xref="GeneID:30035820"
                     /translation="MEATDCRRAFPSFDEPALKATFDITLVADKELTALSNMDVKEEK
                     ILESGKKATSFNTSPVMSTYLVAFIVGELSYVESNYFRVPVRVYATPGMEDRCKFSAE
                     LGARTLEFFEKKFDVPYPLPKMDMVGIHDFSAGAMENWGLVTYRVVDLLFDEENDNAN
                     TKQRVAEVVQHELAHQWFGNLVTMDWWDGLWLNEGFATWMSWYSCNSFYPDWKVWETY
                     VGDNLQSCLALDSLRSSHPVEVPVKRADEVNQIFDAISYSKGSCIVKMVSIILGEDTF
                     IRGISRYLKRHQYGNTETGDLWKALSEESGLDVAGIMDTWTSKVGFPVLTVSEDGNTI
                     HVRQNRFLATGDVKPEEDTTIYPLSLALRNKSGKVENINLDKREISIDLSKYDASSAF
                     YKLNADQAGLYRTLYPPERVVKLSQAGADNLLSVEDRVGLIADTASLSVSGYQKTSAL
                     LDLISLWKNEKEPNVWMEMLKRFGAIRKTWIFQPESTTDALKQLLGELVLPKVNELGW
                     NFHAEESLLQQQLKGTLFSSAVSSENDKIVKEALSLFEKYASGDAKAVHPNIRAAVFG
                     AAAKYGDEATWQRLVDVYTSPKSSVEGLAAITALGGAKNVDLQKKTIKLTLDGTVRSQ
                     DVFYVLNGLSTNVAGIQILWDWLREEWDAITKKFPANMGLLLNIIYICTGSLATPQHL
                     KEFDEFFKSKDTKGFDKAVSISRDRLVSRIAWLERDVKDVEEWLAKHQSSTKL"
     gene            <194525..>195049
                     /locus_tag="AWJ20_3764"
                     /db_xref="GeneID:30035821"
     mRNA            <194525..>195049
                     /locus_tag="AWJ20_3764"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880792.1"
                     /db_xref="GeneID:30035821"
     CDS             194525..195049
                     /locus_tag="AWJ20_3764"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733447.1"
                     /db_xref="GeneID:30035821"
                     /translation="MSHSGWADSVIPTESVANTDSPWAEIESENKSENKSEDAPGREV
                     VSSATGPSGRSNTPVIRINSSSSTSSSQPDNALTVEGDDDIEVTDAIEGQNEHPFSLS
                     PDLNRSPGQIGVVSSCESSPDAVHTSGDDAHILQKENDDLRTATSESDNIIMELNMDT
                     TVRYLSECWDDIVG"
     gene            <195959..>201064
                     /gene="RIM15"
                     /locus_tag="AWJ20_3765"
                     /db_xref="GeneID:30035822"
     mRNA            <195959..>201064
                     /gene="RIM15"
                     /locus_tag="AWJ20_3765"
                     /product="protein kinase RIM15"
                     /transcript_id="XM_018880793.1"
                     /db_xref="GeneID:30035822"
     CDS             195959..201064
                     /gene="RIM15"
                     /locus_tag="AWJ20_3765"
                     /inference="similar to AA sequence:KEGG_Orthology:K12767"
                     /codon_start=1
                     /product="protein kinase RIM15"
                     /protein_id="XP_018733448.1"
                     /db_xref="GeneID:30035822"
                     /translation="MEDSDAVPAPPLVLCRICERHYTTWWFERHSELCMIEHRAASEL
                     EETHEAVLEHRLVITGLLGALELRMNFHVFDSPLTPSGSTSSYGSVTGRSGSSSGSGS
                     GSIGLGPSAGGGSGSGGVPSLEYRGYTLQLPLFPSDLVSNITSSGPGVTNNAVNIPNT
                     GGSVGSIGSLPSSLGSPGPVTVGSAGSIPINGSPPRSPRLASSPLSSGSNRRALQRPG
                     AIPISASSVPHPFMGKRSPIRIMELLLDLCDAAMQIKNPEIIIDEHNEEGEIRVHAHR
                     SEIKIYEVLNWMPPSSIEDPGLALLCDDTMKFAREKAAAALRMGNTLLYSEKIRRETE
                     LQVQQVIQDIGEKVATERDYDDSMLVDYNSDSRNSQVFFDSDRSSSGRGFRENRLGGV
                     GRKGSNGGASTGSNAGSGIFSNAYLQADVLPNSGNATPPRVPRESNISPYQLPAQPTP
                     TSMLQMQRLNLEDSDSGEHRELSPSPSSFSPSAPAAAPAQPPAPAPSQIPLATPSAAS
                     SPLSQIAHLATAAPASPAAFTTAPAVQGQPSHIASPSMAAPRPIAPLSGNTLTPKLLL
                     NINTSMEHEAISPTRRLSTSDGGYAGYGSAFGSGITPTNVANISSPGGVLLRDRFVTR
                     SRGSGGSSIGSHGSMDINSEDLPTNIGELDLNSPVHSGGTSSGSSSNTASAGPMKLSA
                     RKSMTNMSSARSFGSPITNLQRTRTSGGPAPGPIPAVASTVLASNSPSTPGTSPLLFP
                     RDFDRHHHRQSSAASDFTRAPVSPLLTSTVPPMKVSQPSIRDYEIISPISKGAFGSVY
                     LSKKKVTGEYFAIKVLKKADMIAKNQVMNVKNERAIMMSQADSPYVAKLFATFQSKEY
                     LFLVMEYLNGGDCAALVKALNGVPADWCQQYIAEIVVITENLHQRGIVHRDLKPDNLL
                     IDNRGHLKLSDFGLSRMGAVGRHTRMKDGQTSAPRGGSGSMGTGTATASATTSTGGTV
                     IAAGSGTSTGSGNGGTSTPSGLESPADINALLARSSVFGSINNNATNAFGITPGITGA
                     HENISLVPGYFNYARSASSSYFYDHKSNVRTDSSDSERARDHNSPTPDPSGKNSTNSS
                     MAVDETSTTTNVSQVVKSSSRTSSSSGSTPRVVLYDPDDTSSRRFVGTPDYLAPETIQ
                     GNGQDEMSDWWSVGCIIFEFWYGYPPFHADSPEKVFRNILARNIQWPSELLEDKPGTD
                     LANDLISKLLAVDQKQRLGANGVDEIRQHPFFSKDLDWDHLYDDDQAVFVPAVDNPES
                     TDYFDSRGAVMTEFPDDSAVAGDDDNSMAIESDSSDNNSSKQTGTSPLSTKKEPRMKM
                     LPLHIPPHVHDSTRIRRLSEPSLADDFGSFSFKNLPVLEKANKEVISKIKSETESGRQ
                     RGLSVSAKGSPTSSKVITPAWCSPGQPSSSSPGTFPNTSTSGTHGSSMSSSISNIATH
                     TGSVASSTSDDIFADSESPSRRLQQDLHLSISSIGSKGGDLDSESGSPRHKRHSSSYR
                     RLSNMESSPELGEQYRKQSLASASRNYQVFDMSPSSSDNEDSRGAALLRVQKRRQLSR
                     RMSSFALNVEPSPRALDILVCDGNPVWRYTTEKMLVSLGCRVVTVATGEEAIRRSVGD
                     VIFDIIFVEYKIGKWSGVDITRLIHSTLNPNKSTPVVVMTNLIKEAEETVKQAQEENK
                     TVFSAVIEKPPSEQKLVTALQKVVNWRPKERKK"
     gene            complement(<201367..>203100)
                     /gene="SIS2"
                     /locus_tag="AWJ20_3766"
                     /db_xref="GeneID:30035823"
     mRNA            complement(<201367..>203100)
                     /gene="SIS2"
                     /locus_tag="AWJ20_3766"
                     /product="phosphopantothenoylcysteine decarboxylase
                     complex subunit SIS2"
                     /transcript_id="XM_018880794.1"
                     /db_xref="GeneID:30035823"
     CDS             complement(201367..203100)
                     /gene="SIS2"
                     /locus_tag="AWJ20_3766"
                     /note="Negative regulatory subunit of protein phosphatase
                     1 (Ppz1p); involved in coenzyme A biosynthesis; subunit of
                     phosphopantothenoylcysteine decarboxylase (PPCDC: Cab3p,
                     Sis2p, Vhs3p) complex and the CoA-Synthesizing Protein
                     Complex (CoA-SPC: Cab2p, Cab3p, Cab4p, Cab5p, Sis2p and
                     Vhs3p); SIS2 has a paralog, VHS3, that arose from the
                     whole genome duplication; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IC,IPI] [PMID 9636153]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 7705654];
                     GO_component: GO:0005634 - nucleus [Evidence IPI] [PMID
                     9636153]; GO_component: GO:0071513 -
                     phosphopantothenoylcysteine decarboxylase complex
                     [Evidence IDA] [PMID 19915539]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0004633
                     - phosphopantothenoylcysteine decarboxylase activity
                     [Evidence ISS] [PMID 10592175]; GO_function: GO:0004633 -
                     phosphopantothenoylcysteine decarboxylase activity
                     [Evidence IDA,IMP] [PMID 19915539]; GO_function:
                     GO:0004864 - protein phosphatase inhibitor activity
                     [Evidence IEA]; GO_function: GO:0004864 - protein
                     phosphatase inhibitor activity [Evidence IDA] [PMID
                     9636153]; GO_process: GO:0015937 - coenzyme A biosynthetic
                     process [Evidence IEA]; GO_process: GO:0015937 - coenzyme
                     A biosynthetic process [Evidence ISS] [PMID 10592175];
                     GO_process: GO:0043086 - negative regulation of catalytic
                     activity [Evidence IEA]; GO_process: GO:0007346 -
                     regulation of mitotic cell cycle [Evidence IGI] [PMID
                     10022927]; GO_process: GO:0009651 - response to salt
                     stress [Evidence IGI,IMP] [PMID 9636153]"
                     /codon_start=1
                     /product="phosphopantothenoylcysteine decarboxylase
                     complex subunit SIS2"
                     /protein_id="XP_018733449.1"
                     /db_xref="GeneID:30035823"
                     /translation="MSEVGSDQNTLAQQDQFRHQQQQQQQPQQQQDQQKEQQVPSLKT
                     DSIGETGLIGASGVATTNTGIRPPASTQSSADGTAKAKKEKPNFKLDIMPPSYFQQQS
                     QNASQQAPAESILVKDTSRLSIDSGRAKGATLLPPPNNSTSHNKQPSMHAHFLVNDVV
                     GHQGNSRSRSASGSDRGSDSDFARSAVIESIIKGENKGLNISGGPAGSSNTSLNASRS
                     GSVSGAASGGPSNATSGTSSTHNNGSVAIGGVVSGGNNNGLNLDSTLKSRQGSTVDAI
                     GPDSVVGTLDGIPASTAAGAAQTTASATSNSDPRLPQDDGRIHILIGATGSVSTGKLR
                     QIIHKLEEIYTKPKVSIQVILTKAAEKFVSRGEIPSNIRIWRDSDEWANWRGRSDAVV
                     HIELRRWADILVVAPLSANTLGKIAIGLCDNLLTNVIRAWDTQYPILIAPAMSSYAYN
                     HPATKRHIKTIKEEMKWIETLKPVEKVVGSYGGIGMGGMMDWNEIVDKTIMKLGGYPE
                     NDLEDEDDESIDRTKDDDDDDDDDDDDEDDDEDDDDDNDGQTKRDDRARDVDSDDDTD
                     SRRRRNSVSSF"
     gene            <206522..>208168
                     /gene="PHO80"
                     /locus_tag="AWJ20_3767"
                     /db_xref="GeneID:30035824"
     mRNA            <206522..>208168
                     /gene="PHO80"
                     /locus_tag="AWJ20_3767"
                     /product="Pho80p"
                     /transcript_id="XM_018880795.1"
                     /db_xref="GeneID:30035824"
     CDS             206522..208168
                     /gene="PHO80"
                     /locus_tag="AWJ20_3767"
                     /inference="similar to AA sequence:KEGG_Orthology:K06654"
                     /note="Cyclin; interacts with cyclin-dependent kinase
                     Pho85p; regulates the response to nutrient levels and
                     environmental conditions, including the response to
                     phosphate limitation and stress-dependent calcium
                     signaling; GO_component: GO:0000307 - cyclin-dependent
                     protein kinase holoenzyme complex [Evidence IPI] [PMID
                     8108735]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 9853758]; GO_function: GO:0016538 -
                     cyclin-dependent protein serine/threonine kinase regulator
                     activity [Evidence IDA] [PMID 8108735]; GO_function:
                     GO:0019901 - protein kinase binding [Evidence IEA];
                     GO_process: GO:0006875 - cellular metal ion homeostasis
                     [Evidence IMP] [PMID 20429018]; GO_process: GO:0050849 -
                     negative regulation of calcium-mediated signaling
                     [Evidence IGI] [PMID 16455487]; GO_process: GO:0016242 -
                     negative regulation of macroautophagy [Evidence IMP] [PMID
                     20417603]; GO_process: GO:0045936 - negative regulation of
                     phosphate metabolic process [Evidence IGI] [PMID 3915785];
                     GO_process: GO:0000122 - negative regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IGI] [PMID 3915785]; GO_process: GO:0000079 - regulation
                     of cyclin-dependent protein serine/threonine kinase
                     activity [Evidence IEA]; GO_process: GO:0000079 -
                     regulation of cyclin-dependent protein serine/threonine
                     kinase activity [Evidence IDA] [PMID 8108735]; GO_process:
                     GO:0032880 - regulation of protein localization [Evidence
                     IMP] [PMID 16455487]"
                     /codon_start=1
                     /product="Pho80p"
                     /protein_id="XP_018733450.1"
                     /db_xref="GeneID:30035824"
                     /translation="MSGPGNSDSVNGALAAISVPATAPVTASGSEEHIQQKGHVPETA
                     STSAGLGGATDSTAPRTGAHDLSQNGKGVSAEAVNGASVVNQQQQLLQQECQRQEQQQ
                     EEQQIQQIQQQQQQQQQQQQQQLQQQQHQQQQTSSQTTHVATPSTPLSPRNVKFVSRN
                     FYDCPMNDLVRLVSSMLQELVSLNDALPFKTDQLTRFHSRSAPGISIQDYLIRIIKFC
                     TLEKSIVLSIIYFIDLLCTTYSKFNINSLTVHRFMITAAMVGSKGLCDSFCTNSHYAK
                     VGGVSKVELNLLEVEFLTRVDYRIVPKVELLNQYYESMVARLEGVYAFPAEPSPASAL
                     VSSPPHAGLTPPPFDHDVPSAPATFNGGNGSNTTPTHYSFGHLSHISTPNRASSQPPE
                     FTQTPTAQSNPISDSNMTNSAHHHRSVKVTLREAALSLSKLMLPSDIARKEGRKNRSS
                     VLKRRFSSSFSGSNNSAPDPVTTQSNETDLATVVENDMPVAPAVPADITASLMYDPEG
                     YPSPRKKPNIIDSVPSGPTDVFDEADVDLPMTPKRPKPTP"
     gene            <209713..>210915
                     /gene="ECT1"
                     /locus_tag="AWJ20_3768"
                     /db_xref="GeneID:30035825"
     mRNA            <209713..>210915
                     /gene="ECT1"
                     /locus_tag="AWJ20_3768"
                     /product="ethanolamine-phosphate cytidylyltransferase"
                     /transcript_id="XM_018880796.1"
                     /db_xref="GeneID:30035825"
     CDS             209713..210915
                     /gene="ECT1"
                     /locus_tag="AWJ20_3768"
                     /inference="similar to AA sequence:KEGG_Orthology:K00967"
                     /note="Ethanolamine-phosphate cytidylyltransferase;
                     catalyzes the second step of phosphatidylethanolamine
                     biosynthesis; involved in the maintenance of plasma
                     membrane; similar to mammalian CTP: phosphocholine
                     cytidylyl-transferases; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]; GO_function: GO:0004306 - ethanolamine-phosphate
                     cytidylyltransferase activity [Evidence IEA]; GO_function:
                     GO:0004306 - ethanolamine-phosphate cytidylyltransferase
                     activity [Evidence IDA,IMP,ISS] [PMID 8982874];
                     GO_function: GO:0016779 - nucleotidyltransferase activity
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0009058 -
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006629 - lipid metabolic process [Evidence IEA];
                     GO_process: GO:0006646 - phosphatidylethanolamine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006646 - phosphatidylethanolamine biosynthetic process
                     [Evidence IMP] [PMID 8982874]; GO_process: GO:0008654 -
                     phospholipid biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="ethanolamine-phosphate cytidylyltransferase"
                     /protein_id="XP_018733451.1"
                     /db_xref="GeneID:30035825"
                     /translation="MTHSEINSTETTSTPLREDRYWVDGCFDFTHHGHAGAIRQARKL
                     ANELYVGIHTDEEIYVNKGPVVMKLEERVTAVEACKWCTKSVPGAPYVTDPEVLDSYG
                     CKYVVHGDDITTDADGNDCYQVVKDMGRFVVVKRTPNISTTDLVDRMLSSRTTHHIES
                     ITPSNYSSHVLINDEDSLTRFKDYATAVDAKAPWSGVYVSVDDKTSVLVEPAAGVADK
                     LKKNAFYVDGGFDLFFMGHIEFLRLVHEEAQRSNAVVVVGLHDDATVNSVKGENYPIM
                     NQFERALCVLQCKYVDSVVIGAPFTPDEPFINSLSPHMTIKQVLHGPTPIVGEKGTKT
                     VDPYVYVKEQGIYKQIGPHKYDDVSSNKIVDRVLEYREQYEERQRKKGVKAVNERDLE
                     AIEKATAK"
     gene            <214505..>217816
                     /gene="CHS1"
                     /locus_tag="AWJ20_3769"
                     /db_xref="GeneID:30035826"
     mRNA            <214505..>217816
                     /gene="CHS1"
                     /locus_tag="AWJ20_3769"
                     /product="chitin synthase CHS1"
                     /transcript_id="XM_018880797.1"
                     /db_xref="GeneID:30035826"
     CDS             214505..217816
                     /gene="CHS1"
                     /locus_tag="AWJ20_3769"
                     /inference="similar to AA sequence:KEGG_Orthology:K00698"
                     /note="Chitin synthase I; requires activation from
                     zymogenic form in order to catalyze the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin; required for
                     repairing the chitin septum during cytokinesis;
                     transcription activated by mating factor; GO_component:
                     GO:0045009 - chitosome [Evidence IDA] [PMID 8970154];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 8970154]; GO_function: GO:0004100 -
                     chitin synthase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004100 - chitin synthase activity [Evidence IDA] [PMID
                     7952171]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016757 - transferase
                     activity, transferring glycosyl groups [Evidence IEA];
                     GO_function: GO:0016758 - transferase activity,
                     transferring hexosyl groups [Evidence IEA]; GO_process:
                     GO:0006031 - chitin biosynthetic process [Evidence IEA];
                     GO_process: GO:0007109 - cytokinesis, completion of
                     separation [Evidence IMP] [PMID 2523889]"
                     /codon_start=1
                     /product="chitin synthase CHS1"
                     /protein_id="XP_018733452.1"
                     /db_xref="GeneID:30035826"
                     /translation="MTPNTGPESSGGHAHNQYYSYDDNPDPYGHQDQEEGDRVPLNPS
                     GGPDGLGHMPSPNPYQGGMDQSGMGFGNHDVHGGPPGGPQGYAEDDQYYEYPIGQQHH
                     EPVDNQYYDPYAHTAATPGVGVGPIPGMNPMNHVPPPMPGPPPAPIPPPQPAMPYDTH
                     PINPYSNPPTNPYGNPFENEPAFESQYNLPQEPESYLLKPVYPPPQPLHHAMDTNHSP
                     FSSYFGSTNDDVDDFHPFPVQGDQYALNTYEDDDDTEDSDSSDGRDDSFAYQPPVAPQ
                     PIPAGAAVSGMPLPSGPTPPPIMGAPLPVAPPPNMQPRRAKTMKRVRLFKGNLVLDCP
                     VSGTLLSQFPDDLEGQREFTHMRYSAATCDPKDFKLNGFTMRQNCYTHPRATELFIVI
                     TIYNESDILLGKTLQGVFRNIKHLSSRTRSKTWGKDAWKKVVVCVVADGREKLNPRAR
                     ALMAALGVYQDGLAKNMVNDRPVDAHIYEYTTRVGISHVDTTVKLVTEKTVPVQMIFC
                     LKEHNKKKINSHRWFFQAFGPILNPNICVLLDAGTQPGHDSIYHLWKAFDVNPHVGGA
                     CGEITAGLGTGFRKLLNPLVAAQNFEYKMSNILDKPLESVFGFISVLPGAFSAYRYVA
                     LQNEPLEKYFKGETLHDSGAGIFTANMYLAEDRILCYELVAKRGDRWLLKYVKSAHAE
                     TDVPDKLDELVLQRRRWLNGSFFAAVYAQVHMFAIWRSSHSILRKLSLHLEFLYQMVS
                     MLFSWFSIGNYFLVFRILTSSLSDSSLGFAPGKILSVLFLWIYAGCLVTIFVLSFGNR
                     PSGTAHFYYAIVAFFAFLMAYLMFAAIYISVKSVEYAICANGGFSPALVVKNQTFRDL
                     VISILSTYALYFISSFLFFEPWHMFTSFLQYLLISPSYINVLNVYAFCNIHDISWGTK
                     GDTSQKMDLGVAKLKTTQSKKEILEVDVPTSKEEINSSYLNQISLLRDEAKEEKKVVS
                     KEDKNIDYYAQFRSAVVLSWIFTNVALVAVVLNTAGLNVFNSNSNSSNPNSGTLKRGL
                     DMGIELLKRQTPAAPASPAPAAGAGSGSCSSIGVGEDVQTQIYLSVILWSVAALAAFR
                     FIGSVWYLVLRLMGR"
     gene            <218027..>218737
                     /gene="dtd"
                     /locus_tag="AWJ20_3770"
                     /db_xref="GeneID:30035828"
     mRNA            <218027..>218737
                     /gene="dtd"
                     /locus_tag="AWJ20_3770"
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /transcript_id="XM_018880799.1"
                     /db_xref="GeneID:30035828"
     CDS             218027..218737
                     /gene="dtd"
                     /locus_tag="AWJ20_3770"
                     /note="Fungal Genetics Stock Center 12543"
                     /codon_start=1
                     /product="D-tyrosyl-tRNA(Tyr) deacylase"
                     /protein_id="XP_018733453.1"
                     /db_xref="GeneID:30035828"
                     /translation="MLVYSRFALRRAYTSKCIHEKLFHTSRTLLSEVNPVYPDDSHLT
                     KIKKPGMLFSEPIDPNLRMGYNPLYSSPVGGQIAFTKRWSIGLSLIGSYVGYLVHDVT
                     GASDLAGIIGAAVLIAPLPLVQFFAGNYVTNIYRLYRKDEPQTYENLTKDETIVLERI
                     GLFGRKTYATAVKVQDLRLVNKRFGWVNWEYKDPKTNFSTKFYVADNIGGMKMDRIWG
                     IIEKNSGVDNGRSFLNEP"
     gene            <222301..>223590
                     /locus_tag="AWJ20_3771"
                     /db_xref="GeneID:30035829"
     mRNA            <222301..>223590
                     /locus_tag="AWJ20_3771"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880800.1"
                     /db_xref="GeneID:30035829"
     CDS             222301..223590
                     /locus_tag="AWJ20_3771"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733454.1"
                     /db_xref="GeneID:30035829"
                     /translation="MTQVSYLRALIVGAGSRGRAYTRSLRHLDYIRVTGVAEPSGPRR
                     KKLINYCHQVYPDKVAITEYSDWKESLADSGNYDCVIICVLDDMHREVAVAFANAGKH
                     MLCEKPLATTLEDCEAIVKAVKENNVLLAIGHVLRYSPHNIALKELLDSGVVGEIINI
                     NHTEPVGWYHFAHSYVRGNWRREDTTTFSLMAKCCHDIDVLMWLLGYENLRRVSSFGS
                     LSYFKKENKPEAAGDRCMSCPIEESCAYSAKKIYYDDLAAGRKAWKTKTITDIEDPVH
                     LKKALEEGPYGICVFDADNDVCDNQVVSLDFGKATATMTMIAFSEEVCFRKMCIYGTK
                     GEISTDSRTIKLFDFATRTTKSFTPDTDEESGHGGGDKGLATAFAEALKDVLLHGSSI
                     ENATTKHIKCTPEEVLGSHKVVFLAEQARLNGQVISL"
     gene            <223899..>226607
                     /gene="UTP14"
                     /locus_tag="AWJ20_3772"
                     /db_xref="GeneID:30035830"
     mRNA            <223899..>226607
                     /gene="UTP14"
                     /locus_tag="AWJ20_3772"
                     /product="Utp14p"
                     /transcript_id="XM_018880801.1"
                     /db_xref="GeneID:30035830"
     CDS             223899..226607
                     /gene="UTP14"
                     /locus_tag="AWJ20_3772"
                     /inference="similar to AA sequence:KEGG_Orthology:K14567"
                     /note="Subunit of U3-containing Small Subunit (SSU)
                     processome complex; involved in production of 18S rRNA and
                     assembly of small ribosomal subunit; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 12068309];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0032040 - small-subunit
                     processome [Evidence IEA]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 12068309];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0000480 - endonucleolytic
                     cleavage in 5'-ETS of tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15489292]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000472 - endonucleolytic cleavage to
                     generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0006364 - rRNA processing [Evidence
                     IEA,IEA]; GO_process: GO:0042254 - ribosome biogenesis
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Utp14p"
                     /protein_id="XP_018733455.1"
                     /db_xref="GeneID:30035830"
                     /translation="MAKKGVKKRQNRRALSNRAQNAFNLAQDEEDSRLMRGMEPDIEN
                     DSDREGEDGEKPAYRIGEVASEDDEDIDSDEALGSDDEEIFESHRRKSNKNDDDDEED
                     SDDDGYKSVDESEFVSLSEVWDLDDKDERETSGKDKGSSKERLPNKIDENNLLKLDDE
                     ILSDSESEADSESQDDSESEGGSDSEGGSSGSDSVLSDEFSDLDEDDIDEEKLANLKN
                     MISGMSEEALAEATRKAKKQRLQMMNIQESEFALPVGGQKLSLSDLTAGVTTEKKQDS
                     GLKLLENNSKQTLAVPLAKRIQQKNDRKAAYELTKEEVSKWEETVKKNREAEHLQFPI
                     NPAPQVSKVAAHAPIEPSTELEKKVNNLLTESNLSEEKSVSTFEELAPSKLTMEEVKR
                     RRNELRLMRELMFREEQKARRIKKIKSKSYRKVHKKERERERMMVEGDEESDRESHDI
                     ERARERMSLKHKNTGKWAKRMVEQGFTKDKETRGEMEEMLRRGEDLRKKILDDQDNES
                     DSQEIESAGDDDDDEDDETINEQKESLGKGLLAMKFMKDAEQKERQINKAQREALRNA
                     KNLDDFEDLKDETEDAVNQVVNAGRRKFAPGTSEARDEMLDELEKARDETIIDEEKSL
                     ENVITKAFDSRTNSRTKSKSKHSKSQEPDEAEEEEANPWLTISSNSKQKSKKVNIVDK
                     NSSTQSKSQDKLRKEKEKLRSSSNDDSGDIDMNEVLRIVDPLASDNEEGDDDASEAVA
                     EGQNDMKRVPRKGLTFKQRELVKRAFAGDDVVEEFQEEKRQKIADEGDKEIDVTLPGW
                     GSWGGSSIKKKKKVIKKVQGIQADKRQDARLKNVIINEKVNKKSSKYNASSVPFPYEN
                     REQYERSLRMPIGREWSSRDTFQKLTKPRVIVKQGTVIDPIKAPFK"
     gene            <232657..>235095
                     /gene="XBP1"
                     /locus_tag="AWJ20_3773"
                     /db_xref="GeneID:30035831"
     mRNA            <232657..>235095
                     /gene="XBP1"
                     /locus_tag="AWJ20_3773"
                     /product="Xbp1p"
                     /transcript_id="XM_018880802.1"
                     /db_xref="GeneID:30035831"
     CDS             232657..235095
                     /gene="XBP1"
                     /locus_tag="AWJ20_3773"
                     /note="Transcriptional repressor; binds to promoter
                     sequences of the cyclin genes, CYS3, and SMF2; expression
                     is induced by stress or starvation during mitosis, and
                     late in meiosis; member of the Swi4p/Mbp1p family;
                     potential Cdc28p substrate; relative distribution to the
                     nucleus increases upon DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA,IPI] [PMID 9343412]; GO_function: GO:0003677
                     - DNA binding [Evidence IEA,IEA]; GO_function: GO:0043565
                     - sequence-specific DNA binding [Evidence IDA] [PMID
                     19111667]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19158363]; GO_function:
                     GO:0003700 - sequence-specific DNA binding transcription
                     factor activity [Evidence IEA]; GO_function: GO:0003700 -
                     sequence-specific DNA binding transcription factor
                     activity [Evidence IDA] [PMID 9343412]; GO_process:
                     GO:0042149 - cellular response to glucose starvation
                     [Evidence IMP] [PMID 9343412]; GO_process: GO:0034605 -
                     cellular response to heat [Evidence IMP] [PMID 9343412];
                     GO_process: GO:0034599 - cellular response to oxidative
                     stress [Evidence IMP] [PMID 9343412]; GO_process:
                     GO:0071472 - cellular response to salt stress [Evidence
                     IMP] [PMID 9343412]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA,IEA];
                     GO_process: GO:0006950 - response to stress [Evidence
                     IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Xbp1p"
                     /protein_id="XP_018733456.1"
                     /db_xref="GeneID:30035831"
                     /translation="MSWTPFNGPSGQHEPHGLSDASNQLNGPRRPLPLDSQRAGDASN
                     QSIQYTRSPQTVPLIAPARNVHGRDLLNPTGSSGTGVAPAQPGQHPPSPDLESTSHSD
                     LHLQHQQQHQQQHPYQPSHQRLGSISYQQEHISNQELHLHHQKQNSHQLTGHQNSHIL
                     PSHPRQHLDHQLDHQLDHQHHLHVHGHGPLAVGDSSHAHILPNITGNGHNGHHKSHSD
                     MTNMTRAGQITPPPGHNMSGVAVSASSPLPSSASLSAKPHGLANNRKQSLASSSPKAP
                     PKQRVSRTSHLEPANSPGFPVNYPIYPMVDIGTIPVQQVPLLPLPGSIVMKRYATSVD
                     QRNFLTVYEYMVNNQWVIWDYFTGYVHLTGLWKAVGNSKADIVRLVDNSPDLEPVIKR
                     VRGGFLKIQGTWLPYSVARTLASRTCYHIRYALIPIFGPDFPESCLQPHQPGFGQLQL
                     TTTENPRRRRKRSSVGSISGITGLTSVSTANGVSNGAGAGTGGPGAGELSPNPQSPVQ
                     RKRRQSELAPSTQPFNSHGLASPRSSHASIMNPVLITPAGSKNDNQRQGMSDSNRIMS
                     LSMTSSSGSTATAGLSPLRHHRHSKSIGSIDTSSLAIGGSIVPRLELNRPSYFKRPAY
                     DEDSQAIEFSSSSDDDDDYEAHLVKRAKHDHSDSIHDTTGRTSKPASGSGPVQVPHSP
                     HHRYILPPPMPVKVVFADETELVESPDEFLAVLQATRSLQQLSAGKAGRRWSLNPAST
                     TASGGSFECGGKLWRWDGGQKLTSTGLAADGDSSPKSQVVERVKSLPDRRYSHGDEPI
                     RQRSNVMNINGLIS"
     gene            complement(<235754..>236602)
                     /gene="RSM10"
                     /locus_tag="AWJ20_3774"
                     /db_xref="GeneID:30035832"
     mRNA            complement(<235754..>236602)
                     /gene="RSM10"
                     /locus_tag="AWJ20_3774"
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /transcript_id="XM_018880803.1"
                     /db_xref="GeneID:30035832"
     CDS             complement(235754..236602)
                     /gene="RSM10"
                     /locus_tag="AWJ20_3774"
                     /inference="similar to AA sequence:KEGG_Orthology:K02946"
                     /note="Mitochondrial ribosomal protein of the small
                     subunit; has similarity to E. coli S10 ribosomal protein;
                     essential for viability, unlike most other mitoribosomal
                     proteins; GO_component: GO:0005763 - mitochondrial small
                     ribosomal subunit [Evidence IPI] [PMID 11278769];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IPI] [PMID 11278769]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence IC] [PMID
                     11278769]; GO_process: GO:0006412 - translation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /protein_id="XP_018733457.1"
                     /db_xref="GeneID:30035832"
                     /translation="MNSVRFLAAQCRLATRGVYTPAVRGFRSVSAANSASTPASSQPA
                     SEPVRARMSPSGPYVDDTESYSSEHLYPKEGEYVQSSTEEAYGTGRPVPINVELNHYA
                     PIKHKLTHGHRVADVHLRSFTTQNLDFYADFLLRVAFYLRIPVKGVTPLPNKTEKWTV
                     IRSPFAHAKSKENFQRITHKRLIQLYDANPEVVQVFLATAREYSIGGVGVKATLYHKE
                     GLGVIDKLDLPETGAESSSLNPLSLENVDLGSADSEVARAVLDILEDPVFKPLMDEAK
                     PTQKAE"
     gene            <237120..>237908
                     /gene="BMT2"
                     /locus_tag="AWJ20_3775"
                     /db_xref="GeneID:30035833"
     mRNA            <237120..>237908
                     /gene="BMT2"
                     /locus_tag="AWJ20_3775"
                     /product="Bmt2p"
                     /transcript_id="XM_018880804.1"
                     /db_xref="GeneID:30035833"
     CDS             237120..237908
                     /gene="BMT2"
                     /locus_tag="AWJ20_3775"
                     /inference="similar to AA sequence:KEGG_Orthology:K18849"
                     /note="Nucleolar S-adenosylmethionine-dependent rRNA
                     methyltransferase; methylates adenine (m1A) of the large
                     subunit (LSU) rRNA at position 2142; belongs to Rossmann
                     fold superfamily; green fluorescent protein (GFP)-fusion
                     protein localizes to the nucleolus; YBR141C is not an
                     essential gene; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA,IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 23558746]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_function:
                     GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity [Evidence ISM] [PMID 19351663];
                     GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]; GO_function: GO:0016433 - rRNA (adenine)
                     methyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0016433 - rRNA (adenine) methyltransferase
                     activity [Evidence IMP] [PMID 23558746]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0008150 - biological_process [Evidence ND];
                     GO_process: GO:0032259 - methylation [Evidence IEA];
                     GO_process: GO:0031167 - rRNA methylation [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Bmt2p"
                     /protein_id="XP_018733458.1"
                     /db_xref="GeneID:30035833"
                     /translation="MMKRQASLQAQLDKTIDPAERAGLQDEISRISKALNEEGGLDKY
                     QQASIAGQSTTRGGDSSKILVDWLKDELKTEDQLRTDLSLLEVGCLSVKNACSQSKLF
                     SSIERIDLNSQDPLIKKQDFMERPLPRQNQKETDRFDVISLSLVLNYVPDAVTRGQML
                     YRTTQFLKPPSTPGRPLPALFLVLPSPCTNNSRYLTEERLLQILQTLGYTLTQRKEAK
                     KVVYWLLTLEKPPLTPSQAAKLKGRFKKKLLNDGKIRNNFAVVI"
     gene            complement(<238833..>240815)
                     /gene="AVT1"
                     /locus_tag="AWJ20_3776"
                     /db_xref="GeneID:30035834"
     mRNA            complement(<238833..>240815)
                     /gene="AVT1"
                     /locus_tag="AWJ20_3776"
                     /product="Avt1p"
                     /transcript_id="XM_018880805.1"
                     /db_xref="GeneID:30035834"
     CDS             complement(238833..240815)
                     /gene="AVT1"
                     /locus_tag="AWJ20_3776"
                     /inference="similar to AA sequence:KEGG_Orthology:K15015"
                     /note="Vacuolar transporter; imports large neutral amino
                     acids into the vacuole; member of a family of seven S.
                     cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 11274162];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IMP] [PMID 11274162]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0015186 -
                     L-glutamine transmembrane transporter activity [Evidence
                     IMP] [PMID 11274162]; GO_function: GO:0015188 -
                     L-isoleucine transmembrane transporter activity [Evidence
                     IMP] [PMID 11274162]; GO_function: GO:0005302 - L-tyrosine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11274162]; GO_function: GO:0005215 - transporter activity
                     [Evidence ISS] [PMID 11274162]; GO_process: GO:0006865 -
                     amino acid transport [Evidence IEA]; GO_process:
                     GO:0006865 - amino acid transport [Evidence IMP] [PMID
                     11274162]; GO_process: GO:0006810 - transport [Evidence
                     IEA]; GO_process: GO:0007034 - vacuolar transport
                     [Evidence IMP] [PMID 11274162]"
                     /codon_start=1
                     /product="Avt1p"
                     /protein_id="XP_018733459.1"
                     /db_xref="GeneID:30035834"
                     /translation="MPGTNSQIPSSPDRNGSAAHGSSAWHGGSSTSGLPSSATYGTPG
                     LGTGGTTTTGGGIGSGNLTSSRRSSFFNGAGGGLNSIEHFASSYTRAQSFLAIEPPSE
                     ISRQRSFFDETGSPVIPSSFASRYRPHFDEGTDFTDAIDEDGYESSTYLDDNEDASGH
                     ISTGGTEPSQTDHLLGHNESLYGSYKSTSTSGGYLNIPTHNRRHPRSRRLSLYTAEPD
                     QGTHILGESQAISTGTEQDPVIIQKVEDEDGHITTVIAGQSTAPQTVFNSVNILIGIG
                     LLALPLGFRYAGWVIGCILLVISAASTFYSAKLLAKCLDTDSTIVTYADVAYAAFGSR
                     ARILVSMLFTIELMGAGVSLVVLFSDSLHSLVPSISQLQWKFVAFAILTPPCFLPLRI
                     LSFSSIMGITATFALVVIVLFDGFYKADSPGSLLHPATTWMWPEKWSLLPMSIGIFMA
                     PWGGHAVFPNIYRDMRHPQKYGQCLKTTYKITFLVDASMGVLGFLMFGQDVMDEVTKS
                     ILLTPGYPESLNYLITLLIATIPLAKTPLNARPIVSTLDILFGIDKVEFGDKTSHHFG
                     ARIGKFLVRVSVVASFVLMAIAFPDFDRIIAFFGSLLCVTICMILPLSFYLKLYAGRI
                     SKFELILDYILLVFFSILAIVGTIWCMLPADLIGRE"
     gene            <242840..>243553
                     /locus_tag="AWJ20_3777"
                     /db_xref="GeneID:30035835"
     mRNA            <242840..>243553
                     /locus_tag="AWJ20_3777"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880806.1"
                     /db_xref="GeneID:30035835"
     CDS             242840..243553
                     /locus_tag="AWJ20_3777"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733460.1"
                     /db_xref="GeneID:30035835"
                     /translation="MILASLELVRLQLPTDPWQQDAARARQQAVRKGQNPSFWFGPTG
                     YRAVEYKEWKRRMDQALNKAQNVGKSVNLAKEVYSEIRENNRQLSHKILEELKRENEQ
                     DAQTRENKALIELKEEEGHDIASSSSASTSNSNINSSTSDSRNLNTNNNNNSNGKSAT
                     GEKSRTDSLSVDSLMSAIESLSTTKSDEWDALEPWEKLRLETDIAVRIMPHTRGVQEQ
                     AADKSLSINLSLDDDSPST"
     gene            complement(<243867..>245744)
                     /locus_tag="AWJ20_3778"
                     /db_xref="GeneID:30035836"
     mRNA            complement(<243867..>245744)
                     /locus_tag="AWJ20_3778"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880807.1"
                     /db_xref="GeneID:30035836"
     CDS             complement(243867..245744)
                     /locus_tag="AWJ20_3778"
                     /inference="similar to AA sequence:KEGG_Orthology:K03510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733461.1"
                     /db_xref="GeneID:30035836"
                     /translation="MSKVVISLDLDAFYCAVEQHYDPTLAGDVPFIVYQKNCVATLSY
                     AARNLGLKKLSTVSEAVKKVPGIRLVNGESLAKYRAEGKKILDFVSGLFGGCVPMERL
                     GLEELRIDITKVVDYNMENLRNTGLLDIIRNSGAEVGDESPEGIYLFMTDGDTPTNDS
                     GISGRRVIGGGGGLDGSEADIDKTPSSDPFFCENFFFNVPAKVFPLDRNNALPTFTDS
                     EEHLRCYIGGQLASYIMERLSMDMGYNCSIGLGPNKTIAKMACSLNKPKGLTIVLPEH
                     VQDYLDSTFVSAIPGFGHKTVRRIAEDIAFSDRPGNGLFSTFKRENENPTSAAPIRDS
                     RTPTPDSPLATNSNEAKLSSVEVSPPTLQKPVSIEASPSSNKPVSVETSPSSKKPIST
                     IKSSGGVEKLELHALMDREFGRHLTVYDVRTNLHRTDFVRLFGQKQGSVLWDLMHGID
                     NSPVKQASDIPTQISIEDTYKRIDTFELVKEAIVSLTNSLLYQIHCDLIDSGDLTWRV
                     FPTTFRLTMSRGDFNPYAVRKSKSTRLPPSFFDEMLSISSTPDPTPLSYEVLSRKLFQ
                     DPILALYNQLSTARAGEKLNVRLLNVAVTNFDPTRPTATRSKPSSRQSRGVMDRFLNL
                     K"
     gene            <247766..>248209
                     /gene="YPT7"
                     /locus_tag="AWJ20_3779"
                     /db_xref="GeneID:30035837"
     mRNA            <247766..>248209
                     /gene="YPT7"
                     /locus_tag="AWJ20_3779"
                     /product="Rab family GTPase YPT7"
                     /transcript_id="XM_018880808.1"
                     /db_xref="GeneID:30035837"
     CDS             247766..248209
                     /gene="YPT7"
                     /locus_tag="AWJ20_3779"
                     /inference="similar to AA sequence:KEGG_Orthology:K07897"
                     /note="Rab family GTPase; GTP-binding protein of the rab
                     family; required for homotypic fusion event in vacuole
                     inheritance, for endosome-endosome fusion; interacts with
                     the cargo selection/retromer complex for retrograde
                     sorting; similar to mammalian Rab7; GO_component:
                     GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID
                     11853670]; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 22593205]; GO_component:
                     GO:0005741 - mitochondrial outer membrane [Evidence IDA]
                     [PMID 16407407]; GO_component: GO:0030906 - retromer
                     complex, inner shell [Evidence IPI] [PMID 22593205];
                     GO_component: GO:0005773 - vacuole [Evidence IEA,IEA];
                     GO_function: GO:0005525 - GTP binding [Evidence IEA,IEA];
                     GO_function: GO:0003924 - GTPase activity [Evidence IDA]
                     [PMID 11210571]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006896 - Golgi to
                     vacuole transport [Evidence TAS] [PMID 9714809];
                     GO_process: GO:0006897 - endocytosis [Evidence IMP] [PMID
                     1473149]; GO_process: GO:0034727 - piecemeal
                     microautophagy of nucleus [Evidence IMP] [PMID 18701704];
                     GO_process: GO:0072665 - protein localization to vacuole
                     [Evidence IMP] [PMID 22593205]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA,IEA]; GO_process:
                     GO:0032889 - regulation of vacuole fusion, non-autophagic
                     [Evidence IMP] [PMID 11598008]; GO_process: GO:0032889 -
                     regulation of vacuole fusion, non-autophagic [Evidence
                     IMP] [PMID 7489715]; GO_process: GO:0042147 - retrograde
                     transport, endosome to Golgi [Evidence IPI] [PMID
                     22593205]; GO_process: GO:0007264 - small GTPase mediated
                     signal transduction [Evidence IEA]; GO_process: GO:0006810
                     - transport [Evidence IEA]; GO_process: GO:0000011 -
                     vacuole inheritance [Evidence IDA] [PMID 7489715];
                     GO_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IDA] [PMID 9015302]"
                     /codon_start=1
                     /product="Rab family GTPase YPT7"
                     /protein_id="XP_018733462.1"
                     /db_xref="GeneID:30035837"
                     /translation="MQIWDTAGQERFQSLGVAFYRGADCCVLMYDVNNAKSFEALENW
                     RDEFLIQANPRDPDSFPFVVIGNKIDVEDSKRAVSTKRAQAFCASKGNLPYFETSAKE
                     ATGVEQAFEVVARNALQQEDAQDFSQEYSDAININLDSDSSSCAC"
     gene            <250075..>252407
                     /gene="ACS2"
                     /locus_tag="AWJ20_3780"
                     /db_xref="GeneID:30035839"
     mRNA            join(<250075..250118,250484..>252407)
                     /gene="ACS2"
                     /locus_tag="AWJ20_3780"
                     /product="acetate--CoA ligase ACS2"
                     /transcript_id="XM_018880810.1"
                     /db_xref="GeneID:30035839"
     CDS             join(250075..250118,250484..252407)
                     /gene="ACS2"
                     /locus_tag="AWJ20_3780"
                     /inference="similar to AA sequence:KEGG_Orthology:K01895"
                     /note="Acetyl-coA synthetase isoform; along with Acs1p,
                     acetyl-coA synthetase isoform is the nuclear source of
                     acetyl-coA for histone acetylation; mutants affect global
                     transcription; required for growth on glucose; expressed
                     under anaerobic conditions; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 16857587]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 9711835];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     19618123]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 16857587]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 19618123]; GO_function: GO:0016208 -
                     AMP binding [Evidence IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0003987 -
                     acetate-CoA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0003987 - acetate-CoA ligase activity
                     [Evidence IDA] [PMID 8910545]; GO_function: GO:0016880 -
                     acid-ammonia (or amide) ligase activity [Evidence IDA]
                     [PMID 18305111]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016874 - ligase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006085
                     - acetyl-CoA biosynthetic process [Evidence IDA] [PMID
                     8910545]; GO_process: GO:0019427 - acetyl-CoA biosynthetic
                     process from acetate [Evidence IEA]; GO_process:
                     GO:0016573 - histone acetylation [Evidence IMP] [PMID
                     16857587]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0006090 - pyruvate
                     metabolic process [Evidence IEA]; GO_process: GO:0001302 -
                     replicative cell aging [Evidence IMP] [PMID 19618123]"
                     /codon_start=1
                     /product="acetate--CoA ligase ACS2"
                     /protein_id="XP_018733463.1"
                     /db_xref="GeneID:30035839"
                     /translation="MTALLRQGCYSKLWRKHPSKTHLSSFDHYSQLYKESIENPDKFF
                     GDAARELLSWDRDFKTVSSGGFEHGDVAWFLEGQLNASYNCVDRHAFANPEKIALIYE
                     ADDAKDSRNVTYGELLRQVSKLAAVLTSFGVKKGDTVAIYLPNIPEAIVALLAVTRIG
                     AIHSVIFAGFSSGSLKDRINDAKCKVIITSDEGRRGGKTVYTKKIVDDSLKNAPSIEK
                     VLVFKRTGSEIPWTEGRDFWWHEELDKQRAYSPPVAVNSEDPLFLLYTSGSTGSPKGV
                     VHSTAGYLLGAAITAKHVFDIQEKDILFTAGDVGWITGHTYALYAPLLLGATSVIFEG
                     TPAYPNLSRYWQIIEKYKVTQFYVAPTALRLLKRGGEEFITGHDLSSLRTLGSVGEPI
                     AGEIWEWYHELIGNSECHIADTYWQTETGSHIIAPLAGITPMKPGSASFPFFGIDLAI
                     IDPVTGKELVGNDVEGVLAVKKPWPSIARSVWGAHQRYLDTYLKPYPGLYFTGDGAAR
                     DHEGFYWIRGRVDDVVNVSGHRLSTAEIEASLIEHHSVAESAVVGVSDDLTGQAVIAF
                     VSLKDGFDHTQEIKKELIMHVRKEIGPFAAPKTVIVIDDLPKTRSGKIMRRILRKIVS
                     NEADSIGDISTLNNPQSVDQIIAAVDIQLKK"
     gene            <253907..>254410
                     /locus_tag="AWJ20_3781"
                     /db_xref="GeneID:30035840"
     mRNA            <253907..>254410
                     /locus_tag="AWJ20_3781"
                     /product="Usp (universal stress protein) family protein"
                     /transcript_id="XM_018880811.1"
                     /db_xref="GeneID:30035840"
     CDS             253907..254410
                     /locus_tag="AWJ20_3781"
                     /codon_start=1
                     /product="Usp (universal stress protein) family protein"
                     /protein_id="XP_018733464.1"
                     /db_xref="GeneID:30035840"
                     /translation="MALEERQYRFEGERFLRQILAKNVNNKKLSLIVEFPVGKIEDMI
                     QRMIQIYEPAILVVGTRGRSMDGFKGLLLPGSVSKYCLQHSPVPVIVVRGIQKLAKRK
                     AKRDADPARRAYREMLYQAQLPAMKLYPQGSTGKQLAPTIPAFLRPDHYGSRSATPSR
                     PSTPAGH"
     gene            complement(<254505..>255671)
                     /gene="RAD10"
                     /locus_tag="AWJ20_3782"
                     /db_xref="GeneID:30035841"
     mRNA            complement(<254505..>255671)
                     /gene="RAD10"
                     /locus_tag="AWJ20_3782"
                     /product="Rad10p"
                     /transcript_id="XM_018880812.1"
                     /db_xref="GeneID:30035841"
     CDS             complement(254505..255671)
                     /gene="RAD10"
                     /locus_tag="AWJ20_3782"
                     /inference="similar to AA sequence:KEGG_Orthology:K10849"
                     /note="Single-stranded DNA endonuclease (with Rad1p);
                     cleaves single-stranded DNA during nucleotide excision
                     repair and double-strand break repair; subunit of
                     Nucleotide Excision Repair Factor 1 (NEF1); homolog of
                     human ERCC1 protein; GO_component: GO:0000110 -
                     nucleotide-excision repair factor 1 complex [Evidence IPI]
                     [PMID 8621533]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 9852079]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0003684 -
                     damaged DNA binding [Evidence IEA]; GO_function:
                     GO:0004519 - endonuclease activity [Evidence IEA,IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0004518 - nuclease activity
                     [Evidence IEA]; GO_function: GO:0003697 - single-stranded
                     DNA binding [Evidence IDA] [PMID 1741062]; GO_function:
                     GO:0000014 - single-stranded DNA endodeoxyribonuclease
                     activity [Evidence IDA] [PMID 8253764]; GO_process:
                     GO:0006277 - DNA amplification [Evidence IMP] [PMID
                     23271978]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA,IEA]; GO_process: GO:0000733 - DNA strand renaturation
                     [Evidence IDA] [PMID 1741062]; GO_process: GO:0006974 -
                     cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0000736 - double-strand break repair via
                     single-strand annealing, removal of nonhomologous ends
                     [Evidence IMP] [PMID 7891718]; GO_process: GO:0000710 -
                     meiotic mismatch repair [Evidence IMP] [PMID 11514439];
                     GO_process: GO:0006312 - mitotic recombination [Evidence
                     IMP] [PMID 2188090]; GO_process: GO:0006296 -
                     nucleotide-excision repair, DNA incision, 5'-to lesion
                     [Evidence IDA] [PMID 7559571]; GO_process: GO:0000735 -
                     removal of nonhomologous ends [Evidence IMP] [PMID
                     7891718]"
                     /codon_start=1
                     /product="Rad10p"
                     /protein_id="XP_018733465.1"
                     /db_xref="GeneID:30035841"
                     /translation="MEADRTAAILKAAAALRGKSGNNNGSSNSNGASSGSAPPSNQAT
                     PGGSNSNSAPAPPLATSTVARTGIQISGTNIPILNSRQTGASATSTSYSSGSSTAANG
                     SGSGPSKRSYGASSVPGPSGHYRAANSGMSTYSRASPTTSSSLPTNTTSASSATPGST
                     STAKANTTSSIIVNAKKQKQNPVLKHIRGVGYYMDDIVPDFITGHNSCALFLSIKYHN
                     IHKEYIYKRIQQLNKAFEHRVLLVLVDVDNPAAALLELDIISLRAGLQMIITWNMEEA
                     GKYLVLLKQLENASATGISGQKKESYKEQLIEVMNRISRSSINKTDAVTLVANFGSLK
                     NAILDGGDNVELIHGWGSTKAKVFRDAINEPFINHRQYDMKPYKSESQVDSELP"
     gene            <258775..>259539
                     /locus_tag="AWJ20_3783"
                     /db_xref="GeneID:30035842"
     mRNA            <258775..>259539
                     /locus_tag="AWJ20_3783"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880813.1"
                     /db_xref="GeneID:30035842"
     CDS             258775..259539
                     /locus_tag="AWJ20_3783"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733466.1"
                     /db_xref="GeneID:30035842"
                     /translation="MSSNTIYFVSGGNRGIGFALVKKLSSLANSVVITTARSPAKATD
                     LKDWQKEHSNVHVLKYDASVHNDATELATQIEKLTGGIDVFVANSGISEEPMTVLETP
                     IESWTRLYAINTLGPIVLFKALYPLIAKRDTRKVVFISSGLGSQKNMSDAFGTSSYGQ
                     SKSALNFTAKELSLELAKENFVVVPVHPGLVNTEMGSGYVDNLGKNSGEFADVLRANV
                     MITTEQSADGIANVIATLSKEDSGKFLGYDRSTLEW"
     gene            complement(<261086..>261400)
                     /gene="DTD1"
                     /locus_tag="AWJ20_3784"
                     /db_xref="GeneID:30035843"
     mRNA            complement(<261086..>261400)
                     /gene="DTD1"
                     /locus_tag="AWJ20_3784"
                     /product="Dtd1p"
                     /transcript_id="XM_018880814.1"
                     /db_xref="GeneID:30035843"
     CDS             complement(261086..261400)
                     /gene="DTD1"
                     /locus_tag="AWJ20_3784"
                     /inference="similar to AA sequence:KEGG_Orthology:K07560"
                     /note="D-Tyr-tRNA(Tyr) deacylase; functions in protein
                     translation, may affect nonsense suppression via
                     alteration of the protein synthesis machinery; ubiquitous
                     among eukaryotes; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0097358 - D-leucyl-tRNA(Leu) deacylase activity
                     [Evidence IMP] [PMID 10918062]; GO_function: GO:0051500 -
                     D-tyrosyl-tRNA(Tyr) deacylase activity [Evidence IMP]
                     [PMID 10766779]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0016788 -
                     hydrolase activity, acting on ester bonds [Evidence IEA];
                     GO_process: GO:0019478 - D-amino acid catabolic process
                     [Evidence IEA]; GO_process: GO:1900832 - D-leucine
                     catabolic process [Evidence IMP] [PMID 10918062];
                     GO_process: GO:1900829 - D-tyrosine catabolic process
                     [Evidence IMP] [PMID 10918062]; GO_process: GO:0006399 -
                     tRNA metabolic process [Evidence IMP] [PMID 10918062]"
                     /codon_start=1
                     /product="Dtd1p"
                     /protein_id="XP_018733467.1"
                     /db_xref="GeneID:30035843"
                     /translation="MPNFQEKVLTNKSVSQFTLLAKTKKGAKPDFHAAAKGDHARTLY
                     NKVLEEVAKGLPGGQSRVGDGVFGAMMDVALVNDGPVTIQLDSKETKSGNILQPSPTP
                     PQ"
     gene            <262458..>265166
                     /gene="pof10"
                     /locus_tag="AWJ20_3785"
                     /db_xref="GeneID:30035844"
     mRNA            <262458..>265166
                     /gene="pof10"
                     /locus_tag="AWJ20_3785"
                     /product="F-box protein Pof10"
                     /transcript_id="XM_018880815.1"
                     /db_xref="GeneID:30035844"
     CDS             262458..265166
                     /gene="pof10"
                     /locus_tag="AWJ20_3785"
                     /codon_start=1
                     /product="F-box protein Pof10"
                     /protein_id="XP_018733468.1"
                     /db_xref="GeneID:30035844"
                     /translation="MHSQASGSTDTPKTSEIATESATVSADTTATSSQHVSQEYEPEA
                     VESATADSSFDNSNITSDGSSAEDEATDLDQITDNAIKISGYERHLDQDVDEVIPSHR
                     RSNVTSNLPFQSLSSDRKLKGKTSNNPFAVPPSVAENLPNEILVSVFSYLSPGCLDAA
                     SLVCRKWHQAASEASWRASFLRHFSSAKFNRVTSSLKWRTELMTRLDYLHKWKKGHCN
                     NLSFNALIWNISHVFCDFEASRITAFSIWRGIGTIADPTRGKVANQRVFTNKMLQAVA
                     DESCVDGSRFGLIYGFFSDGRVQATLFSHETRLRDYVTMKGPRHFGDVSAVWINKLES
                     PRTTNKVAALSAGEDGHVFQWEFNTCKLVRDFAVCPQYTDGEDEEGKPKIVKSRRIIH
                     IQCDSKDKIVCINSHGEVFASVGGSEFVLIGCFIHPVVQDDTSAVSVVSYFDVDFSSN
                     YVVYAHGQYAMRFKLTLDKSKFESVHFSLGGMSPHGYITAISMDHTTFPQSDLSTDTP
                     GLNFRYVAAATSDNLVFVWLLQDNADENGSIAPLRRSESPFQVSEESQIGGVLPNEIP
                     EFRPSISAIALNSMVLLLGSYNGVTVALDLLTGEFLRVVSARFSKRALNLRATEDPNS
                     VSLWPITHLEIDPDPANPHGIIVVRSAIQYFDLGADLRKSTIKKKGVQKKRNARVPYE
                     GQGLSRARLSEDIEMDLEMMELEDEEIDEARQHRQHLDGYLAHDLSEEDQLKYAMLLS
                     EEAAKKESQPKTEEEEDEEMRRAIDLSIAESGAAASLPSSSQTNEKASSSKHLDSPPP
                     SYDDMDEDLKLAIELSRAEAGTSDAESLYAVPNYINRGESSTHNQSDQEQLDLELKLA
                     IEMSKEDSGYISDSQLYDPPSAGANPDYDSDLELAMRLSLSEANKS"
     gene            complement(<265219..>267531)
                     /locus_tag="AWJ20_3786"
                     /db_xref="GeneID:30035845"
     mRNA            complement(<265219..>267531)
                     /locus_tag="AWJ20_3786"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880816.1"
                     /db_xref="GeneID:30035845"
     CDS             complement(265219..267531)
                     /locus_tag="AWJ20_3786"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733469.1"
                     /db_xref="GeneID:30035845"
                     /translation="MLSASISRDFTTASLVCNLGYTLQSMACGFFVNAPTMPVYVRWT
                     RWIAYVYYAFGTVVSNQFNGFLGDCPYDLADDRCDPYTGEYILQTLGFPKNWILVPMM
                     VNIGWAVGFHILAYLLLKYVRVSVAVSKTFTVKKIEEVAAVPSTRSDSARSEITVTLN
                     DIRLSVIRRQRLGLTTREIEILRGISATFVPGSINAILGPSGSGKSSLLNFMADRLHS
                     SFNQKYMSTGDIIFNDKLPSRSLVRSLCSYVTQEDDGLLPSLTVRETLYYAADLRLPK
                     TMSKQEKRARANEIIMKMGLKDCADTLIGGEFVKGISGGEKRRVTISIQLLNDPKILL
                     LDEPTSGLDSFIASSILQVLKALAEEGRTIICTIHQPRSDLFAQFGNILLLAKGGRVA
                     YNGQSTQMLDYFASLNHPCPPLTNPADFVLDLVSVNLQSEEKESISRLKVTKLLDHWQ
                     NVEDPALERPLVDAHLGLAAAEAEFSSQVREPSKFLPAYQTLLRRSTLNFSRSPHMIV
                     ARIMQVAGIGIIFALFFSPLKDDMIGVTNRLGLVQEITALYFVGMLNNMAIYPYDRSV
                     FYREHDDNVYGVLPFFLVYLTLELPFECITSLIFAVFLVLVPGLPRTPELFFACAYCA
                     LAIVNCGESIGIAFNTLFLHEGFAVNLISVVLSIGCLMAGIMSLEMPGFLKGVNWLSP
                     LKYAVSVMINMSFDGQTFNCVGQAIDADGGCEFDSGAKVLENYGLKANVPAYLGGIAV
                     AAVVYRVLALVVLKINRLKLGIKTLSRNSR"
     gene            complement(<267669..>269339)
                     /locus_tag="AWJ20_3787"
                     /db_xref="GeneID:30035846"
     mRNA            complement(<267669..>269339)
                     /locus_tag="AWJ20_3787"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880817.1"
                     /db_xref="GeneID:30035846"
     CDS             complement(267669..269339)
                     /locus_tag="AWJ20_3787"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733470.1"
                     /db_xref="GeneID:30035846"
                     /translation="MSEASSSQYLDDIGQLTYEESTLSPIDAGFSPVGSKGQEKEVEQ
                     NIEIDSSPLSTVQSTGLTLSSIDKVTVNVRNLSLTVAPTDPASLLGRLLKVKSALGGG
                     SKSEEDAESSTGTSLVETWHDNEKTIDSNAPDVLSGSRKKILQNISVDVPAGSMMAII
                     GGSGSGKTSLLNVMAYRMGSRNLHCEGSVTFNGNPNINHVRNAYVMQQDVLQPNLTCR
                     ETLVYAANLRLPSSTSRQQRADLVEEIILELGLKECANTLVGDTAHKGLSGGEKRRLS
                     IGIQLLANPSVLFLDEPTTGLDANSAFLLVETCKKLVLKGRTIIMSIHQPRSDIFFLF
                     DSVTILTRGQAVYSGSVRDVLPYIEQLGYNFPTHMNPADFLIDLSAIDTRTAEQEVKT
                     KRVVNRLLAAWIANQRFGPVMQPDSVPPSSSAALAKAPLWREIAVLTKRSFIVSMRDP
                     MGLVGLLLECVLMGTICGWIFFKLDGSISGIRSMEGLLYTSCAAQGYLILLYETYRLC
                     GPDLRVFDREYNDGSVGPFGYLISRRLSKMFTEDLYVPLIYSVSNILF"
     gene            <274120..>275625
                     /gene="GPR1"
                     /locus_tag="AWJ20_3788"
                     /db_xref="GeneID:30035847"
     mRNA            <274120..>275625
                     /gene="GPR1"
                     /locus_tag="AWJ20_3788"
                     /product="Gpr1p"
                     /transcript_id="XM_018880818.1"
                     /db_xref="GeneID:30035847"
     CDS             274120..275625
                     /gene="GPR1"
                     /locus_tag="AWJ20_3788"
                     /inference="similar to AA sequence:KEGG_Orthology:K12762"
                     /note="Plasma membrane G protein coupled receptor (GPCR);
                     interacts with the heterotrimeric G protein alpha subunit,
                     Gpa2p, and with Plc1p; sensor that integrates nutritional
                     signals with the modulation of cell fate via PKA and cAMP
                     synthesis; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 10655215]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 9388468];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9524122]; GO_function: GO:0004930 - G-protein
                     coupled receptor activity [Evidence IEA]; GO_function:
                     GO:0004930 - G-protein coupled receptor activity [Evidence
                     IPI] [PMID 9388468]; GO_function: GO:0004930 - G-protein
                     coupled receptor activity [Evidence IMP,IPI,ISS] [PMID
                     9524122]; GO_function: GO:0005536 - glucose binding
                     [Evidence IMP] [PMID 15494315]; GO_function: GO:0004871 -
                     signal transducer activity [Evidence IEA]; GO_process:
                     GO:0007186 - G-protein coupled receptor signaling pathway
                     [Evidence IEA]; GO_process: GO:0007186 - G-protein coupled
                     receptor signaling pathway [Evidence IPI] [PMID 9388468];
                     GO_process: GO:0007186 - G-protein coupled receptor
                     signaling pathway [Evidence IMP,IPI] [PMID 9524122];
                     GO_process: GO:0051594 - detection of glucose [Evidence
                     IMP] [PMID 15494315]; GO_process: GO:0009731 - detection
                     of sucrose stimulus [Evidence IMP] [PMID 15494315];
                     GO_process: GO:0010255 - glucose mediated signaling
                     pathway [Evidence IGI,IMP] [PMID 10361302]; GO_process:
                     GO:0010255 - glucose mediated signaling pathway [Evidence
                     IMP] [PMID 15494315]; GO_process: GO:0010255 - glucose
                     mediated signaling pathway [Evidence IMP] [PMID 9813141];
                     GO_process: GO:0009757 - hexose mediated signaling
                     [Evidence IMP] [PMID 10655215]; GO_process: GO:0009757 -
                     hexose mediated signaling [Evidence IGI,IMP] [PMID
                     9813141]; GO_process: GO:0001403 - invasive growth in
                     response to glucose limitation [Evidence IMP] [PMID
                     12150916]; GO_process: GO:0007124 - pseudohyphal growth
                     [Evidence IMP] [PMID 10655215]; GO_process: GO:0001302 -
                     replicative cell aging [Evidence IMP] [PMID 15722108];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IEA]; GO_process: GO:0009745 - sucrose mediated signaling
                     [Evidence IMP] [PMID 15494315]"
                     /codon_start=1
                     /product="Gpr1p"
                     /protein_id="XP_018733471.1"
                     /db_xref="GeneID:30035847"
                     /translation="MSDYYDSDTSKVNNYSAYQALVLRWVSVSSSCLSIVFGLAALYF
                     YTNMKTKVFRHHLILLLLLFDFGKAVVLLWYPARVLLVASAYDNINFCDVVGFFTSAF
                     IEGADLAVLALAIHTALLIFKKYKGPEGGLYRYRYWVYALTIIIPLIMAALVFVEGRK
                     SYRPYITWCYLPVRPLWYRLVLSWIPRYIIIVTIVSIYVAIYIYVKLQYREVVRNFSQ
                     SQSYVDKYDAKLVGKGIRPRFRRGWRMFKAGTLSFLSYFPGFAFLATSNENITDSPSQ
                     PIDVQANTIAEFQRASMADFQFRRSVIERQIRSIFVYPTAYVFLWLAPFALQCLQFRS
                     DLTKSTVFWVNAIAAFMQPFNCVVDTIAFFIRETPWRNREERVFKKETGRKILRGLSI
                     RRTDGCKWNSSRSPSSPSSDKPSRNTQESDLYTPDIKGGYDVVELQTRGRQYSNDDIM
                     TGGSSSTNYSPKHTVYPPFPGNELVRSDNLDAESDADIDIFEFLKGPPPHP"
     gene            complement(<275748..>276599)
                     /gene="RKM5"
                     /locus_tag="AWJ20_3789"
                     /db_xref="GeneID:30035848"
     mRNA            complement(<275748..>276599)
                     /gene="RKM5"
                     /locus_tag="AWJ20_3789"
                     /product="Rkm5p"
                     /transcript_id="XM_018880819.1"
                     /db_xref="GeneID:30035848"
     CDS             complement(275748..276599)
                     /gene="RKM5"
                     /locus_tag="AWJ20_3789"
                     /note="Protein lysine methyltransferase; monomethylates
                     Lys-46 of the ribosomal large subunit Rpl1a/Rpl1b; member
                     of the seven beta-strand methyltransferase superfamily;
                     orthologs only found among fungal species; GO_component:
                     GO:0005575 - cellular_component [Evidence ND];
                     GO_function: GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity [Evidence ISM] [PMID 19351663];
                     GO_function: GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity [Evidence IDA] [PMID 21460220];
                     GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0032259 -
                     methylation [Evidence IEA]; GO_process: GO:0006479 -
                     protein methylation [Evidence IDA] [PMID 21460220]"
                     /codon_start=1
                     /product="Rkm5p"
                     /protein_id="XP_018733472.1"
                     /db_xref="GeneID:30035848"
                     /translation="MLTQDLEPVDEDSLYDHVYELIVSRAGSSQSELGLGYVSRTDLV
                     EISVGDQELEIKQSLSMLNSSQESSTTGAVIWKVSPLFADWLLTETSLFNKTIVNSSQ
                     TVVELGTGVAGIVAATLGQKVGRYIATDQEHILKLLSYNIENNTASSKISSKKRVKAA
                     AVPSQISVCEYDWEHLETFGNFKDGIEGLGSNGTIIACDTIYNDYLIPHFVNALLTVA
                     KTMGPEHNIIIAQQLRTHEILEASLSQLLEAGFNVWSVPDELLSKKLRNGFAVHYLQL
                     PLEDKSF"
     gene            complement(<276882..>277388)
                     /gene="HOM2"
                     /locus_tag="AWJ20_3790"
                     /db_xref="GeneID:30035850"
     mRNA            complement(<276882..>277388)
                     /gene="HOM2"
                     /locus_tag="AWJ20_3790"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /transcript_id="XM_018880821.1"
                     /db_xref="GeneID:30035850"
     CDS             complement(276882..277388)
                     /gene="HOM2"
                     /locus_tag="AWJ20_3790"
                     /inference="similar to AA sequence:KEGG_Orthology:K00133"
                     /note="Aspartic beta semi-aldehyde dehydrogenase;
                     catalyzes the second step in the common pathway for
                     methionine and threonine biosynthesis; expression
                     regulated by Gcn4p and the general control of amino acid
                     synthesis; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA]; GO_component: GO:0005737 - cytoplasm [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 16622836];
                     GO_function: GO:0003942 -
                     N-acetyl-gamma-glutamyl-phosphate reductase activity
                     [Evidence IEA]; GO_function: GO:0051287 - NAD binding
                     [Evidence IEA]; GO_function: GO:0050661 - NADP binding
                     [Evidence IEA]; GO_function: GO:0004073 -
                     aspartate-semialdehyde dehydrogenase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004073 - aspartate-semialdehyde
                     dehydrogenase activity [Evidence IDA] [PMID 4145650];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]; GO_function: GO:0016620 - oxidoreductase
                     activity, acting on the aldehyde or oxo group of donors,
                     NAD or NADP as acceptor [Evidence IEA]; GO_function:
                     GO:0046983 - protein dimerization activity [Evidence IEA];
                     GO_process: GO:0006531 - aspartate metabolic process
                     [Evidence IEA]; GO_process: GO:0008652 - cellular amino
                     acid biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0006520 - cellular amino acid metabolic process
                     [Evidence IEA]; GO_process: GO:0009090 - homoserine
                     biosynthetic process [Evidence IMP] [PMID 4380684];
                     GO_process: GO:0009097 - isoleucine biosynthetic process
                     [Evidence IEA]; GO_process: GO:0009085 - lysine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0009089 - lysine biosynthetic process via
                     diaminopimelate [Evidence IEA,IEA]; GO_process: GO:0009086
                     - methionine biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0009086 - methionine biosynthetic process
                     [Evidence IMP] [PMID 4380684]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0009088 - threonine biosynthetic process
                     [Evidence IEA,IEA,IEA]; GO_process: GO:0009088 - threonine
                     biosynthetic process [Evidence IMP] [PMID 4380684]"
                     /codon_start=1
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="XP_018733473.1"
                     /db_xref="GeneID:30035850"
                     /translation="MDILDNIIPYISGEEDKLETEPRKILGAVSSDKVSFSIIPENEM
                     KISATTTRVPVTDGHTACVSIKFAKQPAPSIAEIEKVLSEYTCEAQQLGCHSAPAHAI
                     DVLSQPNRPQPRLDRDRGNGYTVSVGRIRPDPVLDVKFVALSHNTVLGAAGSGILIAE
                     LLLAKNLL"
     gene            <278542..>281805
                     /gene="HOS4"
                     /locus_tag="AWJ20_3791"
                     /db_xref="GeneID:30035851"
     mRNA            <278542..>281805
                     /gene="HOS4"
                     /locus_tag="AWJ20_3791"
                     /product="Hos4p"
                     /transcript_id="XM_018880822.1"
                     /db_xref="GeneID:30035851"
     CDS             278542..281805
                     /gene="HOS4"
                     /locus_tag="AWJ20_3791"
                     /note="Subunit of the Set3 complex; complex is a
                     meiotic-specific repressor of sporulation specific genes
                     that contains deacetylase activity; potential Cdc28p
                     substrate; GO_component: GO:0034967 - Set3 complex
                     [Evidence IDA] [PMID 11711434]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0016575 -
                     histone deacetylation [Evidence IDA] [PMID 11711434];
                     GO_process: GO:0045835 - negative regulation of meiosis
                     [Evidence IPI] [PMID 11711434]"
                     /codon_start=1
                     /product="Hos4p"
                     /protein_id="XP_018733474.1"
                     /db_xref="GeneID:30035851"
                     /translation="MASDNVASSDTGPVNDEGSTGSGNGNSTSPSGGGSNSGPPSSGW
                     RFSASTASTKPGAVINKRTLAEYNSSLSTKNQATQAKQQTNQENLTEQKSESNKGHRE
                     TRENYDRKVGDDMENDDSTAETDDAHEADSSEAETVILEESKEPKRRNLSVVESGNGS
                     NDSGVKIKIRKLSDASEGRSAHSKSNKPLKRLQKRIHVSDDDDDDEYSGDKDDSENEN
                     DNDDHEHRNEQRHNRQPFQRAGGASGTLSDSDDWNDPRGRVKSRSRDTSRNSSSSTAA
                     NANRKVKSVVTAKMRKDGRSHVKDTDDGKHSRSVSPAVRSGNHNVTASGLTMPVQPIR
                     KDGSPIRDASGRLLLQKLCDKGDFERSKALIEMGVDVNDRDYAGNTALHDAALKGHLN
                     IVELLLDNGAIIDIRSGISDLDTPLIDATSRGHVEVVKLLLSRGADPRIFNAQGKTAL
                     DFLSQDDEHFNTLESLLKEYSIKMRNKPRRGSDTGGAEDENNGGNGSAANNSAYDAAL
                     HATPGTFPDAYFEGRRGGGNYSDGGYSSSGSQSGHRQKHSHNNQVSHGHNNHHHHHNR
                     SHSPSHTHNHGTGHHTTSGDADESSSLSHDEGSKSSSSHTRRRGGARSQSIRNDLLWM
                     DLTTKTGREQVYRRAADGDLQYVGRSLEEGWQPDADCLVLAAKHGHTEVVGLLLAFGV
                     SSDQLNDEGVTALHETVGRGHMDTIRLLLDSGADPCWVDAQGRSYLDLAKEALGSDDE
                     ETILIRDAVDKKKKIPGKKDQTSSSSSSSASNLIKSKSDVEKRRKVSDDHEIPPDRIK
                     KRKLQKVEKIDKAEKAEKAEKSEKAKSRMESPARVKEEPSSDVRSRQLDEKAKAEAAE
                     SAARELRKQQEAAAEKKAREEAALAEKKRLEEIERERLKELERKRAEEAEIKRAEEAE
                     KARQAREAERRAEEEKRRIQKEKERELARKREIIAAQKERERKEREFQMLKSLEEEEN
                     RRKEKIKREQELEAERLRQLQIEEERKKALEAEQELDRQRMLQLQQEAEARKNFPYAI
                     RMATYGPKQLDEMMSFFPILVHSVVPDTSYFLDIQVSLLLGLPNVHQSCKLYVAVQT"
     gene            complement(<282424..>283662)
                     /locus_tag="AWJ20_3792"
                     /db_xref="GeneID:30035852"
     mRNA            complement(<282424..>283662)
                     /locus_tag="AWJ20_3792"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880823.1"
                     /db_xref="GeneID:30035852"
     CDS             complement(282424..283662)
                     /locus_tag="AWJ20_3792"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733475.1"
                     /db_xref="GeneID:30035852"
                     /translation="MANLQNSSSLESSMSGSFIVSSTASVATETYQRAAKLFLTKSFV
                     DSLNTLEPLLADAKELRRTGQLSEKTWIKSWKLYFVLLDAAARQQEEASTRSPSSSSS
                     SSSSSISGTNSVSSSWPKKVRLELVKKITDGSLWKQVENEFGGSLSSAPPDIVFGLTS
                     LTIRHGTTNNSILSMVSESLELYLSSMSDLVQSFDDTYRHEYLKVLDLYILKVLPLRN
                     EYDLAREMIESSQFYDSHVKEEKRRQLIKSEENLVKKKQKKEEEDSKRKQMEALREEA
                     KRKHERLVQQQRQQQKQLQQQQQQQQQLEQKTSLEHQQSSVNSLSSSGLGPRRTASPT
                     PPRSSNPVRSFDSLIFYWRRRATAIVQSAMVWKIIAFFIIIVLSVSNPLARERARRIV
                     NNVWRKLSETARMGFKVSFV"
     gene            <287753..>288880
                     /gene="FBP26"
                     /locus_tag="AWJ20_3793"
                     /db_xref="GeneID:30035853"
     mRNA            <287753..>288880
                     /gene="FBP26"
                     /locus_tag="AWJ20_3793"
                     /product="Fbp26p"
                     /transcript_id="XM_018880824.1"
                     /db_xref="GeneID:30035853"
     CDS             287753..288880
                     /gene="FBP26"
                     /locus_tag="AWJ20_3793"
                     /inference="similar to AA sequence:KEGG_Orthology:K19029"
                     /note="Fructose-2,6-bisphosphatase, required for glucose
                     metabolism; protein abundance increases in response to DNA
                     replication stress; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003873 -
                     6-phosphofructo-2-kinase activity [Evidence IKR] [PMID
                     9032445]; GO_function: GO:0003873 -
                     6-phosphofructo-2-kinase activity [Evidence IKR] [PMID
                     9032446]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0004331 -
                     fructose-2,6-bisphosphate 2-phosphatase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004331 -
                     fructose-2,6-bisphosphate 2-phosphatase activity [Evidence
                     IMP] [PMID 1322693]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0016311
                     - dephosphorylation [Evidence IEA,IEA]; GO_process:
                     GO:0006003 - fructose 2,6-bisphosphate metabolic process
                     [Evidence IEA]; GO_process: GO:0006000 - fructose
                     metabolic process [Evidence IEA]; GO_process: GO:0006006 -
                     glucose metabolic process [Evidence IMP] [PMID 1322693];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Fbp26p"
                     /protein_id="XP_018733476.1"
                     /db_xref="GeneID:30035853"
                     /translation="MEAAQPSALFFDAHNEEGARLRRQAAIRAIEDMLKWFSEEDGVV
                     GILDATNSTKQRRQWIQDLLVKQGIEPMFVESWCDDQELIMHNIMDVKTCSPDYTGQD
                     PDEAAKDFMERIKKYEEVYETINDESLTYAKIINVNSQVIINRIQSYVQSRIVYYLMN
                     LHIKRRCIYLSRHGESEFNLTGQLGGDSNLSPRGDLYAHKLPQLVKEAVGDQPLTVWT
                     STLKRTQQTARFLPYRQMQWKALDELDAGVCDGMTYEEIKQEYPEDFEARDANKFEYR
                     YRGGESYRDVVARLEPIIMELERQENIMIVTHQAVLRCIYAYFMNVPQDRSPWMDVPL
                     HTLIRLEPRPYSTLETRVPANIPAVSTYREKGSTVLAAPTK"
     gene            <289346..>291289
                     /gene="SRS2"
                     /locus_tag="AWJ20_3794"
                     /db_xref="GeneID:30035854"
     mRNA            <289346..>291289
                     /gene="SRS2"
                     /locus_tag="AWJ20_3794"
                     /product="DNA helicase SRS2"
                     /transcript_id="XM_018880825.1"
                     /db_xref="GeneID:30035854"
     CDS             289346..291289
                     /gene="SRS2"
                     /locus_tag="AWJ20_3794"
                     /inference="similar to AA sequence:KEGG_Orthology:K03657"
                     /codon_start=1
                     /product="DNA helicase SRS2"
                     /protein_id="XP_018733477.1"
                     /db_xref="GeneID:30035854"
                     /translation="MSEQDPGDASLAGGAIGYDLISGQALESKAWGIEEDLNDQQLRA
                     VQLPVDANIQVIAGPGTGKTKTLVNRLLYILTEYNVPPEKVLVLTFTNRAIHIFRESL
                     FKLAPAIAPQVEIHTFHSYCQSLISDHWEEVGLRPGWTVADDMDQEYILTEVIKETVG
                     SHTTAREFRVLSNKLHTYKRSLLNKSAKRDSKLDEILTKYETRLAGCNMLDYDGILKL
                     GYRLAEKYSKAPESDKNKYFSALLIDEFQDANLFQWDLTCLIAKGSASITIVGDPDQS
                     IFSFQGASSNLLDIMKKQLSDVRTVVLTQNYRSSQEIVDAASAMIREDSHFLGDEQMP
                     VGLFTGPKPIFKKSLDSTSETVWVANTIHHLTHKENVEPSSIAVLVRTNGRKDSVAAG
                     LRQRGIEVAIYGPLSLLKSPYIRPLYSFLKFIQNFEQDIQLLYMLRNPNKILSPKQIS
                     EAQSFSRSRGLPLWEALQQNQLWLRQPTTRVNKSKKPHGPPDLDQFISVINKSADIIH
                     SNVHDSESLVEGLQLVSQYLSWPTRYGDKAHVKQQELFDLITSIAPLLKDESTSLSSS
                     LLAHTRLQDIAAKPGEVVVSTIHNAKGRLQHCLRRLGLRPRPRGSCFAGECWERRRND
                     SSAARGAAGSGAEPQPPEAPYRM"
     gene            complement(<291885..>292643)
                     /locus_tag="AWJ20_3795"
                     /db_xref="GeneID:30035855"
     mRNA            complement(<291885..>292643)
                     /locus_tag="AWJ20_3795"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880826.1"
                     /db_xref="GeneID:30035855"
     CDS             complement(291885..292643)
                     /locus_tag="AWJ20_3795"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733478.1"
                     /db_xref="GeneID:30035855"
                     /translation="MSKVYFISGGNRGIGFGFVQELSQRKDVTVIASVRNAAKATELN
                     AWIKEHPNIHTVNYDGNVDGSALEAAKEVESITGGKGIDVFIANAAISDAHYSVLDLP
                     EKNWLEHYKINTLAPLLLFKAFYPLLKKKDTRQVIFISSDAGSIAATPKMSFSAYGQS
                     KAALNYSTKELSFELEEEKFTIIALNPGPVLSDMGTFSREEMKKISVAFSHKHWDTAP
                     SVKESVDELLLVIDKLTPADNGKFFHHDGTIYPW"
     gene            complement(<293054..>294529)
                     /gene="STL1"
                     /locus_tag="AWJ20_3796"
                     /db_xref="GeneID:30035856"
     mRNA            complement(<293054..>294529)
                     /gene="STL1"
                     /locus_tag="AWJ20_3796"
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /transcript_id="XM_018880827.1"
                     /db_xref="GeneID:30035856"
     CDS             complement(293054..294529)
                     /gene="STL1"
                     /locus_tag="AWJ20_3796"
                     /codon_start=1
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /protein_id="XP_018733479.1"
                     /db_xref="GeneID:30035856"
                     /translation="MFAIPWFDSNPEGFFKLKGSRLIWATAILSSLGFSMIGYGNALM
                     GGIINEEPFKQRFDYPSSSEIGFITAIYGVGAFVGSILTSLVGDSFGRRKSIAIGAIV
                     MILGSLVQSSAITLRSLSVGRFVSGTGLGFLNSTIPVLQNEVSPHGERGMYVAVYCTT
                     LNVGILVAYWVNFSLRNLGSDKSWRLPILLQIFILAPILALTVLTCESPRWLLLKDRD
                     SNALQVLANLENSEPDDPLVEDKFHSLKESVVWDTVDAEQSSFWQDFYNPNDIIATKR
                     LWISLSVQIFQQLGGINVLIYYCPILFEDSIKLSSQTSSQLSVLLQIWLVVTSMVPWS
                     LLDRVGRRPLILGGISGQGASMLMQAIFIYQLNIHGNSNDSEKSSLSIWAILSIVTLF
                     TFEASFAIGMQASVWVYCSEILPLRLRGRGTSLATSANWATNSVLVHLAPVVLEKLNY
                     ASFLILAALNFTFLPVAYLAFCETKGLSLEQVDQLFLEHQD"
     gene            <296215..>298728
                     /gene="MPS1"
                     /locus_tag="AWJ20_3797"
                     /db_xref="GeneID:30035857"
     mRNA            <296215..>298728
                     /gene="MPS1"
                     /locus_tag="AWJ20_3797"
                     /product="serine/threonine/tyrosine protein kinase MPS1"
                     /transcript_id="XM_018880828.1"
                     /db_xref="GeneID:30035857"
     CDS             296215..298728
                     /gene="MPS1"
                     /locus_tag="AWJ20_3797"
                     /inference="similar to AA sequence:KEGG_Orthology:K08866"
                     /codon_start=1
                     /product="serine/threonine/tyrosine protein kinase MPS1"
                     /protein_id="XP_018733480.1"
                     /db_xref="GeneID:30035857"
                     /translation="MSVNDGEHHEGDDSVSSSDGSFMPPVLSDYANQLLFEDKERQSR
                     LQYLQQQESYQDSRGANVGYQQSHHYNQGSVGLPNGDYSPVDKMVISPQVPKTSRREL
                     SGSPHMNSSGGISSSSLGTSPLESSDKISNASTTPGIRPAATLFTRAPAADMTSLRTT
                     TMRSKRFGSNAFNKRLGKPLNFKGLPSANPNTTSNSTSTAISSMAQLSVSSSTATSSN
                     PASNTASMHQPLPATTTSFSAGTSSMSIPATSLATTTATRPANIYSSLSGVDEDRNPN
                     LSPSTKRSTTRIRFAEEHQEIAHDSPRRSYLLRHSKSSDNNSQYHDSDIGEANSSVSS
                     NSSKRDRRDWSSRATTPVGDTSRHSSSSKSDHSQYDANPQQGSLSQFRAQDERPVLQS
                     ISPNIPVNPGNRFGSKVPPPKLENWANVKTSSLFSSNELHEYHNNHHNHHEVQEPERP
                     APPVPTDRADRAARIERFEKAAEQQSVAQLHAAHNLGTDRPRQSSDRSKTKKNMMAIN
                     NRLYQRLELLGRGGSSKVYKVQSNEGKVFAVKKVTFEDVDESVISGFKGEIDLLQRLR
                     NEDRVVKLVDYEMHDTSVYLVMECGEIDLAHVLSARLNSQLDISFVRFYATEMLRCVA
                     AVHNQGIVHSDLKPANFLLVKGMLKIIDFGIANVVPDYTANIHRDTQIGTPNYMAPEA
                     LLDANQFGPGSGTETAAKFKVGKPSDVWSCGCIIYQMVYGKPPYAAYSGAQRMLAIMN
                     PKVQIQYPKHGLGGVRVSRDAIETIRGCLHRDPAARMTVEEVLEGSFLNPQAVDRSFI
                     RTLLEHAVQYGATRKEPILPREVDMLTDDIWKKIQLSNR"
     gene            <302689..>303480
                     /gene="RAS2"
                     /locus_tag="AWJ20_3798"
                     /db_xref="GeneID:30035858"
     mRNA            <302689..>303480
                     /gene="RAS2"
                     /locus_tag="AWJ20_3798"
                     /product="Ras family GTPase RAS2"
                     /transcript_id="XM_018880829.1"
                     /db_xref="GeneID:30035858"
     CDS             302689..303480
                     /gene="RAS2"
                     /locus_tag="AWJ20_3798"
                     /inference="similar to AA sequence:KEGG_Orthology:K07827"
                     /note="GTP-binding protein; regulates nitrogen starvation
                     response, sporulation, and filamentous growth;
                     farnesylation and palmitoylation required for activity and
                     localization to plasma membrane; homolog of mammalian Ras
                     proto-oncogenes; RAS2 has a paralog, RAS1, that arose from
                     the whole genome duplication; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IDA] [PMID
                     22575457]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 22575457]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 23127800]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 11914276]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 16622836]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA] [PMID
                     20162532]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 23127800]; GO_function: GO:0005525 -
                     GTP binding [Evidence IEA,IEA]; GO_function: GO:0005525 -
                     GTP binding [Evidence IDA] [PMID 6438624]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IDA] [PMID
                     8106517]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0006184 - GTP catabolic
                     process [Evidence IEA]; GO_process: GO:0007190 -
                     activation of adenylate cyclase activity [Evidence IDA]
                     [PMID 8106517]; GO_process: GO:0030437 - ascospore
                     formation [Evidence IMP] [PMID 2558958]; GO_process:
                     GO:0045762 - positive regulation of adenylate cyclase
                     activity [Evidence IGI] [PMID 2981630]; GO_process:
                     GO:0045762 - positive regulation of adenylate cyclase
                     activity [Evidence IGI] [PMID 3891097]; GO_process:
                     GO:0000411 - positive regulation of transcription by
                     galactose [Evidence IMP] [PMID 16292676]; GO_process:
                     GO:0097271 - protein localization to bud neck [Evidence
                     IGI] [PMID 12782684]; GO_process: GO:0007124 -
                     pseudohyphal growth [Evidence IMP] [PMID 1547504];
                     GO_process: GO:0032880 - regulation of protein
                     localization [Evidence IMP] [PMID 15917658]; GO_process:
                     GO:0001302 - replicative cell aging [Evidence IMP] [PMID
                     12839995]; GO_process: GO:0001302 - replicative cell aging
                     [Evidence IMP] [PMID 8034612]; GO_process: GO:0007165 -
                     signal transduction [Evidence IEA]; GO_process: GO:0007264
                     - small GTPase mediated signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Ras family GTPase RAS2"
                     /protein_id="XP_018733481.1"
                     /db_xref="GeneID:30035858"
                     /translation="MSRRESNPLYKLIVLGDGGVGKTALTIQLCLNHFVETYDPTIED
                     SYRKQVMIDDQPATLEVLDTAGQEEYTALRDQWIRDGEGFILVYSITSRSSFSRIKNY
                     YSQIERVKDEDPFAIVLVGNKSDRKGERQVSEQDGEQLARELGDNVAFFESSAKLNIN
                     IEKAFFECARKCRVIRHPETNPQGGPNSNNNLADVHSGYVDQGLGHGGNALGNQSSQN
                     AGQNQKAPANQAHNRPSHNAGTSSQSHGRSDTRKAQKKKSKCIVM"
     gene            complement(<306722..>308389)
                     /gene="YHK8"
                     /locus_tag="AWJ20_3799"
                     /db_xref="GeneID:30035859"
     mRNA            complement(<306722..>308389)
                     /gene="YHK8"
                     /locus_tag="AWJ20_3799"
                     /product="Yhk8p"
                     /transcript_id="XM_018880830.1"
                     /db_xref="GeneID:30035859"
     CDS             complement(306722..308389)
                     /gene="YHK8"
                     /locus_tag="AWJ20_3799"
                     /note="Presumed antiporter of the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; expression of gene is up-regulated in cells
                     exhibiting reduced susceptibility to azoles; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISS]
                     [PMID 9046086]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0015297 -
                     antiporter activity [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND];
                     GO_function: GO:0005215 - transporter activity [Evidence
                     IEA]; GO_process: GO:0015893 - drug transport [Evidence
                     IEP] [PMID 12697649]; GO_process: GO:0006811 - ion
                     transport [Evidence IEA]; GO_process: GO:0015992 - proton
                     transport [Evidence IEA]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Yhk8p"
                     /protein_id="XP_018733482.1"
                     /db_xref="GeneID:30035859"
                     /translation="MAEPESGIRRSRSNSFSHHESSGPTASSPTLSMNSSNPDLMSKK
                     VFNEDPEKQRDLKTDDDDVEAAPKPLTDDTTAENPVIPFDSTTPTHDPNCVYWDGLQD
                     KENARRMSFARKWFICIILTSTAGCLTALSSAWTSAVDPMVERFHSSAEVGDLGLTLF
                     LFGLGIGPLIAAPLSEKFGRQPVYLISLFLFFVFQFPTAFAHNMASALVGRYLCALGG
                     SAFMSNVPGTFSDLFEKHQLALPVTVFTFGPFLGPGIGPVISGPITQHVGYRWVFYVF
                     LIWTFVLLVTIALTVPETYPPILLAKKAKRLRKETGNDAIYAPIEKSERSFWRSLRHS
                     CSMPVILISHEPVLDILCFYTGFLLAIIYLFFVAFPYVFTKVYHFQVEFVGLSFTGII
                     VGMALAASTYPFWRHFYEKELAKNGGVANPEMRLPQMCFGAVIIPIGLFMFAWTAYAE
                     VHWIVPMVASGIFAFGSYFTFNGIITYTVETYHRYAASATAANVFIRCAIAGSAPLFG
                     VQMLEGMGIHWGISLLGFVAVLLCPSAFIFRIYGKTLRMKSKYAIKV"
     gene            complement(<311367..>311768)
                     /gene="ESS1"
                     /locus_tag="AWJ20_3800"
                     /db_xref="GeneID:30035862"
     mRNA            complement(<311367..>311768)
                     /gene="ESS1"
                     /locus_tag="AWJ20_3800"
                     /product="peptidylprolyl isomerase ESS1"
                     /transcript_id="XM_018880832.1"
                     /db_xref="GeneID:30035862"
     CDS             complement(311367..311768)
                     /gene="ESS1"
                     /locus_tag="AWJ20_3800"
                     /inference="similar to AA sequence:KEGG_Orthology:K09578"
                     /note="Peptidylprolyl-cis/trans-isomerase (PPIase);
                     specific for phosphorylated serine and threonine residues
                     N-terminal to proline; regulates phosphorylation of the
                     RNAP II large subunit (Rpo21p) C-terminal domain (CTD);
                     associates with phospho-Ser5 form of RNAP II in vivo;
                     regulates phosphorylation of Ser7 within CTD; present
                     along entire coding length of genes; represses initiation
                     of CUTs; required for efficient termination of mRNA
                     transcription and trimethylation of histone H3;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IC] [PMID
                     10531363]; GO_component: GO:0005634 - nucleus [Evidence
                     IC] [PMID 10899126]; GO_component: GO:0005634 - nucleus
                     [Evidence IC] [PMID 10899127]; GO_component: GO:0005634 -
                     nucleus [Evidence IC] [PMID 11708797]; GO_component:
                     GO:0005634 - nucleus [Evidence IC] [PMID 14704159];
                     GO_function: GO:0000993 - RNA polymerase II core binding
                     [Evidence IPI] [PMID 10531363]; GO_function: GO:0000993 -
                     RNA polymerase II core binding [Evidence IPI] [PMID
                     10899126]; GO_function: GO:0016853 - isomerase activity
                     [Evidence IEA,IEA]; GO_function: GO:0003755 -
                     peptidyl-prolyl cis-trans isomerase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003755 - peptidyl-prolyl
                     cis-trans isomerase activity [Evidence IDA,IMP] [PMID
                     15728580]; GO_function: GO:0003755 - peptidyl-prolyl
                     cis-trans isomerase activity [Evidence IDA] [PMID
                     9867817]; GO_process: GO:0080182 - histone H3-K4
                     trimethylation [Evidence IGI,IMP] [PMID 22778132];
                     GO_process: GO:0031064 - negative regulation of histone
                     deacetylation [Evidence IMP,IPI] [PMID 10899127];
                     GO_process: GO:2000059 - negative regulation of protein
                     ubiquitination involved in ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 19597489];
                     GO_process: GO:0000122 - negative regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IGI,IMP] [PMID 14704159]; GO_process: GO:0045899 -
                     positive regulation of RNA polymerase II transcriptional
                     preinitiation complex assembly [Evidence IGI] [PMID
                     15166139]; GO_process: GO:2000749 - positive regulation of
                     chromatin silencing at rDNA [Evidence IMP] [PMID
                     10899127]; GO_process: GO:0035307 - positive regulation of
                     protein dephosphorylation [Evidence IDA] [PMID 11904169];
                     GO_process: GO:0035307 - positive regulation of protein
                     dephosphorylation [Evidence IMP] [PMID 19854134];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IGI,IPI] [PMID 10899126]; GO_process: GO:0006457 - protein
                     folding [Evidence IEA]; GO_process: GO:0000413 - protein
                     peptidyl-prolyl isomerization [Evidence IDA,IMP] [PMID
                     15728580]; GO_process: GO:1901407 - regulation of
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 22778132]; GO_process: GO:0000083 -
                     regulation of transcription involved in G1/S transition of
                     mitotic cell cycle [Evidence IMP] [PMID 11708797];
                     GO_process: GO:0000117 - regulation of transcription
                     involved in G2/M transition of mitotic cell cycle
                     [Evidence IMP] [PMID 11708797]; GO_process: GO:0006369 -
                     termination of RNA polymerase II transcription [Evidence
                     IMP] [PMID 14704159]; GO_process: GO:0006369 - termination
                     of RNA polymerase II transcription [Evidence IGI,IMP]
                     [PMID 19854134]; GO_process: GO:0006369 - termination of
                     RNA polymerase II transcription [Evidence IMP] [PMID
                     22778132]"
                     /codon_start=1
                     /product="peptidylprolyl isomerase ESS1"
                     /protein_id="XP_018733483.1"
                     /db_xref="GeneID:30035862"
                     /translation="MAKNYSQNASGAAAAQGASGDSEKIRASHLLVKHKDSRRPSSWK
                     EANISRTKEEALSIILAHEARIRSGAATLSELAVSESDCSSARRGGDLGYFGRGEMQK
                     EFEDAAFALKPGELSRVVETSSGLHLIERTG"
     gene            <313836..>314834
                     /locus_tag="AWJ20_3801"
                     /db_xref="GeneID:30035863"
     mRNA            <313836..>314834
                     /locus_tag="AWJ20_3801"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880833.1"
                     /db_xref="GeneID:30035863"
     CDS             313836..314834
                     /locus_tag="AWJ20_3801"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733484.1"
                     /db_xref="GeneID:30035863"
                     /translation="MAPHLLVYAGTSYDKDQLVKVPVNKGDDASYIELDCPHAVDGVV
                     RLAIRIKNFKDVRSSKHDPPEQEEIEEAVVVEEGSETDPKASVKDMSRSSSTSSNASN
                     SSRTSTSSRLKNYLKKKKSRSPSPSPADSPYFEQENHKQDQLSIQFSIRFADPVAGDN
                     LLFGNDFDEPIRDILPYGFSLGYKMFQWYIDPSVEGDPMADKPYLYGRALTSINAIHE
                     NDSPDIKWDGYVNGDKFLNPGSAPEKVKQMSSSERMTYFRDKSHRQSFDFVANNLYTF
                     DFFTPYLTLGDSFGVQLPGFKFDVGKYCGGQPLRYVLKNLLDDSIYLVVVFSLVNE"
     gene            <315717..>316349
                     /locus_tag="AWJ20_3802"
                     /db_xref="GeneID:30035864"
     mRNA            <315717..>316349
                     /locus_tag="AWJ20_3802"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880834.1"
                     /db_xref="GeneID:30035864"
     CDS             315717..316349
                     /locus_tag="AWJ20_3802"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733485.1"
                     /db_xref="GeneID:30035864"
                     /translation="MEIREREVEALKDRESAARKEATALSDGVVVWKDTCETVSDLER
                     RLSLLPKQDRSDVKKISTMLNETLARLTRNLDVSEDNKWSLLSVAISQEVEALKQGIE
                     LVESMSAPPSSTSSSKVNSPPTAVSRILPKISHQVPNTALSSLEEPSKSHIIVPTPKT
                     SPSPSFTNAVTGLNINNVSAEPISSSPTQSSTNAFNSVAQLLGNYETKTD"
     gene            complement(<316646..>319810)
                     /locus_tag="AWJ20_3803"
                     /db_xref="GeneID:30035865"
     mRNA            complement(<316646..>319810)
                     /locus_tag="AWJ20_3803"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880835.1"
                     /db_xref="GeneID:30035865"
     CDS             complement(316646..319810)
                     /locus_tag="AWJ20_3803"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733486.1"
                     /db_xref="GeneID:30035865"
                     /translation="MSDSNPPPLPAGAGDTSSAPVDIEAQLKALLAGLGQDADGDKNA
                     DNNTNFSTGEHESEEQSEDAATEAARKLIENALYSESSNLEAGVHPTADEQRETEPVE
                     EPQQVDPVSDSTRPSASADMESLLLEQTLAEVQKALADDQGLSGQDSESQPETNVRST
                     QDIESSKTVQDSHIAIADQEPDTKENDEQNTDVDQGSLNALIQNALTALDDQPERERQ
                     DNQDDVPQAPKPLHEEPTVLEHPSSKEQTQHDTFSSDSGASRPSGEPDQAALASAIAN
                     ALAGVGTRADDTDGSVTETSLQDQIAAAVASVSQEILPVHEDTNQHDTAAITEALVSS
                     LSGEGANHNQEPDVLHIQQELQRILANDVSQQVSADTESHPQQASQTEANEDGEPEFD
                     ADAAAASVAEALAKALQQGAGDIDGESGNASAEETELAAQKALMEQLSSALREESAGH
                     IQGQTGDEQHSVEGVDVQAMAELLSGSDLESTLSSILSGMNDPPQQEEPPRSNLSIAE
                     TLAISRSNIEKSREKLAKRIDPMLNRRGYLQSWSVRRQQHQQQQQRQHQEQPRQTIQP
                     QQDADIDPLLQFSSETLPSQEEQSSDQIESGDGAEVPADSMLAALLLAKQMIGDEEAT
                     SEGQDLSLNEDAMEAVQQALQALSKSIQEEGASGTTTENNLTSDSTTAGNTPIFSSLD
                     QFRTTRKYKPRRYRANAVLTPEDKERIRMDNRERKKRWRSNNNIRNKDNDLRARLHRR
                     ATNMFGPEDSPEKKSWFDKEFQKRREKRMLREMQLDPDFQRDDENSNGFVNINSNNNA
                     NGNSSSAESLRAALEILGKTEGLNEGLAQTVDSLVKDPQLLKTLMGDLFGNEESNNVS
                     NNTSTATNYTFQPHANVNKPIAGGGIMSTFKIRKTESQPRAVQSRPPTAQPQFPSKYP
                     DRGLTTLVRRAMKSRGRNTGGFQQPSQSTQPSVPRVLTNVPPLPNMSAPDPVAAIAGA
                     LSMRADNFSDVQQLSQPPQSLKRKPSLETISVTVSPKPPTYFGKPASRPSSVLQPAKK
                     FKTMDNRAKAFGFPPLLSAMSTKR"
     gene            complement(<320293..>320403)
                     /locus_tag="AWJ20_3804"
                     /db_xref="GeneID:30035866"
     tRNA            complement(<320293..>320403)
                     /locus_tag="AWJ20_3804"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:30035866"
     gene            <321912..>323276
                     /locus_tag="AWJ20_3805"
                     /db_xref="GeneID:30035867"
     mRNA            <321912..>323276
                     /locus_tag="AWJ20_3805"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880836.1"
                     /db_xref="GeneID:30035867"
     CDS             321912..323276
                     /locus_tag="AWJ20_3805"
                     /inference="similar to AA sequence:KEGG_Orthology:K13099"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733487.1"
                     /db_xref="GeneID:30035867"
                     /translation="MVSNSATFDKRNPLQLRDVDEDDEIDPNDQEAALLRQDIEGSRP
                     KSKRNAVKLDYDSDSSDDGASRRNKVHKQKKKTQKSSENKDGDSGSDDDMFSDNDNDD
                     LKEADAIDSDTERRESKKKAKFLDMDKFEKQEELEDLPENSDSDPDDSGSDVNEANVD
                     IDYFVNAGSPTTTDNAVLDSKPNKVKNAKKTEPKMESFHLRTDLEEGNFDQDGNFIRN
                     AMDTNAHQDAWLDGLSKHDIKVARQAHQYREKHNVEHGGVDDEESTKFVPKCDVIAAL
                     LSYLQTGESPLDALQRLNSAAPKKRLGRKSASHAPLKGDIKTDAKESIRIQAIESISE
                     NSNKLLQEFGLTDIYDKTREELLRQYQKETGEVYVDLKRKRSESSLDGDDDTNDRGVD
                     GTSTQSSLWEFRWDESDEIHGPYTSEQMASWVEYNYFDERVSVRQVSQGPLDFVPYDQ
                     VTFL"
     gene            <323630..>324391
                     /locus_tag="AWJ20_3806"
                     /db_xref="GeneID:30035868"
     mRNA            <323630..>324391
                     /locus_tag="AWJ20_3806"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880837.1"
                     /db_xref="GeneID:30035868"
     CDS             323630..324391
                     /locus_tag="AWJ20_3806"
                     /inference="similar to AA sequence:KEGG_Orthology:K05019"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733488.1"
                     /db_xref="GeneID:30035868"
                     /translation="MPFAIQTIQSAPLDSEFTPLQEHQSYTPASFSLEENPILYLKST
                     AAKIETSKPLPQVPNATVITGDIYISSSYLTIWIPDHSVGVTIPYQCITLHAIQSGGE
                     SVYLQIESEGLVEGNPSFDDAPIMELTISLEKENDPTIRDLYNALSECSSLHLDVSEG
                     DEEDIDGFEGMGEGDDGWITAESLISGQGDDDVSLDASKENGHGPAAALEVAVADAES
                     VRAGQRRGREENEDEEVDAEEESVEAEESKWRRTN"
     gene            complement(<327407..>329305)
                     /gene="CMP2"
                     /locus_tag="AWJ20_3807"
                     /db_xref="GeneID:30035869"
     mRNA            complement(<327407..>329305)
                     /gene="CMP2"
                     /locus_tag="AWJ20_3807"
                     /product="calcineurin catalytic subunit A"
                     /transcript_id="XM_018880838.1"
                     /db_xref="GeneID:30035869"
     CDS             complement(327407..329305)
                     /gene="CMP2"
                     /locus_tag="AWJ20_3807"
                     /inference="similar to AA sequence:KEGG_Orthology:K04348"
                     /note="Calcineurin A; one isoform (the other is Cna1p) of
                     the catalytic subunit of calcineurin, a
                     Ca++/calmodulin-regulated protein phosphatase which
                     regulates Crz1p (a stress-response transcription factor),
                     the other calcineurin subunit is CNB1; regulates the
                     function of Aly1p alpha-arrestin; CMP2 has a paralog,
                     CNA1, that arose from the whole genome duplication;
                     GO_component: GO:0005955 - calcineurin complex [Evidence
                     IPI] [PMID 10887154]; GO_component: GO:0005955 -
                     calcineurin complex [Evidence IDA] [PMID 1321337];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0004723 - calcium-dependent
                     protein serine/threonine phosphatase activity [Evidence
                     IDA] [PMID 1321337]; GO_function: GO:0005516 - calmodulin
                     binding [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA,IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004721 - phosphoprotein phosphatase
                     activity [Evidence IEA,IEA]; GO_process: GO:0000754 -
                     adaptation of signaling pathway by response to pheromone
                     involved in conjugation with cellular fusion [Evidence
                     IMP] [PMID 1651503]; GO_process: GO:0006873 - cellular ion
                     homeostasis [Evidence IMP] [PMID 8798496]; GO_process:
                     GO:0016311 - dephosphorylation [Evidence IEA,IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="calcineurin catalytic subunit A"
                     /protein_id="XP_018733489.1"
                     /db_xref="GeneID:30035869"
                     /translation="MSDERAKKLENAIKAFQEKKPLPKVDFSVYKGDDGKELRTDERV
                     IKTTPAPATKIPTDDELFLPGTSNPRLPNLAFLKDHLFREGRLHEEQAIYIINSATKI
                     IMEEPTLLEIDPPVTLCGDIHGQYYDLMKLFEVGGDPRNTKYLFLGDYVDRGYFSIEC
                     VLYLWALKLHYPKSVFFLRGNHECRHLTDYFTFKLECKHKYSLNIYEACMMSFCTLPL
                     AAVVNKQFFCVHGGLSPELHTLDDVRKLDRFREPPTHGLMCDLLWADPIENFGEEDNN
                     RSFIHNNVRGCSYFYTYKAACDFLVKNNLLSIIRAHEAQNAGYRAYLESRNTGFPSVM
                     TIFSAPNYLDTYNNKAAVVKYENNVLNIRQFKHSPHPYWLPNFMDVFTWSLPFVGEKI
                     TDMLISILNICTREELEEDTVRYIQEKGNTSKYGGIFGRKSPRSPRSPRSPSSPRSPR
                     SPTSPRSPKKPIAGQTQQYDSDEDLPVKIPEEVEPEEDYFQDAQSTAMDRDDDDLDQE
                     DDEDEDDLEVRRDRFKNKILAIGRLSRMFQVLRQESESVSEFKATTGTMLPAGTLMSG
                     AEGIRKAITTFDEARRVDLINEQLPPTADEKAQENERQRKEALNRAMKEADADVKIRN
                     LARRLTGE"
     gene            <330504..>331115
                     /gene="TSR2"
                     /locus_tag="AWJ20_3808"
                     /db_xref="GeneID:30035870"
     mRNA            <330504..>331115
                     /gene="TSR2"
                     /locus_tag="AWJ20_3808"
                     /product="Tsr2p"
                     /transcript_id="XM_018880839.1"
                     /db_xref="GeneID:30035870"
     CDS             330504..331115
                     /gene="TSR2"
                     /locus_tag="AWJ20_3808"
                     /inference="similar to AA sequence:KEGG_Orthology:K14800"
                     /note="Protein with a potential role in pre-rRNA
                     processing; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0000462 -
                     maturation of SSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     12837249]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Tsr2p"
                     /protein_id="XP_018733490.1"
                     /db_xref="GeneID:30035870"
                     /translation="MSEPLASVQGEGANLVLSDPKHQSRFELGVCMAVYQWDNLQTAV
                     DNQWGGADSEDKRDWMVGSVVELFETSNYVDSDDIEDRLLGIMEDEFGVSIEDNTATP
                     VAVSIIQLYKECAEGNFSHVDELYAKYQEKESKRKAGLLPVNKVQTEGSDEEDEDEEE
                     GDDDEEMNDAPASSSSSDPSEPQGPIVDEDGFELVQKKGNRRR"
     gene            complement(<331283..>333655)
                     /locus_tag="AWJ20_3809"
                     /db_xref="GeneID:30035871"
     mRNA            complement(<331283..>333655)
                     /locus_tag="AWJ20_3809"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880840.1"
                     /db_xref="GeneID:30035871"
     CDS             complement(331283..333655)
                     /locus_tag="AWJ20_3809"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733491.1"
                     /db_xref="GeneID:30035871"
                     /translation="MGNTDSKLRFRTHISRLFELDNISADDRYYWVKYWTEPNSVFDV
                     FTLLSSADIRKTRDGNLANLETLIKVVYFRLKELRNSRSFPHNDIAPAKELLNCVRIL
                     TKILPFVYEKDTDEIREWEEKVFWQTTSDKTSDTSHLQGIAPDLINITLDLLFIEGFT
                     IPIGQANSSIWEPGVGSNTVQQPTHEMLSNRVEILRFLLTLVSDCLYQNQVDVAVKGS
                     KYLTYVVTNPDKRVVMTVLCSLLNTSLRYSPAGKVPYDHMLISDRNRQLVIYSVQLLV
                     VLLVYPIPEVPDFSIGSSSRLIPKSGSGRKQDINMYRYFLSKIRHPEDFQFIIDNLLK
                     LISQPILLTSSLLPGSQTEVQWVTELLALFWELTQCNRKFRDYLYSGSATDFMIFLLA
                     YVQEKYQDASQREVVRLSAYILLYLSSDSAFVKLLRYKVEVSSGSDDINGNLRRKYIS
                     SKSKMSIFSGTYGDYLINQLLHPLLSSGSNNDPMFDFLAPTFMEIIYNISPFTINISY
                     STASNLVQLFSNLISSNYIITASIKEFLLLNILKVFSNLIHFNFRSNKNLLFVILKNE
                     SKFRFLHNSTKDGDSDGPFVIEDEDGGIDGPSEASSSKSKGKQPVKAASSTPMVSAKD
                     SSSRVSDLWTLVEPIIMIVEDLRRQIPYTEYISTTNTQETKVQPHIIIDSIGNIPSVR
                     GVDLDQHEPADFEPIRFNWNSISLGWYESIIWGDIFRNESQLILSTINEVATSLVSPR
                     IGSVGVWNGTNIKLFRLQEAARQGPSLLRPKGAVDAVAESVLQQFGKLTH"
     gene            complement(<334250..>334331)
                     /locus_tag="AWJ20_3810"
                     /db_xref="GeneID:30035873"
     tRNA            complement(<334250..>334331)
                     /locus_tag="AWJ20_3810"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30035873"
     gene            <334574..>335491
                     /gene="CDA1"
                     /locus_tag="AWJ20_3811"
                     /db_xref="GeneID:30035874"
     mRNA            <334574..>335491
                     /gene="CDA1"
                     /locus_tag="AWJ20_3811"
                     /product="chitin deacetylase CDA1"
                     /transcript_id="XM_018880842.1"
                     /db_xref="GeneID:30035874"
     CDS             334574..335491
                     /gene="CDA1"
                     /locus_tag="AWJ20_3811"
                     /inference="similar to AA sequence:KEGG_Orthology:K01452"
                     /note="Chitin deacetylase; together with Cda2p involved in
                     the biosynthesis ascospore wall component, chitosan;
                     required for proper rigidity of the ascospore wall;
                     GO_component: GO:0005631 - chitosan layer of spore wall
                     [Evidence ISS] [PMID 8940152]; GO_component: GO:0005628 -
                     prospore membrane [Evidence IDA] [PMID 24390141];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]; GO_function: GO:0004099 - chitin deacetylase
                     activity [Evidence IEA]; GO_function: GO:0004099 - chitin
                     deacetylase activity [Evidence IDA,ISS] [PMID 8940152];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016810 - hydrolase activity, acting
                     on carbon-nitrogen (but not peptide) bonds [Evidence IEA];
                     GO_process: GO:0030476 - ascospore wall assembly [Evidence
                     IDA,IMP] [PMID 8940152]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA,IEA];
                     GO_process: GO:0006032 - chitin catabolic process
                     [Evidence IEA]; GO_process: GO:0000272 - polysaccharide
                     catabolic process [Evidence IEA]; GO_process: GO:0030435 -
                     sporulation resulting in formation of a cellular spore
                     [Evidence IEA]"
                     /codon_start=1
                     /product="chitin deacetylase CDA1"
                     /protein_id="XP_018733492.1"
                     /db_xref="GeneID:30035874"
                     /translation="MTRLAFFVLIAITASAADITTARAAAAVVAVNSPLQAPLAPSPS
                     DPFPLWLQELTGQTRWPGETPPYIPMPNIDLSQVPNEIPRRDLGVCQGIERSHCSFDC
                     YRCVAVDDISTCPTLSQTFDDGPSMHTPKLLMELEYKTTFFTQGINVVRYPDIFRQQH
                     MAGHLLATHTWSHAHLPGLSNEDIVAQLQWSIWAMNATAGIVPKYFRPPYGAIDDRVR
                     SISRQFGLVAVFWDRDSYDWRLNDDSKLVEEVVKDIVSWKQESQGGLILEHDSTVKTV
                     NAGINVSRMLGPSQLTVAECINSNWYQNQ"
     gene            <337686..>339938
                     /gene="TMT1"
                     /locus_tag="AWJ20_3812"
                     /db_xref="GeneID:30035875"
     mRNA            <337686..>339938
                     /gene="TMT1"
                     /locus_tag="AWJ20_3812"
                     /product="Ubiquinone/menaquinone biosynthesis
                     methyltransferase ubiE"
                     /transcript_id="XM_018880843.1"
                     /db_xref="GeneID:30035875"
     CDS             337686..339938
                     /gene="TMT1"
                     /locus_tag="AWJ20_3812"
                     /inference="similar to AA sequence:KEGG_Orthology:K13621"
                     /codon_start=1
                     /product="Ubiquinone/menaquinone biosynthesis
                     methyltransferase ubiE"
                     /protein_id="XP_018733493.1"
                     /db_xref="GeneID:30035875"
                     /translation="MSSMLTLILPAAAVLALALIITNPSAKAVAQFAWNCFLKPIGHV
                     GSDQKSALESFYKGQAKIYDTTRKKLLKGRHTMLSLSVSHLKKSKDIVWIDFGGGTGW
                     NIEKMNEVVPITSFKEIHLVDLSPSLCEVAQNRFAARGWSNVHVHCIDATTFQLPNKE
                     TRADLITLSYSLSMIPSYYSMIDRICQLVHSDSIFAVVDFYVQSNATLNGKATSVGGV
                     LLRHVNWLSRTFWRLWFEFDRVYLDSSRRDYLEYRFGTIKSLNMRNKSLGGIPYYIWI
                     GCDKDRSQDFMYRLNALATESPYLAPSNASSDALANQEQIQIRSKGYEATVINMEHNL
                     PYPSFYYQSEVWRIYYDAENPHYHQFNNQYIYAFTWEDPREDINLLNLGPSDVVLAIT
                     SAGDNILTYAAMENPPKRIHGVDLNPHQNHLMELKLASLRCLPFEDVWKIFGDGKHED
                     FMKILVTKLSPHLSSHALQFWIKNGKKYLDPKTKGLYDSGSTRWAIRIARWLFFALGL
                     ESDVKRLLKTQTIKEQLKVWNESIRPALFNPIFCKLILGNPVFLWKALGVPVNQANMI
                     EGGILQYIVDTIDPLISRSLISDDNYFYHLCLTGSYSPKNCPDYITKKGYFNLAKRKG
                     ALDTIRLHTDTINDVSDRLAPGTLTVAIIMDHMDWFEPTGTLAVEEIQALNKSLAKGG
                     RVMLRSSSKTPWYIKTFESQGFSCKSAATRFSGTSIDRVNMYASTWICTKLYNTAEKE
                     RSGSIKPLEL"
     gene            <341366..>342292
                     /locus_tag="AWJ20_3813"
                     /db_xref="GeneID:30035876"
     mRNA            <341366..>342292
                     /locus_tag="AWJ20_3813"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880844.1"
                     /db_xref="GeneID:30035876"
     CDS             341366..342292
                     /locus_tag="AWJ20_3813"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733494.1"
                     /db_xref="GeneID:30035876"
                     /translation="MDSRITEVQVSLHDDTVSVVSPKEITSRDIAKVLDKEGFDVIVT
                     DVSEDPEESHHGSSSIWLPSRIRYWQKSRAHLEKCDQCRISKASSESSRSSLKKALHY
                     FEKEKDITDGSSVIHEEDEDMVVVMDASSDATQFRAIYSIGDMTCAACTTAISTTVKE
                     QMPELLDIGVDLINKSAVALVPNKQVALKIQEIINDIGYTCELVELTPVESNKSWRLT
                     ASISGMSCMSCVNAIKDQVGPLPYLQEADISLLTNSGTFTINDLKMADELKEKIQDMG
                     YDYDLIEVNEVDYAKNKTSRTVNLSIKGMFCE"
     gene            <342657..>344816
                     /gene="CCC2"
                     /locus_tag="AWJ20_3814"
                     /db_xref="GeneID:30035877"
     mRNA            <342657..>344816
                     /gene="CCC2"
                     /locus_tag="AWJ20_3814"
                     /product="Cu(2+)-transporting P-type ATPase CCC2"
                     /transcript_id="XM_018880845.1"
                     /db_xref="GeneID:30035877"
     CDS             342657..344816
                     /gene="CCC2"
                     /locus_tag="AWJ20_3814"
                     /note="Cu(+2)-transporting P-type ATPase; required for
                     export of copper from the cytosol into an extracytosolic
                     compartment; has similarity to human proteins involved in
                     Menkes and Wilsons diseases; protein abundance increases
                     in response to DNA replication stress; affects TBSV model
                     (+)RNA virus replication by regulating copper metabolism;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0012510 - trans-Golgi network
                     transport vesicle membrane [Evidence IDA] [PMID 9325307];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0019829 - cation-transporting ATPase
                     activity [Evidence IEA]; GO_function: GO:0019829 -
                     cation-transporting ATPase activity [Evidence IDA] [PMID
                     15078884]; GO_function: GO:0019829 - cation-transporting
                     ATPase activity [Evidence IMP] [PMID 7708696];
                     GO_function: GO:0005507 - copper ion binding [Evidence
                     IEA]; GO_function: GO:0005507 - copper ion binding
                     [Evidence IDA] [PMID 17961510]; GO_function: GO:0043682 -
                     copper-transporting ATPase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA,IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA,IEA]; GO_process: GO:0006812 -
                     cation transport [Evidence IEA]; GO_process: GO:0006879 -
                     cellular iron ion homeostasis [Evidence IMP] [PMID
                     7708696]; GO_process: GO:0060003 - copper ion export
                     [Evidence IMP] [PMID 7708696]; GO_process: GO:0006825 -
                     copper ion transport [Evidence IEA,IEA]; GO_process:
                     GO:0006811 - ion transport [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0030001 - metal ion transport [Evidence IEA];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IMP] [PMID 7708696]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Cu(2+)-transporting P-type ATPase CCC2"
                     /protein_id="XP_018733495.1"
                     /db_xref="GeneID:30035877"
                     /translation="MDLVPKGSKLRTYFEQPIWAGGVSRSTWALLFLSTPVYFFAADL
                     FHTKALKEIWSLWRGGASWKRRLFRFGSMNLLMSLGITIAYFASIALLILSATSQPKE
                     VMGYTSTYFDSVVFLAFFLLMGRCIDAYSKAQTASAVSMLGNLRPDTVNVIEPEQGQT
                     VLSDYLHNESKAVSIDMVEVGDYVKVLPGERCSVDGIIVDGQSTFDESTLTGESRPVK
                     HGVGEEIFAGTINTGTGAVVARIKAIEEGSLLNSIVSIVREGQLHRAPIERVAEKITG
                     IFVPVVTLIAVLTWVIWLALGLSGSLPQRYLDIDVGGWTVWSLQFAISVFVVACPCGI
                     GLAAPTALFVGSGLAAKYGILARGGGEAFQEGSNIDIICFDKTGTLTEGGEPKITDHH
                     FTGTISLELLQIANTMEGASTHPLGIAVRNFVQITLEEAKNDTVALYSPAVKKIEEIP
                     GMGLEAEIDGPEIAKVLLGNERLLEKYNSKVDDETNDLMNKWKAQGKSVILVATSKDR
                     NNFEIRLVMGAADAVRPESKEVIEALTSRGIECWMISGDNEITAKAVAAQVSIRPENV
                     IAGVLPAEKSDKVTWLQKSGNSKRTPGGARAIVAMVGDGVNDAPSLSIADVGIAIGSG
                     SDLALTSAKFVLLKSDLYSLLNLLDISRVVFRRVKFNFAWALIYNLIGIPVAAGVIYP
                     YHNSRLSPAWASLAMALSSVSVVTSSLLLKLYRPKGQ"
     gene            complement(<345007..>345756)
                     /gene="GPM1"
                     /locus_tag="AWJ20_3815"
                     /db_xref="GeneID:30035878"
     mRNA            complement(<345007..>345756)
                     /gene="GPM1"
                     /locus_tag="AWJ20_3815"
                     /product="phosphoglycerate mutase GPM1"
                     /transcript_id="XM_018880846.1"
                     /db_xref="GeneID:30035878"
     CDS             complement(345007..345756)
                     /gene="GPM1"
                     /locus_tag="AWJ20_3815"
                     /inference="similar to AA sequence:KEGG_Orthology:K01834"
                     /note="Tetrameric phosphoglycerate mutase; mediates the
                     conversion of 3-phosphoglycerate to 2-phosphoglycerate
                     during glycolysis and the reverse reaction during
                     gluconeogenesis; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 3332961]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IEA];
                     GO_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IDA] [PMID 22984289]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16962558]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016868 -
                     intramolecular transferase activity, phosphotransferases
                     [Evidence IEA]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA]; GO_function: GO:0004619 -
                     phosphoglycerate mutase activity [Evidence IEA];
                     GO_function: GO:0004619 - phosphoglycerate mutase activity
                     [Evidence IDA] [PMID 1386023]; GO_function: GO:0004619 -
                     phosphoglycerate mutase activity [Evidence IMP] [PMID
                     3033435]; GO_process: GO:0006094 - gluconeogenesis
                     [Evidence IMP] [PMID 3033435]; GO_process: GO:0006096 -
                     glycolytic process [Evidence IEA,IEA,IEA]; GO_process:
                     GO:0006096 - glycolytic process [Evidence IMP] [PMID
                     11015729]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="phosphoglycerate mutase GPM1"
                     /protein_id="XP_018733496.1"
                     /db_xref="GeneID:30035878"
                     /translation="MSTHKLILVRHGQSDWNEKNLFTGWVDVKLSEVGIKEATRAGEL
                     LKESGLKPDILYTSKLSRAIQTANIALDNADRLFIDVKRNWRLNERHYGALQGKDKAQ
                     TLAQYGKEQFMTWRRSFDVPPPPIADDSEFSQAHDERYKDVPKEDLPKTESLELVIKR
                     LLPYWQSDISKDLLAGKTVIVVAHGNSLRALVKHLDNISDEDIAGLNIPTGIPLVYEL
                     DDNLKPVKKAEYLDPEAAEAGAAAVAAQGSK"
     gene            <349711..>350178
                     /gene="YPT1"
                     /locus_tag="AWJ20_3816"
                     /db_xref="GeneID:30035879"
     mRNA            <349711..>350178
                     /gene="YPT1"
                     /locus_tag="AWJ20_3816"
                     /product="Rab family GTPase YPT1"
                     /transcript_id="XM_018880847.1"
                     /db_xref="GeneID:30035879"
     CDS             349711..350178
                     /gene="YPT1"
                     /locus_tag="AWJ20_3816"
                     /note="Rab family GTPase; involved in the ER-to-Golgi step
                     of the secretory pathway; complex formation with the Rab
                     escort protein Mrs6p is required for prenylation of Ypt1p
                     by protein geranylgeranyltransferase type II
                     (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates
                     unfolded protein response (UPR) by promoting the decay of
                     HAC1 RNA; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IDA] [PMID 10747087]; GO_component: GO:0005795 -
                     Golgi stack [Evidence IDA] [PMID 12802060]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0031410 - cytoplasmic vesicle [Evidence IDA] [PMID
                     23129774]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 10747087]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0000407 -
                     pre-autophagosomal structure [Evidence IDA] [PMID
                     20375281]; GO_component: GO:0005802 - trans-Golgi network
                     [Evidence IDA] [PMID 20059749]; GO_function: GO:0005525 -
                     GTP binding [Evidence IEA,IEA]; GO_function: GO:0003924 -
                     GTPase activity [Evidence IDA] [PMID 3311726];
                     GO_function: GO:0003924 - GTPase activity [Evidence IDA]
                     [PMID 9447979]; GO_function: GO:0000149 - SNARE binding
                     [Evidence IDA,IPI] [PMID 18388317]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0090114 - COPII-coated vesicle budding
                     [Evidence IMP] [PMID 15689495]; GO_process: GO:0032258 -
                     CVT pathway [Evidence IMP] [PMID 20375281]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IMP] [PMID 15689495]; GO_process: GO:0006888 -
                     ER to Golgi vesicle-mediated transport [Evidence IMP]
                     [PMID 2504726]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IMP] [PMID 7593181];
                     GO_process: GO:0048194 - Golgi vesicle budding [Evidence
                     IGI] [PMID 18388317]; GO_process: GO:0048211 - Golgi
                     vesicle docking [Evidence IMP] [PMID 9545229]; GO_process:
                     GO:0035494 - SNARE complex disassembly [Evidence IMP]
                     [PMID 9157884]; GO_process: GO:0034498 - early endosome to
                     Golgi transport [Evidence IMP] [PMID 20059749];
                     GO_process: GO:0032456 - endocytic recycling [Evidence
                     IMP] [PMID 20059749]; GO_process: GO:0016236 -
                     macroautophagy [Evidence IMP] [PMID 20375281]; GO_process:
                     GO:1990261 - pre-mRNA catabolic process [Evidence IMP]
                     [PMID 22844259]; GO_process: GO:0006461 - protein complex
                     assembly [Evidence IDA] [PMID 8603910]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA,IEA];
                     GO_process: GO:1900101 - regulation of endoplasmic
                     reticulum unfolded protein response [Evidence IMP] [PMID
                     22844259]; GO_process: GO:0006890 - retrograde
                     vesicle-mediated transport, Golgi to ER [Evidence IGI,IMP]
                     [PMID 18388317]; GO_process: GO:0007264 - small GTPase
                     mediated signal transduction [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]; GO_process:
                     GO:0016192 - vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="Rab family GTPase YPT1"
                     /protein_id="XP_018733497.1"
                     /db_xref="GeneID:30035879"
                     /translation="MKLQIWDTAGQEHFRAVTRSYFRNAAGCILVYDVTRRQTFDQVS
                     MWLNDIREQAHEEINICLVGNKSDLEDQRQVPYEEAKQWADSNGISHFLETSAKTGDN
                     VLEAYTSVAQSIHSKIVGGRYNLQDKGHGVKANNSGLINLNVDASTKRKGGCC"
     gene            <350571..>352538
                     /gene="PUF6"
                     /locus_tag="AWJ20_3817"
                     /db_xref="GeneID:30035880"
     mRNA            <350571..>352538
                     /gene="PUF6"
                     /locus_tag="AWJ20_3817"
                     /product="Puf6p"
                     /transcript_id="XM_018880848.1"
                     /db_xref="GeneID:30035880"
     CDS             350571..352538
                     /gene="PUF6"
                     /locus_tag="AWJ20_3817"
                     /inference="similar to AA sequence:KEGG_Orthology:K14844"
                     /note="Pumilio-homology domain protein; binds the 3' UTR
                     of ASH1 mRNA and represses its translation, resulting in
                     proper asymmetric localization of ASH1 mRNA; required at
                     post-transcriptional step for efficient
                     retrotransposition; absence results in decreased Ty1
                     Gag:GFP protein levels; co-sediments with the 60S
                     ribosomal subunit and is required for its biogenesis;
                     GO_component: GO:0005934 - cellular bud tip [Evidence
                     IEA]; GO_component: GO:0015934 - large ribosomal subunit
                     [Evidence IDA] [PMID 19806183]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA,IEA];
                     GO_function: GO:0003730 - mRNA 3'-UTR binding [Evidence
                     IDA] [PMID 15198983]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0000900 - translation repressor activity, nucleic acid
                     binding [Evidence IDA] [PMID 15198983]; GO_process:
                     GO:0017148 - negative regulation of translation [Evidence
                     IDA] [PMID 15198983]; GO_process: GO:0006417 - regulation
                     of translation [Evidence IEA]; GO_process: GO:0042273 -
                     ribosomal large subunit biogenesis [Evidence IMP] [PMID
                     19806183]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Puf6p"
                     /protein_id="XP_018733498.1"
                     /db_xref="GeneID:30035880"
                     /translation="MGKTAVKLSTKRKAVAVESRKPVTNGKLKKAKKEEEVVEESEEN
                     EDDFASSDDESINLSSDDSDEDELDKDDDEEDELDQDEEVDEEGNGSEDGEEDEEGLA
                     DDGSKTARSKEQRAEQKKLQQERKLQRSGGVEIQQIKNIWERLRVKTGVPTEVRKKLV
                     DQAWELCHDKVKELVFKHDASRVVQTIFKYADKEKRLAITKALKGSYVELAKSSYGKY
                     LLVKLLHYGSSDVRDGVLSEMHGSFRKLIKHKEGAYVIEDAYRDYSTAAHKSQIISEF
                     YGSEFAIFKDIAKDKSLEDIIKENPDKRPYLMKNLNEVITSAVNKGSIGFTIIHAAML
                     EYVKNIDATGSEREVFIDLITEQFAEIVHTNEGSQVACRVLSIATAKERKGLVRSLKP
                     FASKLASDEYGYLVLIALFRSVDDTVLVSKSFTADLKENINSLIVSKTGRRAFLYLLL
                     GLSPRYFTPTIIKKFNQLDELKAATSKKDDEVRRTELLKAFSPLFFEAISANTRTILK
                     ESLGAQFVAEALLYGIGEDDRQKALESVASAFGDSSPDADNGTHLIHEPFSTRLLRTL
                     VQDGHWDAKEKRANVVSSPTNFKALLLTKVLEFPAEWATGDGSFVVVSLVENLESADK
                     ATLVKVLKKHKKAITAASADNKGAKLLVEHL"
     gene            complement(<352859..>353602)
                     /gene="HAP3"
                     /locus_tag="AWJ20_3818"
                     /db_xref="GeneID:30035881"
     mRNA            complement(<352859..>353602)
                     /gene="HAP3"
                     /locus_tag="AWJ20_3818"
                     /product="Hap3p"
                     /transcript_id="XM_018880849.1"
                     /db_xref="GeneID:30035881"
     CDS             complement(352859..353602)
                     /gene="HAP3"
                     /locus_tag="AWJ20_3818"
                     /note="Subunit of the Hap2p/3p/4p/5p CCAAT-binding
                     complex; complex is heme-activated and glucose-repressed;
                     complex is a transcriptional activator and global
                     regulator of respiratory gene expression; contains
                     sequences contributing to both complex assembly and DNA
                     binding; GO_component: GO:0016602 - CCAAT-binding factor
                     complex [Evidence IDA,IPI] [PMID 2832951]; GO_component:
                     GO:0005622 - intracellular [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0000978 - RNA polymerase II core promoter proximal
                     region sequence-specific DNA binding [Evidence IDA] [PMID
                     7828851]; GO_function: GO:0001077 - RNA polymerase II core
                     promoter proximal region sequence-specific DNA binding
                     transcription factor activity involved in positive
                     regulation of transcription [Evidence IDA] [PMID 2832951];
                     GO_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IEA]; GO_process:
                     GO:0000436 - carbon catabolite activation of transcription
                     from RNA polymerase II promoter [Evidence IDA] [PMID
                     2832951]; GO_process: GO:0043457 - regulation of cellular
                     respiration [Evidence IMP] [PMID 2182199]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA,IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Hap3p"
                     /protein_id="XP_018733499.1"
                     /db_xref="GeneID:30035881"
                     /translation="MDKSPPDSSKNFELREQDKWLPIANVSRIMKNALPESAKVSKEA
                     KECVQECVSEFVSFITSEASEKCSAEKRKTVNGEDILFAMTSLGFENYAEVLKIYLAK
                     YREFQVLKQEREGDRKPSGGSGAGLGRLGNGGSSVSVGLDEDEDDDMDSGSGGVVMDN
                     ASESLAADGAVAEMLNTDGEHDQEHAEIKVEGQSGDGSEGAVATTADTYTNYDDSTYT
                     TNDHAPAATDDPSIYEDYGQYTNVDMNQF"
     gene            complement(<354966..>356045)
                     /locus_tag="AWJ20_3819"
                     /db_xref="GeneID:30035882"
     mRNA            complement(<354966..>356045)
                     /locus_tag="AWJ20_3819"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880850.1"
                     /db_xref="GeneID:30035882"
     CDS             complement(354966..356045)
                     /locus_tag="AWJ20_3819"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733500.1"
                     /db_xref="GeneID:30035882"
                     /translation="MVGEAPKLELQSLEFEKRMVLLTYSLALMMLAETAVTSRYGDGN
                     QDNDRKWKLATSHLIKSQSIVWYLVANSNSYKGQPIPPQLQNQTGFITGLQTLIGGSL
                     HLLIIYKDLERELQESSDGYNSSSTTTTSRNLLSRVAIYAADKFGAASQLISSSSSSF
                     SSSGGTGSDLSSSGSTEPTKSKMRSAMSRIAPSSHNGSSSSSSSSHNSSFSLGNSSDT
                     LSGWLSEARKFCIADTYKLSAIDQAQKGQTGQAIGFLTAALELLGANSKLKKVVSSTA
                     KPGTIQYQQDQLKQTILPILHSYTTENNNYTFQTIPKASELESNRPSGRQVVAAEQPW
                     VPPSSLISDSVSETLTPSSSSRTYY"
     gene            <357300..>360764
                     /gene="VPS3"
                     /locus_tag="AWJ20_3820"
                     /db_xref="GeneID:30035884"
     mRNA            <357300..>360764
                     /gene="VPS3"
                     /locus_tag="AWJ20_3820"
                     /product="CORVET complex subunit VPS3"
                     /transcript_id="XM_018880852.1"
                     /db_xref="GeneID:30035884"
     CDS             357300..360764
                     /gene="VPS3"
                     /locus_tag="AWJ20_3820"
                     /codon_start=1
                     /product="CORVET complex subunit VPS3"
                     /protein_id="XP_018733501.1"
                     /db_xref="GeneID:30035884"
                     /translation="MESDPYIIASKQRTHSKKRRPVSQIVILPTISRALVLSQSTTSV
                     FTLPEFAPCSNVGSMRDVNALSRDIDDFTVLNERGDSEFAEVTVFSKSAIRLVKVFGE
                     SLKLAGNIEYPGVLNGVRRSSYALVVNNESYDLLDLKHVRKVPLFPLRAAGEDEDQDS
                     ETREEDTYAQKQPGTTTETAGTEGETNASPTVEQSAETEPVGTTLTNKQVPEIAKEEG
                     DDSKTGTEESKTITETSAQSTTEEVDKAKDELTEPGSEADKKSNVETDPTNTIKVEED
                     AGMEVSVDSTTEVTTEPSTQPAPEVKVGETATSEGSTTEPSTQVATELKIGGTATTEG
                     SHIQRPRAGKGHAPAVSIHSIQSTGSVESAESKPSSSPVSTTSATFPSMEGVPTPTTE
                     VEGSKSDHSATGKSKSKKHADPIKPIIVPVASDEFLVTSGTSAVDRAMGLVVNVDGEI
                     SRGTIAWSKYPSSVAVDYPYVAAVIDNQVQLHSLHDQKLVQTVEFPSKPLVTTVLAPY
                     KTPYTVLVNKIVLAPLAVEDIKSPDVVSRMSSERDTACKISICSSTLFAYTPEAGVEC
                     LIPTPRFLSLEKLVLVNGQVDDVYDEIERMDFSTELAVTQLQYLNLLIGLYYLREANH
                     TPSHFSDVTKTWLVASLDPRIMIFIFDKKNVKGEVWVFNGVISFIETLQKTYSSSMSK
                     LSENVVSFLKTFYKDWFKKREMASLGLADKENVFKSLELSYLAFLLKCEEKSKASQHD
                     LIHAIDNEIVLATDESIELLRQQKKFFYLSHMYNKLKMPSELLSCWKEMLLETNPAFA
                     NGETTMAEYLINECEDEGLVWDYGAWLVQTYPKTGIKVFTSPDLRVNINENQVVAVLK
                     SMNNDEAWRQYLKFLVYEKNQTLFASDLATVMLLDIVDKISKNPDVRKSLMDNYDIYK
                     ALPVPKPAYIPFLRNKLQNSQPVVPTKSKGLLLKSTIAAPAASLSPFEEVMKMRLELM
                     ELVDSTSDFDYTSLMHLSQDEPDTLLIEQCVVFGHLGIHEQCLDILCNRLTDYKTAID
                     YCIYGRIPISMTILEPLDSQIQKDLFRQLFLRYLKVPDPGTRIACTRILLEQWGNRLD
                     VSLVLSNLPDNWPVEVVSGYLSQFFKRTMADQNQASVDRSLARSENLFISQQLLELSK
                     IAYTPSDI"
     gene            complement(<360932..>361576)
                     /locus_tag="AWJ20_3821"
                     /db_xref="GeneID:30035885"
     mRNA            complement(<360932..>361576)
                     /locus_tag="AWJ20_3821"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880853.1"
                     /db_xref="GeneID:30035885"
     CDS             complement(360932..361576)
                     /locus_tag="AWJ20_3821"
                     /inference="similar to AA sequence:KEGG_Orthology:K03247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733502.1"
                     /db_xref="GeneID:30035885"
                     /translation="MFAYQAENADSVVLVYDTAKSNQGGLALRAYRLSNSYLNAKKDG
                     KFTTENLVKNELSYSNIFQELPIDVKNSHLVTLYLHSAKEATENVKDYDDLAISVDQF
                     LEQNIEGIFDSVDEFHYDQGNYNYYQRQLTREKLKIQQWQQKRKAENTALEQQGKPLL
                     STDDYKTLFRLPEEPSRLDNLLISAQINQYCTQIEEFGATVVPKLFATQKVLEG"
     gene            <362367..>363341
                     /gene="PRP18"
                     /locus_tag="AWJ20_3822"
                     /db_xref="GeneID:30035886"
     mRNA            <362367..>363341
                     /gene="PRP18"
                     /locus_tag="AWJ20_3822"
                     /product="Prp18p"
                     /transcript_id="XM_018880854.1"
                     /db_xref="GeneID:30035886"
     CDS             362367..363341
                     /gene="PRP18"
                     /locus_tag="AWJ20_3822"
                     /inference="similar to AA sequence:KEGG_Orthology:K12817"
                     /note="Splicing factor and component of snRNP U5; factor
                     involved in the positioning of the 3' splice site during
                     the second catalytic step of splicing; interacts with
                     Slu7p; GO_component: GO:0071021 - U2-type
                     post-spliceosomal complex [Evidence IDA] [PMID 12212850];
                     GO_component: GO:0046540 - U4/U6 x U5 tri-snRNP complex
                     [Evidence IDA] [PMID 8474454]; GO_component: GO:0005682 -
                     U5 snRNP [Evidence IDA] [PMID 8474454]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005681 - spliceosomal complex [Evidence IEA,IEA];
                     GO_function: GO:0000386 - second spliceosomal
                     transesterification activity [Evidence IDA] [PMID
                     12212850]; GO_function: GO:0000386 - second spliceosomal
                     transesterification activity [Evidence IGI] [PMID
                     17626844]; GO_process: GO:0008380 - RNA splicing [Evidence
                     IEA,IEA]; GO_process: GO:0000350 - generation of catalytic
                     spliceosome for second transesterification step [Evidence
                     IDA] [PMID 12212850]; GO_process: GO:0006397 - mRNA
                     processing [Evidence IEA]; GO_process: GO:0000398 - mRNA
                     splicing, via spliceosome [Evidence IMP] [PMID 12403466];
                     GO_process: GO:0071048 - nuclear retention of unspliced
                     pre-mRNA at the site of transcription [Evidence IGI,IMP]
                     [PMID 14718167]"
                     /codon_start=1
                     /product="Prp18p"
                     /protein_id="XP_018733503.1"
                     /db_xref="GeneID:30035886"
                     /translation="MDFSALLAKEIAKKKAQAAAVTNLKTESADGPGQKPKSYVRKAE
                     LEELREKEYRKEQEAKQAAARKRQLEQELEHEREKENEAKRLKRRGNDGSNSNKSETE
                     RSDSEIIARLEELNEPTSVPGESEKGRKNRLARIEKKLELQERLRKEEEEDARTDPTI
                     VPQDIKDNEPKVYIQMRVYIKQLLRKWELYLEQNQEETKSIYKEASKDIEILLGHLRN
                     KSLSKQIFPSLATLLYYLQTKKFRDANDTYIQLSIGNVAWPIGVIGVAIHERSAQSKI
                     TGIHNTSSEGSVQIAHIMSDDETRRWLTAVKRLITFCEKTSKTSSVTD"
     gene            complement(<363718..>364554)
                     /gene="SGT1"
                     /locus_tag="AWJ20_3823"
                     /db_xref="GeneID:30035887"
     mRNA            complement(<363718..>364554)
                     /gene="SGT1"
                     /locus_tag="AWJ20_3823"
                     /product="Sgt1p"
                     /transcript_id="XM_018880855.1"
                     /db_xref="GeneID:30035887"
     CDS             complement(363718..364554)
                     /gene="SGT1"
                     /locus_tag="AWJ20_3823"
                     /inference="similar to AA sequence:KEGG_Orthology:K12795"
                     /note="Cochaperone protein; regulates activity of adenylyl
                     cyclase Cyr1p; involved in kinetochore complex assembly;
                     associates with the SCF (Skp1p/Cdc53p/F box protein)
                     ubiquitin ligase complex; acts as a linker between Skp1p
                     and HSP90 complexes; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0000151 - ubiquitin ligase complex [Evidence IDA] [PMID
                     10445024]; GO_function: GO:0051087 - chaperone binding
                     [Evidence ISS] [PMID 12456005]; GO_function: GO:0051087 -
                     chaperone binding [Evidence IDA] [PMID 16945921];
                     GO_function: GO:0030674 - protein binding, bridging
                     [Evidence IDA] [PMID 16945921]; GO_process: GO:0019933 -
                     cAMP-mediated signaling [Evidence IGI,IPI] [PMID
                     12456005]; GO_process: GO:0007049 - cell cycle [Evidence
                     IEA]; GO_process: GO:0051382 - kinetochore assembly
                     [Evidence IDA] [PMID 10445024]; GO_process: GO:0006461 -
                     protein complex assembly [Evidence IGI,ISS] [PMID
                     12456005]; GO_process: GO:0006461 - protein complex
                     assembly [Evidence IDA] [PMID 15090617]; GO_process:
                     GO:0016567 - protein ubiquitination [Evidence TAS] [PMID
                     12456005]; GO_process: GO:0051726 - regulation of cell
                     cycle [Evidence TAS] [PMID 11847307]"
                     /codon_start=1
                     /product="Sgt1p"
                     /protein_id="XP_018733504.1"
                     /db_xref="GeneID:30035887"
                     /translation="MKIQSHLKSVEDEDDLIVSIQDIPKIQDLSDDESGRKEVEKALD
                     VQPEKQSGISVSTPEYPAPDTVRHDWFQMGNKCDVSIFIKNSPKEDVTVEFTESSATI
                     KFPLASGQLYEYNIGPFSHEIEPSKSTCKVFSTKIELGIVKKVNTSWATLLSPEGERP
                     LNNKVPLSLDEMRTALEKTAKDSSNSSSEASTTNSTRPLVPSFEKNWEKMAAEALGDE
                     EQQPDDFFKQLYGNADDDTRKAMLKSYTESGGTTLSTNWEDVKKAPVPVSPPSGMEAK
                     KF"
     gene            <365586..>367052
                     /gene="NOB1"
                     /locus_tag="AWJ20_3824"
                     /db_xref="GeneID:30035888"
     mRNA            <365586..>367052
                     /gene="NOB1"
                     /locus_tag="AWJ20_3824"
                     /product="Nob1p"
                     /transcript_id="XM_018880856.1"
                     /db_xref="GeneID:30035888"
     CDS             365586..367052
                     /gene="NOB1"
                     /locus_tag="AWJ20_3824"
                     /inference="similar to AA sequence:KEGG_Orthology:K11883"
                     /note="Protein involved in proteasomal and 40S ribosomal
                     subunit biogenesis; required for cleavage of the 20S
                     pre-rRNA to generate the mature 18S rRNA; cleavage is
                     activated by Fun12p, a GTPase and translation initiation
                     factor; relocalizes from nucleus to nucleolus upon DNA
                     replication stress; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 12588997]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     12502737]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 12588997]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0030688 -
                     preribosome, small subunit precursor [Evidence IDA] [PMID
                     12588997]; GO_function: GO:0004521 - endoribonuclease
                     activity [Evidence IDA] [PMID 19801658]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0004518 - nuclease activity
                     [Evidence IEA]; GO_function: GO:0070181 - small ribosomal
                     subunit rRNA binding [Evidence IDA] [PMID 19706509];
                     GO_process: GO:0030490 - maturation of SSU-rRNA [Evidence
                     IDA] [PMID 19801658]; GO_process: GO:0000462 - maturation
                     of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IEP,IMP] [PMID 12588997];
                     GO_process: GO:0000462 - maturation of SSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 15388878]; GO_process:
                     GO:0090305 - nucleic acid phosphodiester bond hydrolysis
                     [Evidence IEA]; GO_process: GO:0043248 - proteasome
                     assembly [Evidence IMP,IPI] [PMID 12502737]; GO_process:
                     GO:0042274 - ribosomal small subunit biogenesis [Evidence
                     IDA] [PMID 12588997]; GO_process: GO:0042274 - ribosomal
                     small subunit biogenesis [Evidence IPI] [PMID 12628929];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Nob1p"
                     /protein_id="XP_018733505.1"
                     /db_xref="GeneID:30035888"
                     /translation="MASINSLILDAGPLLTQTFSDLHSRAEKFFTTPSVYNEIKDERA
                     RQNLLLWGEELVVRQPKPSSIAAVSEFSKKTGDYAVLSSTDMHILALCYELEVELNGG
                     DWRLRKVPGQKNINGAKEVKHSETQKSESTDSSVSKVKESNEQTAEPVSDLTKTESKK
                     ESSETTATEPEANPEETEDDGWSVVAAKPRKQKKGKKRNDLWSKPAQVPVIPSEPTTT
                     DSAQPESEVDNQQITEATATEESQPPAEENVETQDSFVEEIIEEDYDDEDADDWITTE
                     NLQETLEKAGGDKLEKVETKTMKAAMSTGDFAMQNVALQMGLNLVNPTNGKHIKRVKN
                     YMLRCHACFKLTAFPKDGRPRQFCPRCGGATLLRCTVQVSDSGNIQVFLKKNMQWSSR
                     GDKFSLPTPQSRNARKQRHESDPILLREDQKEYQKAVKDSMWKKRQNEKLLDEWIGTG
                     SADSVGSPFAISGYKRDATKHTGVRVGRGRYVNDSKRK"
     gene            <371591..>372541
                     /gene="RSR1"
                     /locus_tag="AWJ20_3825"
                     /db_xref="GeneID:30035889"
     mRNA            <371591..>372541
                     /gene="RSR1"
                     /locus_tag="AWJ20_3825"
                     /product="Ras family GTPase RSR1"
                     /transcript_id="XM_018880857.1"
                     /db_xref="GeneID:30035889"
     CDS             371591..372541
                     /gene="RSR1"
                     /locus_tag="AWJ20_3825"
                     /inference="similar to AA sequence:KEGG_Orthology:K07836"
                     /note="GTP-binding protein of the Ras superfamily;
                     required for bud site selection, morphological changes in
                     response to mating pheromone, and efficient cell fusion;
                     localized to the plasma membrane; significantly similar to
                     mammalian Rap GTPases; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 15282802]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 8723349]; GO_function: GO:0005525 - GTP binding
                     [Evidence IEA,IEA]; GO_function: GO:0003924 - GTPase
                     activity [Evidence IDA] [PMID 1910037]; GO_function:
                     GO:0003924 - GTPase activity [Evidence TAS] [PMID
                     9759491]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0004871 - signal
                     transducer activity [Evidence TAS] [PMID 9891811];
                     GO_process: GO:0006184 - GTP catabolic process [Evidence
                     IEA]; GO_process: GO:0007120 - axial cellular bud site
                     selection [Evidence TAS] [PMID 2065354]; GO_process:
                     GO:0007120 - axial cellular bud site selection [Evidence
                     TAS] [PMID 2690082]; GO_process: GO:0007121 - bipolar
                     cellular bud site selection [Evidence TAS] [PMID 2065354];
                     GO_process: GO:0007121 - bipolar cellular bud site
                     selection [Evidence TAS] [PMID 2690082]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0000282 - cellular bud site selection [Evidence TAS]
                     [PMID 9759491]; GO_process: GO:0007165 - signal
                     transduction [Evidence IEA]; GO_process: GO:0007264 -
                     small GTPase mediated signal transduction [Evidence IEA];
                     GO_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence TAS] [PMID 9891811]"
                     /codon_start=1
                     /product="Ras family GTPase RSR1"
                     /protein_id="XP_018733506.1"
                     /db_xref="GeneID:30035889"
                     /translation="MRDYKVVVLGAGGVGKSALTVQFVQGVYLESYDPTIEDSYRKQC
                     LIDNRSCTLEILDSAGVEQFTAMRELYIKNGEGFILVYSVTNESSLQELLELREQVIR
                     IKDNANVPIVLVGNKCDLMDDRVVPAKVGVQVADSWGKVPFYETSAKYRLNVEEVFVD
                     LVRQIMRRDSGFGSSLGMRQGSIDESTKKYILGHGHNNSSNSHYYSSHGRQLSHNGSN
                     NASSVALAAATHTASNSTSSTFSSRSNSHTQTHSAASLEGFDHAFLTTDPAAKSTRNK
                     LLRHKPSNRKLSGKASTLSLRRNHANPASAGQKDKDCLIM"
     gene            complement(<373013..>374818)
                     /locus_tag="AWJ20_3826"
                     /db_xref="GeneID:30035890"
     mRNA            complement(<373013..>374818)
                     /locus_tag="AWJ20_3826"
                     /product="methylcrotonoyl-CoA carboxylase beta chain,
                     mitochondrial precursor"
                     /transcript_id="XM_018880858.1"
                     /db_xref="GeneID:30035890"
     CDS             complement(373013..374818)
                     /locus_tag="AWJ20_3826"
                     /inference="similar to AA sequence:KEGG_Orthology:K01969"
                     /codon_start=1
                     /product="methylcrotonoyl-CoA carboxylase beta chain,
                     mitochondrial precursor"
                     /protein_id="XP_018733507.1"
                     /db_xref="GeneID:30035890"
                     /translation="MLQWSLRSISSLGHGVRSSSGLHFGLARCTSISGVHGVKIESRL
                     ASTASLFASKYQTESLQTLPTAISNTSPEFQEKAAAMNELISEIQAIHNHVTDVNEIP
                     EKIRTKHLARKKLLPRDRIAALIDPGTSFMDLSLLAGHELYEGEDIRGGGIITGIGIV
                     QGVKCLIIANDSTVKGGTYYPITVRKHLRAQEIAQENHMPCIYLSDSGGANLPHQSDV
                     FPAHNHFGHIFYQQSRMSSMGIPQLALVLGPCTAGGAYVPAMSDESIIVRGTGHIFLA
                     GPPLVKAATGEVVSAEDLGGGEMHASVSGVVDYLAETEEEGIALLRQSVGNLNWPKVE
                     TLASSAQPEKTIDEPLYPPEELGGVVGTNLKVAYNVREVIARIVDGSRFSEFKKKYGT
                     SLVCGWSEIWGHKVGILANNGPLFSDSSLKGAHFIQLCKQRDIPLVFLQNISGFMVGS
                     DAERGGIAKNGAKLVNAVVGAGVEKYTVIIGGSYGAGNYGMCGRAYKPRFLWSWPNAR
                     TAVMGAEQLASVMDSVGSASNKAKSDALRDRIERESLVKFGSARLWDDGVILPQQTRQ
                     YLGQALEIRAQSRVVQATRFAQKAAAPHDFGIWRM"
     gene            <375670..>376845
                     /locus_tag="AWJ20_3827"
                     /db_xref="GeneID:30035891"
     mRNA            <375670..>376845
                     /locus_tag="AWJ20_3827"
                     /product="isovaleryl-CoA dehydrogenase, mitochondrial
                     precursor"
                     /transcript_id="XM_018880859.1"
                     /db_xref="GeneID:30035891"
     CDS             375670..376845
                     /locus_tag="AWJ20_3827"
                     /inference="similar to AA sequence:KEGG_Orthology:K00253"
                     /note="Fungal Genetics Stock Center 12071"
                     /codon_start=1
                     /product="isovaleryl-CoA dehydrogenase, mitochondrial
                     precursor"
                     /protein_id="XP_018733508.1"
                     /db_xref="GeneID:30035891"
                     /translation="MSSRAYSAAAALDVEELREATIAFCKEEITREVAAATDSNNSFP
                     NELWPKLGEAGLLGITASPEYGGLGQGYLAHSVVIEELSRASGSIALSYAAHSNLCIN
                     QLTLHTTPEQGAKYLPDLISGKKIGALAMSEAGSGSDVVSMKTTATLSDDGSGYYLNG
                     TKMWITNGPDADTLVVYAKTDPKAGSKGITTFIVEKGMPGFSCTRKLDKLGMRGSNTG
                     ELVFDNVFIPKENVLGKVGGGVYVLMSGLDLERLVLAAGPVGLMKAALDETLPYVHTR
                     LQFGQPIAHNQLIQGKLADMYTKYATARAFLYETARAADAGHKDTKDCAAVILYAAER
                     ATEVCLDAIQCLGGMGYVNETVPGRLLRDAKLYEIGAGTSEIRRMVIGRAFNKEYRQ"
     gene            <380125..>383535
                     /gene="OSH2"
                     /locus_tag="AWJ20_3828"
                     /db_xref="GeneID:30035892"
     mRNA            <380125..>383535
                     /gene="OSH2"
                     /locus_tag="AWJ20_3828"
                     /product="oxysterol-binding protein related protein OSH2"
                     /transcript_id="XM_018880860.1"
                     /db_xref="GeneID:30035892"
     CDS             380125..383535
                     /gene="OSH2"
                     /locus_tag="AWJ20_3828"
                     /note="Member of an oxysterol-binding protein family with
                     seven members; in S. cerevisiae, family members have
                     overlapping, redundant functions in sterol metabolism and
                     collectively perform a function essential for viability;
                     OSH2 has a paralog, SWH1, that arose from the whole genome
                     duplication; GO_component: GO:0005935 - cellular bud neck
                     [Evidence IDA] [PMID 11408574]; GO_component: GO:0032541 -
                     cortical endoplasmic reticulum [Evidence IDA] [PMID
                     20008566]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IDA] [PMID 12727870]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 11408574]; GO_function: GO:0005545 -
                     1-phosphatidylinositol binding [Evidence ISS] [PMID
                     11238399]; GO_function: GO:0008289 - lipid binding
                     [Evidence IEA]; GO_function: GO:0008289 - lipid binding
                     [Evidence IDA] [PMID 20008566]; GO_function: GO:0008142 -
                     oxysterol binding [Evidence ISS] [PMID 11238399];
                     GO_function: GO:0015248 - sterol transporter activity
                     [Evidence IDA] [PMID 20008566]; GO_process: GO:0035621 -
                     ER to Golgi ceramide transport [Evidence IMP] [PMID
                     24213531]; GO_process: GO:0006897 - endocytosis [Evidence
                     IGI] [PMID 15173322]; GO_process: GO:0006887 - exocytosis
                     [Evidence IGI] [PMID 17004323]; GO_process: GO:0006869 -
                     lipid transport [Evidence IEA]; GO_process: GO:0030011 -
                     maintenance of cell polarity [Evidence IGI] [PMID
                     17004323]; GO_process: GO:0015918 - sterol transport
                     [Evidence IGI] [PMID 16585271]; GO_process: GO:0015918 -
                     sterol transport [Evidence IDA] [PMID 20008566];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="oxysterol-binding protein related protein OSH2"
                     /protein_id="XP_018733509.1"
                     /db_xref="GeneID:30035892"
                     /translation="MYGRQEIALLLLNQPQINDTIVNSKGKQPVELSKTPQIAEAMQI
                     ARAQYVEKVAFLLKKYLDEENTAALEELLSIPRASALLDINGQDPVTGGTVLHDFVRK
                     KNKKMVEFILSHGGDPFKRDFKGVLPIEVTKDDTIKKMLKAAKKEQTVIIGNGDKAGG
                     SGPGGAVAGGPRVSGESPNMKGYLKKWTNFTGGYKLRWFVLENGVLSYYKRQDDIQRA
                     CRGSVNLKEAKLHLDSSEKLRFEVVIRGSNSKFHLKGNHPVETNRWVWALQNAIQYAK
                     DQDRLKNGSGTALSASSTGSTDLRRSGTSGSVSSARTNATTSTTATGVTRSGSAGAAA
                     RGDENSTLTVPNTSSGSSRISSSSRRSPSSSSHSRSHSASEMFASTNSKIISGTMNLH
                     DDAESRGLGGIGLNSSTKLVDDILPEDEDVVDDDDDDYSEGLTDPESFDEEIGNGSGL
                     KWGRFEDSITLEANAIRDLLTLIRAKNQKNIDNQPGGLTSKELDDSLSAMSASIETLE
                     SVAKQHAKQFNAQERYYQQKIDQAETKERLWAKNLRDLELEHQKIQGDLHSALQKRKE
                     ATKLLREAQSAQARVTSPSDNSGVSTTAAAAGSAMAGVVAGVGAGIAATTASSDEGST
                     SKTGDSVPPNPTITAAGQASKSDINRPTITSNEESDDSDDDDDEFFDTLPEVTDTLDE
                     KGASLATIHESTSAETLAVESDLTSVQEKKKQLITGQDSFAGYEDGPRKRLKLDADDR
                     PKISLWGVLKSLIGKDMTKMTLPVSFNECTNLLQRSAEDMEYTDILDRGAKIVDDPAL
                     RLAHVAAFAASSYSSTINRIAKPFNPLLGETFEYCRPDCGYRLFSEQVSHHPPIGALY
                     AEAPKWDFYGASNVKSQFYGRSFDINPLGRWYLTLRPDAGAGVEEELYSFKKVTSSVV
                     GIITGSPIVDNYGDMDIINHTLGYKCTVNFKPRGWSGKNAYELKGRIVSPSGKEEWIV
                     GGRWNDKIIARRIVKGQESTGDGVKLPAGDSNAPTSSANINAILLWKVHDRPPAPFNL
                     TAFAITLNDLPDKLARYIAPTDTRLRPDQRAMEEGRYDAAADEKKRVEEKQRAARRLR
                     EQSGVEYKPLWFKKDVHPVTGEEYYTPTRDYWQYRQNKSIKTIAPDIF"
     gene            <387080..>388555
                     /gene="MEP3"
                     /locus_tag="AWJ20_3829"
                     /db_xref="GeneID:30035893"
     mRNA            <387080..>388555
                     /gene="MEP3"
                     /locus_tag="AWJ20_3829"
                     /product="ammonium permease MEP3"
                     /transcript_id="XM_018880861.1"
                     /db_xref="GeneID:30035893"
     CDS             387080..388555
                     /gene="MEP3"
                     /locus_tag="AWJ20_3829"
                     /inference="similar to AA sequence:KEGG_Orthology:K03320"
                     /note="Ammonium permease of high capacity and low
                     affinity; belongs to a ubiquitous family of cytoplasmic
                     membrane proteins that transport only ammonium (NH4+);
                     expression is under the nitrogen catabolite repression
                     regulation ammonia permease; MEP3 has a paralog, MEP1,
                     that arose from the whole genome duplication;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence TAS] [PMID 11486013]; GO_component: GO:0005886 -
                     plasma membrane [Evidence ISS] [PMID 9234685];
                     GO_function: GO:0008519 - ammonium transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0008519 - ammonium transmembrane transporter activity
                     [Evidence IDA,IMP,ISS] [PMID 9234685]; GO_process:
                     GO:0072488 - ammonium transmembrane transport [Evidence
                     IEA]; GO_process: GO:0015696 - ammonium transport
                     [Evidence IEA,IEA]; GO_process: GO:0015696 - ammonium
                     transport [Evidence IMP,ISS] [PMID 9234685]; GO_process:
                     GO:0019740 - nitrogen utilization [Evidence IMP] [PMID
                     9234685]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="ammonium permease MEP3"
                     /protein_id="XP_018733510.1"
                     /db_xref="GeneID:30035893"
                     /translation="MHSYKVAEDLNRARLGIVARGDSSTNFNFDTGDVGYLMVSTCMV
                     FIMIPGLGFLYSGLARRKSALSMIWFTLSAGCVGIFQWYFWGYSLTFSPTATNGYIGN
                     LYQFGMRHVLGGDATYPELLFAGYQGMFQAVTVAIVMGGAAERGRLFPAMVVTFLWAT
                     LVYCPLACWAWGPNGWAGAQWGVLDFAGGGPVEIGSGVAGLAYSIALGRRKEQLLLNF
                     RPHNVSLVTLGTVLLWFGWLGFNGGSALGANLRAVYAVWNSNLCAAFGAMAWCLLDFR
                     LEKKWSTVAICSGIISGLVAATPAAGNIPMWASVILGATAGIVCNFSTQIKYLIHADD
                     SMDTFAEHAMAGIIGLLFNGLFAETWIIGLDGVTVHPGGWMSHNWKQLYKQFAYLCAC
                     MGYCFVVTLLICYAVNYIPGCHLRVTEDGERGGIDEDQIGEFAYDYVEIRRNYDSKQF
                     DEPIIYEQRVEEPEHPPEEIEEAEEHSSTTKTNPPQEKASA"
     gene            complement(<389005..>390252)
                     /gene="csn2"
                     /locus_tag="AWJ20_3830"
                     /db_xref="GeneID:30035895"
     mRNA            complement(<389005..>390252)
                     /gene="csn2"
                     /locus_tag="AWJ20_3830"
                     /product="COP9/signalosome complex subunit Csn2"
                     /transcript_id="XM_018880863.1"
                     /db_xref="GeneID:30035895"
     CDS             complement(389005..390252)
                     /gene="csn2"
                     /locus_tag="AWJ20_3830"
                     /inference="similar to AA sequence:KEGG_Orthology:K12176"
                     /codon_start=1
                     /product="COP9/signalosome complex subunit Csn2"
                     /protein_id="XP_018733511.1"
                     /db_xref="GeneID:30035895"
                     /translation="MTSPVITKNYAEKSLNNIIERITCDDLDFMDKIYTTTLDKLKAK
                     QENDRLWIRTSLKLANLYISRELVDKAQDLVNELMEVCHQTNSGSDTIMSTYLLEIYA
                     LEIQVCMLTGNIKRLKELYSKTLNVTTAVLHPRILGVIRECGGKMHMQEKKWDIARED
                     FFESFKNYDEAGSLHRTQVLKYYVLACMLSESGINPFESQETKPYKDDPQVSVIVQLV
                     DVFQKSDVEGFNELMKTHRAEIMSDSFFANFLDDIVLSIRSLGVLNLVKPYRRVSLDH
                     IQNILGVDQATLVEIIVGLILDDRLPNTKIDLTNGFIDLNITNQSASVSSSKQDTRFS
                     TSTSSNNVAPLPSRYYESDRDSAQQQEQQNLVRASSDAVAMAGLSSTSNTSTTTSHTD
                     SQRPVSLAHWLGSLERLHSAIHA"
     gene            complement(<391496..>394201)
                     /gene="NAM2"
                     /locus_tag="AWJ20_3831"
                     /db_xref="GeneID:30035896"
     mRNA            complement(<391496..>394201)
                     /gene="NAM2"
                     /locus_tag="AWJ20_3831"
                     /product="leucine--tRNA ligase NAM2"
                     /transcript_id="XM_018880864.1"
                     /db_xref="GeneID:30035896"
     CDS             complement(391496..394201)
                     /gene="NAM2"
                     /locus_tag="AWJ20_3831"
                     /inference="similar to AA sequence:KEGG_Orthology:K01869"
                     /note="Mitochondrial leucyl-tRNA synthetase; also has a
                     direct role in splicing of several mitochondrial group I
                     introns; indirectly required for mitochondrial genome
                     maintenance; GO_component: GO:0005759 - mitochondrial
                     matrix [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 1990003]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0002161 -
                     aminoacyl-tRNA editing activity [Evidence IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004823 - leucine-tRNA
                     ligase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004823 - leucine-tRNA ligase activity [Evidence IDA]
                     [PMID 1990003]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IPI] [PMID 11142386]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_process:
                     GO:0000372 - Group I intron splicing [Evidence IMP] [PMID
                     12486008]; GO_process: GO:0000372 - Group I intron
                     splicing [Evidence IMP] [PMID 2277640]; GO_process:
                     GO:0006429 - leucyl-tRNA aminoacylation [Evidence IEA];
                     GO_process: GO:0006429 - leucyl-tRNA aminoacylation
                     [Evidence IDA] [PMID 1990003]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IGI] [PMID 16777356];
                     GO_process: GO:0006450 - regulation of translational
                     fidelity [Evidence IEA]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="leucine--tRNA ligase NAM2"
                     /protein_id="XP_018733512.1"
                     /db_xref="GeneID:30035896"
                     /translation="MFRVIQQYPRLVPGCALNYGARFYSESAGLLSTQLDEKWKKIWK
                     SHPPRADAATSDTSKGKYFVLSMFPYPSGILHIGHLRVYTISDVLARYRRLSGYDVIH
                     PMGWDAFGLPAENAAIERNVDPAVWTYSNIEKMRAQMDIMLADLDWDKEVITCSPEYY
                     KFTQKLFIMLYESGYAYRKEAVVNWDPIEKTVLANEQVDNEGRSWRSGAIVEKKKLEQ
                     WFLAITKLAPQLLDDLKVLDKWPKKVKTMQRNWIGKSEGAEIQFLFNPSSENGLISKL
                     GLDRVSAFTTRPDTLFGVDYVALSLNHPVSEWYSKQHPQLAKFLEEAKNLPEDSKAGF
                     KIPGLFLSNPLTPDTYDIPVFVAPYVIGDYGHGAVMGCPGHDLRDNAFWAENNPGVEP
                     SVVVRPASDTVAPGEIFAGKDGILNEKSGQFAGLTSKEGGSAIIDYVSKLNGLASKTT
                     QLKLRDWLISRQRFWGAPIPMIHCETDCGIVPVPEEDLPVLLPDGLGAPLSTSEEFTK
                     TTCPKCGGPAHRDTDTMDTFMDSSWYFFRYTDPKNPNQLFDYEKASTLMPVDLYIGGV
                     EHAILHLLYSRFISKFLAETGAWSGGDLNGEPIKRLVTQGMVHGRTLIDGETGRFLKP
                     EEVDESNPQVGPIIKSTGKVAEISSEKMSKSKFNGADPVKCITSHGADATRAHILFQA
                     PVSDVLNWEEQRIVGIERWLARVQSAVDSTIEKGLDTTSELDVSKLSAEDVKLWNEVQ
                     KKIEQITAALHEDLSMNTLISDYMKLTRTILNGLESPTTSPAVLYKSTKTLLQLISPV
                     TPANAEEGWEKLLKADGKEWTTIFNQRWPQPSPIEVTIKASGKHRIIINGKSVFELEI
                     TDTSISDDELIALIRSNGGDEHLAGKTIKRVIRPDGKPAVSLIAA"
     gene            <396173..>397399
                     /gene="NHX1"
                     /locus_tag="AWJ20_3832"
                     /db_xref="GeneID:30035897"
     mRNA            <396173..>397399
                     /gene="NHX1"
                     /locus_tag="AWJ20_3832"
                     /product="bifunctional K:H/Na:H antiporter NHX1"
                     /transcript_id="XM_018880865.1"
                     /db_xref="GeneID:30035897"
     CDS             396173..397399
                     /gene="NHX1"
                     /locus_tag="AWJ20_3832"
                     /inference="similar to AA sequence:KEGG_Orthology:K12041"
                     /note="Na+/H+ and K+/H+ exchanger; required for
                     intracellular sequestration of Na+ and K+; located in the
                     vacuole and late endosome compartments; required for
                     osmotolerance to acute hypertonic shock and for vacuolar
                     fusion; ortholog of human NHE9, which is linked to autism;
                     GO_component: GO:0005769 - early endosome [Evidence IDA]
                     [PMID 22210050]; GO_component: GO:0005768 - endosome
                     [Evidence IEA]; GO_component: GO:0010008 - endosome
                     membrane [Evidence IEA]; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     20826459]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0005770 - late endosome
                     [Evidence IDA] [PMID 20709757]; GO_component: GO:0005770 -
                     late endosome [Evidence IDA] [PMID 22210050];
                     GO_component: GO:0005770 - late endosome [Evidence IDA]
                     [PMID 9694857]; GO_component: GO:0031902 - late endosome
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005802 -
                     trans-Golgi network [Evidence IDA] [PMID 22210050];
                     GO_function: GO:0015297 - antiporter activity [Evidence
                     IEA]; GO_function: GO:0015386 - potassium:proton
                     antiporter activity [Evidence IMP] [PMID 15635088];
                     GO_function: GO:0015385 - sodium:proton antiporter
                     activity [Evidence IEA]; GO_function: GO:0015385 -
                     sodium:proton antiporter activity [Evidence IMP] [PMID
                     10998367]; GO_function: GO:0015385 - sodium:proton
                     antiporter activity [Evidence IMP] [PMID 15635088];
                     GO_function: GO:0015299 - solute:proton antiporter
                     activity [Evidence IEA]; GO_process: GO:0006812 - cation
                     transport [Evidence IEA]; GO_process: GO:0030004 -
                     cellular monovalent inorganic cation homeostasis [Evidence
                     IMP] [PMID 10589731]; GO_process: GO:1902600 - hydrogen
                     ion transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006811 - ion transport [Evidence IEA]; GO_process:
                     GO:0071805 - potassium ion transmembrane transport
                     [Evidence IMP] [PMID 15635088]; GO_process: GO:0006813 -
                     potassium ion transport [Evidence IEA]; GO_process:
                     GO:0006885 - regulation of pH [Evidence IEA]; GO_process:
                     GO:0035725 - sodium ion transmembrane transport [Evidence
                     IMP] [PMID 10998367]; GO_process: GO:0035725 - sodium ion
                     transmembrane transport [Evidence IMP] [PMID 15635088];
                     GO_process: GO:0006814 - sodium ion transport [Evidence
                     IEA,IEA]; GO_process: GO:0055085 - transmembrane transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0007035 - vacuolar
                     acidification [Evidence IMP] [PMID 10589731]"
                     /codon_start=1
                     /product="bifunctional K:H/Na:H antiporter NHX1"
                     /protein_id="XP_018733513.1"
                     /db_xref="GeneID:30035897"
                     /translation="MTALVLKHSHVRRFPQIESCLVLLFAYASYFFSNGCHMSGIVSL
                     LFCGITLKHYAYYNMSRRTQIAIKYIFQLLAQLSENFIFVYLGLSLFTQEELIFKPVL
                     IIVTALGICVSRWAAVFPLSKLINFASRARATRILRGSSLGSASGASASLTDEIPQPY
                     QMMLFWAGLRGAVGVALAAGLEGEHGPSLRATVLVIVVLTVIVFGGTTARMLEILGIR
                     TGVIEDVESDDEFDIEAVLDSRHQREEGFGYNSRSGNLSATHLIGGGVGSTSSPGDLG
                     NISGGFYQPGSRSGSVTRLRRSGSYHDDQLDAANIHGNNNEFDSDVDSDVSDLPPMAG
                     SRSAAGSSSVALDNLGPLNSSNGGSGASGDLAANSSGTSFLRAEDRARWFREFDEQVL
                     KPVLLDSSPGANSPNR"
     gene            <399759..>402416
                     /gene="SMC6"
                     /locus_tag="AWJ20_3833"
                     /db_xref="GeneID:30035898"
     mRNA            <399759..>402416
                     /gene="SMC6"
                     /locus_tag="AWJ20_3833"
                     /product="DNA repair protein SMC6"
                     /transcript_id="XM_018880866.1"
                     /db_xref="GeneID:30035898"
     CDS             399759..402416
                     /gene="SMC6"
                     /locus_tag="AWJ20_3833"
                     /note="Component of the SMC5-SMC6 complex; this complex
                     plays a key role in the removal of X-shaped DNA structures
                     that arise between sister chromatids during DNA
                     replication and repair; homologous to S. pombe rad18;
                     GO_component: GO:0030915 - Smc5-Smc6 complex [Evidence
                     IEA]; GO_component: GO:0030915 - Smc5-Smc6 complex
                     [Evidence IDA] [PMID 15738391]; GO_component: GO:0005694 -
                     chromosome [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 11927594]; GO_component: GO:0035861 -
                     site of double-strand break [Evidence IDA] [PMID
                     16892052]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA]; GO_function: GO:0019789 - SUMO ligase activity
                     [Evidence IDA] [PMID 15738391]; GO_function: GO:0003684 -
                     damaged DNA binding [Evidence IDA] [PMID 16793545];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0006310 - DNA recombination [Evidence
                     IEA]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA,IEA]; GO_process: GO:0006281 - DNA repair [Evidence
                     IDA] [PMID 11927594]; GO_process: GO:0006281 - DNA repair
                     [Evidence IMP] [PMID 15738391]; GO_process: GO:0006974 -
                     cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0051304 - chromosome separation [Evidence
                     IMP] [PMID 15793567]; GO_process: GO:0000724 -
                     double-strand break repair via homologous recombination
                     [Evidence IEA]; GO_process: GO:0000724 - double-strand
                     break repair via homologous recombination [Evidence IMP]
                     [PMID 16892052]; GO_process: GO:0071139 - resolution of
                     recombination intermediates [Evidence IMP] [PMID
                     20159973]"
                     /codon_start=1
                     /product="DNA repair protein SMC6"
                     /protein_id="XP_018733514.1"
                     /db_xref="GeneID:30035898"
                     /translation="MDTRQEPVKGDESLTVSPPPAKRFRSQRFNDDNDNSSSPSPVDS
                     ESLTSSFTSPEDANNDGAGPSNLSQDLDLDQYEGERDQTISPTIGIDGTPEPEQSVEI
                     QRGSREMEGIARSPQSQSAGKIISVQMINFMCHSNLTISLGRRINFIVGKNGSGKSAV
                     LTAIIIGLGGRASDTDRGSSISDVIKEGQQMASIRIKFDNVGKLSFRHEIYGDFFTLE
                     RAISRTERAGHSNYNVYTQSGKKMKISRTDILEMLSISHFSIDIDNQFAILTQDQART
                     FLVARTQEEMYHLLMRGLRVTQSYHNANVSNNNITATESDLKAKRTDIKELKEKVKNL
                     ELRRNNNLRIEEAMREVARYTAMGLWFRHDRQMEKISQLEERNDELKREQAEKQDEAD
                     AYSKRAQELVVDTDSQVSELRDQRDKSSAERLEAINRRRELSDKLDSLKQNQVNVNTE
                     KNKNEQHKVELESELNRLTTSEGGKEYLEAQIETVNLKINELKEEEMALVNEAENFES
                     KIKEASDLVKSLQGEVKKYESSILSEKSQLAKIQEGSQVSVDAAYGVNMANVLKEISM
                     NSSFHQKPIGPLGQFVSLKIPTWGPMLEHHLRHTLAAFWTKNTEDRNLLLKILAKYKM
                     TNTVIVKDVDMFDYSWSSPSKEYTTVLDALEFKDESVKRIFIDQYQIHRILLIEDRAE
                     ADRVMYSHPKNALVAFAKQKSIDGSQSRDGFQVGANRGGSSSSILRGAPVNKTPRMGV
                     DLRYRVKELEDSIRSTQSQCTRVRSKLDDATRALGESKESSRQTTRRLSSLRHEMRTL
                     DEKRDDLQTQLEDYDNGKVLEVQGEIENCKQRIETYILQFEKIHADMLETQEDVRLAD
                     TIIAEADKIHDELCNRIETIRVCIAVLIL"
     gene            <402676..>403341
                     /gene="SMC6"
                     /locus_tag="AWJ20_3834"
                     /db_xref="GeneID:30035899"
     mRNA            <402676..>403341
                     /gene="SMC6"
                     /locus_tag="AWJ20_3834"
                     /product="DNA repair protein SMC6"
                     /transcript_id="XM_018880867.1"
                     /db_xref="GeneID:30035899"
     CDS             402676..403341
                     /gene="SMC6"
                     /locus_tag="AWJ20_3834"
                     /note="Component of the SMC5-SMC6 complex; this complex
                     plays a key role in the removal of X-shaped DNA structures
                     that arise between sister chromatids during DNA
                     replication and repair; homologous to S. pombe rad18;
                     GO_component: GO:0030915 - Smc5-Smc6 complex [Evidence
                     IEA]; GO_component: GO:0030915 - Smc5-Smc6 complex
                     [Evidence IDA] [PMID 15738391]; GO_component: GO:0005694 -
                     chromosome [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 11927594]; GO_component: GO:0035861 -
                     site of double-strand break [Evidence IDA] [PMID
                     16892052]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA]; GO_function: GO:0019789 - SUMO ligase activity
                     [Evidence IDA] [PMID 15738391]; GO_function: GO:0003684 -
                     damaged DNA binding [Evidence IDA] [PMID 16793545];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0006310 - DNA recombination [Evidence
                     IEA]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA,IEA]; GO_process: GO:0006281 - DNA repair [Evidence
                     IDA] [PMID 11927594]; GO_process: GO:0006281 - DNA repair
                     [Evidence IMP] [PMID 15738391]; GO_process: GO:0006974 -
                     cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0051304 - chromosome separation [Evidence
                     IMP] [PMID 15793567]; GO_process: GO:0000724 -
                     double-strand break repair via homologous recombination
                     [Evidence IEA]; GO_process: GO:0000724 - double-strand
                     break repair via homologous recombination [Evidence IMP]
                     [PMID 16892052]; GO_process: GO:0071139 - resolution of
                     recombination intermediates [Evidence IMP] [PMID
                     20159973]"
                     /codon_start=1
                     /product="DNA repair protein SMC6"
                     /protein_id="XP_018733515.1"
                     /db_xref="GeneID:30035899"
                     /translation="MEKDMTIENLAQKILELRATMETLEKENGCDMVELVKQYTEANT
                     ALLNAKKEYDNLNRVYSVLIGSSKNRESKYEAIVTATLDSIKKGFKVNLGMRGFNGKL
                     IIDRTEENLIMDIDPVKSAVTRKVETLSGGEKSFAQIALLISIWRAMPSKLLALDEFD
                     VFMDNANRKQSLDMVIKSLGNRYNAQSIVITPQDMEIDDVQLKNNDITIQRMPDPVRS
                     APH"
     gene            complement(<403435..>405690)
                     /gene="USO1"
                     /locus_tag="AWJ20_3835"
                     /db_xref="GeneID:30035900"
     mRNA            complement(<403435..>405690)
                     /gene="USO1"
                     /locus_tag="AWJ20_3835"
                     /product="Uso1p"
                     /transcript_id="XM_018880868.1"
                     /db_xref="GeneID:30035900"
     CDS             complement(403435..405690)
                     /gene="USO1"
                     /locus_tag="AWJ20_3835"
                     /note="Essential protein involved in vesicle-mediated ER
                     to Golgi transport; binds membranes and functions during
                     vesicle docking to the Golgi; required for assembly of the
                     ER-to-Golgi SNARE complex; GO_component: GO:0012507 - ER
                     to Golgi transport vesicle membrane [Evidence IDA] [PMID
                     17192843]; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA,IEA]; GO_component: GO:0000139 - Golgi
                     membrane [Evidence IDA] [PMID 17192843]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0031410 - cytoplasmic vesicle [Evidence IEA];
                     GO_component: GO:0030659 - cytoplasmic vesicle membrane
                     [Evidence IEA]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0008565
                     - protein transporter activity [Evidence IEA]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IMP] [PMID 8603910]; GO_process: GO:0048211 -
                     Golgi vesicle docking [Evidence IDA] [PMID 9545229];
                     GO_process: GO:0048193 - Golgi vesicle transport [Evidence
                     IEA]; GO_process: GO:0035493 - SNARE complex assembly
                     [Evidence IMP] [PMID 8603910]; GO_process: GO:0006886 -
                     intracellular protein transport [Evidence IEA];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0048280 - vesicle fusion with Golgi
                     apparatus [Evidence IEA]"
                     /codon_start=1
                     /product="Uso1p"
                     /protein_id="XP_018733516.1"
                     /db_xref="GeneID:30035900"
                     /translation="MFRTELHKLLSSTIGRDQYVVKFKKLRENPVLKEFDVDDIFSYE
                     RDKTGLPQVYLDSAYVDLLKENSARIQKALDRDPTVEPNSRVSLDMYESLQSEHLDIC
                     RELEELKEKTTGLEHSTSEQIENLKETISKTTGLLQESEKNLKAAKSEKESLELAHTK
                     SIKDMEELEVKYNKLDENFKQISDSLQKANRAVEEHKQKEKQLISQLGNMTRDKEKAE
                     GGINKMNRELFSLTRAKEDADKENKTLQKQIQDLQKQILKSQESDSKLKSQLKEMTAS
                     RDKILRESKESLEAAKKFELQVKASSAELVQVKTQFQELSDSFTEVETLKETLISKLQ
                     SAAQQIEQLKSRKAELGTEIEKLNNEKANLSSELDKSKLLNSELKSKVDAIALDKDSR
                     GKEIESLSRRIVEFETAKSKLEDELKISENTTEALTKEKQESELLKTALREEINQLKI
                     ELDELRAENNTLKLEAANLVENGNPKQAEELEKKYKDQVSEMEFKLKNLSDELSAAKQ
                     KDSEDKDTQLSTLEDEISSLEKEKSILEKVNSAKLASLEKAHSTEKDSLEQQHVKEKD
                     NLHKDFSDQKSILEKEFVKQKEEILSSHENEKETLEKAHRKAIEENKKILFASHTDAM
                     EKLRNELQKSQSAEAEKLKDLYEKSQQENIALSRKFEEQVAKLESENKNLTQKLQLGE
                     KSKDKPTVDMVPKSDLDDLMLLLNDLDEQKKKYKKQLLKLGADVTDSEDDSEDDDDEE
                     EGDDEGDEDGN"
     gene            complement(<405732..>407753)
                     /gene="USO1"
                     /locus_tag="AWJ20_3836"
                     /db_xref="GeneID:30035901"
     mRNA            complement(<405732..>407753)
                     /gene="USO1"
                     /locus_tag="AWJ20_3836"
                     /product="Uso1p"
                     /transcript_id="XM_018880869.1"
                     /db_xref="GeneID:30035901"
     CDS             complement(405732..407753)
                     /gene="USO1"
                     /locus_tag="AWJ20_3836"
                     /note="Essential protein involved in vesicle-mediated ER
                     to Golgi transport; binds membranes and functions during
                     vesicle docking to the Golgi; required for assembly of the
                     ER-to-Golgi SNARE complex; GO_component: GO:0012507 - ER
                     to Golgi transport vesicle membrane [Evidence IDA] [PMID
                     17192843]; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA,IEA]; GO_component: GO:0000139 - Golgi
                     membrane [Evidence IDA] [PMID 17192843]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0031410 - cytoplasmic vesicle [Evidence IEA];
                     GO_component: GO:0030659 - cytoplasmic vesicle membrane
                     [Evidence IEA]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0008565
                     - protein transporter activity [Evidence IEA]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IMP] [PMID 8603910]; GO_process: GO:0048211 -
                     Golgi vesicle docking [Evidence IDA] [PMID 9545229];
                     GO_process: GO:0048193 - Golgi vesicle transport [Evidence
                     IEA]; GO_process: GO:0035493 - SNARE complex assembly
                     [Evidence IMP] [PMID 8603910]; GO_process: GO:0006886 -
                     intracellular protein transport [Evidence IEA];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0048280 - vesicle fusion with Golgi
                     apparatus [Evidence IEA]"
                     /codon_start=1
                     /product="Uso1p"
                     /protein_id="XP_018733517.1"
                     /db_xref="GeneID:30035901"
                     /translation="MLSGFLSQTQPKPQTASVTITKLCDRLQHSTLLEDRRAAVLGLK
                     GFSREYRETVAAGGLRGLISALHRDSEDAETCRATLETLLILFMPDELSEDQATTTNG
                     NSTGSGRQARRPLEQNSRFTRSRGKKYSSPLLKPNHNPDNISLWLTDEFTQKQDNIIT
                     LLELVEKTDDFFTKLYALQLLSAIISNRPLRSQECILAAPLGISSLVACLDDYRDVIR
                     NEAILLLLYLVSEHFDMQKLVAFEGTFDKLFSIIDIEGGLNGGVVVEEAISLLSALLR
                     YNVSNQHHFRETNCVPKLVSLLENKDTLDQLSSDDSGSLSNAIIGTLELCRLFVIEDH
                     WSTPVNQQALCKEGLLFTVLRLAFGVSTPMPVRCSAFLTAAALVRGNSPLQEEFLAID
                     VPYFDLSIAFNVEKEPLIIPVSLALLNWVLLSTSVHTFDLRVAAQLCLSSALQGNIQA
                     KLSFLKDQMASYPGNMSEVADELEIKDKVESRSTSTSPNLEQIETNAPKIVGDAKPQP
                     DYPEGSANLFSALVDYDPDARLNPYKPWFAAVILINLFEDADISNPSHYNTESHEVRD
                     FVRGLMIGDASIGEEVVSCIQAMSGMLVTSLRYPDPRISLGYLMLLSIWLYDDTKAVS
                     DFLGESGTIQALISSATHSSNNDPLVEALSTVLLGIVYDFSSAESPIPR"
     gene            <412571..>414010
                     /locus_tag="AWJ20_3837"
                     /db_xref="GeneID:30035902"
     mRNA            <412571..>414010
                     /locus_tag="AWJ20_3837"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880870.1"
                     /db_xref="GeneID:30035902"
     CDS             412571..414010
                     /locus_tag="AWJ20_3837"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733518.1"
                     /db_xref="GeneID:30035902"
                     /translation="MTEGSPGLLQDQKYDTSRNIIILDTSHYAQSAMLSSDPPVTDHE
                     NGHALPTNGSTIYTSESYQSRPQQPAPDNPPERPPQGELIIRDRINPFATVPGTLLPP
                     ECTVKHQDLELIHHYSFHTDNIIMMQSAREKPIWERVVPKVSFAFPYLSDALLAISAL
                     HLQHCSDGSRDLRNYALQKYYNAMSSSQVLDITNSFEPKFLTSCFLMMLAFSFDDVID
                     LISFNGKPDVFALSRGPYILAERLFPFLSKGPLRGLLRQVPGEDNAFAKAMELRLPAY
                     ENLYSVLSMLSRPSVSRSSQSSSDSSHRYSIPEDAIPMANFDFVEVKSEVETSSSNSS
                     VTTSEGNFPTSVVDTYASHMHEHSILKNELDRLICIVKASIYFNAEPLIITWITSVSN
                     DFANLARRNNSFAKVIIAYYMAALHTCQGVFWIGGRPAREVIKIANSLPSEWTDLMSK
                     PLQIVQRQYVSLTDLLELSGWVSDTPGHL"
     gene            complement(<414180..>420110)
                     /gene="UTP20"
                     /locus_tag="AWJ20_3838"
                     /db_xref="GeneID:30035903"
     mRNA            complement(<414180..>420110)
                     /gene="UTP20"
                     /locus_tag="AWJ20_3838"
                     /product="Utp20p"
                     /transcript_id="XM_018880871.1"
                     /db_xref="GeneID:30035903"
     CDS             complement(414180..420110)
                     /gene="UTP20"
                     /locus_tag="AWJ20_3838"
                     /inference="similar to AA sequence:KEGG_Orthology:K14772"
                     /note="Component of the small-subunit (SSU) processome;
                     SSU processome is involved in the biogenesis of the 18S
                     rRNA; GO_component: GO:0030686 - 90S preribosome [Evidence
                     IDA] [PMID 12150911]; GO_component: GO:0030686 - 90S
                     preribosome [Evidence IDA] [PMID 17652137]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     17652137]; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 15590835]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 17652137]; GO_component:
                     GO:0005654 - nucleoplasm [Evidence IDA] [PMID 17652137];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0030688 - preribosome, small subunit
                     precursor [Evidence IDA] [PMID 17652137]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0032040 - small-subunit processome
                     [Evidence IDA] [PMID 15590835]; GO_function: GO:0003729 -
                     mRNA binding [Evidence IDA] [PMID 23222640]; GO_process:
                     GO:0000480 - endonucleolytic cleavage in 5'-ETS of
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 15590835]; GO_process:
                     GO:0000480 - endonucleolytic cleavage in 5'-ETS of
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 17652137]; GO_process:
                     GO:0000447 - endonucleolytic cleavage in ITS1 to separate
                     SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic
                     rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 15590835]; GO_process: GO:0000447 -
                     endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
                     5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     17652137]; GO_process: GO:0000472 - endonucleolytic
                     cleavage to generate mature 5'-end of SSU-rRNA from
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15590835]; GO_process: GO:0000472 - endonucleolytic
                     cleavage to generate mature 5'-end of SSU-rRNA from
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     17652137]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Utp20p"
                     /protein_id="XP_018733519.1"
                     /db_xref="GeneID:30035903"
                     /translation="MIINIVESLRSPSHDVRYLAIQVIIFIYQAMRLEVPKLITDCKL
                     IDEIPLDVSNARNFGLYIRNLSNSYAGTGADTLLDLIIPRFFFGLLTAKFQPIWEASV
                     EAISKISEKNGEIIWSLAYEWIVYEPKISPVFGMFDDIILDEPEQSATVECSNLSQVI
                     NHSVSSFYKYSNSQNFSKLSIRDSLDKIDFPPTVRGQIIKVLASIPRVAEKHSRLLVP
                     FLLWDINSDDGEDSEETETPLSSTWSVKDRIALLDLFSLFGNPKTLYKSEEVYERYLY
                     LLGNRSLAVQKIALKCLLTFKNPQIRKYRDNLEGMLDDTQFKDELTNLVRYSGEEGTI
                     HEDDRAALLPIVIRIIFGRAQIAKTGGVKQGRRFAVVNSLSNVEPEYLRLFIDLSANR
                     LEHEGFLKGSYDGVLTINPEFSHFQSSDLRLRRELGFVTMLEEILEQLGDRVHVAWDI
                     IIESLILCLYRANQAHTDLNEQDEDEPTDSVIGKNIRSIRQLGFKCLNALFSILPGSN
                     WAGCFDIIYSNFISNRMAKFAEENLQQPSSLMRIFVTLSSEKSLVRFLTWDNCAIIKS
                     FFACLSYDEVKDSVVDVIMDTMNNILELERSEDTETLSVTGVPIVLNRMPYLFERQSN
                     HQLLEKEAQLLVKLMTSGYEASDDIRKQLIEVSLAALEKNTTLVRVSVKVSVLQTLSV
                     LLMDGRSTLEECTSAYYTLSKLFRQFTNRQARENLAAVFDVFGDQFDVFKTVSKLVVD
                     LNSYSAKRLDLPDFDRRLSAFAVINETKFDKLTAMEWLPLLYNMLFFMKDPEELALRT
                     NATYSVKRFIDGLASRTNEEDVSSYVQLLDDVVIPVVKTSLRDSNDIFRTQFIDVLGH
                     IVKAAKWYSKMNDMKCLLFDGDEEANFFNNINHLQIHRRRRAVRRLSKLASKGSLTDT
                     NIAHYILPIIEHFVGGTEGDAHNLSEDSIKCIGVLARHLTWNQYRAITKRYIAYLNSR
                     PESIKATVKLVETASDALISPVDETDMDLSLLEEDEDEDTTMAGSEDISPAVVNSVEG
                     AVKLADCLPSVERLSAFITEDIVPTMQKVLNKKNDDDTLTLRIPLALPIVKFIKALPE
                     ALIELKLPGVLTGLCQILRAKSQELRDMIRSTLGRIARILGTKYLVFIIKELKGALRR
                     GAQLHILGYSLHSLLSELKDIILPRDLDVSATLIMDIIMEDTFGVTGGEKDEEGYTSD
                     MKEVKQYKSYDSGQILASNVGLGTFSELVEPVKTLLLYEKLNLKMEKKVEELLRRFAL
                     GLYHNIDASKQEVLVMCFELYEMVNNVSTEIEKKKKIDSESHIRDEQKREAEEHFMIQ
                     LDSRHWGEQNTIRIGNLHIITKFVIEMIRTVLGKNEHMMTAENVAGFMPMLDEGLNGN
                     YEDVQIASLRLLAHIIKLPIPDVSGRVVSLGRRTLWLIKSSTSTNTELCQACLRFISV
                     CIRQKKDFSLKEKELAYCLNRLKPDIEEPDRQGITLTFIRAVLSRQIMMPEVYDIMDQ
                     VAQVMVTNQSNVTREACRSAYFQFLTEYPQGKGRLTKQLKFLVANLEYPAVSGRLSVM
                     EIIHLLLAKVTDDQVQEVIASFFVALVLVLINDEESQCRETAAALIGELLDISKDEQL
                     SLIEKYCTTWLTNRENELLLRGGFQVTGIYCAKFGVRKNPKLFKLAISVLEKLLEDAK
                     SDSNVVVQWETLYQGLQFVAKTVQNSNGLKILFSSNYQQLWDLIESSLLFPHAWVRLA
                     SSRLIGKLYSVYSGGKNCEITISTDGLQSTAFKFVRQLGAASISEDLGIQIVKNLVFI
                     SMQWEKSEETIYFVKPRSSNEDEDEDDDTATEERIPVIRWLIQKISSVLRAEKNFKEM
                     IVSKKASIQLLASIIQLLSVEKLSEMAEDIIMAFYIYSISEEDRTRDLKELCLEALNM
                     VQKKLGTTKYVQAYSNVQQQVSERRLERKSKRAIQSVSAPDVYARKKLRKNLAKREKR
                     KHSKDENGYYHSKKSKNA"
     gene            complement(<420190..>421350)
                     /locus_tag="AWJ20_3839"
                     /db_xref="GeneID:30035904"
     mRNA            complement(<420190..>421350)
                     /locus_tag="AWJ20_3839"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880872.1"
                     /db_xref="GeneID:30035904"
     CDS             complement(420190..421350)
                     /locus_tag="AWJ20_3839"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733520.1"
                     /db_xref="GeneID:30035904"
                     /translation="MSFLLRKSTGSSLDLIIDHILDDVISHPKADFVTSVANLFSDSI
                     KSSGNNLHSRTSEILSALLRSCKKHVNQSLVVVDVSSAVLVALLHHVRQETAHILYTE
                     SMTFVDSMLGEKELSDNQIILAQTVIRDLSGLRKGSRVSDWTPLFGKFLSILGRITEA
                     SSQQVLISTLTASVSLLQSANFESTTKYCSPLVQELYRLLGQEYFLSFCESMVEYNPT
                     VFSNHLIVYVQRFIKEYRSDVSSVHLLLTKLESAGLVNRTSQPVPGKLFTAPDSAFSK
                     SLEQKVQFPKLDSVNGLYDLFIALDIFAIAVIPTDKLSKSLPKLLERIILEVNESNIA
                     WKKALVGKTLSLVNEPSVAAEMIDTIKESFSELSDSKIFLEGFLNLWRANKG"
     gene            complement(<422530..>424269)
                     /gene="URA7"
                     /locus_tag="AWJ20_3840"
                     /db_xref="GeneID:30035906"
     mRNA            complement(<422530..>424269)
                     /gene="URA7"
                     /locus_tag="AWJ20_3840"
                     /product="CTP synthase URA7"
                     /transcript_id="XM_018880874.1"
                     /db_xref="GeneID:30035906"
     CDS             complement(422530..424269)
                     /gene="URA7"
                     /locus_tag="AWJ20_3840"
                     /inference="similar to AA sequence:KEGG_Orthology:K01937"
                     /note="Major CTP synthase isozyme (see also URA8);
                     catalyzes the ATP-dependent transfer of the amide nitrogen
                     from glutamine to UTP, forming CTP, the final step in de
                     novo biosynthesis of pyrimidines; involved in phospholipid
                     biosynthesis; capable of forming cytoplasmic filaments
                     termed cytoophidium, especially during conditions of
                     glucose depletion; URA7 has a paralog, URA8, that arose
                     from the whole genome duplication; GO_component:
                     GO:0097268 - cytoophidium [Evidence IDA] [PMID 20713603];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA]; GO_function: GO:0003883 - CTP synthase activity
                     [Evidence IEA,IEA]; GO_function: GO:0003883 - CTP synthase
                     activity [Evidence IMP,ISS] [PMID 1753946]; GO_function:
                     GO:0003883 - CTP synthase activity [Evidence IDA] [PMID
                     8075080]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0044210 - 'de novo'
                     CTP biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006241 - CTP biosynthetic process [Evidence IDA] [PMID
                     8075080]; GO_process: GO:0006541 - glutamine metabolic
                     process [Evidence IEA]; GO_process: GO:0008654 -
                     phospholipid biosynthetic process [Evidence IMP] [PMID
                     9668079]; GO_process: GO:0019856 - pyrimidine nucleobase
                     biosynthetic process [Evidence IMP] [PMID 1753946];
                     GO_process: GO:0006221 - pyrimidine nucleotide
                     biosynthetic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="CTP synthase URA7"
                     /protein_id="XP_018733521.1"
                     /db_xref="GeneID:30035906"
                     /translation="MKYVVVSGGVISGIGKGVIASSTGLLFKTMGLKATSIKIDPYMN
                     IDAGTMSPLEHGEVFVLNDGGEVDLDLGNYERYLNVTLTRDHNITTGKVYKQVIEKER
                     RGDYLGKTVQIVPHLTNAIQDWIEKVAHIPVDGDNEVPDVCIIELGGTVGDIESAPFV
                     EALRQFQFRVGPENFALIHVSLVPVIHGEKKTKPTQAAIKDLRSLGLTPDIIACRCSE
                     ELDQAAIDKISMFCHVGPNQVLGVHDVNSTYHVPLLLHDQKLMEFFSKRFKLDELKLS
                     SERIAKGQDLWTRWNSITQSHDRSFQKVTIALVGKYTNLQDSYISVVKALEHSALRCE
                     LKLEIVWVEASDLEIESSVTNKINYHKAWGSLCSADGILVPGGFGTRGTEGMIAAARW
                     ARENLVPYLGICLGFQVGVIDYARHVLNMKTNSIELDETIEDPVIVYMPEVDKINMGG
                     TMRLGIRPAVFQESTENSVLRRLYGSAPTVMERHRHRYEVNPEHIDELEKSGLHFVAK
                     DEKAERMEVFELKNHPYFVGTQYHPEYLSRVLDPSKPLLGLVAAAGGKLESILAATVD
                     HHSDQAKGPVTDF"
     gene            <423019..>423783
                     /locus_tag="AWJ20_3841"
                     /db_xref="GeneID:30035907"
     mRNA            <423019..>423783
                     /locus_tag="AWJ20_3841"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880875.1"
                     /db_xref="GeneID:30035907"
     CDS             423019..423783
                     /locus_tag="AWJ20_3841"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733522.1"
                     /db_xref="GeneID:30035907"
                     /translation="MTSIINDTNLETKTNTEVRNQIFTGPASSSNHTLSTSGTKSTRN
                     KNTISRAETAPGLVVVDLVSNGAFDLKIGSFDPNNLELKLASQSRVLKSLDNRNITVL
                     KIGIFTDQGNSDLLETTVMGLGNTIPTSPQILTLSNTLRRQFKFIELKTLGKEFHQLL
                     VVQKKRNMVSRIDIMDTQNLVRTDVTEHRDLVNSSLVKLFRTSTGNNIGCQTKGSQIL
                     DSSLSRFGLLLTMYNRNKRNVNQSKVLRTDSELKLT"
     gene            <425685..>426581
                     /gene="YPR1"
                     /locus_tag="AWJ20_3842"
                     /db_xref="GeneID:30035908"
     mRNA            <425685..>426581
                     /gene="YPR1"
                     /locus_tag="AWJ20_3842"
                     /product="trifunctional aldehyde reductase/carbonyl
                     reductase (NADPH)/glucose 1-dehydrogenase (NADP(+)) YPR1"
                     /transcript_id="XM_018880876.1"
                     /db_xref="GeneID:30035908"
     CDS             425685..426581
                     /gene="YPR1"
                     /locus_tag="AWJ20_3842"
                     /inference="similar to AA sequence:KEGG_Orthology:K18097"
                     /note="NADPH-dependent aldo-keto reductase; reduces
                     multiple substrates including 2-methylbutyraldehyde and
                     D,L-glyceraldehyde, expression is induced by osmotic and
                     oxidative stress; functionally redundant with other
                     aldo-keto reductases; protein abundance increases in
                     response to DNA replication stress; YPR1 has a paralog,
                     GCY1, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0004032 -
                     alditol:NADP+ 1-oxidoreductase activity [Evidence IDA,ISS]
                     [PMID 11306085]; GO_function: GO:0004090 - carbonyl
                     reductase (NADPH) activity [Evidence IDA] [PMID 19016485];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_process: GO:0042843 - D-xylose
                     catabolic process [Evidence IDA] [PMID 12271459];
                     GO_process: GO:0019568 - arabinose catabolic process
                     [Evidence IDA,IMP] [PMID 12271459]; GO_process: GO:0034599
                     - cellular response to oxidative stress [Evidence IGI]
                     [PMID 17919749]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="trifunctional aldehyde reductase/carbonyl
                     reductase (NADPH)/glucose 1-dehydrogenase (NADP(+)) YPR1"
                     /protein_id="XP_018733523.1"
                     /db_xref="GeneID:30035908"
                     /translation="MSAATLNTSTATLNDGNKIPYVGFGTWQVNDETDGYDALIYALK
                     HGYRHIDTAFAYKNEAVVGKAVRDSGIPREEIFVVSKLWGKDHRDPAAALDKSLKLLG
                     LDYVDLYLMHWPVPFKNIEDKDEIDEDWNHVKTWELMQKLPKSKVKSIGVSNYDTALL
                     EELSKAPTTTVVPVINQVELHPYLAQDKLRDYCNEHKIVLEAYCPLGKGTKLLEEPIV
                     VELAEKYKVSPGQIALSWGIARGYVVIPKSSTPSRIEANLHTVKLSKEDEEKLTSLSK
                     TNPQRRVRPGWKTKILFNDDDF"
     gene            <427253..>428629
                     /gene="RMD1"
                     /locus_tag="AWJ20_3843"
                     /db_xref="GeneID:30035909"
     mRNA            <427253..>428629
                     /gene="RMD1"
                     /locus_tag="AWJ20_3843"
                     /product="Rmd1p"
                     /transcript_id="XM_018880877.1"
                     /db_xref="GeneID:30035909"
     CDS             427253..428629
                     /gene="RMD1"
                     /locus_tag="AWJ20_3843"
                     /note="Cytoplasmic protein required for sporulation;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0007126 - meiotic nuclear
                     division [Evidence IEA]; GO_process: GO:0030435 -
                     sporulation resulting in formation of a cellular spore
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Rmd1p"
                     /protein_id="XP_018733524.1"
                     /db_xref="GeneID:30035909"
                     /translation="MSEQTPLLAPQTSAGSAMSRNQMPLGVAQGTTELMSQDIANQHH
                     LQQKGQSQEHQGSSGSTVTRTGPSSTNNQFHRHNNPNINTTPIRPDYPPVINGTGAGV
                     RRNGPQRTSYTTQKLKLLPDEPVSTDDDDISISEGDVYSQVARIKDRPARKDAERLGK
                     AHRSMLPRVTAYCTAGSYRINDLSRYFLGRKSHGTAPKLFDECLYTPYRYRRDNGSSS
                     TNTSPTLSTAPDPTSDETIVSSEADSQPSDFIRLDDEGGEIDVSYGRSELFLFDYGVT
                     VFWGFTEAEEKRFLKELARFETEKLADEDVQIEEFNYYITKSYQPRIYNDFITLRDNT
                     NYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDFPQEIALTGKINMNRKNIMKSIGE
                     LFILRISKLKTVNEATKAIKYTNNQQILICTDQFWTRLNLCGQSHILSPFIKLPVDIL
                     KSTREFRS"
     gene            <434804..>436258
                     /locus_tag="AWJ20_3844"
                     /db_xref="GeneID:30035910"
     mRNA            <434804..>436258
                     /locus_tag="AWJ20_3844"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880878.1"
                     /db_xref="GeneID:30035910"
     CDS             434804..436258
                     /locus_tag="AWJ20_3844"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733525.1"
                     /db_xref="GeneID:30035910"
                     /translation="MKLTVGLVATLWVQLQLTQGLQPVIRDYSNPSTPASQFRLAYNG
                     AEGVTVSWNSPSQINSPQVWYGEDPNNLVASSPGTSTTFSTATSWDNHVTIGNLKPNT
                     KYYYRVTGLADNFDVVGQNFYFTTARTTGDRTPYSIGFIADLGIVIGNLFGKQIPDTF
                     DSILSARDSLDFLWHSGDFGYADDWLWEELTGAYPLNLDGGVATYNNIMNSYYDQFVN
                     VTKNTPYMVGPGNHEADCIEPDLDYITNKFDLTICPSGQRNFTYHRNHFAMPTAEQAQ
                     DYFQNLWYSWNHGMTHFVQINTETDLAAGTTAPDEPGGDGGLDAGPFGFPNQQLQWLE
                     ADLAAVDRTKTPWLVVAGHRPWYSASTVCTECQEAFENLVIKYKVDLVMAGHVHYYER
                     DAPVANGVVDPNGLNNPSAPWYITNGAAGNFEGHSSNSGKNPSYTSIINNSDYGWSKL
                     TFHNSTHLTHDFISSETDQVLDTATLYKDHGLGW"
     gene            complement(<437248..>439506)
                     /gene="CDC4"
                     /locus_tag="AWJ20_3845"
                     /db_xref="GeneID:30035911"
     mRNA            complement(<437248..>439506)
                     /gene="CDC4"
                     /locus_tag="AWJ20_3845"
                     /product="SCF ubiquitin ligase complex subunit CDC4"
                     /transcript_id="XM_018880879.1"
                     /db_xref="GeneID:30035911"
     CDS             complement(437248..439506)
                     /gene="CDC4"
                     /locus_tag="AWJ20_3845"
                     /inference="similar to AA sequence:KEGG_Orthology:K03361"
                     /note="F-box protein required for both the G1/S and G2/M
                     phase transitions; modular substrate specificity factor
                     which associates with core SCF (Cdc53p, Skp1p and
                     Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as
                     a ubiquitin-protein ligase directing ubiquitination of
                     cyclin-dependent kinase (CDK) phosphorylated substrates,
                     such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p;
                     GO_component: GO:0019005 - SCF ubiquitin ligase complex
                     [Evidence IDA,IPI] [PMID 9346238]; GO_component:
                     GO:0019005 - SCF ubiquitin ligase complex [Evidence
                     IDA,IPI] [PMID 9346239]; GO_component: GO:0043224 -
                     nuclear SCF ubiquitin ligase complex [Evidence IDA] [PMID
                     11080155]; GO_component: GO:0016363 - nuclear matrix
                     [Evidence IDA] [PMID 2244914]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 11080155]; GO_function:
                     GO:0050815 - phosphoserine binding [Evidence IDA] [PMID
                     23314252]; GO_function: GO:0043130 - ubiquitin binding
                     [Evidence IDA] [PMID 21070969]; GO_function: GO:0061630 -
                     ubiquitin protein ligase activity [Evidence IDA] [PMID
                     9346238]; GO_function: GO:0004842 - ubiquitin-protein
                     transferase activity [Evidence IDA] [PMID 9346239];
                     GO_process: GO:0000082 - G1/S transition of mitotic cell
                     cycle [Evidence IMP] [PMID 10409741]; GO_process:
                     GO:0000086 - G2/M transition of mitotic cell cycle
                     [Evidence IGI,IMP] [PMID 10409741]; GO_process: GO:0000086
                     - G2/M transition of mitotic cell cycle [Evidence IGI]
                     [PMID 7954792]; GO_process: GO:0031146 - SCF-dependent
                     proteasomal ubiquitin-dependent protein catabolic process
                     [Evidence IDA] [PMID 9346238]; GO_process: GO:0031146 -
                     SCF-dependent proteasomal ubiquitin-dependent protein
                     catabolic process [Evidence IDA] [PMID 9346239];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0007126 - meiotic nuclear division
                     [Evidence IMP] [PMID 328339]; GO_process: GO:0007067 -
                     mitotic nuclear division [Evidence IEA]; GO_process:
                     GO:0016567 - protein ubiquitination [Evidence IEA];
                     GO_process: GO:0042787 - protein ubiquitination involved
                     in ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 9346238]; GO_process: GO:0042787 - protein
                     ubiquitination involved in ubiquitin-dependent protein
                     catabolic process [Evidence IDA] [PMID 9346239];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="SCF ubiquitin ligase complex subunit CDC4"
                     /protein_id="XP_018733526.1"
                     /db_xref="GeneID:30035911"
                     /translation="MSEQDPLSLGHISRPAVAEQSFAAVMSGSNGSAGSGSVNEPSGH
                     SSIASSSSSAIIDHFNEEFKSPLTPAPSPTAHHHYSYSNSSSPNTSSHSPNSRNFHQL
                     QQEWNLDESQHYNYHLHQLRSRRTGGGRLDSVVGQDFPSAHDDYQKESSTSKALSLVE
                     SVRSQFGSLDDEGRSLFLGELLAMCGRAVLSETLDYISPMLKRDPMVVLPSELALKVL
                     SYVDDPLSLARASQVSKTWYLMISDDLTWKELCKTHHFRRLSAAVNVAMSGDNLRGRV
                     PSVVGVNSGIHPGTVVPGSSPTGSVSGQSDLTEAFYNPNATKRPVPTSYRSHFKQQYL
                     LNSAWASGGRLAAKYVISIPGVVTSLLMEGQYIVIALDNSKIFVFREDGRLLRALFGH
                     VMGVWALALRGHTLVSGGCDRDVRVWDLRSGGCSQILKGHSSTVRCLQMVDEDTAISG
                     SRDATIRIWDVKKGICKRVLEGHDASVRCVEVHGDICVSGSYDFTAKVWRISDGTLLH
                     TLVGHISQIYSLAFDGKRIATGSLDASIRIWDPETGLCLAFLQGHTSLVGQLQMKGNI
                     LVSGGSDGAIRVWDLENYTCLQRFTAHDNSVTTLQFDEERIVSGGSDGKVEVWELATG
                     KHIRSLSGPFDAVWRVAFKDEKIAILASRQNMIHMELMSFTPTVDRADSTATPPTIEF
                     RSTDGYGRRRGHSTKPSDDPGMSPTMVPVGRESPEHTMTDRPSGTVVTAPTAAATPGQ
                     PRQDDDAMDISA"
     gene            <442775..>443782
                     /locus_tag="AWJ20_3846"
                     /db_xref="GeneID:30035912"
     mRNA            <442775..>443782
                     /locus_tag="AWJ20_3846"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880880.1"
                     /db_xref="GeneID:30035912"
     CDS             442775..443782
                     /locus_tag="AWJ20_3846"
                     /inference="similar to AA sequence:KEGG_Orthology:K11205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733527.1"
                     /db_xref="GeneID:30035912"
                     /translation="MSLIFYTGNTLDQTLLNDQKLSGRIINSIQAWRSNRSYSDPLKG
                     SRNSTANGNSSGTAATIQTTAAVTSSTTTASTSTTTTDSSTTITSSTTNSTSTNTTAV
                     IVPPISFHKPTAGCPNADLTAKLFLPANATPNQAHIAINEMLDIIGPLIPAGSVDGDA
                     LIKIFIISLEGLSFSADSDEEQNGNSASSSVSPSVEKIADIWKQVVSAVQTRYPKLVE
                     KYGIAELSTEKLTKLLAHLEAESAVLPSVDHINAADCCALPPGLISIAKQRGIRLLAH
                     HDPEEMLSQDALNRVLEAYNPELSSSSYRWNWILRLTYIAHDRQVLAGNDYLVSVSPS
                     E"
     gene            <447425..>448225
                     /gene="BXI1"
                     /locus_tag="AWJ20_3847"
                     /db_xref="GeneID:30035913"
     mRNA            <447425..>448225
                     /gene="BXI1"
                     /locus_tag="AWJ20_3847"
                     /product="Bxi1p"
                     /transcript_id="XM_018880881.1"
                     /db_xref="GeneID:30035913"
     CDS             447425..448225
                     /gene="BXI1"
                     /locus_tag="AWJ20_3847"
                     /inference="similar to AA sequence:KEGG_Orthology:K06890"
                     /note="Protein involved in apoptosis; variously described
                     as containing a BCL-2 homology (BH3) domain or as a member
                     of the BAX inhibitor family; reported to promote apoptosis
                     under some conditions and to inhibit it in others;
                     localizes to ER and vacuole; may link the unfolded protein
                     response to apoptosis via regulation of calcium-mediated
                     signaling; translocates to mitochondria under
                     apoptosis-inducing conditions in a process involving Mir1p
                     and Cor1p; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 21673967];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA]; GO_component: GO:0000324 - fungal-type
                     vacuole [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID
                     21673659]; GO_component: GO:0000324 - fungal-type vacuole
                     [Evidence IDA] [PMID 21673967]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 21673659];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006915 - apoptotic process [Evidence
                     IEA]; GO_process: GO:0006915 - apoptotic process [Evidence
                     IMP] [PMID 21673659]; GO_process: GO:0006915 - apoptotic
                     process [Evidence IMP] [PMID 21673967]; GO_process:
                     GO:0019722 - calcium-mediated signaling [Evidence IMP]
                     [PMID 21673967]; GO_process: GO:0030968 - endoplasmic
                     reticulum unfolded protein response [Evidence IMP] [PMID
                     21673967]"
                     /codon_start=1
                     /product="Bxi1p"
                     /protein_id="XP_018733528.1"
                     /db_xref="GeneID:30035913"
                     /translation="MSTPSAPPPQYTAPGNGAQSSEPLLVPGEAPPRRQEDDNIPDDF
                     KYSTSVAECTLPIRHAFLRKVYTILFGQLVVTAAVGAVISQNSSVSHWVLTHIWTFYV
                     AIFGAMGLMIGAYVKQRSYPTNMLFLGGFTLLESYCVGIISSLYDTKIVIQAVVLTLV
                     IFGGLSLFALQTKYDFSGWQSYLGAALWGLIGFGLISIFMPYSSGVELAYSVVGALVF
                     AGYIVVDTQLIMRRYHPEDEVAAAIALYLDIINLFLNILRILNEMNRD"
     gene            complement(<448477..>450570)
                     /gene="PHO11"
                     /locus_tag="AWJ20_3848"
                     /db_xref="GeneID:30035914"
     mRNA            complement(<448477..>450570)
                     /gene="PHO11"
                     /locus_tag="AWJ20_3848"
                     /product="acid phosphatase PHO11"
                     /transcript_id="XM_018880882.1"
                     /db_xref="GeneID:30035914"
     CDS             complement(448477..450570)
                     /gene="PHO11"
                     /locus_tag="AWJ20_3848"
                     /inference="similar to AA sequence:KEGG_Orthology:K01078"
                     /codon_start=1
                     /product="acid phosphatase PHO11"
                     /protein_id="XP_018733529.1"
                     /db_xref="GeneID:30035914"
                     /translation="MTDHQSIENEEQSAFLARSSLDDGLDLDHELDHEFELDPSSTGS
                     PYDEESSIETGDNGIAKVGSRNNASSLDTTGSSGASITKGRKPKVNFDLDETYVQYDE
                     AYKGIKGRSKTTTNSKGNISRHFDYSSSVNPIPPSPTSHRRGNNRLSSRKSSKLTTKL
                     IIMLVLPALVLFILFFAVSSSASNPPRNASPVVAPTGLTYPSGFNMKQNWGSASPYFD
                     TGVSYTGIDSTKAFERSARCSLRQSHVLHRHAERYPTDGMTARLSATAEKLMKMPPPP
                     SKQFEWISKWNYTLGADLLTARGVGTEFKSGSDYWGSHGVALYNATSNGNNELFYSPK
                     LNVYENGTSRPVPVLRATTQSRIETSARAWAAGFFGVYGGQIYNVVENSHDGSKNNNG
                     DGTGWNSPVKPDSPVNYVSDAGIYKLVLQAENHGNNNTLASYYACPNDNSDNIGKEKK
                     YAWIDNYLAPAAVRLNKVFPDYGNMTAGEVYDLQNFCAFETAAYGSSRFCELFTESEW
                     RGFEYAGDLSFYYDSSFGSPVGASMGAGYLVELLARLQNKSVIAELNKGVNLTLDNDP
                     ATFPLGQPFYLDMTHDSIIISVLTAIGFDFINKELPTDKLLAPRQFVASRLVPFGARL
                     IFDILECDDSTSSDSPPDLNYYVRVSLNSRVLPLGSLHDCPQSEDGFCPLDKFASSLQ
                     RQISSIDFVKACYGK"
     gene            complement(<451234..>452847)
                     /locus_tag="AWJ20_3849"
                     /db_xref="GeneID:30035915"
     mRNA            complement(<451234..>452847)
                     /locus_tag="AWJ20_3849"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880883.1"
                     /db_xref="GeneID:30035915"
     CDS             complement(451234..452847)
                     /locus_tag="AWJ20_3849"
                     /inference="similar to AA sequence:KEGG_Orthology:K13076"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733530.1"
                     /db_xref="GeneID:30035915"
                     /translation="MKDDLLSREDVEVLIAEGNLVVIYHDRALKLNNWITKHPGGDKA
                     VLHMVGRDASDEIDVYHSDKTLKSLPAFQIGRVQLPWRNFLPPIQGGTFRTRAELDSD
                     EGVSLSDPDQRIPRWEKTDMKKSTRWTKQEQRTHEIIENFDRKLVESDREKYPPVDLD
                     TQTNIISKFRDLHKELREEGFFQCNYWGYVREASRISTLFILARVFFTWRYQSYGTIW
                     LTLSAICLGLAWHQLTFIAHDAGHLGITHDYQIDNIVGVIIADYIGGLSIGWWKRNHN
                     VHHFVTNDPVHDPDIQHLPFFAVSSKFFGNIKSTYYDRVLDYDIFAKTLLKVQNYMYY
                     PILCFGRFNLYRLSWEYLILGLGPRKGKGAWLRYFELVGMAFFFYWFFYRVVTCSLHS
                     ASERWLYVMVSHIVTMPLHVQITLSHFGMSTSDLGIDESFAQRQIRTTMDVDCPPWLD
                     YIHGGLQFQAIHHLFPRMPRHNLRAAQPKVIKFCDDLGLHYTIYGFTKGNKVVISKLA
                     DVAKQARILADCNAFCQKEMLSELGIHKT"
     gene            complement(<453209..>455224)
                     /locus_tag="AWJ20_3850"
                     /db_xref="GeneID:30035917"
     mRNA            complement(<453209..>455224)
                     /locus_tag="AWJ20_3850"
                     /product="Peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagineamidase A"
                     /transcript_id="XM_018880885.1"
                     /db_xref="GeneID:30035917"
     CDS             complement(453209..455224)
                     /locus_tag="AWJ20_3850"
                     /codon_start=1
                     /product="Peptide-N4-(N-acetyl-beta-
                     glucosaminyl)asparagineamidase A"
                     /protein_id="XP_018733531.1"
                     /db_xref="GeneID:30035917"
                     /translation="MSISAWFTGNTATGYIALSDDNDRNRINTRKRNLALAAAIAVGV
                     VIITVGMFHDYRWHDGIYRPLPGRGRHGGIHHGGSHHGGISNLWSKQLLLSFDDNSDI
                     GKPAHGSQKVEDVFQVYAPPEDIGELVLNKTLIDNYVFDNSYGKPFVVSYTAPDQEFT
                     HVRLTLNATTYGRQFDRLAQVYLGGSEIWRTSTAEPGHRNISFSYVKDVSKYASLFKT
                     SDIDFTFALNNIVDEVYTGPITVSLSAQYFNVPETRSTSVAELLKKDVTSPDQVIAIA
                     PPTGLSWSAPSQKISTKLPALPKDAARVVVDVFASGNADEEFWYSHLLDPYSDWFPNG
                     ANEFGKHGPTRLVEVHINGVLAGVAIPFPVIYTGGYSPPLWSKIVGTNTYDVPSYQID
                     ITPFLPYLWSESGSAISLRVVNGDKSESAKTLISEDWIVSANVLVWQVPGVQGSGVSD
                     IPKNKDSLTRIVSPRYDSRVSQIIAFSDSISTSARLEYIGTDGEKEDLTVGWQQKLAL
                     SNVQSVSNGGDKHEIVFSSSTANKLVVDDDFEAVNAQFKESHGLVLNLKYDSFEDSFK
                     ISYVRGVSTNDALGLTSAGQNGTSAFAFTGPRQVSGHGDLETNYTRQSYITDEKYHRH
                     VRAANGSVLFDHVDCSKPGLYSVDSVSPIESLIQLDGLDLSFFASNE"
     gene            <455956..>456753
                     /gene="URA3"
                     /locus_tag="AWJ20_3851"
                     /db_xref="GeneID:30035918"
     mRNA            <455956..>456753
                     /gene="URA3"
                     /locus_tag="AWJ20_3851"
                     /product="orotidine-5'-phosphate decarboxylase"
                     /transcript_id="XM_018880886.1"
                     /db_xref="GeneID:30035918"
     CDS             455956..456753
                     /gene="URA3"
                     /locus_tag="AWJ20_3851"
                     /inference="similar to AA sequence:KEGG_Orthology:K01591"
                     /note="Orotidine-5'-phosphate (OMP) decarboxylase;
                     catalyzes the sixth enzymatic step in the de novo
                     biosynthesis of pyrimidines, converting OMP into uridine
                     monophosphate (UMP); converts 5-FOA into 5-fluorouracil, a
                     toxic compound; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 18812321]; GO_function: GO:0016831 -
                     carboxy-lyase activity [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0016829 - lyase activity [Evidence IEA];
                     GO_function: GO:0004590 - orotidine-5'-phosphate
                     decarboxylase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004590 - orotidine-5'-phosphate decarboxylase activity
                     [Evidence IDA] [PMID 2061334]; GO_function: GO:0004590 -
                     orotidine-5'-phosphate decarboxylase activity [Evidence
                     IMP] [PMID 4550660]; GO_function: GO:0004590 -
                     orotidine-5'-phosphate decarboxylase activity [Evidence
                     IMP] [PMID 5651325]; GO_process: GO:0044205 - 'de novo'
                     UMP biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006207 - 'de novo'
                     pyrimidine nucleobase biosynthetic process [Evidence IMP]
                     [PMID 4550660]; GO_process: GO:0006207 - 'de novo'
                     pyrimidine nucleobase biosynthetic process [Evidence IMP]
                     [PMID 5651325]; GO_process: GO:0006222 - UMP biosynthetic
                     process [Evidence IDA] [PMID 2061334]; GO_process:
                     GO:0006222 - UMP biosynthetic process [Evidence IMP] [PMID
                     4550660]; GO_process: GO:0006222 - UMP biosynthetic
                     process [Evidence IMP] [PMID 5651325]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0006221 - pyrimidine nucleotide biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="XP_018733532.1"
                     /db_xref="GeneID:30035918"
                     /translation="MSNTTLSYEARAAKHPSAVASKLLKLMAEKKTNLCASLDVRTTK
                     EFLDLLEKVGPYIAVVKSHIDIIDDFTYEGTIVPLLALAKKHNFLIFEDRKFADIGST
                     VKAQYSGGVYKIAKWSDITNAHSVPGAGIVNGLEEAAKETTSEERGLLMLAELSTKGS
                     LATGEYTAKTVEIARQNSQFVFGFIAQSRMPEQGDEDWLILTPGVGLDDKGDGLGQQY
                     RTVDQVVSTGTDVIIVGRGLFGKGRDPVAESKRYRDAGWAAYEKRLA"
     gene            complement(<458453..>460072)
                     /gene="DBP3"
                     /locus_tag="AWJ20_3852"
                     /db_xref="GeneID:30035919"
     mRNA            complement(<458453..>460072)
                     /gene="DBP3"
                     /locus_tag="AWJ20_3852"
                     /product="RNA-dependent ATPase DBP3"
                     /transcript_id="XM_018880887.1"
                     /db_xref="GeneID:30035919"
     CDS             complement(458453..460072)
                     /gene="DBP3"
                     /locus_tag="AWJ20_3852"
                     /inference="similar to AA sequence:KEGG_Orthology:K14811"
                     /note="RNA-Dependent ATPase, member of DExD/H-box family;
                     involved in cleavage of site A3 within the ITS1 spacer
                     during rRNA processing; not essential for growth, but
                     deletion causes severe slow-growth phenotype;
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     9032262]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 22083961];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0004004 - ATP-dependent RNA helicase
                     activity [Evidence IDA] [PMID 23153376]; GO_function:
                     GO:0008026 - ATP-dependent helicase activity [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0008186 - RNA-dependent ATPase
                     activity [Evidence IDA] [PMID 18975973]; GO_function:
                     GO:0008186 - RNA-dependent ATPase activity [Evidence IDA]
                     [PMID 23153376]; GO_function: GO:0004386 - helicase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0003676
                     - nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0006200 - ATP catabolic process [Evidence
                     IEA]; GO_process: GO:0000464 - endonucleolytic cleavage in
                     ITS1 upstream of 5.8S rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 9032262]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="RNA-dependent ATPase DBP3"
                     /protein_id="XP_018733533.1"
                     /db_xref="GeneID:30035919"
                     /translation="MSTEKEIKSSKRSLEEAEKNESTKKLKVKSDKKDHKEEKNKKEK
                     KEKKDKKEKKEKKDKKDKKEKKEKKEKKDKEEKKESKSDDTVSSEQTAVPAAAAAAAA
                     PSSAEVTKFLADNSVKIEDDSNSNIQPCLSFDSLPVESKIISILKKFPKPSPIQAASW
                     PFLLAGRDVVGVAETGSGKTFAFSVPVVNHIIQEKKKGVRALVVSPTRELAMQIYDSL
                     VTLTNVTDISAVCVYGGVPKEEQRQGLKKASIVIATPGRLKDLIEEGSADLSKVEYLV
                     LDEADRMLEKGFEEDIKSIVSNTNSDGRQTIMFTATWPPEVRKLASTFMNNAVKVYIG
                     ERDELAANKRITQLVEVIDPFRKEQRLLQLLKEHQSGAKKDDKILVFALYKKEATRVE
                     RLLQNRGFALAAIHGDLGQAQRTKALEDFKTGRSKILLATDVAARGLDIPAVKVVINL
                     TFPLTAEDYVHRIGRTGRAGQTGLAITLFTEQEKHLSGALINVLRGANQPVPDELLKF
                     GSHTKKKEHSAYGAFFKDVDSTKKATKVKFD"
     gene            <461851..>463677
                     /gene="ERO1"
                     /locus_tag="AWJ20_3853"
                     /db_xref="GeneID:30035920"
     mRNA            <461851..>463677
                     /gene="ERO1"
                     /locus_tag="AWJ20_3853"
                     /product="Ero1p"
                     /transcript_id="XM_018880888.1"
                     /db_xref="GeneID:30035920"
     CDS             461851..463677
                     /gene="ERO1"
                     /locus_tag="AWJ20_3853"
                     /note="Thiol oxidase required for oxidative protein
                     folding in the ER; essential for maintaining proper redox
                     balance in ER; feedback regulation of Ero1p occurs via
                     reduction and oxidation of Ero1p regulatory bonds; reduced
                     Pdi1p activates Ero1p by direct reduction of Ero1p
                     regulatory bonds; depletion of thiol substrates and
                     accumulation of oxidized Pdi1p results in inactivation of
                     Ero1p by both Pdi1p-mediated oxidation and autonomous
                     oxidation of Ero1p regulatory bonds; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 9659914]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]; GO_function: GO:0016671 - oxidoreductase
                     activity, acting on a sulfur group of donors, disulfide as
                     acceptor [Evidence IEA]; GO_function: GO:0003756 - protein
                     disulfide isomerase activity [Evidence IEA]; GO_function:
                     GO:0003756 - protein disulfide isomerase activity
                     [Evidence IMP] [PMID 10982384]; GO_function: GO:0016972 -
                     thiol oxidase activity [Evidence IDA] [PMID 16407158];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IGI] [PMID
                     11584268]; GO_process: GO:0006457 - protein folding
                     [Evidence IMP] [PMID 9659913]"
                     /codon_start=1
                     /product="Ero1p"
                     /protein_id="XP_018733534.1"
                     /db_xref="GeneID:30035920"
                     /translation="MSKIFYLTLLATVLASSSPFPSPPLEASVASQTVYDFLPIASDS
                     PVKDTLGGATYQQVEDTNFRLRPVLKELTKTDYFKYYKVDLSPELCPFNDDELGMCGN
                     RACAVDVIDDESEVPEFWRSQYLGKLAKDSVTTDRLWSPDDDAVASKLCRANGVSVGH
                     EYYNVLPSPSPPSKDDYLDSELEDTNYCYPEDESLSGPGTYVSLPDNPERFTGYGGPH
                     ANKVWRAVYQENCFGYFGDSNQDSGTSNAVSSGDGFSAGQLQPSLPAAGSLLSSVLMD
                     SNRYERQEVGGESGRQALNAEKQCVEQRLFYRILSGLQSSVSSHLCYEYLNQTTGEWV
                     PNLDCFMSRVGNHQERLENLYFNYALVSRAVSKLRNYIDDLHFNNQDASADQATRRQL
                     LRLIKSSSPVTYSRAQANDTNTPTSASSSQQKLLLFNETAIFSSPEGRALKSEFRKRV
                     RNVSALMSCVGCDRCRLWGKLQTAGYGTALKLLFELPENPADDPELCSTVMSTFRRSE
                     LVALINTLDRLSKSIEAVTYFRNELQSQAVEAEKLAERSEFQQAWDSELEGAWTALKF
                     VFRSYVELPKNLWTLFIHYSAIYWNRFIGRDALTAQYYHLDL"
     gene            complement(<464898..>465311)
                     /gene="RRT12"
                     /locus_tag="AWJ20_3854"
                     /db_xref="GeneID:30035921"
     mRNA            complement(<464898..>465311)
                     /gene="RRT12"
                     /locus_tag="AWJ20_3854"
                     /product="Rrt12p"
                     /transcript_id="XM_018880889.1"
                     /db_xref="GeneID:30035921"
     CDS             complement(464898..465311)
                     /gene="RRT12"
                     /locus_tag="AWJ20_3854"
                     /note="Probable subtilisin-family protease; role in
                     formation of the dityrosine layer of spore walls;
                     localizes to the spore wall and also the nuclear envelope
                     and ER region in mature spores; GO_component: GO:0005619 -
                     ascospore wall [Evidence IDA] [PMID 19779569];
                     GO_component: GO:0005635 - nuclear envelope [Evidence IDA]
                     [PMID 19779569]; GO_component: GO:0031160 - spore wall
                     [Evidence IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0042802 -
                     identical protein binding [Evidence IEA]; GO_function:
                     GO:0008233 - peptidase activity [Evidence IEA];
                     GO_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IBA,IEA]; GO_function: GO:0008236 -
                     serine-type peptidase activity [Evidence IEA];
                     GO_function: GO:0008236 - serine-type peptidase activity
                     [Evidence ISS] [PMID 10592175]; GO_process: GO:0030476 -
                     ascospore wall assembly [Evidence IMP] [PMID 19779569];
                     GO_process: GO:0043086 - negative regulation of catalytic
                     activity [Evidence IEA]; GO_process: GO:0006508 -
                     proteolysis [Evidence IBA,IEA,IEA]; GO_process: GO:0030435
                     - sporulation resulting in formation of a cellular spore
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Rrt12p"
                     /protein_id="XP_018733535.1"
                     /db_xref="GeneID:30035921"
                     /translation="MSLGTPKNNILNRAVQQLVDMGVPVVVAAGNSDSNACRFSPSSA
                     QGAFVVGALDDRLDTAATFTNWGECVDAFASGVNVESISIFNNSPVKYSGTSVSSPIA
                     AGLIAYFMGMGDSGEVATQRVSKLISIILSRLGPN"
     gene            complement(<466442..>467893)
                     /gene="RRD1"
                     /locus_tag="AWJ20_3855"
                     /db_xref="GeneID:30035922"
     mRNA            complement(<466442..>467893)
                     /gene="RRD1"
                     /locus_tag="AWJ20_3855"
                     /product="peptidylprolyl isomerase RRD1"
                     /transcript_id="XM_018880890.1"
                     /db_xref="GeneID:30035922"
     CDS             complement(466442..467893)
                     /gene="RRD1"
                     /locus_tag="AWJ20_3855"
                     /inference="similar to AA sequence:KEGG_Orthology:K17605"
                     /note="Peptidyl-prolyl cis/trans-isomerase; activator of
                     the phosphotyrosyl phosphatase activity of PP2A; involved
                     in G1 phase progression, microtubule dynamics, bud
                     morphogenesis and DNA repair; required for rapid reduction
                     of Sgs1p levels in response to rapamycin; subunit of the
                     Tap42p-Sit4p-Rrd1p complex; protein increases in abundance
                     and relative distribution to the nucleus increases upon
                     DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 15150670]; GO_component:
                     GO:0000790 - nuclear chromatin [Evidence IDA] [PMID
                     21129186]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 15150670]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA]; GO_function: GO:0003755 -
                     peptidyl-prolyl cis-trans isomerase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003755 - peptidyl-prolyl
                     cis-trans isomerase activity [Evidence IDA] [PMID
                     16380387]; GO_function: GO:0019211 - phosphatase activator
                     activity [Evidence IEA]; GO_function: GO:0008601 - protein
                     phosphatase type 2A regulator activity [Evidence IMP]
                     [PMID 12952889]; GO_process: GO:0006281 - DNA repair
                     [Evidence IMP] [PMID 15150670]; GO_process: GO:0006281 -
                     DNA repair [Evidence IMP] [PMID 9705277]; GO_process:
                     GO:0000082 - G1/S transition of mitotic cell cycle
                     [Evidence IPI] [PMID 11134337]; GO_process: GO:0030472 -
                     mitotic spindle organization in nucleus [Evidence IMP]
                     [PMID 11262194]; GO_process: GO:0043085 - positive
                     regulation of catalytic activity [Evidence IEA];
                     GO_process: GO:0006457 - protein folding [Evidence IEA];
                     GO_process: GO:0000413 - protein peptidyl-prolyl
                     isomerization [Evidence IEA,IEA]; GO_process: GO:0043618 -
                     regulation of transcription from RNA polymerase II
                     promoter in response to stress [Evidence IMP,IPI] [PMID
                     21129186]; GO_process: GO:0006970 - response to osmotic
                     stress [Evidence IMP] [PMID 10660069]"
                     /codon_start=1
                     /product="peptidylprolyl isomerase RRD1"
                     /protein_id="XP_018733536.1"
                     /db_xref="GeneID:30035922"
                     /translation="MTENIYNGSIVSGTIGTPGSGGSGSSEASVSSTLPSGTGKSQPL
                     LAPEDPFGTGETYSVEFPIHPSSYSTPGKKIHDQSDLIYFQQSIAYNRIQNLITSISQ
                     AVIQKFPADINSSSIHPVFKSIIEILQTLSKWCDEIEPVIGPRRFGNIAFRQWHTVLE
                     NRSGQLLTEKLAEPLAFSTIGDEMSDKVSAENSPLTELIPYFQGSFGSKQRLDFGTGH
                     ELSFLAFIGGLILLGVIDQPSGEDILLVFETYFEVIRKLVLRYTLEPAGSHGVWGLDD
                     HFHLPYILGSAQLVDPQSNGIPKPSSIISKDVPTPRSVLDKASVSKYARTNLYFKAID
                     FVYQVKRGPFYEHSPILYDITGVPTWNKIYRGMIKMYNAEVLGKFPVVQHFIFGSALY
                     PWKHINGNGLKSHSGEEEKAAPRKDASAVPSMVSSVMPLSATVSGVRPRASNAPRTSI
                     NPITGSSIGEPSTGSPTGGGNIPGPTKASWAKK"
     gene            <468646..>473577
                     /gene="NUP192"
                     /locus_tag="AWJ20_3856"
                     /db_xref="GeneID:30035923"
     mRNA            <468646..>473577
                     /gene="NUP192"
                     /locus_tag="AWJ20_3856"
                     /product="Nup192p"
                     /transcript_id="XM_018880891.1"
                     /db_xref="GeneID:30035923"
     CDS             468646..473577
                     /gene="NUP192"
                     /locus_tag="AWJ20_3856"
                     /inference="similar to AA sequence:KEGG_Orthology:K14310"
                     /note="Essential subunit of the inner ring of the nuclear
                     pore complex (NPC); contributes to nucleocytoplasmic
                     transport; homologous to human NUP205; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0031965 - nuclear membrane [Evidence IEA];
                     GO_component: GO:0005643 - nuclear pore [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005643 - nuclear pore
                     [Evidence IDA] [PMID 10684247]; GO_component: GO:0044611 -
                     nuclear pore inner ring [Evidence IDA] [PMID 18046406];
                     GO_component: GO:0044615 - nuclear pore nuclear basket
                     [Evidence IDA] [PMID 10428845]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_function: GO:0017056 -
                     structural constituent of nuclear pore [Evidence IMP]
                     [PMID 10428845]; GO_process: GO:0051028 - mRNA transport
                     [Evidence IEA]; GO_process: GO:0006999 - nuclear pore
                     organization [Evidence IMP] [PMID 10428845]; GO_process:
                     GO:0006999 - nuclear pore organization [Evidence IMP]
                     [PMID 11121302]; GO_process: GO:0006913 -
                     nucleocytoplasmic transport [Evidence IC] [PMID 10684247];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Nup192p"
                     /protein_id="XP_018733537.1"
                     /db_xref="GeneID:30035923"
                     /translation="MLSEELNIDEVVAAEMVYNSSDDLNRLDMSPLQAGVALFHVRRQ
                     YILDLIRYFLVESGSDDRISDEFRKIVKSWSANGNDAALDSILEALKSVEEAYAELNE
                     KEKRGQFLGQMNNAEFVQLLKLRRDFLLREHDYLGQILCGLVQNRMVDAKGFAKLISK
                     VQTLSEYDTMFVHYIPSLLLYMSTFDPALTGTGYSVDFEEAYNGYKELSGDAQGWKLD
                     YWKGALSLAMLSGFSGCCRADTGDENGSGTGSNLIKYNISYELSILDPTKQAIDIGGI
                     EFLMILAANTSQTLSKKPHFYDYRPSVQNKVPSLKRLGDFSDEFLALLLQELERLVES
                     VVTNLADILKEMRLNEEDAFLSLTSVNNEFDHEEVDMPGADLERFFIFVSYLYSDRPD
                     ASINFWLDPESSLYGFTTWARQSHISFMAATLCDMLASLASGKECANAVYQLLKDDSD
                     SEENGEMGTKINAAAKGFSMGLAKLDNGNNNMLKRMNNTSSSYRLTWDVIFDALDYYA
                     KQLQPHSAAPSSSLSMGGLGAANGRQNALVLVTDMPELDDDIVLLLSAYFRLITVTIS
                     NDPEARLEFTTAVGGKYISTLFELLHSQTSLYGSILMTLAGFAKTDNEQIRYALWTAV
                     DNWLFNSTVYSPDGTVIAPSLPPRERLAQLFRSSSDIVGLITLLEALMSPLPQSARQG
                     FPFPQDLGSKYRYPGIWPYVDFIINEVFLSSASPTFTQDERLFIQLPCLLFIQYSLEL
                     LDPDVTRLSSTLGINPDIVVRSPSFLSYLYNHPSAPTMSHLFSSKIYSILISIASAGI
                     DEIGELGPDEPLVQAVVHSIRIMNDILDLQQIFLDVIVKEFKHGSSANGPAVDGVPTV
                     PPLQIVTHGLKAFEDVLLFNLPTVIHLALYIGSSNIELASRSLQLLQRLSLSSQFVST
                     VSTDARVKKNRLLSTLETADESNRIKEGFLEQLERPVDSYVEFNNSGSLPAIEIKLAL
                     LDFIICNLKTKSREPTTAHFLLGFKTTGDGKLDLDDGRCGIATGVSSFNSILSLLQYG
                     IENISGTDVEYGASKLSNACMEIILLLVQDPLSSQPILQLLRDTDFALSSLMAEPVVG
                     QDSLWNGQPYESTAAFSTIVSFFNHRSSLLEYVSLEIHESAELGSLSLVLRYVDSLVN
                     LDVTKKLSVNHQDSEHSAAMLSLLDVLEMPSRDQEPLQESSLEFFGSSVLNQIFSILG
                     NSIDPYANDLDTDNESAMSELNHLLKLKGLEFVANGKIQSLEDGVFKAAVEDIVSFMY
                     NSRTGGLIRDTQLKCLRSWSKLALVLVNDANVPSTKLITFILEIFQTLIPKLVDYSSS
                     DIAFAEVLASLLVSLQHIYQNEAKVGHGNSELNTAGYDRSHSLFRASLESIQTPLATP
                     ELRADLYIICYQYLKSTLDSPQAQQVIQVVRAAGDRLLETICGDALSGEGVTRLVALI
                     FLEVLFSLSSKTRSTFVQDGLVRYNLLLLLVKSIQRTDHEISNRDSLSPSELFFELKV
                     FNATLCFLLQVARTRSGASQLIQSGLFDILDGCQFLNIDLDVGIEISSPIDHRAGAVS
                     DLKISFYEILVPVFQILCAVLLSMGAENEPVITRVRRFLEGHQQLVVAIMKKDMLQSS
                     RPPSGDESSEVGLDDLVKLTVLLVSLTEFVPNL"
     gene            complement(<473749..>476502)
                     /gene="NSP1"
                     /locus_tag="AWJ20_3857"
                     /db_xref="GeneID:30035924"
     mRNA            complement(join(<473749..475815,476488..>476502))
                     /gene="NSP1"
                     /locus_tag="AWJ20_3857"
                     /product="FG-nucleoporin NSP1"
                     /transcript_id="XM_018880892.1"
                     /db_xref="GeneID:30035924"
     CDS             complement(join(473749..475815,476488..476502))
                     /gene="NSP1"
                     /locus_tag="AWJ20_3857"
                     /inference="similar to AA sequence:KEGG_Orthology:K14306"
                     /codon_start=1
                     /product="FG-nucleoporin NSP1"
                     /protein_id="XP_018733538.1"
                     /db_xref="GeneID:30035924"
                     /translation="MLRQTPFAFGSSTTPAGNPSGGNAFSFGNASNNTASGTTASTGT
                     GLFGTNTTGTGLFGSKPAATTTAPSGTGLFGATAGSTNSGTGSTGLFGGASTGTAAKP
                     LFGAATSTTPATSGTGLFGASTNNNASSTPASGTPSLFGSSTTGTSNASKPLFGSVAT
                     STTSSEASKPLFGAATATSQPAPSLFGGAASSTTTNTTSSGLTKPLFGTAASTGTSTE
                     PAKPLFGAATTTSATTEPAKPLFGAATTSTSSSQPAKPLFGAATTSTSSSQPAKPLFG
                     AAATGTSSEPAKPLFGAATTGTSSEPAKPLFGAAATGASTEPAKPLFGAAASTATTSA
                     EPAKPLFGAASTSTSTPLFGAKPATSEPAKPLFGAATTNTATSSKPAETAKPLFGAAT
                     TTSTSTTEPAKPLFGAPAATSSSTTNTTSSEPAKPLFGGATSTAKTTEPAKPLFGAAP
                     TTTSTTTATTSAPTTSGTKAASASSTTAPATKPEEIAPSLYLKNKSFEDIIAKWTSTL
                     AQNTADFQSQAISIAGWDRVLVENGERISEVFSEVVLAEQNQGKVDQMLQYISRQQDD
                     LETLLEGYEKQASHFLSDMAGPEGMQPVDQEREKAYRVAEDLNEKLESMDSNLASVIE
                     EINKVSSDLTRAKDDDALTQIVKILNSHLSSLRWIDSNTSLLQEKLDKIHTLESQTRD
                     HLNESQRFGAY"
     gene            <477310..>480333
                     /gene="GCV2"
                     /locus_tag="AWJ20_3858"
                     /db_xref="GeneID:30035925"
     mRNA            <477310..>480333
                     /gene="GCV2"
                     /locus_tag="AWJ20_3858"
                     /product="glycine decarboxylase subunit P"
                     /transcript_id="XM_018880893.1"
                     /db_xref="GeneID:30035925"
     CDS             477310..480333
                     /gene="GCV2"
                     /locus_tag="AWJ20_3858"
                     /inference="similar to AA sequence:KEGG_Orthology:K00281"
                     /note="P subunit of the mitochondrial glycine
                     decarboxylase complex; glycine decarboxylase is required
                     for the catabolism of glycine to 5,10-methylene-THF;
                     expression is regulated by levels of 5,10-methylene-THF in
                     the cytoplasm; GO_component: GO:0005960 - glycine cleavage
                     complex [Evidence ISS] [PMID 8830251]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0004375
                     - glycine dehydrogenase (decarboxylating) activity
                     [Evidence IEA,IEA]; GO_function: GO:0004375 - glycine
                     dehydrogenase (decarboxylating) activity [Evidence IDA]
                     [PMID 320197]; GO_function: GO:0004375 - glycine
                     dehydrogenase (decarboxylating) activity [Evidence IDA]
                     [PMID 8830251]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0030170 -
                     pyridoxal phosphate binding [Evidence IEA]; GO_process:
                     GO:0006546 - glycine catabolic process [Evidence IEA];
                     GO_process: GO:0019464 - glycine decarboxylation via
                     glycine cleavage system [Evidence IEP,IMP] [PMID 8830251];
                     GO_process: GO:0006544 - glycine metabolic process
                     [Evidence IEA]; GO_process: GO:0006730 - one-carbon
                     metabolic process [Evidence IGI] [PMID 10871621];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="glycine decarboxylase subunit P"
                     /protein_id="XP_018733539.1"
                     /db_xref="GeneID:30035925"
                     /translation="MRFLIRSSQRLVAGRYAVNTTSRVFTRGALIGSRSYSSQIPSSS
                     PLEPLDTYLRRHNGSSSPKSIETLLDKVGYKSVDSFVESVVPDGILSRRPLQISPENG
                     LSESQLTSRLREIASENKLYRSFIGRGYYGTIVPPVIQRNILECPEWYTSYTPYQPEI
                     AQGRLESLMNFQTLVADLTGMSVANASLLDEATAGAEAMAMGFHALRGKRKVYYVDEN
                     VHSQTISVLKTRAKTLGIEVVIGLPKDEAEFKSSFGTLIQYPGANGNIESPEYYQQLS
                     DKVHGSGGVLAVATDLLALTVLKAPSSFGADIVFGNSQRFGVPFGYGGPHAAFFAVAD
                     SEKRKMPGRLIGRSKDRLGNPAFRLALQTREQHIRREKATSNICTAQALLANMAAMYA
                     VYHGPEGLKNIANRVYSLTTYLASQIESSSSHSLVNNKWFDTLTVKLGGVTADEFLAK
                     ARSEYQINLFKVDDSSVSVALDETVTAKDVSDLVSLFTGSTVGLTTLSAADVQYTSVP
                     EDLARTGKILQFAVFNTHHSETELLRYIHHLQSKDLSLANSMIPLGSCTMKLNATVQM
                     APVTWPEFGQIHPFAPIDQAKGYQTLVSELEADLADITGFDATSLQPNSGAQGEFAGL
                     KVIRAYLDSIGQGHRDICIIPVSAHGTNPASAAMAGFKVVSVKCTNNGELDLVDLEAK
                     AEKYKDKLAATMITYPSTYGVFEPGVKRAIEIVHSHGGQVYMDGANMNAQIGLTSPGE
                     IGADVCHLNLHKTFCIPHGGGGPGVGPICVKSHLQPFLPSHDTVAVTSASSDGRAVDS
                     VSAAPYGSASILPISWAYIKLMGASGLKKATELALLNANYMKARVGEHFPVAYTNAEG
                     RCAHEFIVDLRGFKSTSGIEAIDVAKRLQDYGFHAPTMSWPVPNTLMIEPTESESIAE
                     LDRFCDALISIRKEIADIEEGRVPRENNVLKNAPHSQQDLLTSEWDRPYTREQAAYPL
                     PYLREAKFWPSVTRLDDNYGDLNLFCSCDPVEAIE"
     gene            <482919..>483815
                     /gene="TRM7"
                     /locus_tag="AWJ20_3859"
                     /db_xref="GeneID:30035926"
     mRNA            <482919..>483815
                     /gene="TRM7"
                     /locus_tag="AWJ20_3859"
                     /product="Trm7p"
                     /transcript_id="XM_018880894.1"
                     /db_xref="GeneID:30035926"
     CDS             482919..483815
                     /gene="TRM7"
                     /locus_tag="AWJ20_3859"
                     /inference="similar to AA sequence:KEGG_Orthology:K14864"
                     /note="2'-O-ribose methyltransferase; methylates the
                     2'-O-ribose of tRNA-Phe, tRNA-Trp, and tRNA-Leu at
                     positions C32 and N34 of the tRNA anticodon loop; crucial
                     biological role likely modification of tRNA-Phe; interacts
                     with Trm732p and Rtt10p in 2'-O-methylation of C32 and N34
                     substrate tRNAs, respectively; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11927565]; GO_function:
                     GO:0008168 - methyltransferase activity [Evidence
                     IEA,IEA]; GO_function: GO:0008175 - tRNA methyltransferase
                     activity [Evidence IEA]; GO_function: GO:0008175 - tRNA
                     methyltransferase activity [Evidence IDA] [PMID 11927565];
                     GO_function: GO:0008175 - tRNA methyltransferase activity
                     [Evidence IMP,ISS] [PMID 9917067]; GO_function: GO:0016740
                     - transferase activity [Evidence IEA]; GO_process:
                     GO:0001510 - RNA methylation [Evidence IEA]; GO_process:
                     GO:0002181 - cytoplasmic translation [Evidence IMP] [PMID
                     11927565]; GO_process: GO:0032259 - methylation [Evidence
                     IEA,IEA]; GO_process: GO:0030488 - tRNA methylation
                     [Evidence IDA] [PMID 11927565]; GO_process: GO:0008033 -
                     tRNA processing [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Trm7p"
                     /protein_id="XP_018733540.1"
                     /db_xref="GeneID:30035926"
                     /translation="MGKSSKDKRDLYYRKAKEEGWRARSAFKLLQLDSQFHLLKGLNR
                     VVDLCAAPGSWSQVLSRSLPEDSAKIVAVDLQPMAPIKGVTSIQADITHPKTLKRILD
                     IFGGEPADFVCSDGAPDVTGLHDLDEYIQAQLILSALQLATALLRPGGAFVAKIFRGR
                     DIDLMYFQLGLLFERVTCAKPRSSRGSSLEAFIVCQGYKPRPGWVPSIINEVFSTEEY
                     FKKMGIERPLIVDLDGEYEEEERVVAPFVACGDLSEYDSDATYTIERSTARVSLDPVQ
                     SPTAPPYKTAIELKRKGIIKRT"
     gene            complement(<484050..>485798)
                     /gene="KRS1"
                     /locus_tag="AWJ20_3860"
                     /db_xref="GeneID:30035928"
     mRNA            complement(<484050..>485798)
                     /gene="KRS1"
                     /locus_tag="AWJ20_3860"
                     /product="lysine--tRNA ligase KRS1"
                     /transcript_id="XM_018880896.1"
                     /db_xref="GeneID:30035928"
     CDS             complement(484050..485798)
                     /gene="KRS1"
                     /locus_tag="AWJ20_3860"
                     /inference="similar to AA sequence:KEGG_Orthology:K04567"
                     /note="Lysyl-tRNA synthetase; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 330225]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0004812 - aminoacyl-tRNA ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0004824 - lysine-tRNA
                     ligase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004824 - lysine-tRNA ligase activity [Evidence IDA]
                     [PMID 3888626]; GO_function: GO:0004824 - lysine-tRNA
                     ligase activity [Evidence IMP] [PMID 7628447];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_process:
                     GO:0006430 - lysyl-tRNA aminoacylation [Evidence IEA];
                     GO_process: GO:0006430 - lysyl-tRNA aminoacylation
                     [Evidence IDA] [PMID 3888626]; GO_process: GO:0006430 -
                     lysyl-tRNA aminoacylation [Evidence IMP] [PMID 7628447];
                     GO_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="lysine--tRNA ligase KRS1"
                     /protein_id="XP_018733541.1"
                     /db_xref="GeneID:30035928"
                     /translation="MSDSAVKEATEQLQKTYLDEETGEQVSKTELKKRQKAREVAKKR
                     AEKAAAAAEKAAASGEAKPKAKRDDDINPNQYFELRSTQIKALKETKAPNPYPHKFFV
                     TIKINEFVEQYKHLKRGEELKDVEVSLAGRIHVKRESGTQLKFYVLHGEGTQVQVVAQ
                     AVGEETLPEIHDLLRRGDIVGVKGYPYRTSPKKGGEGEVSVFVKEIVLLTPSLRMLPT
                     DHYGFKDLETRYRQRYLDLIMNNSTRDKFITRSKIISYIRKFFDSRDFVEVETPMMNQ
                     IAGGATAKPFITHHNDLNMDLFMRIAPELYLKELVVGGLERVYEIGRQFRNEGIDMTH
                     NPEFTTCEFYQAYADVYDLMDTTELLFSEMVKEITGSYKVEYQPQGPEGKTWEIDFSR
                     PWKRLDMIETLEEKLNVKFPPGDQLHTAETNEFLRGVLAKVGLECSPPLTNARMLDKL
                     VGEYLEETCINPTFIFGHPQMMSPLAKYHRSRPGLCERFEVFVGTKEIANAYTELNDP
                     FDQRDRFEEQARQKDQGDDEAQLIDETFCQALEYGLPPTGGWGCGIDRIAMFLTNSNS
                     IKEVLLFPAMKPEVNN"
     gene            <486426..>487697
                     /gene="TFG2"
                     /locus_tag="AWJ20_3861"
                     /db_xref="GeneID:30035929"
     mRNA            <486426..>487697
                     /gene="TFG2"
                     /locus_tag="AWJ20_3861"
                     /product="transcription factor IIF subunit TFG2"
                     /transcript_id="XM_018880897.1"
                     /db_xref="GeneID:30035929"
     CDS             486426..487697
                     /gene="TFG2"
                     /locus_tag="AWJ20_3861"
                     /inference="similar to AA sequence:KEGG_Orthology:K03139"
                     /note="TFIIF (Transcription Factor II) middle subunit;
                     involved in both transcription initiation and elongation
                     of RNA polymerase II; homologous to human RAP30;
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005674 - transcription factor TFIIF
                     complex [Evidence IEA]; GO_component: GO:0005674 -
                     transcription factor TFIIF complex [Evidence IDA] [PMID
                     12242279]; GO_component: GO:0005674 - transcription factor
                     TFIIF complex [Evidence IDA] [PMID 7995524]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0000991 - core RNA polymerase II binding
                     transcription factor activity [Evidence IDA] [PMID
                     14749386]; GO_function: GO:0001139 - core RNA polymerase
                     II recruiting transcription factor activity [Evidence IC]
                     [PMID 7995524]; GO_function: GO:0004386 - helicase
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_process:
                     GO:0051123 - RNA polymerase II transcriptional
                     preinitiation complex assembly [Evidence IC] [PMID
                     7995524]; GO_process: GO:0001111 - promoter clearance from
                     RNA polymerase II promoter [Evidence IC] [PMID 7995524];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006368 -
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IDA] [PMID 18362165]; GO_process: GO:0006367 -
                     transcription initiation from RNA polymerase II promoter
                     [Evidence IEA]; GO_process: GO:0006367 - transcription
                     initiation from RNA polymerase II promoter [Evidence IDA]
                     [PMID 1331084]; GO_process: GO:0006367 - transcription
                     initiation from RNA polymerase II promoter [Evidence IDA]
                     [PMID 18362165]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0001174 -
                     transcriptional start site selection at RNA polymerase II
                     promoter [Evidence IMP] [PMID 15572698]; GO_process:
                     GO:0001174 - transcriptional start site selection at RNA
                     polymerase II promoter [Evidence IMP] [PMID 20033062]"
                     /codon_start=1
                     /product="transcription factor IIF subunit TFG2"
                     /protein_id="XP_018733542.1"
                     /db_xref="GeneID:30035929"
                     /translation="MSAVDVKEEPGSPGFEDDVSLSPSSPRPSGSLDDQDVPTRDGAE
                     EEEEIFEDSLDLDTSGASSKVWLVRLPKFLMERWKDVDKISDSELGKVRIRNQQGNEP
                     WKVKLVLNDTPETADIPHEYDISLVKQVVDNTFVFTEKDLPKFSKPQDKETTNPTTAA
                     ANRLAALNKAKNKYNNRKNYFKNSSPGVGSDGNNGNSSDSGISSPRFVPYVKTIPKKT
                     ALVGTACHECLVMPSMKDPNYAKVVSQRKALESESSAAKVTFLNEMPGVNAATFGQSL
                     RNKPGAFIRSTKKDIAKSSEGKATRIPKNELLDLLFKLFEEYDYWSLKGLRERTKQPE
                     TYLKEVLDTMAILIKKGPYAMKYTLKPEFKQIKGKEGSLSEYMERTGANGDADNEPNG
                     NRNENGNASGNDEPTIEDDEDDDDVEMETIL"
     gene            <490103..>491218
                     /locus_tag="AWJ20_3862"
                     /db_xref="GeneID:30035930"
     mRNA            <490103..>491218
                     /locus_tag="AWJ20_3862"
                     /product="AraC family transcriptional regulator"
                     /transcript_id="XM_018880898.1"
                     /db_xref="GeneID:30035930"
     CDS             490103..491218
                     /locus_tag="AWJ20_3862"
                     /codon_start=1
                     /product="AraC family transcriptional regulator"
                     /protein_id="XP_018733543.1"
                     /db_xref="GeneID:30035930"
                     /translation="MSDGSSSLSSYASPVTPSIGSKSTYENSFQDIDTFRVKLLCFMD
                     SEIKKRQFLDQIRGRCSIDLKALVEWESPLTVSQKKVEVEKLLPDGIKDDDSVSPTGA
                     VKWVTPDFVVVPRSPKRIFCRPHCPSRKHKPLESVRLQFPKSIYSAMKDYGLAPCGRC
                     RPLDSHYLPAQSRLLQSVELMKEKGYKAKLIDLARKAGMSKHHYDRSFSAKFELPPGK
                     FQKMKLAQLSKDEEQIDKHSDEPCSAPGTSSTTSTGSDMEDAGDFADFESRFKDPLQI
                     PSGELTFFSDSEPSSITEETIGTEEDFSSCEMLNSMEWFTNYTKEIVREEVNIAVFYN
                     SNEVGCNLEQPMTFEPESDIFSQGFYDFSCDFILNYN"
     gene            <491935..>493533
                     /locus_tag="AWJ20_3863"
                     /db_xref="GeneID:30035931"
     mRNA            <491935..>493533
                     /locus_tag="AWJ20_3863"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880899.1"
                     /db_xref="GeneID:30035931"
     CDS             491935..493533
                     /locus_tag="AWJ20_3863"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733544.1"
                     /db_xref="GeneID:30035931"
                     /translation="MVEATKTVSGSVPDLGTGSDPGALNNVIDLVSQLSEDGLAQLQK
                     KIELLKSRSGGTAGSSSSPSSSTTNIKSSTSTTVAGTLPTDAAASGTPPTASSTPIPP
                     TPSITTLDGSEKWGSKVIITTYPGQQGVKSVPIKWGAKDPLERGPVIVSRTTGSLKRR
                     NAIGAYSGSYSIYHALAVAINDLPVDHKPDFTNAQPPVDIGPFPQWEGVDRIVSMDPF
                     GHIAPWVYSDLAAKENLDIRPTIAVTKAHMQLAEIRDEVKSGKLKVDGKIVLNEQGDL
                     AVTKVAVEPVWYLPGVAKRFGIDELTLRRALFEDTGGSYPELITRGDIKIFLPPIGGL
                     TAYIFGDPAKVSDPNSKLALRIHDECNGSDVFGSDICTCRPYLLFGISEAVKEAQNGG
                     SGVVIYFRKEGRALGEVTKYLVYNARKRGGDNAAEYFKRTENIAGVKDMRFQVLMPDI
                     LHFLGITKIDRMLSMSNMKHDAIVEQGIKIIERVPIPDELIPPDSRVEIDAKIFSGYF
                     TTGKIVTAEDLQQVKGRQWEDIDH"
     gene            <494277..>496028
                     /gene="KIN3"
                     /locus_tag="AWJ20_3864"
                     /db_xref="GeneID:30035932"
     mRNA            <494277..>496028
                     /gene="KIN3"
                     /locus_tag="AWJ20_3864"
                     /product="serine/threonine protein kinase KIN3"
                     /transcript_id="XM_018880900.1"
                     /db_xref="GeneID:30035932"
     CDS             494277..496028
                     /gene="KIN3"
                     /locus_tag="AWJ20_3864"
                     /inference="similar to AA sequence:KEGG_Orthology:K08857"
                     /codon_start=1
                     /product="serine/threonine protein kinase KIN3"
                     /protein_id="XP_018733545.1"
                     /db_xref="GeneID:30035932"
                     /translation="MVRPDEFEPLEVIGRGSFGQIRKVRRITNGEILARKEISYKSMN
                     QKEKAQLIAEFRILKSLVHPNIVQYLHHEHLVDEHIVHLYMEYCGGGDLAGLISQCRS
                     SNTLVPENVIWGVFTQLIMALYRCHYNEDPPPVPEDLFGNDSDTPPPPNPSTVILHRD
                     IKPDNVFLDENYSVKLGDFGLAKMLDQENRFARTYVGTPYYMSPEVLLDEPSTPSSDV
                     WSLGCVIYELCALHPPFQAKTHMALSQKIREGAFDDIPSCYSSTLSRTITACLNTNPL
                     QRPTTATLLRLDIIKLCRKEREILTRERELKAIEQILIEREHQMEQQLEQQRFQMEQE
                     IEQEMYNRLEQRLAGVLEAEVEKRVEIALKSVMANNNNPNQVAVSPIDTSMLVAPSSP
                     IPGMSTGRNVRGPRSIRDAIISPLRDMSNSQYRTTAIDSPLSYYPKNASNSNINSSNS
                     SNSSSNNTVNVNIEGLGLSDGSGTSSTNSGSSVSSTSSTGTSSDPTANWITSKKDPQR
                     VAPHYQAMHSSPGIGAAAAKARLLNTKGSTPGMLGRVAVQLQREAQDTTQIWDENIHG
                     DNMPSPFLRRWERRTVS"
     gene            complement(<496266..>497540)
                     /gene="ACT1"
                     /locus_tag="AWJ20_3865"
                     /db_xref="GeneID:30035933"
     mRNA            complement(<496266..>497540)
                     /gene="ACT1"
                     /locus_tag="AWJ20_3865"
                     /product="actin"
                     /transcript_id="XM_018880901.1"
                     /db_xref="GeneID:30035933"
     CDS             complement(496266..497540)
                     /gene="ACT1"
                     /locus_tag="AWJ20_3865"
                     /inference="similar to AA sequence:KEGG_Orthology:K11400"
                     /note="Actin; structural protein involved in cell
                     polarization, endocytosis, and other cytoskeletal
                     functions; GO_component: GO:0031011 - Ino80 complex
                     [Evidence IPI] [PMID 10952318]; GO_component: GO:0031011 -
                     Ino80 complex [Evidence IPI] [PMID 24034245];
                     GO_component: GO:0035267 - NuA4 histone acetyltransferase
                     complex [Evidence IDA] [PMID 10911987]; GO_component:
                     GO:0035267 - NuA4 histone acetyltransferase complex
                     [Evidence IPI] [PMID 15485911]; GO_component: GO:0000812 -
                     Swr1 complex [Evidence IDA] [PMID 14645854]; GO_component:
                     GO:0000812 - Swr1 complex [Evidence IDA] [PMID 14690608];
                     GO_component: GO:0000812 - Swr1 complex [Evidence IDA]
                     [PMID 16299513]; GO_component: GO:0030479 - actin cortical
                     patch [Evidence IDA] [PMID 3967297]; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IDA] [PMID
                     6365930]; GO_component: GO:0030479 - actin cortical patch
                     [Evidence IDA] [PMID 8163554]; GO_component: GO:0005884 -
                     actin filament [Evidence IDA] [PMID 6217414];
                     GO_component: GO:0032432 - actin filament bundle [Evidence
                     IDA] [PMID 3967297]; GO_component: GO:0032432 - actin
                     filament bundle [Evidence IDA] [PMID 6365930];
                     GO_component: GO:0032432 - actin filament bundle [Evidence
                     IDA] [PMID 8163554]; GO_component: GO:0000142 - cellular
                     bud neck contractile ring [Evidence IDA] [PMID 3967297];
                     GO_component: GO:0000142 - cellular bud neck contractile
                     ring [Evidence IDA] [PMID 8163554]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005856 - cytoskeleton [Evidence IEA,IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0004402 - histone acetyltransferase activity [Evidence
                     IDA] [PMID 10911987]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0005200 -
                     structural constituent of cytoskeleton [Evidence IDA]
                     [PMID 6217414]; GO_process: GO:0006281 - DNA repair
                     [Evidence IDA] [PMID 16135807]; GO_process: GO:0000916 -
                     actomyosin contractile ring contraction [Evidence IDA,IMP]
                     [PMID 9732290]; GO_process: GO:0030476 - ascospore wall
                     assembly [Evidence IDA] [PMID 17118118]; GO_process:
                     GO:0007119 - budding cell isotropic bud growth [Evidence
                     TAS] [PMID 10652251]; GO_process: GO:0034599 - cellular
                     response to oxidative stress [Evidence IGI] [PMID
                     17287397]; GO_process: GO:0001300 - chronological cell
                     aging [Evidence IMP] [PMID 15024029]; GO_process:
                     GO:0006897 - endocytosis [Evidence IMP] [PMID 8590801];
                     GO_process: GO:0030010 - establishment of cell polarity
                     [Evidence IGI] [PMID 9864365]; GO_process: GO:0000132 -
                     establishment of mitotic spindle orientation [Evidence
                     TAS] [PMID 10652251]; GO_process: GO:0006887 - exocytosis
                     [Evidence TAS] [PMID 10652251]; GO_process: GO:0031505 -
                     fungal-type cell wall organization [Evidence TAS] [PMID
                     10652251]; GO_process: GO:0016573 - histone acetylation
                     [Evidence IDA] [PMID 10911987]; GO_process: GO:0000001 -
                     mitochondrion inheritance [Evidence TAS] [PMID 10652251];
                     GO_process: GO:0009306 - protein secretion [Evidence
                     IGI,IMP] [PMID 10793147]; GO_process: GO:0000011 - vacuole
                     inheritance [Evidence IGI,IMP] [PMID 8978821]; GO_process:
                     GO:0030050 - vesicle transport along actin filament
                     [Evidence TAS] [PMID 10652251]"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_018733546.1"
                     /db_xref="GeneID:30035933"
                     /translation="MTRVKPPQADDVTSIVIENGSTWTRVGYSGDVTPKHYIPTVYAK
                     DADGKHYYGEEVDVPRPNTDIFSPMHDGCVQDWDAMSSFWKWIYSDKLFIEPNELPLV
                     TVEPSWNSLANKQKALEVAFEDLQVPVFSLVKAPIATAYESARPTSLIIDIGSAVASV
                     TPVIDGSLVPKTVFHSRFAGDFVNLHILTYLQTKNITITPSYLVRKKSVLDPGQPVST
                     PDLYEYPDIKPSFHAYQTSKVLHAFKETTSQVSNVPFTSASPFARIGRPFEFPDGFNM
                     IFGPERLTTAEPLLKPTQFPLPQVNLPENSVGSAPGNTIMHGLGDLLYLSLSKLDITP
                     EVLITLLNNIIICGGTSLISGLTDRIKEEILHMFPTYAPRFYIPEQESHRKNVVWTGA
                     SVLAGLGTFDQTWITKQEYDEFGAELAEKRFK"
     gene            <498378..>500636
                     /gene="PRT1"
                     /locus_tag="AWJ20_3866"
                     /db_xref="GeneID:30035934"
     mRNA            <498378..>500636
                     /gene="PRT1"
                     /locus_tag="AWJ20_3866"
                     /product="Prt1p"
                     /transcript_id="XM_018880902.1"
                     /db_xref="GeneID:30035934"
     CDS             498378..500636
                     /gene="PRT1"
                     /locus_tag="AWJ20_3866"
                     /inference="similar to AA sequence:KEGG_Orthology:K03253"
                     /note="eIF3b subunit of the eukaryotic translation
                     initiation factor 3 (eIF3); subunit of the core complex of
                     eIF3; essential for translation; part of a subcomplex
                     (Prt1p-Rpg1p-Nip1p) that stimulates binding of mRNA and
                     tRNA(i)Met to ribosomes; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IPI] [PMID 9722586]; GO_component:
                     GO:0010494 - cytoplasmic stress granule [Evidence IDA]
                     [PMID 19470581]; GO_component: GO:0016282 - eukaryotic 43S
                     preinitiation complex [Evidence IEA]; GO_component:
                     GO:0033290 - eukaryotic 48S preinitiation complex
                     [Evidence IEA]; GO_component: GO:0033290 - eukaryotic 48S
                     preinitiation complex [Evidence IDA] [PMID 17242201];
                     GO_component: GO:0005852 - eukaryotic translation
                     initiation factor 3 complex [Evidence IEA,IEA];
                     GO_component: GO:0005852 - eukaryotic translation
                     initiation factor 3 complex [Evidence IDA,IPI] [PMID
                     9660829]; GO_component: GO:0005852 - eukaryotic
                     translation initiation factor 3 complex [Evidence IDA,IPI]
                     [PMID 9671501]; GO_component: GO:0043614 - multi-eIF
                     complex [Evidence IDA] [PMID 11018020]; GO_component:
                     GO:0043614 - multi-eIF complex [Evidence IDA] [PMID
                     15838098]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0003743
                     - translation initiation factor activity [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0003743 - translation
                     initiation factor activity [Evidence IDA,IPI,ISS] [PMID
                     7876188]; GO_function: GO:0003743 - translation initiation
                     factor activity [Evidence IDA] [PMID 9671501];
                     GO_function: GO:0031369 - translation initiation factor
                     binding [Evidence IEA]; GO_process: GO:0001731 - formation
                     of translation preinitiation complex [Evidence IEA];
                     GO_process: GO:0006446 - regulation of translational
                     initiation [Evidence IEA]; GO_process: GO:0006412 -
                     translation [Evidence IEA]; GO_process: GO:0006413 -
                     translational initiation [Evidence IEA,IEA,IEA];
                     GO_process: GO:0006413 - translational initiation
                     [Evidence IMP] [PMID 3029094]; GO_process: GO:0006413 -
                     translational initiation [Evidence IDA] [PMID 9671501]"
                     /codon_start=1
                     /product="Prt1p"
                     /protein_id="XP_018733547.1"
                     /db_xref="GeneID:30035934"
                     /translation="MPEATKNDHPHNEEEELDIDFSDLEAKYATNPDDGLETFVVVDG
                     APIVPAAKVEVLTKVLLKLFRSVGNIKAEDGFFMPMDEATGKSKGYVFIEYETPQQAQ
                     EAVKTYHQKKLDQRHTLLVNKLGDVERYGFAGNVASEYVEPTIEPFKPQEHLKSWLTD
                     SQGRDQMVLHRGDNVGVFYNRKSQTPEQVVDRQHWTEKYVRWSPKGTYLVSIHRQGVA
                     LWGGDSWNRLGRFAHNDVRLIDFSPNEKYLISLSMEPISIPPPDSPARAACPFKEQDE
                     GNHVVVWDVKTMLPLRSFPLLPGEGPSAASKNGPPAPEKKIVWPMFKWSSNSKYFARV
                     IPDEALAIYEAPSMGLLDKKSIKIPGIVDFEFAPAPVKLEGHKATAATEDGGVAAGEQ
                     ILCYWTPEMNNQTARVSIMDVGTRKVIRSRNLFNVSGCRLHWQDQGKYLCVKVDRHTK
                     TKKSTFTNLEFFRLCDKDIPVEVLELKETVINFQWEPKSDRFVLISFLDQGPLATAPV
                     ANRNTVAFYAFERSKGSQGTWKPIKVQDKKATNSIYWSPKGRFVIAGTVRPSSACEFE
                     FWDFDHEGDVKAAGAEDLPANLVNIGSCEHYGMTDLEWDPSGRFVVTSSSFWRHAIEN
                     GYKMWDFRGSLVREEAIEKFKSFLWRPRPASILPKEKRKQVNKNLKSYSRRFDEEDAM
                     EESEASRQLILKRREALAEWREWRAEMEAHLHELGLTPESDLIAAADGDDDEVIEEIR
                     EEILEEKEEEIE"
     gene            complement(<504870..>505979)
                     /gene="IMD4"
                     /locus_tag="AWJ20_3867"
                     /db_xref="GeneID:30035935"
     mRNA            complement(<504870..>505979)
                     /gene="IMD4"
                     /locus_tag="AWJ20_3867"
                     /product="IMP dehydrogenase IMD4"
                     /transcript_id="XM_018880903.1"
                     /db_xref="GeneID:30035935"
     CDS             complement(504870..505979)
                     /gene="IMD4"
                     /locus_tag="AWJ20_3867"
                     /inference="similar to AA sequence:KEGG_Orthology:K00088"
                     /note="Inosine monophosphate dehydrogenase; catalyzes the
                     rate-limiting step in the de novo synthesis of GTP; member
                     of a four-gene family in S. cerevisiae, constitutively
                     expressed; IMD4 has a paralog, IMD3, that arose from the
                     whole genome duplication; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 23222640];
                     GO_function: GO:0003938 - IMP dehydrogenase activity
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0003938 - IMP
                     dehydrogenase activity [Evidence ISS] [PMID 11003640];
                     GO_function: GO:0030554 - adenyl nucleotide binding
                     [Evidence IEA]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA,IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_process: GO:0006177 - GMP
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]; GO_process: GO:0006164 - purine nucleotide
                     biosynthetic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="IMP dehydrogenase IMD4"
                     /protein_id="XP_018733548.1"
                     /db_xref="GeneID:30035935"
                     /translation="MPGKLVGIVTSRDIQFHDNDSTPVSDIMTKRSELVTASHGIDLA
                     SANDILRKSKKGKLPIVDSDGNIIALLSRTDLKKNHNYPLASKSADSKQLICGAAIGT
                     RPDDRERLTKLAAAGLDLVILDSSQGNSVFQIEMIQWIKENYPHIEVVAGNVVTREQA
                     ASLIDAGADGLRIGMGSGSICITQEVMAVGRPQATAVYRVTEFANKFGVPCIADGGVQ
                     NIGHITKALALGASCVMMGGLLAGTTESPGQYFYREGQRLKAYRGMGSIEAMEKTGSN
                     DNAATSRYFSESDAVLVAQGVSGSVVDRGSITKFIPYLMSGLQHGLQDIGVRSVGELR
                     EKVDAGLVRFEHRTPSAQLEGGVHSLHSYEKRLHN"
     gene            complement(<506268..>506783)
                     /gene="IMD4"
                     /locus_tag="AWJ20_3868"
                     /db_xref="GeneID:30035936"
     mRNA            complement(<506268..>506783)
                     /gene="IMD4"
                     /locus_tag="AWJ20_3868"
                     /product="IMP dehydrogenase IMD4"
                     /transcript_id="XM_018880904.1"
                     /db_xref="GeneID:30035936"
     CDS             complement(506268..506783)
                     /gene="IMD4"
                     /locus_tag="AWJ20_3868"
                     /inference="similar to AA sequence:KEGG_Orthology:K00088"
                     /note="Inosine monophosphate dehydrogenase; catalyzes the
                     rate-limiting step in the de novo synthesis of GTP; member
                     of a four-gene family in S. cerevisiae, constitutively
                     expressed; IMD4 has a paralog, IMD3, that arose from the
                     whole genome duplication; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 23222640];
                     GO_function: GO:0003938 - IMP dehydrogenase activity
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0003938 - IMP
                     dehydrogenase activity [Evidence ISS] [PMID 11003640];
                     GO_function: GO:0030554 - adenyl nucleotide binding
                     [Evidence IEA]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA,IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_process: GO:0006177 - GMP
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]; GO_process: GO:0006164 - purine nucleotide
                     biosynthetic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="IMP dehydrogenase IMD4"
                     /protein_id="XP_018733549.1"
                     /db_xref="GeneID:30035936"
                     /translation="MSPAVTKLSATQALAHLKEYEELDGLDVRTLMDPNIRGGLTYND
                     FLLLPGKIDFPSSIVNLESKISRNISLKLPLVSSPMDTVTESEMAIHMALLGGIGIIH
                     HNCTPDEQAAMVRKVKKYENGFISDPVVVAPTKTVGEVRALKESLGFAGFPVTGKCIF
                     QLVDLSGSDLI"
     gene            complement(<507742..>508815)
                     /gene="PEP4"
                     /locus_tag="AWJ20_3869"
                     /db_xref="GeneID:30035937"
     mRNA            complement(<507742..>508815)
                     /gene="PEP4"
                     /locus_tag="AWJ20_3869"
                     /product="proteinase A"
                     /transcript_id="XM_018880905.1"
                     /db_xref="GeneID:30035937"
     CDS             complement(507742..508815)
                     /gene="PEP4"
                     /locus_tag="AWJ20_3869"
                     /inference="similar to AA sequence:KEGG_Orthology:K01381"
                     /codon_start=1
                     /product="proteinase A"
                     /protein_id="XP_018733550.1"
                     /db_xref="GeneID:30035937"
                     /translation="MSRGSSGGEQKPLINENNVDIDLEIAAAKGGVDVPLTNYVNAQY
                     FTEISLGNPPQQFKVVLDTGSSNLWVPSSECGSIACYLHEKYDSSASSSYKSNGSDFE
                     IHYGSGSVSGFVSQDTLKIGSLTIPNQDFAEITSEPGLAFAFGKFDGILGLAYDTISV
                     NHIVPPIYNAIKDKLLDENKFSFHLGDTAKSAAGGTATFGGIDEDLFEGKLTYLPLRR
                     LAYWEVPFDSIALGNEVADLEDTGAAIDTGTSLLALPSGLAEILNAQIGAKKSWSGQY
                     TIDCAARDTLPDLTLNFAGYNFTLTAYDYTLEISGSCASAFTPLDIPAPIGPLAIIGD
                     SFLRRYYSVYDIDNNAVGLAKAK"
     gene            complement(<512551..>514062)
                     /locus_tag="AWJ20_3870"
                     /db_xref="GeneID:30035939"
     mRNA            complement(<512551..>514062)
                     /locus_tag="AWJ20_3870"
                     /product="ser/thr/tyr protein kinase RAD53"
                     /transcript_id="XM_018880907.1"
                     /db_xref="GeneID:30035939"
     CDS             complement(512551..514062)
                     /locus_tag="AWJ20_3870"
                     /codon_start=1
                     /product="ser/thr/tyr protein kinase RAD53"
                     /protein_id="XP_018733551.1"
                     /db_xref="GeneID:30035939"
                     /translation="MNHNIGTGRFLLKPLQDINLSKNGIDFIGSLLTVDAQHRPNATV
                     CLKLPWMMETEESFNSGESVLEELPITPARQAPAPPRPLPPIPPSAAQLAADSPVRST
                     VRPAAVTPGKVSGLPAPESPAVDPGPADLQSSYNEELPISSLQIRSSVEPEIPDNTDS
                     NDKSEQEKALKDYESLEAEYNSLPALAECDSDSDSQEIKEHVEAQLSQRSNKYGDSSM
                     QVESSFDSGIHLRNGLASSPGHKVLPFQQPGVRDFDSIGNADQPPPGAYMRLDTLPNS
                     IPFRDIYVTRPVFTLGRVPDNDVQVEERRVSKRHCEIIRVPHSGSGVKQEIWLVDRSS
                     NGCFLNGELIGAGKKALIESGDTICLFIDMDRDNKRKSIFHTHKHICSSDSLTYYAGH
                     ITLGFSANILDADDEGYLKRCQLIQEGGQPVTAAEPAVLATPSEDSDSSPIRKQLHSY
                     TDAPNNNNATDTRPNLSRLPSKKRAFGVSISCFAGATRVWGGAPAAGGSTTSH"
     gene            <517514..>519562
                     /locus_tag="AWJ20_3871"
                     /db_xref="GeneID:30035940"
     mRNA            join(<517514..517627,518288..>519562)
                     /locus_tag="AWJ20_3871"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880908.1"
                     /db_xref="GeneID:30035940"
     CDS             join(517514..517627,518288..519562)
                     /locus_tag="AWJ20_3871"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733552.1"
                     /db_xref="GeneID:30035940"
                     /translation="MTTLDYEEPLTSTVRPNTAAFLTVRFIKSFPYRTVKNHRRLTAQ
                     TRGTKVTAEVLDSRTETVDNGSEKTNSVGQVTSDGSETSNKATKTGSGTTTGNGGERR
                     NRGQLTSTQTRRGVTKVSTEVLKSRTEAVDNGSEKTDSVRQVTSNGIETSNKATKTSS
                     GTTTGNGGERRNRGQLASTQTRRGVTKVSTEVLKSGTETVDNGSEKTNSVGQVTSDGS
                     ETSNKATKTGSGTTTGNGGERRNRGQLTSTQTRRGVTKVSTEVLKSRTETVDNGLKET
                     DSVGQVTSDGSEASNKATKTGSGTTTGNGGKRGNGGERRNRGQLTTAQTRSTKVTAEV
                     LKSRTETVDNGLEKTDSVGQVTSDGSETSNETTKTGSGTTTGNGGNGGERRNRGQLTT
                     AQTRSTKVTTEVLKSRTETVNNRLKETDSVGQVTSDGIKTSNETTKTSGSTTAGDLGH
                     RSSVNSCKRKGN"
     gene            complement(<518294..>519583)
                     /locus_tag="AWJ20_3872"
                     /db_xref="GeneID:30035941"
     mRNA            complement(<518294..>519583)
                     /locus_tag="AWJ20_3872"
                     /product="putative spidroin-1-like"
                     /transcript_id="XM_018880909.1"
                     /db_xref="GeneID:30035941"
     CDS             complement(518294..519583)
                     /locus_tag="AWJ20_3872"
                     /codon_start=1
                     /product="putative spidroin-1-like"
                     /protein_id="XP_018733553.1"
                     /db_xref="GeneID:30035941"
                     /translation="MRSTSYSLVALSLAAVNAAPMPQVPGGGAAAGLGGLVAGLDPVT
                     GDLSNTVGLLEPVVDSLGPALEHLGGDLGAPGLSRRQLPSVPSLPSVPSVPGGGAAAG
                     LGGLVAGLAPVTGDLSNTVGLLEPVVDSLGPALEHLGGDLGAPGLSRRQLPSVPSLPS
                     VPSLPSVPGGGAAAGLGGLVAGLAPVTGDLSNTVGLLEPVVDSLGPALEDLGADLGDA
                     SSGLSARQLPSVPSLPSVPGGGAAAGLGGLVAGLAPVTGDLSNTVGLLAPVVDSLGPA
                     LEDLGADLGDASSGLSARQLPSVPSLPSVPGGGAAAGLGGLVAGLDPVTGDLSNTVGL
                     LAPVVDSLGPALEDLGADLGDASSGLSARQLPSVPSLPSVPGGGAAAGLGGLVAGLAP
                     VTGDLSNTVGLLAPVVDSLGPAVEHLGGDLGAPGLSR"
     gene            complement(<521620..>522333)
                     /locus_tag="AWJ20_3873"
                     /db_xref="GeneID:30035942"
     mRNA            complement(<521620..>522333)
                     /locus_tag="AWJ20_3873"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880910.1"
                     /db_xref="GeneID:30035942"
     CDS             complement(521620..522333)
                     /locus_tag="AWJ20_3873"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733554.1"
                     /db_xref="GeneID:30035942"
                     /translation="MRSTTYSLATALTLSVVLAAPAPQELPSVPGLPSLPGLPSLPGA
                     SGLPSVPGVSGLPSVPGVSGLPSVPGVSGLPSLPGVSGLPSLPGVSGLPSLPGASGVE
                     GLVGGLLDTVVGLLEPIIATLDPAAAAQAEAALANAGLKVRRQLPTGGAAALDGAGNE
                     VLDAVASIVEPLVAVLDPSAETQKGIFGIEKRDFHHGEHHGNHHGDHSHPHPPTPSPN
                     SEVDNLVDGLDSTIDSLNL"
     gene            <521975..>522265
                     /locus_tag="AWJ20_3874"
                     /db_xref="GeneID:30035943"
     mRNA            <521975..>522265
                     /locus_tag="AWJ20_3874"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880911.1"
                     /db_xref="GeneID:30035943"
     CDS             521975..522265
                     /locus_tag="AWJ20_3874"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733555.1"
                     /db_xref="GeneID:30035943"
                     /translation="MMGSRRPTTVSRRPPTRPSTPLAPGREGRPETPGREGRPETPGR
                     EGRPETPGTEGRPETPGTEGRPETPGTEGRPEAPGREGRPGREGRPGTEGSS"
     gene            <525204..>526226
                     /gene="MPM1"
                     /locus_tag="AWJ20_3875"
                     /db_xref="GeneID:30035944"
     mRNA            <525204..>526226
                     /gene="MPM1"
                     /locus_tag="AWJ20_3875"
                     /product="Mpm1p"
                     /transcript_id="XM_018880912.1"
                     /db_xref="GeneID:30035944"
     CDS             525204..526226
                     /gene="MPM1"
                     /locus_tag="AWJ20_3875"
                     /note="Mitochondrial intermembrane space hypothetical
                     protein; GO_component: GO:0019898 - extrinsic component of
                     membrane [Evidence IDA] [PMID 11791739]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005758 - mitochondrial intermembrane space [Evidence
                     IDA] [PMID 22984289]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IDA] [PMID
                     22993211]; GO_component: GO:0031966 - mitochondrial
                     membrane [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 11791739];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 9874242]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Mpm1p"
                     /protein_id="XP_018733556.1"
                     /db_xref="GeneID:30035944"
                     /translation="MTKDDDNRPGVNSEKDDTAKAWSELSGTLDEVWDLTDRTFGRLT
                     NLASVYGDKVQGALDDNWRNWLDADMIWRSSWKNDGSEGGNGSDDGENNESWHRRFHR
                     VRDCRKDSKMWGYPVPSQRQYDKCIENNGTSVWSRDGVWRCLFPESNANPMAIANAKD
                     VAASASASSGSSLENHQWFTDYSVYLDWRRAMRKAEAAKRESEWNRIKERKEKLFSFP
                     SDSDIESSARSTSISSGNSSGNNGSTAVSATSSAAKQITESEAEDQGKNVISKSIVVE
                     SVWRDGKLQTRQVVKKWYDDNTVSVKETTNSNANSNSNPALTSGTSEDGLNHHSNDSK
                     GGWFWK"
     gene            <527614..>528468
                     /gene="GLC8"
                     /locus_tag="AWJ20_3876"
                     /db_xref="GeneID:30035945"
     mRNA            <527614..>528468
                     /gene="GLC8"
                     /locus_tag="AWJ20_3876"
                     /product="Glc8p"
                     /transcript_id="XM_018880913.1"
                     /db_xref="GeneID:30035945"
     CDS             527614..528468
                     /gene="GLC8"
                     /locus_tag="AWJ20_3876"
                     /inference="similar to AA sequence:KEGG_Orthology:K16833"
                     /note="Regulatory subunit of protein phosphatase 1
                     (Glc7p); involved in glycogen metabolism and chromosome
                     segregation; proposed to regulate Glc7p activity via
                     conformational alteration; ortholog of the mammalian
                     protein phosphatase inhibitor 2; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0008047 -
                     enzyme activator activity [Evidence IDA] [PMID 12127071];
                     GO_function: GO:0004864 - protein phosphatase inhibitor
                     activity [Evidence IEA]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0007059 - chromosome segregation [Evidence IMP] [PMID
                     7565759]; GO_process: GO:0005978 - glycogen biosynthetic
                     process [Evidence TAS] [PMID 9584086]; GO_process:
                     GO:0005977 - glycogen metabolic process [Evidence IEA];
                     GO_process: GO:0043086 - negative regulation of catalytic
                     activity [Evidence IEA]; GO_process: GO:0043666 -
                     regulation of phosphoprotein phosphatase activity
                     [Evidence IEA]; GO_process: GO:0009966 - regulation of
                     signal transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Glc8p"
                     /protein_id="XP_018733557.1"
                     /db_xref="GeneID:30035945"
                     /translation="MSSPSPTGSPRSPHFTTERRRSSASSNVKPKSILRNAPPPGVYN
                     SNPGSPSVDSPAAFDRQAVLENTRANAKLNNIGAEIKRRNTLESGDQLTGDLDSLHNN
                     DHNNNSSNSTTSSNSSTAGVDQDSERAKQEHLKWDEANLYLTEQEKAATMKITEPKTP
                     YQGAVGDSEYYLPDEEDDVVKTRDNRILSVDELDGFSLGESVAPPAQVATQNDRILYR
                     ENDSNDAEDEDDEDEDDEDEEEEEEELTPEERHRRFEELRKSHYHMKAAALHTSVPAE
                     DDDEDDEN"
     gene            <531013..>532137
                     /gene="TUB2"
                     /locus_tag="AWJ20_3877"
                     /db_xref="GeneID:30035946"
     mRNA            <531013..>532137
                     /gene="TUB2"
                     /locus_tag="AWJ20_3877"
                     /product="beta-tubulin"
                     /transcript_id="XM_018880914.1"
                     /db_xref="GeneID:30035946"
     CDS             531013..532137
                     /gene="TUB2"
                     /locus_tag="AWJ20_3877"
                     /inference="similar to AA sequence:KEGG_Orthology:K07375"
                     /note="Beta-tubulin; associates with alpha-tubulin (Tub1p
                     and Tub3p) to form tubulin dimer, which polymerizes to
                     form microtubules; mutation in human ortholog is
                     associated with congenital fibrosis of the extraocular
                     muscles (CFEOM) with polymicrogyria; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005881 - cytoplasmic microtubule [Evidence IC] [PMID
                     9488492]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA,IEA]; GO_component: GO:0005828 - kinetochore
                     microtubule [Evidence IC] [PMID 9488492]; GO_component:
                     GO:0005874 - microtubule [Evidence IEA,IEA]; GO_component:
                     GO:0005880 - nuclear microtubule [Evidence IC] [PMID
                     9488492]; GO_component: GO:0043234 - protein complex
                     [Evidence IEA]; GO_component: GO:0005816 - spindle pole
                     body [Evidence IDA] [PMID 9585415]; GO_component:
                     GO:0045298 - tubulin complex [Evidence IDA,IPI] [PMID
                     9488492]; GO_function: GO:0005525 - GTP binding [Evidence
                     IEA,IEA]; GO_function: GO:0003924 - GTPase activity
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_function:
                     GO:0005200 - structural constituent of cytoskeleton
                     [Evidence IEA]; GO_process: GO:0006184 - GTP catabolic
                     process [Evidence IEA]; GO_process: GO:0045143 -
                     homologous chromosome segregation [Evidence IC] [PMID
                     9488492]; GO_process: GO:0007017 - microtubule-based
                     process [Evidence IEA]; GO_process: GO:0000070 - mitotic
                     sister chromatid segregation [Evidence IC] [PMID 9488492];
                     GO_process: GO:0030473 - nuclear migration along
                     microtubule [Evidence IC] [PMID 9488492]; GO_process:
                     GO:0051258 - protein polymerization [Evidence IEA];
                     GO_process: GO:0046677 - response to antibiotic [Evidence
                     IEA]"
                     /codon_start=1
                     /product="beta-tubulin"
                     /protein_id="XP_018733558.1"
                     /db_xref="GeneID:30035946"
                     /translation="MDAVRSGPFGNLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNV
                     LDIVRREAEGCDSLQGFQIAHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVVPSPK
                     VSDTVVEPYNATLSINELVNYADETFCIDNEALYNICQQTLKMPQPTHGDLNQLISAV
                     MSGVTTCLRYPGQLNSDLRKLAVNLVPFPRLHFFTVGFAPLSAIGSKSFRSLTVPELT
                     QQMFDAKNMMAAADPRLGRYLTVAAFFRGKVSMKEVEDQMRSVQERNSAYFVEWIPNN
                     VQSAICSIPPKGLKMSATFVGNSTSIQELFKRVGDQFSAMFRRKAFLHWYINEGMDEM
                     EFTEAESNMNDLVSEYQQYQQAAAYEEELDYEDEAPIDEM"
     gene            <540215..>541075
                     /gene="CCC1"
                     /locus_tag="AWJ20_3878"
                     /db_xref="GeneID:30035947"
     mRNA            <540215..>541075
                     /gene="CCC1"
                     /locus_tag="AWJ20_3878"
                     /product="Ccc1p"
                     /transcript_id="XM_018880915.1"
                     /db_xref="GeneID:30035947"
     CDS             540215..541075
                     /gene="CCC1"
                     /locus_tag="AWJ20_3878"
                     /note="Putative vacuolar Fe2+/Mn2+ transporter; suppresses
                     respiratory deficit of yfh1 mutants, which lack the
                     ortholog of mammalian frataxin, by preventing
                     mitochondrial iron accumulation; relative distribution to
                     the vacuole decreases upon DNA replication stress;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IDA]
                     [PMID 8866476]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA]; GO_component: GO:0000324 - fungal-type
                     vacuole [Evidence IDA] [PMID 23708375]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 11390404]; GO_component: GO:0000329 - fungal-type
                     vacuole membrane [Evidence IDA] [PMID 22842922];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0015093 - ferrous iron transmembrane
                     transporter activity [Evidence IMP] [PMID 11390404];
                     GO_function: GO:0005384 - manganese ion transmembrane
                     transporter activity [Evidence IMP] [PMID 11390404];
                     GO_process: GO:0006874 - cellular calcium ion homeostasis
                     [Evidence IGI,IMP] [PMID 7941738]; GO_process: GO:0006879
                     - cellular iron ion homeostasis [Evidence IGI,IMP] [PMID
                     10713071]; GO_process: GO:0030026 - cellular manganese ion
                     homeostasis [Evidence IGI,IMP] [PMID 8866476]; GO_process:
                     GO:0015684 - ferrous iron transport [Evidence IMP] [PMID
                     11390404]; GO_process: GO:0006828 - manganese ion
                     transport [Evidence IMP] [PMID 11390404]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ccc1p"
                     /protein_id="XP_018733559.1"
                     /db_xref="GeneID:30035947"
                     /translation="MLVLLKNAIFGSNQDDRRSLLPTARSYDSVNTIGCDNCQDDDTC
                     SRSSSATASSFMESGIANPRVMSDIIIGLSDGLTVPFALTAGLSSLGDSKLVITGGLA
                     ELVSGAISMGLGGYLAARSESEYYEHQVAKEKATYAESPCLATQSIQEVLAEYKLSPE
                     TIKSFVADLEKSQEDTVNFIIRFARGLEEPASGREFTSAMTIGLAYFMGGFVPLIPYF
                     FANDVVTGLYISAIVMAITLFLFGSIKTVISLGKECGRSQILSNGVKMTLTGGVAAAA
                     AWGLVRAIDN"
     gene            complement(<541768..>546084)
                     /locus_tag="AWJ20_3879"
                     /db_xref="GeneID:30035948"
     mRNA            complement(<541768..>546084)
                     /locus_tag="AWJ20_3879"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880916.1"
                     /db_xref="GeneID:30035948"
     CDS             complement(541768..546084)
                     /locus_tag="AWJ20_3879"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733560.1"
                     /db_xref="GeneID:30035948"
                     /translation="MSFFYEGDQLHYRKDKVSEENVSSWTVVDLPYRAAGIVPDLPSF
                     TAFLTQSFTLIPLLEVDLEIDGIQLLSLRKVVGPGTEMAIPKHLNTKSPNGFLKLQSL
                     DVESFQVKIKYMNVTQMSNDSLFGKSGNLFSFGKKLFSSLVTSSSNPSDITEVVCFLR
                     KVSGTIDVSVPASFAAKMKATVMKAPAKKAYISMLAYNKEEKELSELKPPLSDYIFPK
                     EFNDAKIYIGFPTKQSTSMRSHICMNQLIPTMERTAVDMSNQHVKDWNQQMLYISGVL
                     ARAIYENEMSRIAMTYSTSQVTDMLESACYIINRFEFERSTPDPNVGDLIAAGFWRSS
                     AKLSLPSEKGIKLSNEIRVADVNTSFIQQVPVLPYKVVSECPKFIERATYLGYLNKLS
                     VQDVSEDIQGHTLSIQNFKELILWLLGELKHKNITFERLKSVLDIAVVVLPGEGAGET
                     LFLRGVNSYQNKFVVEEKMPLPPTCAPFKFIKDIPWTTLHELGWEELELVDWLEYIVE
                     QKSSLPLEQNISISPDFAILVLQKISTNWNSFTTPTKRRVISLLHNETCIPTQLGMKL
                     PSESYLMDIPLFPNLPVKSPHLTADYKFLFTLGLRESVDMAFVLKLLHDPENSAVKWS
                     TSDMVKYLTDNRKSLKHSDWQLLKEKAFFEADDDNSKVLYKAGELYAPDPTLKKLGFR
                     TLKWNFWSNSGPEATLLFDIGLLRYPDEAALFKSAVSSESKLKIAIDYFVTNSAKNKY
                     SAQRAALIGEKIIPCNLNGQVVYRAPKDCFIDSQVGEFGLPVVRDQLLVTEGWKFGIR
                     KNPSMSELVNALRSKVPPSIAAAESMFTYLSTLVSFISPDHIKQLQSVAFIPIAVGQK
                     IKYQYPLKTFLEPLEKDAHEDLFFKEFFDFVGMPASATPFLLKVGVRYNPSTLEMAEA
                     AVDDPMSMYGLASSSDKYESFLYRLAEAWPELSKNYSLVSKMRTSRFLLALSYKGESC
                     EDGDDDGYSYRQKASYSLASASEIVIVNDVISFNLFKSYLKVAPQDTKLEKFYAVLGS
                     HQLSSVVETSVLLGNKLNSEDPVIAQRIGNIKSRIVERVKLFIEGTRERVKIRPNAMK
                     SLTIIPVSKIQLRRRLNASSIRSDVVSESIKAFMQQKVLYVDLEDFDWYDVSQALIRE
                     ILEKPSPDSIIVLELQLKSDLRSLQRKGFNVDRLMKQKMEEDIRLREQRQKAKEEARQ
                     KLQEQNRLKSEEAQRASDSNSEHPKSQALVPPTQPVPPSPQPMPDLISKSLPSQPEPT
                     TVDNVPGSFPSGERDPLIPQPSPEPQFQPLSQSSSLPIPQPKSSGEGRTGSKLLGGLF
                     NLTKKTEQLKPDYSKEPMDVLRKGLSSTKPFTQGKIKADMHVDVEPPKEMMSCDDGVA
                     QDLRLVTQLKGGLKCFVKSSEPNFTPVQLEEAARFQHILLACSKVSTTHPSLSKPRTT
                     PY"
     gene            <548349..>550058
                     /gene="MUP1"
                     /locus_tag="AWJ20_3880"
                     /db_xref="GeneID:30035950"
     mRNA            <548349..>550058
                     /gene="MUP1"
                     /locus_tag="AWJ20_3880"
                     /product="Mup1p"
                     /transcript_id="XM_018880918.1"
                     /db_xref="GeneID:30035950"
     CDS             548349..550058
                     /gene="MUP1"
                     /locus_tag="AWJ20_3880"
                     /note="High affinity methionine permease; integral
                     membrane protein with 13 putative membrane-spanning
                     regions; also involved in cysteine uptake; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0005887 - integral component of plasma membrane
                     [Evidence ISS] [PMID 8893857]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA,IEA]; GO_function: GO:0000102 -
                     L-methionine secondary active transmembrane transporter
                     activity [Evidence IDA] [PMID 8893857]; GO_function:
                     GO:0015171 - amino acid transmembrane transporter activity
                     [Evidence IEA]; GO_process: GO:0003333 - amino acid
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006865 - amino acid transport [Evidence IEA];
                     GO_process: GO:0042883 - cysteine transport [Evidence IDA]
                     [PMID 11330701]; GO_process: GO:0044690 - methionine
                     import [Evidence IGI,IMP] [PMID 8893857]; GO_process:
                     GO:0015821 - methionine transport [Evidence IDA] [PMID
                     11330701]; GO_process: GO:0000101 - sulfur amino acid
                     transport [Evidence IMP] [PMID 8893857]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mup1p"
                     /protein_id="XP_018733561.1"
                     /db_xref="GeneID:30035950"
                     /translation="MSAKYTRIDSGAGGSLGRPELGHGDSQISLELESLASSDEGSIR
                     SVSSRGLSPLDSPIRSPEIRDDDNDPMSYGMQFHGRSMSVSTMGEHMINLPSTNDPFL
                     GETAVPLEKQKRLTLFHGLSLVIGLQIGSGIFASPNQINSNAGSVGMSLIIWVAGGLL
                     AWTGASSYAELGSAIPLNGSSQAYLNQIYGSLPSFLFSWTALTILKPGSTAIIAIIFS
                     EYFCRALGSSPVFTNYWFQKFIAIIGLAIVVAINCFSTRLGARAGNFFLVIKIGVLLA
                     ITIIGIVASFHFHDTNALTGADSRGLFADSSKSIGNYAIALYAGLWAYDGWDNVNYVS
                     AEMKNPRRDLPRVIHIAMPVVIVAYFLANIAYYAVMSEEEIEKTTSVAITFATKTMGP
                     VAGIIFAILISLSCIGALNATIFSSARLVYSSAEEGFLPSMFCKLHPVRSTPVNALLL
                     QSAIACIFILVGEFHSLLTFYGFAGYSFYFLTVSGVIVLRIREPDLDRPYKTYISTPI
                     LFCCVALFLVSRTLFEKPIESLFVALFIASGLPIYIWRFGLLSQASVPSFDDILRKLK
                     IRR"
     gene            complement(<550308..>552002)
                     /locus_tag="AWJ20_3881"
                     /db_xref="GeneID:30035951"
     mRNA            complement(<550308..>552002)
                     /locus_tag="AWJ20_3881"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880919.1"
                     /db_xref="GeneID:30035951"
     CDS             complement(550308..552002)
                     /locus_tag="AWJ20_3881"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733562.1"
                     /db_xref="GeneID:30035951"
                     /translation="MYRVNSTTVGAGTGHGMSPQPTGGGSARKVYVRQDRGADLGTGS
                     GLGSGIGINPDGNGMGGSLQSPLPAAVKSTGEIGSKGMFVRANSDTKVRPGSGSVKLK
                     AASVPVVATVSTSNSGIGIGAESVGGNGNVFSSNTPGSRASSVVSDRQPRPQLRQRVS
                     VLDLKPELHYNASVSSKSSVSSLNHNQVQSQNVNPSLDGRRSSNDSGSAGVNAYNKRL
                     MSPSVSGTNTPVISPTYKPLIGTKDSKVLKYSPTANVSAAAENLPSHVAVSSGANDQA
                     SDSFTPNLTESSTLASSSSSFPSLSSPSPSSSFASAPAGLLPSPSLHQGSTLPESSPK
                     DHSEILVKLPDKSANIISKAIQQESEQSSVSESMTLVPVLQPSDVTSLSAVSKARAER
                     KIKDLEITNTSLLSINRYLEKKIHRQKKDIERLSTRRTSDRSSMGRRTTRNTEHGSDG
                     DSDNDSDNESRYSGDYENSDLDESSLSSDFSDDEYSELDSSFIDTTLLDEVQERTSAH
                     ISFLKSAEKFDTMLRQCLIISDSLLNDAMSSLDFTVKPSDIGKKVVAVDAGESDDP"
     gene            complement(<552510..>553592)
                     /gene="ACT1"
                     /locus_tag="AWJ20_3882"
                     /db_xref="GeneID:30035952"
     mRNA            complement(<552510..>553592)
                     /gene="ACT1"
                     /locus_tag="AWJ20_3882"
                     /product="actin"
                     /transcript_id="XM_018880920.1"
                     /db_xref="GeneID:30035952"
     CDS             complement(552510..553592)
                     /gene="ACT1"
                     /locus_tag="AWJ20_3882"
                     /inference="similar to AA sequence:KEGG_Orthology:K05692"
                     /note="Actin; structural protein involved in cell
                     polarization, endocytosis, and other cytoskeletal
                     functions; GO_component: GO:0031011 - Ino80 complex
                     [Evidence IPI] [PMID 10952318]; GO_component: GO:0031011 -
                     Ino80 complex [Evidence IPI] [PMID 24034245];
                     GO_component: GO:0035267 - NuA4 histone acetyltransferase
                     complex [Evidence IDA] [PMID 10911987]; GO_component:
                     GO:0035267 - NuA4 histone acetyltransferase complex
                     [Evidence IPI] [PMID 15485911]; GO_component: GO:0000812 -
                     Swr1 complex [Evidence IDA] [PMID 14645854]; GO_component:
                     GO:0000812 - Swr1 complex [Evidence IDA] [PMID 14690608];
                     GO_component: GO:0000812 - Swr1 complex [Evidence IDA]
                     [PMID 16299513]; GO_component: GO:0030479 - actin cortical
                     patch [Evidence IDA] [PMID 3967297]; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IDA] [PMID
                     6365930]; GO_component: GO:0030479 - actin cortical patch
                     [Evidence IDA] [PMID 8163554]; GO_component: GO:0005884 -
                     actin filament [Evidence IDA] [PMID 6217414];
                     GO_component: GO:0032432 - actin filament bundle [Evidence
                     IDA] [PMID 3967297]; GO_component: GO:0032432 - actin
                     filament bundle [Evidence IDA] [PMID 6365930];
                     GO_component: GO:0032432 - actin filament bundle [Evidence
                     IDA] [PMID 8163554]; GO_component: GO:0000142 - cellular
                     bud neck contractile ring [Evidence IDA] [PMID 3967297];
                     GO_component: GO:0000142 - cellular bud neck contractile
                     ring [Evidence IDA] [PMID 8163554]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005856 - cytoskeleton [Evidence IEA,IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0004402 - histone acetyltransferase activity [Evidence
                     IDA] [PMID 10911987]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0005200 -
                     structural constituent of cytoskeleton [Evidence IDA]
                     [PMID 6217414]; GO_process: GO:0006281 - DNA repair
                     [Evidence IDA] [PMID 16135807]; GO_process: GO:0000916 -
                     actomyosin contractile ring contraction [Evidence IDA,IMP]
                     [PMID 9732290]; GO_process: GO:0030476 - ascospore wall
                     assembly [Evidence IDA] [PMID 17118118]; GO_process:
                     GO:0007119 - budding cell isotropic bud growth [Evidence
                     TAS] [PMID 10652251]; GO_process: GO:0034599 - cellular
                     response to oxidative stress [Evidence IGI] [PMID
                     17287397]; GO_process: GO:0001300 - chronological cell
                     aging [Evidence IMP] [PMID 15024029]; GO_process:
                     GO:0006897 - endocytosis [Evidence IMP] [PMID 8590801];
                     GO_process: GO:0030010 - establishment of cell polarity
                     [Evidence IGI] [PMID 9864365]; GO_process: GO:0000132 -
                     establishment of mitotic spindle orientation [Evidence
                     TAS] [PMID 10652251]; GO_process: GO:0006887 - exocytosis
                     [Evidence TAS] [PMID 10652251]; GO_process: GO:0031505 -
                     fungal-type cell wall organization [Evidence TAS] [PMID
                     10652251]; GO_process: GO:0016573 - histone acetylation
                     [Evidence IDA] [PMID 10911987]; GO_process: GO:0000001 -
                     mitochondrion inheritance [Evidence TAS] [PMID 10652251];
                     GO_process: GO:0009306 - protein secretion [Evidence
                     IGI,IMP] [PMID 10793147]; GO_process: GO:0000011 - vacuole
                     inheritance [Evidence IGI,IMP] [PMID 8978821]; GO_process:
                     GO:0030050 - vesicle transport along actin filament
                     [Evidence TAS] [PMID 10652251]"
                     /codon_start=1
                     /product="actin"
                     /protein_id="XP_018733563.1"
                     /db_xref="GeneID:30035952"
                     /translation="MCKAGFAGDDAPRAVFPSIVGRARHPGMMVGMNQKDSYVGDEAQ
                     SKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPVNPKSNRE
                     KMTQIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYAGFSLPHAI
                     MRINLAGRDLTDNLMKLLTERGYSFTTTAEREIVREIKEKLCYVALDFEQELQTASQS
                     SSLEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESPGIHETTFNSIMKCDVDVRK
                     DLYGNIVMSGGTTMYPGIAERMQKEITALAPSSMKIKIIAPPERKYSVWIGGSILASL
                     GTFQQMWISKQEYDESGPSIVHRKCF"
     gene            <559176..>559388
                     /locus_tag="AWJ20_3883"
                     /db_xref="GeneID:30035953"
     mRNA            <559176..>559388
                     /locus_tag="AWJ20_3883"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880921.1"
                     /db_xref="GeneID:30035953"
     CDS             559176..559388
                     /locus_tag="AWJ20_3883"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733564.1"
                     /db_xref="GeneID:30035953"
                     /translation="MAIPLPEKELTKSADNATGSNTSNLDGTAKEPYPTSIPTIIGNV
                     NISKEEAERLYEERIEDEYAKREGGA"
     gene            <562802..>566446
                     /gene="PMC1"
                     /locus_tag="AWJ20_3884"
                     /db_xref="GeneID:30035954"
     mRNA            <562802..>566446
                     /gene="PMC1"
                     /locus_tag="AWJ20_3884"
                     /product="calcium-transporting ATPase PMC1"
                     /transcript_id="XM_018880922.1"
                     /db_xref="GeneID:30035954"
     CDS             562802..566446
                     /gene="PMC1"
                     /locus_tag="AWJ20_3884"
                     /inference="similar to AA sequence:KEGG_Orthology:K01537"
                     /note="Vacuolar Ca2+ ATPase involved in depleting cytosol
                     of Ca2+ ions; prevents growth inhibition by activation of
                     calcineurin in the presence of elevated concentrations of
                     calcium; similar to mammalian PMCA1a; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 24124599]; GO_component: GO:0000329 - fungal-type
                     vacuole membrane [Evidence IDA] [PMID 7507493];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0005388 - calcium-transporting ATPase
                     activity [Evidence IEA,IEA]; GO_function: GO:0005388 -
                     calcium-transporting ATPase activity [Evidence IMP] [PMID
                     10431803]; GO_function: GO:0005388 - calcium-transporting
                     ATPase activity [Evidence IGI] [PMID 7507493];
                     GO_function: GO:0019829 - cation-transporting ATPase
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA,IEA];
                     GO_process: GO:0070588 - calcium ion transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006816 - calcium
                     ion transport [Evidence IEA]; GO_process: GO:0006816 -
                     calcium ion transport [Evidence IMP] [PMID 15280017];
                     GO_process: GO:0006816 - calcium ion transport [Evidence
                     IMP] [PMID 7507493]; GO_process: GO:0006812 - cation
                     transport [Evidence IEA]; GO_process: GO:0006874 -
                     cellular calcium ion homeostasis [Evidence IMP] [PMID
                     7507493]; GO_process: GO:0006811 - ion transport [Evidence
                     IEA]; GO_process: GO:0008152 - metabolic process [Evidence
                     IEA]; GO_process: GO:0055085 - transmembrane transport
                     [Evidence IMP] [PMID 7507493]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="calcium-transporting ATPase PMC1"
                     /protein_id="XP_018733565.1"
                     /db_xref="GeneID:30035954"
                     /translation="MAAIATQEGKDWSADAKKILEEHREAEFEKKLPIGGGDVGFRYS
                     PDQLNSLVDPKNAFVLREMGGIEGLAGGLGVDLNTGLTDQQATDSTRLDVYGRNVLPE
                     RKTKSLLKLMWIALQDKVLIILSVAAVVSLALGIYETVGEPPEYDDQGHKLPKVDWVE
                     GVAILVAVVIVVTVGAVNDWQKERQFAKLNKKKEDRKVKAIRNGKPSEISVYDVVVGD
                     ILLVEPGEMIPTDGILVNGYNIKCDESSASGESDTMKKHPAKEVVDAIDHKSQGLNPQ
                     SKELDAFMLSGAKVLEGTGQFLTIAVGEKSLHGRTMMSLQDEPEATPLQEKLNNIAEG
                     IAKLGFAAAIVLFVALMIRFFVQLPGSVKTPSQKGEEFMTIFITAVTIVVVAVPEGLP
                     LAVTLALAFATTRMVKDNNLVRVLKSCETMGGATTICSDKTGTLTQNRMSVVAATVGF
                     KSCEASIDGPADDQEVPVGDKSLEKSHDKNYDTASEDVLSPSQLVGILPETQFTTLLD
                     SIALNSSAFEDNSPEATEPFLGSKTETALLGFARNYMNLGELLKYRQAADIVQVFPFD
                     SAKKFMATIVRTSSGSYQVLLKGASEVVLSRCTQILDTDSFTNTNLTAEHLEFINNQI
                     NLYASKSLRTIGLVYKDLPADWSPDAPYALEENTLFKDMTFLTLVGIKDPLRPGVKQA
                     VADCKTAGVVVRMVTGDNINTARAIALDCGILTSANNEDEIVMEGPEFRKLNPFELNS
                     VVPKLRVLARSSPQDKRKLVKFLKSLDETVAVTGDGTNDAPALKLADIGFSMGIAGTE
                     VAKEASDVILMDDNFGSIVKAIKWGRTVNDAVKKFLQFQLTVNVTAVLLTFISAVADS
                     DDTSVLTAVQLLWVNLIMDTFAALALATDPPSDSVLHRKPDNRKASLITVTMWKMILG
                     QAIFQLIVTFVLHFAGSQIFNVDTSVGRNKEQLSAMVFNTFVWLQFFNMFVNRRLDNH
                     QNIFEGVHRNIFFILIAAIIGGMQIVIMFVGGAAFSVVKQTGAMWGTALICGMISIPA
                     GVILRLVPDEWVAKLYPARAVNWAMSLLPRKKSSKGPEIIVDEESTMGDPQQYVWPAG
                     IEQVRRELVFLKTVRGGRVLQLNFKPKSIYNSWKEALTPSSASTNSINSPHSPSSTLA
                     PNSYFTDYHSNSNNGGNFLSVPGRRKGSNIAALAVVPAVVGGAIGGWSPELSTNPPPP
                     SSPDSPKNKK"
     gene            complement(<563746..>564084)
                     /locus_tag="AWJ20_3885"
                     /db_xref="GeneID:30035955"
     mRNA            complement(<563746..>564084)
                     /locus_tag="AWJ20_3885"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880923.1"
                     /db_xref="GeneID:30035955"
     CDS             complement(563746..564084)
                     /locus_tag="AWJ20_3885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733566.1"
                     /db_xref="GeneID:30035955"
                     /translation="MVVAPPIVSQDFNTRTRLLSLTIRVVANARARVTANGRPSGTAT
                     TTIVTAVMKIVINSSPFCEGVLTDPGNWTKKRIIRATNKTIAAAKPSLAIPSAILFSF
                     SCKGVASGSS"
     gene            complement(<564754..>565350)
                     /locus_tag="AWJ20_3886"
                     /db_xref="GeneID:30035956"
     mRNA            complement(<564754..>565350)
                     /locus_tag="AWJ20_3886"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880924.1"
                     /db_xref="GeneID:30035956"
     CDS             complement(564754..565350)
                     /locus_tag="AWJ20_3886"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733567.1"
                     /db_xref="GeneID:30035956"
                     /translation="MNVNRTAVTLTVNWNWRNFLTASLTVRPHLMALTILPKLSSMRI
                     TSDASLATSVPAIPIEKPISASLSAGASLVPSPVTATVSSKDFRNLTSFRLSCGDDLA
                     RTRSLGTTLLSSKGLSFRNSGPSMTISSSLLAEVKIPQSRAMARAVLILSPVTIRTTT
                     PAVLQSATACLTPGRRGSLIPTRVKKVMSLNKVFSSSA"
     gene            complement(<567989..>569179)
                     /gene="YPS1"
                     /locus_tag="AWJ20_3887"
                     /db_xref="GeneID:30035957"
     mRNA            complement(<567989..>569179)
                     /gene="YPS1"
                     /locus_tag="AWJ20_3887"
                     /product="Yps1p"
                     /transcript_id="XM_018880925.1"
                     /db_xref="GeneID:30035957"
     CDS             complement(567989..569179)
                     /gene="YPS1"
                     /locus_tag="AWJ20_3887"
                     /note="Aspartic protease; member of the yapsin family of
                     proteases involved in cell wall growth and maintenance;
                     attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor; YPS1 has a
                     paralog, MKC7, that arose from the whole genome
                     duplication; GO_component: GO:0031225 - anchored component
                     of membrane [Evidence IEA]; GO_component: GO:0009277 -
                     fungal-type cell wall [Evidence IDA] [PMID 10383953];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_function: GO:0004190 - aspartic-type
                     endopeptidase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004190 - aspartic-type endopeptidase activity
                     [Evidence IDA] [PMID 8389368]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0008233
                     - peptidase activity [Evidence IEA]; GO_process:
                     GO:0031505 - fungal-type cell wall organization [Evidence
                     IGI] [PMID 16087741]; GO_process: GO:0016485 - protein
                     processing [Evidence IDA] [PMID 8626758]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Yps1p"
                     /protein_id="XP_018733568.1"
                     /db_xref="GeneID:30035957"
                     /translation="MFFQAPVAILTLATLCAAAPANHKGYLSAKTKLHHVSHGNFTKR
                     SSSYETPLGNDIFAYVISFEVGTPPQPIEAAIDTGSADLWIYTTESGQTFPFDTSSSS
                     TYQVLNDDFQINYVSGSASGDWAIDTVNVAGASLTNQQFGSVSVNQNMGCVFGIGYQA
                     TEYTDTKYTNIPQNLVDQGYTAHNAYSLYLDDIDAGEGAILFGAVDSDKYSGQLYTVP
                     ITSSSSLQVTVSGVTGDNGDSLGGEVTAVLDSGTSLTYLPQDTADSIANYLGATFDSS
                     LGAYLLSDVPTSSITYSFSGALVTVPGSELAIPSSDFGFSNTQPYTLSIFPNSESADI
                     TLLGQSFLRSAYVVYDLDSNQISIAQSSWNSDSSNIHVITDSVPGAVSAPGLKNPINH
                     LHHQ"
     gene            <570186..>570258
                     /locus_tag="AWJ20_3888"
                     /db_xref="GeneID:30035958"
     tRNA            <570186..>570258
                     /locus_tag="AWJ20_3888"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:30035958"
     gene            complement(<570577..>571596)
                     /locus_tag="AWJ20_3889"
                     /db_xref="GeneID:30035959"
     mRNA            complement(<570577..>571596)
                     /locus_tag="AWJ20_3889"
                     /product="carbonyl reductase (NADPH-dependent)"
                     /transcript_id="XM_018880926.1"
                     /db_xref="GeneID:30035959"
     CDS             complement(570577..571596)
                     /locus_tag="AWJ20_3889"
                     /note="Putative dihydrokaempferol 4-reductase;
                     GO_component: GO:0005575 - cellular_component [Evidence
                     ND]; GO_function: GO:0004090 - carbonyl reductase (NADPH)
                     activity [Evidence ISA] [PMID 19577617]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0050662 - coenzyme binding [Evidence IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0044237 -
                     cellular metabolic process [Evidence IEA]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence IEA]"
                     /codon_start=1
                     /product="carbonyl reductase (NADPH-dependent)"
                     /protein_id="XP_018733569.1"
                     /db_xref="GeneID:30035959"
                     /translation="MVKVLLTGGSGFIAAHVLDILIEKGYEVVTTVRSQQKGQKILDA
                     HPKVSKDKLSYVIVEDIAQPGAFDEAVKSEPGFDAVIHTASPFHFNVVDPVKDLLDPA
                     VNGTVGILKAIKAHAPTVKRVAITSSFASIINASQHPETYSEKDWNPVTWEQATDPKD
                     PATTYRGSKTFAEKAAWDFVEKEKPNFTITTLCPPLVLGPIVHYLNSLDAINTSNARV
                     RDFIQGKYKGQSELPPTGTFIWVDVRDLALSHVLAIEKSEAENQRFFITAGYFSNKKI
                     VEAIRKSHPELSDKLPLSSAKDDTPEGVYGYDNSKSIKLLGLKYSPFDAAIKDTVDSL
                     LEVGA"
     gene            <573547..>574593
                     /gene="ATG3"
                     /locus_tag="AWJ20_3890"
                     /db_xref="GeneID:30035961"
     mRNA            <573547..>574593
                     /gene="ATG3"
                     /locus_tag="AWJ20_3890"
                     /product="Atg3p"
                     /transcript_id="XM_018880928.1"
                     /db_xref="GeneID:30035961"
     CDS             573547..574593
                     /gene="ATG3"
                     /locus_tag="AWJ20_3890"
                     /inference="similar to AA sequence:KEGG_Orthology:K08343"
                     /note="E2-like enzyme; involved in autophagy and the
                     cytoplasm-to-vacuole targeting (Cvt) pathway; plays a role
                     in formation of Atg8p-phosphatidylethanolamine conjugates,
                     which are involved in membrane dynamics during autophagy
                     and Cvt; interaction with Atg8p is regulated by its
                     acetylation by Esa1p (catalytic subunit of NuA4 histone
                     acetyltransferase complex) while attenuation of Atg3
                     acetylation is mediated by histone deacetylase Rpd3p;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005829 - cytosol [Evidence
                     IDA] [PMID 11149920]; GO_function: GO:0019776 - Atg8
                     ligase activity [Evidence IMP,ISS] [PMID 11100732];
                     GO_process: GO:0006501 - C-terminal protein lipidation
                     [Evidence IMP] [PMID 11100732]; GO_process: GO:0006501 -
                     C-terminal protein lipidation [Evidence IDA,IMP] [PMID
                     15277523]; GO_process: GO:0032258 - CVT pathway [Evidence
                     IMP] [PMID 9023185]; GO_process: GO:0000045 - autophagic
                     vacuole assembly [Evidence IMP] [PMID 11149920];
                     GO_process: GO:0006914 - autophagy [Evidence IEA];
                     GO_process: GO:0044805 - late nucleophagy [Evidence IMP]
                     [PMID 22768199]; GO_process: GO:0000422 - mitochondrion
                     degradation [Evidence IMP] [PMID 19793921]; GO_process:
                     GO:0034727 - piecemeal microautophagy of nucleus [Evidence
                     IMP] [PMID 18701704]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Atg3p"
                     /protein_id="XP_018733570.1"
                     /db_xref="GeneID:30035961"
                     /translation="MLRSTLSSFRDWREYLTPAYHVSSFKETGQITPEEFVEAGDYLV
                     YKFPTWSWAGAPASKRRDFLPEDKQVLVTKHVPSHLRAGAFTDGAGDELDVIVDGADG
                     GDGDDGWVSTAGSNHGSASLKSGSSKVIDREQTGSGPVTESDTASIEEIIDIDEFEEL
                     DEDDQIYRPDDGGDTSKSSGANNSTRSPNRTYNLFITYSTSYRVPKFYLSGFNADGNP
                     LSPNEMFEDIVVDYRDKTVTIEKAPFEEDLTLISVHPCRHANVMKILLDRAENRLRQK
                     QAVEHDELLKGISKVGLADSTVDDWEEIGSNEPPTTSELQQTAIRVDQYLVIFLKFIA
                     SVTPGIELDNTMVM"
     gene            <576039..>579665
                     /gene="PDS5"
                     /locus_tag="AWJ20_3891"
                     /db_xref="GeneID:30035962"
     mRNA            <576039..>579665
                     /gene="PDS5"
                     /locus_tag="AWJ20_3891"
                     /product="Pds5p"
                     /transcript_id="XM_018880929.1"
                     /db_xref="GeneID:30035962"
     CDS             576039..579665
                     /gene="PDS5"
                     /locus_tag="AWJ20_3891"
                     /inference="similar to AA sequence:KEGG_Orthology:K11267"
                     /note="Protein involved in sister chromatid condensation
                     and cohesion; colocalizes with cohesin on chromosomes, may
                     function as a protein-protein interaction scaffold; also
                     required during meiosis; relocalizes to the cytosol in
                     response to hypoxia; GO_component: GO:0000794 - condensed
                     nuclear chromosome [Evidence IDA] [PMID 11062262];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     22932476]; GO_component: GO:0000798 - nuclear cohesin
                     complex [Evidence IDA] [PMID 22901742]; GO_component:
                     GO:0034990 - nuclear mitotic cohesin complex [Evidence
                     IDA] [PMID 22912589]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 22932476]; GO_function:
                     GO:0005198 - structural molecule activity [Evidence ISS]
                     [PMID 11137006]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0051301 - cell division
                     [Evidence IEA]; GO_process: GO:0006302 - double-strand
                     break repair [Evidence IMP] [PMID 11448778]; GO_process:
                     GO:0006302 - double-strand break repair [Evidence IMP]
                     [PMID 19736318]; GO_process: GO:0007126 - meiotic nuclear
                     division [Evidence IMP] [PMID 15819623]; GO_process:
                     GO:0007076 - mitotic chromosome condensation [Evidence
                     IMP] [PMID 11062262]; GO_process: GO:0007067 - mitotic
                     nuclear division [Evidence IEA]; GO_process: GO:0007064 -
                     mitotic sister chromatid cohesion [Evidence IMP] [PMID
                     11062262]; GO_process: GO:0007064 - mitotic sister
                     chromatid cohesion [Evidence IMP] [PMID 14623866];
                     GO_process: GO:0007129 - synapsis [Evidence IMP] [PMID
                     19736318]"
                     /codon_start=1
                     /product="Pds5p"
                     /protein_id="XP_018733571.1"
                     /db_xref="GeneID:30035962"
                     /translation="MIESIFNIFYDVVQKEQIDGLEFLLTAILSQLINELETPPRPIT
                     KIVLSHLLRGEPQTNKDQEEEDGETNLPLAKKKKKPVAGRNKNDDQGNTVISFVSRGY
                     NVSKTVCMDNIDIMTRVVNQYVADILNPILLHTSNNSSSTGSEDLTEDIEKLGNLVIA
                     VWKAVPELLVNVLGQLEQNMSIENTALRYMSTRVIGEIICFEASRINFITEYNAIFKT
                     WIGRYRDVSPKIRINWANTVPNFVKNQTNHTIVLESVIPFLGLLEDPDEKVRIAVCKA
                     LANVDIDTIATTYATVVEQPLAALADRLRDKKSLVRLAAFQAVGKIYDEAYEQIAAGN
                     LQISDVSSWIPSHILGLLYVNDLEINEHLDWVLFDYIYPFEQLSGSDSEEAALARARR
                     LLTIVKALNEESFKAFTAISSRQVAVARYLNAYLEFCKQYHDAAGITRSGLKKSRQSN
                     GGNENSNENPSSPANRDELSNKINSLIKWVASVYPDSEKVHDHLTAFFKSNDRQAFKL
                     FGICINPDSDYKSVYDSYHSLMDRLSKSSSLNSIEPTIKSILYRSAFILFNKTNVSAI
                     INISRSATAQDSVNLKDVSYIILKEIAAIQPGLIKSQSQDISLIIENASPGDKGLVDT
                     LKTARLLFGKFPDLVPSAPAVWRSLLNIAKTGSIKEAKHATNVLDFAPKKNTLLTKLV
                     EGLDVILSGPYEDVPENFSTVLSCIAQLYYHNPQVIEPYSGLVISFLLRHVLLSNKAR
                     PAKDDDPDWVDDSEVNRGSLIERIEGPTSLEATGKLDEHLQRKLLALRIMVNRARSPY
                     LDEDSADEVAKPILNLLMTLLVHNGELNTKDEDTPPHYKSRLRLEACVKILKLSQTGH
                     CLKRIGPAELNVLGVLIRDSQLQVRDRFILKLTTLLSDGSIPERFLCLVFFVAGESNK
                     MLSNYCIRWIKARAARQVKSNSSSTALENSFVRFLHVLAHSGTGEEYEEGEDDNEQLL
                     TSLSRAAKYIIFFLKLIATESNISLLLYLSQRIKEYKDVVSQDSDSESSSSGLYTVAD
                     LAQICVLEMKKTRGWVPDPWPGKISLPADSFEPIESTEEAQRVFRAVYIPDNIDAQLR
                     ESISKEFHHHAKVKPEPTEASNGRGTSAPKKRTSQGSSSSSVKTKKPKAKAATKFKSL
                     TRASEESVAPRRSSRVATKKVNYMVENSDNEDEENEEEEEESNSEEDEEEEGSDDGND
                     TDQD"
     gene            complement(<579889..>580893)
                     /gene="RCO1"
                     /locus_tag="AWJ20_3892"
                     /db_xref="GeneID:30035963"
     mRNA            complement(<579889..>580893)
                     /gene="RCO1"
                     /locus_tag="AWJ20_3892"
                     /product="Rco1p"
                     /transcript_id="XM_018880930.1"
                     /db_xref="GeneID:30035963"
     CDS             complement(579889..580893)
                     /gene="RCO1"
                     /locus_tag="AWJ20_3892"
                     /note="Essential component of the Rpd3S histone
                     deacetylase complex; interacts with Eaf3p; GO_component:
                     GO:0032221 - Rpd3S complex [Evidence IDA] [PMID 16286007];
                     GO_component: GO:0032221 - Rpd3S complex [Evidence IDA]
                     [PMID 16286008]; GO_component: GO:0000118 - histone
                     deacetylase complex [Evidence IDA] [PMID 16286008];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0008270
                     - zinc ion binding [Evidence IEA]; GO_process: GO:0016568
                     - chromatin modification [Evidence IEA]; GO_process:
                     GO:0016575 - histone deacetylation [Evidence IMP] [PMID
                     16286007]; GO_process: GO:0060195 - negative regulation of
                     antisense RNA transcription [Evidence IMP] [PMID
                     21248844]; GO_process: GO:0030174 - regulation of
                     DNA-dependent DNA replication initiation [Evidence IMP]
                     [PMID 19417103]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006368 - transcription elongation from RNA polymerase
                     II promoter [Evidence IGI] [PMID 19948887]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0061587 - transfer RNA gene-mediated
                     silencing [Evidence IMP] [PMID 23707796]"
                     /codon_start=1
                     /product="Rco1p"
                     /protein_id="XP_018733572.1"
                     /db_xref="GeneID:30035963"
                     /translation="MNQLGEYEDEIPKVNKPKATSKDENDPLKLLDKNGRPRMCYRCN
                     ESALRGTMVSCDVCPLNWHVDCLPSPTWTIGSRWKCPNHADQATKLPRRPRKYKVVDT
                     VLQRGFKNDGNVEVLDSSDEEEEGFVQDIPFFDNYDTRIGVASRINKGSEKTFLSNGV
                     LYRLPSRGIKLDFIEAVHDSYDEPYPDSIRSDILVALDELATKSLDVQQAVRNLAYLQ
                     SDGDPSVKVAIGKENINVLVSAALEELPDSNPAPQGPSVYIKPDTGSPSPPRHTNGRS
                     SARSSLAGSVTDSDRDALTSNSSVDDEVLDSERDQLRIIKRLMQIKGKDKLVKFLLEK
                     "
     gene            complement(<583659..>585271)
                     /gene="MAP2"
                     /locus_tag="AWJ20_3893"
                     /db_xref="GeneID:30035964"
     mRNA            complement(join(<583659..584782,585259..>585271))
                     /gene="MAP2"
                     /locus_tag="AWJ20_3893"
                     /product="Map2p"
                     /transcript_id="XM_018880931.1"
                     /db_xref="GeneID:30035964"
     CDS             complement(join(583659..584782,585259..585271))
                     /gene="MAP2"
                     /locus_tag="AWJ20_3893"
                     /note="Methionine aminopeptidase; catalyzes the
                     cotranslational removal of N-terminal methionine from
                     nascent polypeptides; function is partially redundant with
                     that of Map1p; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0004177 - aminopeptidase activity [Evidence IEA,IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA,IEA]; GO_function: GO:0070006 -
                     metalloaminopeptidase activity [Evidence IEA];
                     GO_function: GO:0070006 - metalloaminopeptidase activity
                     [Evidence IGI,ISA] [PMID 8618900]; GO_function: GO:0008235
                     - metalloexopeptidase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_process: GO:0070084 - protein initiator
                     methionine removal [Evidence IEA]; GO_process: GO:0035551
                     - protein initiator methionine removal involved in protein
                     maturation [Evidence IMP] [PMID 11811952]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Map2p"
                     /protein_id="XP_018733573.1"
                     /db_xref="GeneID:30035964"
                     /translation="MSTEPDYSLSNSDVVTKYKTAGDISAKVLANIKALAVEGAKIID
                     LTTEGDRQLLEETSKIYKGKKDIIKGIAFPTSVSPNNVVAHLSPLPTDKEAEITLKAG
                     DVVKITLGAQVDGFASIVGDTVVVGGGEVSGPVADAIAAAWYATEAAIRTIKPGNKNW
                     DVTKIVDKVTSEYGVKALEGMLSNEQSRNVVDGKKRIILNPSESQRREFETFTFEEGE
                     VYGVDILVSTGDGKSRADETPTTVYKKADITYQLKLRTSRATFSEVQKKAGSFPFSLR
                     SLDDAKKARMGLQECQNHGLIIPYEVFYEKEGQTVVQFFTTIALTKTGTIKFAGPVTP
                     DFAKIKTDKKVTDESVLDVLSKPLKASKKNKKKAADAAAAPASA"
     gene            <597377..>598729
                     /gene="ARG7"
                     /locus_tag="AWJ20_3894"
                     /db_xref="GeneID:30035965"
     mRNA            <597377..>598729
                     /gene="ARG7"
                     /locus_tag="AWJ20_3894"
                     /product="glutamate N-acetyltransferase"
                     /transcript_id="XM_018880932.1"
                     /db_xref="GeneID:30035965"
     CDS             597377..598729
                     /gene="ARG7"
                     /locus_tag="AWJ20_3894"
                     /inference="similar to AA sequence:KEGG_Orthology:K00620"
                     /note="Mitochondrial ornithine acetyltransferase;
                     catalyzes the fifth step in arginine biosynthesis; also
                     possesses acetylglutamate synthase activity, regenerates
                     acetylglutamate while forming ornithine; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IEA,IEA];
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IDA] [PMID 205532]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0004042 - acetyl-CoA:L-glutamate N-acetyltransferase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004042 -
                     acetyl-CoA:L-glutamate N-acetyltransferase activity
                     [Evidence IDA,IGI] [PMID 9428669]; GO_function: GO:0003824
                     - catalytic activity [Evidence IEA]; GO_function:
                     GO:0004358 - glutamate N-acetyltransferase activity
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0004358 -
                     glutamate N-acetyltransferase activity [Evidence IDA]
                     [PMID 9428669]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016746 -
                     transferase activity, transferring acyl groups [Evidence
                     IEA]; GO_process: GO:0006526 - arginine biosynthetic
                     process [Evidence IEA,IEA,IEA,IEA]; GO_process: GO:0006526
                     - arginine biosynthetic process [Evidence TAS] [PMID
                     12603335]; GO_process: GO:0008652 - cellular amino acid
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0006592 - ornithine biosynthetic process [Evidence IDA]
                     [PMID 9428669]"
                     /codon_start=1
                     /product="glutamate N-acetyltransferase"
                     /protein_id="XP_018733574.1"
                     /db_xref="GeneID:30035965"
                     /translation="MLSAVRSGRLIQRLAVGGRGPRQFSTSTVALVADKSKYVPSSGI
                     YPQGYKVGAIHCGVKKNAEALDLSVLVSETPCSGAAVFTTNIFQAAPVQVSKKVLSST
                     KGTGIRSIIVNSGCANAVTGEGGLKDAEAMVSTTDRVVGVTSGPASLVMSTGVIGQRL
                     PIDKILNGIPSLIESNLGTDHNAWVTCARGICTTDTFPKLTSKEFSIGSNTYRIAGLA
                     KGAGMIHPNMATLLGFFVTDAPVSQDALHDALKYATDRSFNSISVDGDMSTNDTIAAL
                     ANGAAGGPVITKDSDSYEVLRSVITEFAEELAQLVVRDGEGATKFVTIKVEDALNFAD
                     AKQVASSIATSSLVKTALYGKDANWGRILCATGYAGVPVEPFKTSVSFIPTDGTAELK
                     LLVNGEPEQVDEERASEILALEDLEIKVSLGTGGGASAKFWTCDLSHEYVTINGDYRS
                     "
     gene            complement(<597652..>598059)
                     /locus_tag="AWJ20_3895"
                     /db_xref="GeneID:30035966"
     mRNA            complement(<597652..>598059)
                     /locus_tag="AWJ20_3895"
                     /product="Ecm40p"
                     /transcript_id="XM_018880933.1"
                     /db_xref="GeneID:30035966"
     CDS             complement(597652..598059)
                     /locus_tag="AWJ20_3895"
                     /codon_start=1
                     /product="Ecm40p"
                     /protein_id="XP_018733575.1"
                     /db_xref="GeneID:30035966"
                     /translation="MLGWIIPAPLARPAMRYVLDPMENSLDVSLGNVSVVQMPRAQVT
                     HALWSVPRFDSMSDGMPFRILSIGNLWPITPVDMTNEAGPDVTPTTLSVVETMASASF
                     KPPSPVTALAQPLLTIIDRIPVPLVLDRTFLET"
     gene            complement(<602256..>604001)
                     /locus_tag="AWJ20_3896"
                     /db_xref="GeneID:30035967"
     mRNA            complement(<602256..>604001)
                     /locus_tag="AWJ20_3896"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880934.1"
                     /db_xref="GeneID:30035967"
     CDS             complement(602256..604001)
                     /locus_tag="AWJ20_3896"
                     /inference="similar to AA sequence:KEGG_Orthology:K15029"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733576.1"
                     /db_xref="GeneID:30035967"
                     /translation="MEDYEYDDFEAGNETIAVGEHVYDEAALLRQQEALMEAARKAAY
                     VPEAIKEFILYFQKCLHEKNVYELLSCYDNSFRKLTEKFYKNLPWPSPELAVAPIVNN
                     DQTFLLFYKELYYRHLYAKGQPTIEQRLDSYHNYCTLFDFIINSETPTDIELPTQWCW
                     DMIDEFIYQFNSFSIFRSRLIKKGNASQADLELLEKNVGVWGAYPVLNVLYSLAGKAN
                     ITAQLKATKNGQDATQVAGPFGSKPLYNTLGYFSLIGLLRVHTLLGDYALALKTLEDV
                     QLNKRALLSRVTGAHYTTYYYVGFCYLMLRRYADAIKSFSHILVFISRTKNINRNAQF
                     DNVNKKSDQMYALLAICVALCPTRLDDIIHTGMREKYGEQLSKMNRGGPDALKTFEEL
                     FVFAAPKFISPTPPDFEHPEYNVEPLQHHLKIFLETVKTANLGYTLKNYLNLYATMDI
                     RKLSGFLETDVELLRSALVSFKIKNKQTKWTEGALLDGESVNVSEIDIALDNDLIHIA
                     ESKDGRKFADWFIRNTLKNYTAQEFIANPDSKQDQQHDKSKKQHNRPKKDTNNTKKDS
                     TPAPSTSSSAPVAAK"
     gene            complement(<605282..>605665)
                     /gene="SNU13"
                     /locus_tag="AWJ20_3897"
                     /db_xref="GeneID:30035968"
     mRNA            complement(<605282..>605665)
                     /gene="SNU13"
                     /locus_tag="AWJ20_3897"
                     /product="RNA binding protein SNU13"
                     /transcript_id="XM_018880935.1"
                     /db_xref="GeneID:30035968"
     CDS             complement(605282..605665)
                     /gene="SNU13"
                     /locus_tag="AWJ20_3897"
                     /inference="similar to AA sequence:KEGG_Orthology:K12845"
                     /note="RNA binding protein; part of U3 snoRNP involved in
                     rRNA processing, part of U4/U6-U5 tri-snRNP involved in
                     mRNA splicing, similar to human 15.5K protein;
                     GO_component: GO:0046540 - U4/U6 x U5 tri-snRNP complex
                     [Evidence IDA] [PMID 10377396]; GO_component: GO:0046540 -
                     U4/U6 x U5 tri-snRNP complex [Evidence IDA] [PMID
                     10449419]; GO_component: GO:0031428 - box C/D snoRNP
                     complex [Evidence IDA] [PMID 11081632]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA,IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA,IEA]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 12068309];
                     GO_component: GO:0005681 - spliceosomal complex [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA,IEA]; GO_function: GO:0003723 - RNA binding [Evidence
                     IMP,ISS] [PMID 14730029]; GO_function: GO:0003723 - RNA
                     binding [Evidence IDA] [PMID 17332014]; GO_function:
                     GO:0003723 - RNA binding [Evidence IPI] [PMID 17631273];
                     GO_process: GO:0008380 - RNA splicing [Evidence IEA];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IPI] [PMID 10377396]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IMP] [PMID
                     11720284]; GO_process: GO:0000398 - mRNA splicing, via
                     spliceosome [Evidence IMP] [PMID 14730029]; GO_process:
                     GO:0000462 - maturation of SSU-rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 14730029]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="RNA binding protein SNU13"
                     /protein_id="XP_018733577.1"
                     /db_xref="GeneID:30035968"
                     /translation="MSTNADPRAFPLASSDVTQQILDIVQQATHLRQLKKGANEATKT
                     LNRGISEFIVMAADASPIEIVLHLPLLCEDKNVPYVFVPSKIALGRACGVSRPVIAAS
                     VTSNDASQLRDQINGIKDVIERLLI"
     gene            <606664..>608376
                     /locus_tag="AWJ20_3898"
                     /db_xref="GeneID:30035969"
     mRNA            <606664..>608376
                     /locus_tag="AWJ20_3898"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880936.1"
                     /db_xref="GeneID:30035969"
     CDS             606664..608376
                     /locus_tag="AWJ20_3898"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733578.1"
                     /db_xref="GeneID:30035969"
                     /translation="MDSSARLTAYTIRYVLSPREYRKLVARLNTNVTRILPAPEKIDA
                     SAVRSGDGVQSIVRSQSRLFAASYGLLGLINAFILKRRGLNIPALRIATSLTAISGIY
                     KVLYRVLTLLLQRTGILPRHGLSAKTTGSSTKSRVDSSPSPGTTDDPESTCSDAGYLD
                     NSYKITKLLVRAGYFTKRTLKKTKHLPPLLPALLSGLVAGSAFALFPESAQGYAAIYL
                     STRTLEFVYNYLDDMGYLEFKPRILKSWAIFPFAFSQLFYTFIFHPDACPNIFRRIML
                     RLSDGYIPTKPTGYPIDRPWPNPDQVVDGIATIARARYPKFVSPILFPNLDTTVPGLE
                     SAEPVLSLAHPAMSTLTGALSHPTQPSEFRTYTELVLSKYSSIYKYVFGAYVVLGLLK
                     WRAHSKASSKTSEKNKLSSTDKASKKAAPSLPGILLSSVANTARTTTFIVMTAASSWY
                     GIGLSQQVLNNKFIPVLRFRIIGFLAGLWAFADQVNGRARYMFAVRLALRSQWNVLSK
                     DRRYAPLLKNGAAALFALSFAVLMAIFDLSPKSIPGPSLRKTLNWIKTNQYTDVTAEK
                     EKDI"
     gene            <613092..>614648
                     /gene="APE1"
                     /locus_tag="AWJ20_3899"
                     /db_xref="GeneID:30035970"
     mRNA            <613092..>614648
                     /gene="APE1"
                     /locus_tag="AWJ20_3899"
                     /product="Ape1p"
                     /transcript_id="XM_018880937.1"
                     /db_xref="GeneID:30035970"
     CDS             613092..614648
                     /gene="APE1"
                     /locus_tag="AWJ20_3899"
                     /inference="similar to AA sequence:KEGG_Orthology:K01268"
                     /note="Vacuolar aminopeptidase yscI; zinc
                     metalloproteinase that belongs to the peptidase family
                     M18; often used as a marker protein in studies of
                     autophagy and cytosol to vacuole targeting (CVT) pathway;
                     protein increases in abundance and relative distribution
                     to cytoplasmic foci increases upon DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0000324 - fungal-type vacuole
                     [Evidence IDA] [PMID 1400574]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA,IEA]; GO_function: GO:0004177 -
                     aminopeptidase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0070006 - metalloaminopeptidase
                     activity [Evidence IDA] [PMID 3882418]; GO_function:
                     GO:0008237 - metallopeptidase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0006508 - proteolysis [Evidence
                     IEA,IEA]; GO_process: GO:0007039 - vacuolar protein
                     catabolic process [Evidence ISS] [PMID 2651436];
                     GO_process: GO:0007039 - vacuolar protein catabolic
                     process [Evidence ISS] [PMID 2689224]"
                     /codon_start=1
                     /product="Ape1p"
                     /protein_id="XP_018733579.1"
                     /db_xref="GeneID:30035970"
                     /translation="MTSFRANPAFKNARQRKASSPESFEIVDSVSTNGNGSSESEKAT
                     IRGEFDPKLSSTQYTDLFLDFMNTSPTTYHAVNSVAEVLEAQGFVYLSERESWEDKIT
                     KSNRFYTTRNGSSLLAFVVGKDWAPGKGAAIIGSHIDALTGKVKPISKKTPVEGYEQI
                     GTAPYSGAFNSTWWDRDLGIGGRIITRSKDTKKIESKLVRIPYPVARIPTLAPHFGAV
                     ASGPFNPETQMTPIIGLIGDEDPELVATADEKRSPLIGKHSLRLLRALSKHSGIPVGD
                     FLQLDLEVYDTHPGTVGGLDKEFVFCPRIDDKLCSFAAVYGLLESLEKVDDNSSLSFV
                     ALYDDEEIGSLLRQGAESNLLEGTIDRLLALHGSSDEELKRLTYANSFLISADVIHAV
                     NPNFDNVYLEHHKPKLNVGVTVSFDPNGHMTTDAVSTAFVEEIARRTDNVLQAFQIRN
                     DSRSGGTIGPKLSSKTGLRAIDMGIPQLSMHSIRATTGSKDVYLGVKFFKAFFEKWEE
                     VDVLFKLGDL"
     gene            complement(<614915..>616768)
                     /gene="AMF1"
                     /locus_tag="AWJ20_3900"
                     /db_xref="GeneID:30035973"
     mRNA            complement(<614915..>616768)
                     /gene="AMF1"
                     /locus_tag="AWJ20_3900"
                     /product="Amf1p"
                     /transcript_id="XM_018880940.1"
                     /db_xref="GeneID:30035973"
     CDS             complement(614915..616768)
                     /gene="AMF1"
                     /locus_tag="AWJ20_3900"
                     /note="Putative paralog of ATR1; but not required for
                     boron tolerance; member of the DHA2 family of drug:H+
                     antiporters; YOR378W is not an essential gene;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Amf1p"
                     /protein_id="XP_018733580.1"
                     /db_xref="GeneID:30035973"
                     /translation="MTQLLEKKNGDVESLLQKEAASLDKTGSTGSGVESETQFDHQKT
                     SKELVGGDGGGLENGLDHRLEHGMDSNLDSDPHGLDHEPDGGDSSEGGDEGSNGPESH
                     RPNISYSREYLLILVIISAQLMTQASVAQGLSIGREIGLHFNTTDAGQLSWYVAGFSL
                     TAGTFIVSSGRLGEIYGHKNLFVIGYAWLFVFTLIAGISSYSNSSIFFSVCRGLQGLG
                     CAILLPNGLAIFGMLYPAGSRKNIVFALFGAVAPGGFVLGAIFSTLLAKHRWDFTFYV
                     GSIVCFLLTIAAYVIIPNYENKSNHDRQPFDILGALTGIGGLMLFNVAWNQGPVVGWS
                     DPYVYILLILGVLLFVAFGIVETRVSHPLVPVSTMKSSTILILTAVACGWACFGIWLY
                     YTWQLFTVLRQQTPLLAAVEMLPALFGGFLASGAAAFLFPRIPVSVLMAMALVGFCVP
                     SILLATNRVHETYWAASFVATVIAPFGKCFGDLPPAAWALPQTPLCSASQSGLDCGGS
                     NNCVFYVSNFVAGMDISFPAATILLSLSVPKESQGIAASLVATVVNYAISIGLGIAGT
                     VVRYTTPGTDEQSLLNAVRYSAYLGIGLSSLGLIFALIAVWQDRKNLSRPH"
     gene            <619297..>620592
                     /gene="DAL5"
                     /locus_tag="AWJ20_3901"
                     /db_xref="GeneID:30035974"
     mRNA            <619297..>620592
                     /gene="DAL5"
                     /locus_tag="AWJ20_3901"
                     /product="allantoate permease"
                     /transcript_id="XM_018880941.1"
                     /db_xref="GeneID:30035974"
     CDS             619297..620592
                     /gene="DAL5"
                     /locus_tag="AWJ20_3901"
                     /note="Allantoate permease; ureidosuccinate permease; also
                     transports dipeptides, though with lower affinity than for
                     allantoate and ureidosuccinate; expression is constitutive
                     but sensitive to nitrogen catabolite repression;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0015124 -
                     allantoate transmembrane transporter activity [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0042936 -
                     dipeptide transporter activity [Evidence IMP] [PMID
                     16429164]; GO_function: GO:0042936 - dipeptide transporter
                     activity [Evidence IGI,IMP] [PMID 17693598]; GO_function:
                     GO:0005215 - transporter activity [Evidence IEA];
                     GO_process: GO:0015719 - allantoate transport [Evidence
                     IMP] [PMID 3275614]; GO_process: GO:0042938 - dipeptide
                     transport [Evidence IMP] [PMID 16429164]; GO_process:
                     GO:0042938 - dipeptide transport [Evidence IGI,IMP] [PMID
                     17693598]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0042939 -
                     tripeptide transport [Evidence IMP] [PMID 16429164]"
                     /codon_start=1
                     /product="allantoate permease"
                     /protein_id="XP_018733581.1"
                     /db_xref="GeneID:30035974"
                     /translation="MGFKEDLNLVGNDFSFLGMFFYVGFLAAELPTQWLAQRISFLGK
                     YLGINVTLWGVVLACHAACNSYAQVAVLRTLLGIFEACVAPILVLIICMWYKKQEQGK
                     RVACFYVMNSFTSVAAGLIAYGASFTKSSFASWRIFLLCMGLVTVVCGVLVFLYLPDS
                     PTKAKGFTDEEKLAVLLRIKDDQSGTQNNKLKGYQMLEAVSDPKVWLVVLSVMLISIP
                     NGALSIFSSLIVNSFGFSAQETLIVGVPGGLLSGFWLLAVQYYSDKTQNRTLMNLCYL
                     LPAILGLALMVGLENREKTTAMKTGLLISNYLSQTFGGTLALILSWNASNVAGHSKKV
                     LVNALTFIAFPLGNIIGTQTFQAKDAPMYMPGKAAILGCLSLQCFITVGWYFLNQFYN
                     NKKQRVLDEMDPEQRETMRRQMEFSDETDMRNPFFRYTK"
     gene            <623341..>626019
                     /gene="PAT1"
                     /locus_tag="AWJ20_3902"
                     /db_xref="GeneID:30035975"
     mRNA            <623341..>626019
                     /gene="PAT1"
                     /locus_tag="AWJ20_3902"
                     /product="Pat1p"
                     /transcript_id="XM_018880942.1"
                     /db_xref="GeneID:30035975"
     CDS             623341..626019
                     /gene="PAT1"
                     /locus_tag="AWJ20_3902"
                     /inference="similar to AA sequence:KEGG_Orthology:K12617"
                     /note="Deadenylation-dependent mRNA-decapping factor; also
                     required for faithful chromosome transmission, maintenance
                     of rDNA locus stability, and protection of mRNA 3'-UTRs
                     from trimming; associated with topoisomerase II; binds to
                     mRNAs under glucose starvation, most often in the 3' UTR;
                     functionally linked to Pab1p; forms cytoplasmic foci upon
                     DNA replication stress; phosphorylation by PKA inhibits P
                     body foci formation; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 23706738]; GO_component:
                     GO:0000932 - cytoplasmic mRNA processing body [Evidence
                     IEA]; GO_component: GO:0000932 - cytoplasmic mRNA
                     processing body [Evidence IDA,IMP] [PMID 12730603];
                     GO_component: GO:0010494 - cytoplasmic stress granule
                     [Evidence IDA] [PMID 23222640]; GO_component: GO:0022627 -
                     cytosolic small ribosomal subunit [Evidence IDA] [PMID
                     10779343]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 23706738]; GO_function: GO:0003723 - RNA
                     binding [Evidence IEA]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IDA] [PMID 23706738];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA,IDA]
                     [PMID 23222640]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0051301 - cell division
                     [Evidence IEA]; GO_process: GO:0033962 - cytoplasmic mRNA
                     processing body assembly [Evidence IGI,IMP] [PMID
                     18981231]; GO_process: GO:0000290 -
                     deadenylation-dependent decapping of nuclear-transcribed
                     mRNA [Evidence IMP,IPI] [PMID 10913177]; GO_process:
                     GO:0001731 - formation of translation preinitiation
                     complex [Evidence IMP] [PMID 20832728]; GO_process:
                     GO:0006397 - mRNA processing [Evidence IEA]; GO_process:
                     GO:0045947 - negative regulation of translational
                     initiation [Evidence IDA,IMP] [PMID 20832728]; GO_process:
                     GO:0006417 - regulation of translation [Evidence IEA];
                     GO_process: GO:0006446 - regulation of translational
                     initiation [Evidence IGI,IMP] [PMID 10779343]"
                     /codon_start=1
                     /product="Pat1p"
                     /protein_id="XP_018733582.1"
                     /db_xref="GeneID:30035975"
                     /translation="MSFFGVKTASSGGEAAVYEFDDTYDDNLGAALEETNDDFNDETF
                     GDFGDGVGNDFDFAGQTANVADTIDEEQFTFARNAGGKLGSVSGAGGAGGSGLNLLPS
                     TTGSVPSLQPIASLWGTAGVDKKPEPQPAAQQQQPQQPQQPKILSLEEVEAQMLGKSQ
                     QQLPHGVLPQPPQGFPPQGFPPQGFFPQGFPPQGFPPQGFPGQGFPQVPQGYPPQGFP
                     PQGYPLPQDPAVLMSSGYYGSGAGPTPGQPGLGQPGQPGQPPHQQQIPGQQQLQQQQQ
                     QPQQQQQAQFQQPPAGQSVQADSAIKQIEGQLAQTSVQDQGQSQGQRPQGAHGQEANA
                     QNNAQGNAQTPYSLPQQVQQGQQPVVPLNQVINEDLAQSEAEHQRMFEKSRKIAEIVK
                     YNGLMSQWDKNFIMRIQLQQMVTADPYNEDFYYQVHSAIQARNNPQQPLNEFARTYLL
                     QRGQRGNGRFRRHNDNPLQRMQQQVQRAVAAAKEHPKKEQIAPEGALGKISVGGGKQP
                     RKALNVAGSASNIPSSPSTSSSAKVEALKKLTLTSSTSQSGTYTKKGLLRSIENVYTI
                     LLEIESVERSRPSEDFNDQQQQQHQQQAAEDVADSDSSPAATPASVVSYEERLQTWQD
                     KMQTLVDQLWNELQVLEPIDSANNQPFILMLSHDKGKKVIPRIFRHLSQKQRLTVLTR
                     IVAHIESLDVVKDGDYGSSGTLSAKTRESIELFSQTVLPPLVHLVSESSYDVVIGLLE
                     IMLNSSNMVHVSSTKIGLAFLTVLISRAELISQEESEAATPSAAATRDLANWQATFNT
                     LFTKVQGHLSSIFPPRNVDNSYVWHFLASLALAAKLEHQRIIVDEVREMIFGTMNEAK
                     ALPVELGVSKIANLNLFLNVMGLNATTTEITELSSQ"
     gene            <626975..>627202
                     /gene="ACP1"
                     /locus_tag="AWJ20_3903"
                     /db_xref="GeneID:30035976"
     mRNA            <626975..>627202
                     /gene="ACP1"
                     /locus_tag="AWJ20_3903"
                     /product="Acp1p"
                     /transcript_id="XM_018880943.1"
                     /db_xref="GeneID:30035976"
     CDS             626975..627202
                     /gene="ACP1"
                     /locus_tag="AWJ20_3903"
                     /inference="similar to AA sequence:KEGG_Orthology:K03955"
                     /note="Mitochondrial matrix acyl carrier protein; involved
                     in biosynthesis of octanoate, which is a precursor to
                     lipoic acid; activated by phosphopantetheinylation
                     catalyzed by Ppt2p; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0070469 - respiratory
                     chain [Evidence IEA]; GO_function: GO:0000036 - ACP
                     phosphopantetheine attachment site binding involved in
                     fatty acid biosynthetic process [Evidence ISS] [PMID
                     8394042]; GO_process: GO:0006633 - fatty acid biosynthetic
                     process [Evidence IEA,IEA,IEA]; GO_process: GO:0006631 -
                     fatty acid metabolic process [Evidence IEA]; GO_process:
                     GO:0006629 - lipid metabolic process [Evidence IEA];
                     GO_process: GO:0009107 - lipoate biosynthetic process
                     [Evidence IMP] [PMID 9187370]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]"
                     /codon_start=1
                     /product="Acp1p"
                     /protein_id="XP_018733583.1"
                     /db_xref="GeneID:30035976"
                     /translation="MARSIETNMLQIADPSKITPSANFSTDLGLDSLDVVDALFFIEE
                     EFNIEIPDHEADEIHTVAQAVDYILAQPDGK"
     gene            <629147..>630802
                     /gene="PCS60"
                     /locus_tag="AWJ20_3904"
                     /db_xref="GeneID:30035977"
     mRNA            <629147..>630802
                     /gene="PCS60"
                     /locus_tag="AWJ20_3904"
                     /product="Pcs60p"
                     /transcript_id="XM_018880944.1"
                     /db_xref="GeneID:30035977"
     CDS             629147..630802
                     /gene="PCS60"
                     /locus_tag="AWJ20_3904"
                     /note="Oxalyl-CoA synthetase; capable of catalyzing
                     conversion of oxalate to oxalyl-CoA; catalyzes first step
                     in pathway of oxalate degradation that functions to
                     protect yeast from inhibitory effects of oxalate;
                     peroxisomal protein that binds mRNA; localizes to both
                     peroxisomal peripheral membrane and matrix, expression is
                     highly inducible by oleic acid; similar to E. coli long
                     chain acyl-CoA synthetase; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005782 - peroxisomal
                     matrix [Evidence IEA]; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 8841414];
                     GO_component: GO:0005778 - peroxisomal membrane [Evidence
                     IEA]; GO_component: GO:0005778 - peroxisomal membrane
                     [Evidence IDA] [PMID 8841414]; GO_component: GO:0005777 -
                     peroxisome [Evidence IEA]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0016874
                     - ligase activity [Evidence IEA]; GO_function: GO:0003729
                     - mRNA binding [Evidence IDA] [PMID 20844764];
                     GO_function: GO:0050203 - oxalate-CoA ligase activity
                     [Evidence IDA,IMP] [PMID 24291261]; GO_process: GO:0008152
                     - metabolic process [Evidence IEA]; GO_process: GO:0033611
                     - oxalate catabolic process [Evidence IDA,IMP] [PMID
                     24291261]"
                     /codon_start=1
                     /product="Pcs60p"
                     /protein_id="XP_018733584.1"
                     /db_xref="GeneID:30035977"
                     /translation="MSTSSSTPSSPPVIHKSPWGEVPDLFVGNIAQFVRESPHINRKL
                     DKKILIDAKTNQAIRGRQLFNFTARLSWVLRTKYKIEYDDVVCLFAPNSVWTPIIHHG
                     VLSRGAILSPANIAYNPEELHYQIKTANAKLALVGDAHLETARKALKVGPNNCVKIVP
                     ISRLIKDIKFAKGVENPVPLEGDVAKDKIAYLCFSSGTSGTPKGVMTTHYNMTSNAQQ
                     QFYCFNKALLNGNNVYGAVLPMSHIFGLTKFVYSTLYVASTIVVFEKFDFPLLLSSIL
                     KYNINVLHVVPPILVLFAKSPLVDKYAIKGRLNHIFTGAAPAGKEIIALAEARTGAHI
                     SQGYGLTESSPVTHLYSYDEQAYDQNSIGWLIASCEARLVTDEGTDAAVGERGELWIR
                     GPNIMKGYLNNPAATAETLTSDGFLKTGDVAIRVADGQYYIVDRKKELIKSKGHQVAP
                     AELEALLLDHPDVVDVAVVGVHVSELGTELPRAFLVIREKTDPLEIKKWFDSKVARHK
                     RLWGGIVVLDAIPKSPSGKILRRLLRDRKDDKAIGFTLAEPKL"
     gene            complement(<631041..>632960)
                     /gene="DBP6"
                     /locus_tag="AWJ20_3905"
                     /db_xref="GeneID:30035978"
     mRNA            complement(<631041..>632960)
                     /gene="DBP6"
                     /locus_tag="AWJ20_3905"
                     /product="Dbp6p"
                     /transcript_id="XM_018880945.1"
                     /db_xref="GeneID:30035978"
     CDS             complement(631041..632960)
                     /gene="DBP6"
                     /locus_tag="AWJ20_3905"
                     /inference="similar to AA sequence:KEGG_Orthology:K14807"
                     /note="Essential protein involved in ribosome biogenesis;
                     putative ATP-dependent RNA helicase of the DEAD-box
                     protein family; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 9528757]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     15126390]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 17145778];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0004004 - ATP-dependent RNA helicase
                     activity [Evidence ISS] [PMID 10322435]; GO_function:
                     GO:0008026 - ATP-dependent helicase activity [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0004386 - helicase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0003676 - nucleic
                     acid binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006200
                     - ATP catabolic process [Evidence IEA]; GO_process:
                     GO:0000466 - maturation of 5.8S rRNA from tricistronic
                     rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 9528757]; GO_process: GO:0000463 - maturation
                     of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID 9528757];
                     GO_process: GO:0006364 - rRNA processing [Evidence IEA];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Dbp6p"
                     /protein_id="XP_018733585.1"
                     /db_xref="GeneID:30035978"
                     /translation="MFLATKRFDPNFTSQREEDDQPEPKKVKLDKELIKKDVVPSSLS
                     SENNPAKSNTPIETNSLDSSHVSSSKSVLEESDDSESEYEVDPKYSAVFKRFQDIASK
                     AAKNNVRTSRLADQEAISKDSENNQEEPDEEEIPEVNELVPLPQIARKKESSKKHKEP
                     PKWITEPIIIPLNASKPFAEYEKEHLLSARMVKVLQSLNYESAFAVQTGVCPVLLKDS
                     QSIAPDPLPDVLVNAYTGSGKTLAYGIPIVEALSKRVVPRIRALILLPTRPLIQQVRN
                     VLESLAKGTSLRVMICRTDRPFKEEQALISSHTPDILITTPGRLVDHIRNNTQGFSLN
                     HLQYLVVDEADRLLNQSFQEWVSVLVNALEAAKPKESLAKVWNRPPQKLIFSATLTRD
                     PGKLAALNITTTPTPRIFVLGEEPVVNNGHTNTTSGPSVHEDRQRIMMDYEFSLPEKL
                     QEHHIQVKSASNKPLVLLQLLINHSLHSDTLIFVKSNQAAARLARLIQLIDEELFHLN
                     LSVERCSGELELSQRRKMLKKFADGEIGILVCTDLIARGIDIASVKAVINYDLPVGKR
                     EYVHRVGRTARAGNSGAAWNLTVGSGERKFFNSITTSIFRTGEIESEVIKPSPDHNDG
                     YQKALSRLEQEVFAK"
     gene            <635645..>637453
                     /gene="MSS4"
                     /locus_tag="AWJ20_3906"
                     /db_xref="GeneID:30035979"
     mRNA            <635645..>637453
                     /gene="MSS4"
                     /locus_tag="AWJ20_3906"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018880946.1"
                     /db_xref="GeneID:30035979"
     CDS             635645..637453
                     /gene="MSS4"
                     /locus_tag="AWJ20_3906"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733586.1"
                     /db_xref="GeneID:30035979"
                     /translation="MGAFFFSNGDYLPSNGTHKVPRRPVLSDVHCGVSVPKYGACAQL
                     ENRHPARRSAFAYHKVLILECSDDSGVSVGSDETLNEPTVWKPVDIVAEQAYCEFAPI
                     DNDSDNSSEWSFEAGDEAAFTTRQIESAWSEENTEAIWSAPAASWALSDCPIEIDEND
                     PSPESHGDITLVESSLEASRKYLAESEEITPVNVAETPCAIADIPSSSSLIDSLVAEI
                     IAVATLYKDLPQLIVSGGLQAEPDSELPNTAPLAPSKSIAQTLSGDLVIQVEEVDKSK
                     TPLLLKRAKAKLTSFAGHAAPILKSTLMFNGVQTAAYATPLSSQEALTMENKNYRLDG
                     GAIIKAYSPIVYQDIRTLCGIDYHEFLDSFVLQSDLTKTKSPGKSGSDFLFTPNGKYI
                     IKTIKRKEHKVIANADFLADYYNHIKAHPSTQLPFYLGNYTLVADGKKTHFIIMKNLL
                     QKETDLIYDLKGSSHDRRAGPRKDNRGRVVFKDLDWTDKHEAISMSQKDRDKLLVQVS
                     KDVDFLKRHNIMDYSLLVGFQSDTRTCEQQPVIGMIDTLCPFSWRKRAETVSKSLFFG
                     SSAIDVVHPEKYGARFLNFVQSAVVPEPSRSVSTRY"
     gene            complement(<655603..>658500)
                     /gene="POL90"
                     /locus_tag="AWJ20_3907"
                     /db_xref="GeneID:30035980"
     mRNA            complement(<655603..>658500)
                     /gene="POL90"
                     /locus_tag="AWJ20_3907"
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 1"
                     /transcript_id="XM_018880947.1"
                     /db_xref="GeneID:30035980"
     CDS             complement(655603..658500)
                     /gene="POL90"
                     /locus_tag="AWJ20_3907"
                     /note="polyprotein of non-LTR retrotransposon Zorro 1 and
                     repeat region-related DNA"
                     /codon_start=1
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 1"
                     /protein_id="XP_018733587.1"
                     /db_xref="GeneID:30035980"
                     /translation="MSEDIHPVEYYKTLLPQIPELIIIAGDFNLHHPMWQSTEQVTRE
                     ANSWADWVNDNGLLLATVPNVPTHIFGNTIDLTFATPNITITPEKSEDVGSDHYLQKW
                     RIDTNPLDIELLQTYGGRYNYKRADWEKFEKVLDSRAALITIPKKLRGYSNRKSTHKV
                     ADRYATQLIGLLCDCLDEAVPKLKIVPRSKRWWTPELRQAKRDAVRARRRARSQPTEE
                     NRRLRQQANEEYASKILEAKTNTWNSYLASCRGTDIYDALKMIKPREPVPIMPALRLE
                     TGELAQTFEEQEEELYRGLFPQVKPSTRRLLKVVKTGQWKSLRMQEIEDAIRDQAPNK
                     APGPDGVKTVAIKRAWTVIRFRKLLKGLLQYCVRVGYHPKCFREGITVVIPKRKRDPA
                     LARSYRPITLLSTLGKVLEKIMQRRLTALTSGMLPVDQYGGRHGYSAVEAAHKLVHHA
                     EKRMKRDQVTSVLAIDIKGAFDHVHRDTLLNTMGGMGLPTAVQNWVYQFMRGRRTSLV
                     IDGKRTKERRIATGIPQGSPISPLLFLIYTSPLYPLIKSMGGKVIGFIDDITIYVSST
                     RYAENTAKLSNILARCHEWATSAHAFIDYGEKLGFMHIAKRVTPKGCRRLILPTGERI
                     QATSSLKLLGVTIDRQLKFEEHAKSVINKGQSALNVIRRLGGVTRGVTGATMRCLYKS
                     CVRSILEYASPIWYNRIRKGLKDAIQRIQNAALRSILGAYKPTAIVSLHRDAEISPIE
                     HRMLETEQYYLVRLHRDLHRYNPHRIRARKLYSGTMLGDRLDELYRTVEVTDIKKDRY
                     RLWKPPWASRDSEAISKASSQKKSIRKEIRSQCYQKWEIEYTQSPKGAFYRSFTAPRL
                     YSKKHANALRPFLYESPRGELSKLVQLRTGMGAMGSFFQRFRISNRRYDCRCGVEETV
                     EHILRDCPLTEQHRPILRDASRELDLPSLLDTRKGLKAVASFLKANPSLLS"
     gene            <661076..>661161
                     /locus_tag="AWJ20_3908"
                     /db_xref="GeneID:30035981"
     tRNA            <661076..>661161
                     /locus_tag="AWJ20_3908"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:30035981"
     gene            <664264..>665214
                     /locus_tag="AWJ20_3909"
                     /db_xref="GeneID:30035982"
     mRNA            <664264..>665214
                     /locus_tag="AWJ20_3909"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880948.1"
                     /db_xref="GeneID:30035982"
     CDS             664264..665214
                     /locus_tag="AWJ20_3909"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733588.1"
                     /db_xref="GeneID:30035982"
                     /translation="MRSTSYTLALLSLGLASAAPVPQVPGGGAAAGLGGLVAGLGPVT
                     NDLSNTVGDLKPAVASLEPAVEDLGADLGDASSSLSTRQVPGGGAAAGLGGLVAGLGP
                     VTNDLSNTVGDLKPAVASLQPAVEDLGADLGDASSSLSTRQVPGGGAAAGLGGLVAGL
                     GPVTNDLSNTVGDLKPAVASLQPAVEDLGADLGDASSSLSTRQVPGGGAAAGLGGLVA
                     GLGPVTNDLSNTVGDLKPAVASLEPAVEDLGADLGDASSSLSTRQVPGGGAAAGLGGL
                     VAGLGPVTNDLSNTVEDLKPAVASLEPAVEDLGADLGASS"
     gene            <665497..>668793
                     /gene="NUP85"
                     /locus_tag="AWJ20_3910"
                     /db_xref="GeneID:30035984"
     mRNA            <665497..>668793
                     /gene="NUP85"
                     /locus_tag="AWJ20_3910"
                     /product="Nup85p"
                     /transcript_id="XM_018880950.1"
                     /db_xref="GeneID:30035984"
     CDS             665497..668793
                     /gene="NUP85"
                     /locus_tag="AWJ20_3910"
                     /inference="similar to AA sequence:KEGG_Orthology:K14304"
                     /note="Subunit of the Nup84p subcomplex of the nuclear
                     pore complex (NPC); contributes to nucleocytoplasmic
                     transport and NPC biogenesis and is involved in
                     establishment of a normal nucleocytoplasmic concentration
                     gradient of the GTPase Gsp1p; also plays roles in several
                     processes that may require localization of genes or
                     chromosomes at the nuclear periphery, including
                     double-strand break repair, transcription and chromatin
                     silencing; homologous to human NUP85 aka NUP75;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031965 -
                     nuclear membrane [Evidence IEA]; GO_component: GO:0005643
                     - nuclear pore [Evidence IEA,IEA]; GO_component:
                     GO:0005643 - nuclear pore [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0031080 - nuclear pore outer ring
                     [Evidence IDA] [PMID 11823431]; GO_component: GO:0031080 -
                     nuclear pore outer ring [Evidence IDA] [PMID 18046406];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0017056 - structural constituent of
                     nuclear pore [Evidence IMP] [PMID 22331846]; GO_process:
                     GO:0006406 - mRNA export from nucleus [Evidence IMP] [PMID
                     8565072]; GO_process: GO:0006406 - mRNA export from
                     nucleus [Evidence IMP] [PMID 8816998]; GO_process:
                     GO:0051028 - mRNA transport [Evidence IEA]; GO_process:
                     GO:0031081 - nuclear pore distribution [Evidence IMP]
                     [PMID 8565072]; GO_process: GO:0031081 - nuclear pore
                     distribution [Evidence IMP] [PMID 8816998]; GO_process:
                     GO:0045893 - positive regulation of transcription,
                     DNA-templated [Evidence IDA] [PMID 15817685]; GO_process:
                     GO:0006606 - protein import into nucleus [Evidence IMP]
                     [PMID 12730220]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0000055 -
                     ribosomal large subunit export from nucleus [Evidence IMP]
                     [PMID 11071906]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Nup85p"
                     /protein_id="XP_018733589.1"
                     /db_xref="GeneID:30035984"
                     /translation="MDYNRLFQNKDRDAGDQESSSEPKPFSFNLGGDSTTGNALQNKP
                     SGVGFNGLFSKQPENSYIDAQPLETNKLPDIGMVEHSIFGASATGAPPSFGAQSTETK
                     SLFSNSSSSGSSQPPLFGGFGRSNNDQVSREQSSVVTNSSTQGNSIFGISTNNNNSSS
                     SQTPSLFNKNTGPTFTSTSLFGSGSHEASVGSSGFNIQKPLSFSATSSATSESTQAPK
                     SEKTEDLSSTLAGKNEGFKFGSGEKSGNSWSFSSTKANETTAGQKNDSRIGTGNTNIF
                     NSISTGTNDSIFGQNSTAITNTGSVALPAFNLKGSASQSASDNISSQTARPSLFASSN
                     SNEESRFGATDSGAPLAVPSIGLDLLSQVTSLDTNYPGRDTIESIDSGFLDYEPNMDS
                     NNLETSQPSVSEFSTAPEFTLEDAPIQNGGLEHWHNMNRTLKFTISTVGNGGVAWIDR
                     RNRDKQSIQNEPTGDIIQEEKKLFSANIPSQIPNSPGYIQFVKDCYNIVKECQDEIES
                     DSSGPVNVVCKHYFNLLYNRILESLNYVEDDTQMMDVSFIVYCFLVVYFEANVKSESE
                     PFAKAFSKWANTVDEGSSPEDAAEIMRMSPPTKHPLYWDFVHDRASRGLLEVCASTLQ
                     EANSKEMAADVRESIHYATQLLRSYPNEEGSEYKFHQWKRQCNIAHGHAQDIADPALR
                     IQLVRLFDILRGHKATILEQNSNSWFVALSALVMFNDPSRSRLKEYFDIVQAEIPIDS
                     LLKWESGCAAVISGDILVAIQKLESLDSCVATAVAQLCQMRGLLDDYGIVRINNEPSV
                     RDWLVLSHGQNCITSEIPELEKIGINILVDLDIPQSRATLAEYLPRYVAHDVEELEWV
                     LSTANELGLHDTERQIHRIAARNYAFNGCFLEAFFELDKAKDASALQALSWQLFEDSL
                     VFNEPAAEDLTIQAVLPNSGVELSPLVHEIMAPFAVLNEAFELLRSEKYIQAGGRILA
                     LLRFPYLPGRFVAPLLSMIISLLSHNKQPRSFTSTDLVLVMDTLDMWEKQATNTKDHV
                     DTSGYKEGLAIIERAVHTAKTEETLPLKNNDWRALLLSIPVEKIPDFIISTGRIVLAR
                     EVSRAYLSGL"
     gene            <670651..>672309
                     /locus_tag="AWJ20_3911"
                     /db_xref="GeneID:30035985"
     mRNA            <670651..>672309
                     /locus_tag="AWJ20_3911"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880951.1"
                     /db_xref="GeneID:30035985"
     CDS             670651..672309
                     /locus_tag="AWJ20_3911"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733590.1"
                     /db_xref="GeneID:30035985"
                     /translation="MKKLWDSLKSNARYQAIVIGSGLVGLLYVILTSGLSLMSIKALV
                     IALSYCYALIMALWLMGHGLVNVPRELWLRADVNVRLNNDYRHARSVCDAFADAQSSY
                     VDVAAEITSIARFKDGSQHLEWIDELVEEVETTAFTIHSSAIAGHPTVNVDRSLLNEQ
                     YLSTLAARYYKYRARMIRHRASWQKLLKDCSIAEDIVNASRDTTNKELIFRYGRTMLP
                     AKLARFYYVNINMYFVRTFAVLLAILSVAIIWSELVHGTVASLVNLVISVTYGVGQQL
                     VSSIILGYMCIASFASLARIRVFNIYGLVHKGSDLSSLLFYASYACRLTVPLSYNYLT
                     LIGSRESVFEEFLGKSINLTPLGKAFNDWLPRLILLPIIFTLFHVYDKVKDYFSFELG
                     FDDDDEIGALNSSVIEGKELVNRALSDPNFRFAIDGAAPDSLSGANRGSPALNSRSSN
                     EFGGIRASRDISRSSLLPTHNLSSSPSSRTFGGATSPRPWSSPQVNEFEEPTRLTESM
                     NNVRSFFGNISQRVQSGISNIRQGDSVPRWARLSQSEDQDSQIL"
     gene            complement(<672479..>673576)
                     /locus_tag="AWJ20_3912"
                     /db_xref="GeneID:30035986"
     mRNA            complement(<672479..>673576)
                     /locus_tag="AWJ20_3912"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880952.1"
                     /db_xref="GeneID:30035986"
     CDS             complement(672479..673576)
                     /locus_tag="AWJ20_3912"
                     /inference="similar to AA sequence:KEGG_Orthology:K13118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733591.1"
                     /db_xref="GeneID:30035986"
                     /translation="MNNGSERRLVKVERDGASSESHPASDSPAGELIEFKKWPQVESS
                     EGGKMRLVVQQAESESITTNQTDGYRLKRPEKVIAEDEYSESLSNIISRDYFGGMPPD
                     TSVTPSVSLDEYQAKYTSEDNDSFNSLLEAQIQEQREKFSWLWKSNKLDSGHVESTKR
                     IMDKQQARFITDRAFTESERATENLGLTDRRPTRLRSNVAKDAKNALMFAPEVIGEKN
                     NKRPAHEVKPKKISRENTRLDISHNAKSSHNLPAVHSAVDVITPPTVNSYGFVTENTY
                     SYEPPAQSRRDNIHDRILKNEAEKKRQKKEESIFSFNSRSGRITKTPVSSRGASGSQV
                     SGTPLSPAAARLMGRVKSTKMSGFDFTPKRK"
     gene            <673943..>675442
                     /gene="ESA1"
                     /locus_tag="AWJ20_3913"
                     /db_xref="GeneID:30035987"
     mRNA            <673943..>675442
                     /gene="ESA1"
                     /locus_tag="AWJ20_3913"
                     /product="NuA4 histone acetyltransferase complex catalytic
                     subunit ESA1"
                     /transcript_id="XM_018880953.1"
                     /db_xref="GeneID:30035987"
     CDS             673943..675442
                     /gene="ESA1"
                     /locus_tag="AWJ20_3913"
                     /inference="similar to AA sequence:KEGG_Orthology:K11304"
                     /note="Catalytic subunit of the histone acetyltransferase
                     complex (NuA4); acetylates four conserved internal lysines
                     of histone H4 N-terminal tail and can acetylate histone
                     H2A; required for cell cycle progression and
                     transcriptional silencing at the rDNA locus and regulation
                     of autophagy; GO_component: GO:0035267 - NuA4 histone
                     acetyltransferase complex [Evidence IPI] [PMID 10487762];
                     GO_component: GO:0035267 - NuA4 histone acetyltransferase
                     complex [Evidence IDA] [PMID 10911987]; GO_component:
                     GO:0035267 - NuA4 histone acetyltransferase complex
                     [Evidence IPI] [PMID 15485911]; GO_component: GO:0032777 -
                     Piccolo NuA4 histone acetyltransferase complex [Evidence
                     IDA] [PMID 12782659]; GO_component: GO:0000790 - nuclear
                     chromatin [Evidence IDA] [PMID 10911987]; GO_component:
                     GO:0005724 - nuclear telomeric heterochromatin [Evidence
                     IDA] [PMID 10911987]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_function: GO:0010485 - H4 histone
                     acetyltransferase activity [Evidence IDA] [PMID 12110674];
                     GO_function: GO:0004402 - histone acetyltransferase
                     activity [Evidence IEA]; GO_function: GO:0004402 - histone
                     acetyltransferase activity [Evidence IMP] [PMID 10487762];
                     GO_function: GO:0004402 - histone acetyltransferase
                     activity [Evidence IDA] [PMID 17274630]; GO_function:
                     GO:0034212 - peptide N-acetyltransferase activity
                     [Evidence IMP] [PMID 23050233]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0016747 - transferase activity, transferring acyl
                     groups other than amino-acyl groups [Evidence IEA];
                     GO_process: GO:0006281 - DNA repair [Evidence IMP] [PMID
                     12353039]; GO_process: GO:0006281 - DNA repair [Evidence
                     IDA] [PMID 16135807]; GO_process: GO:0006354 -
                     DNA-templated transcription, elongation [Evidence IDA,IMP]
                     [PMID 15949446]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IEA]; GO_process: GO:0000183 -
                     chromatin silencing at rDNA [Evidence IGI,IMP] [PMID
                     16436512]; GO_process: GO:0016573 - histone acetylation
                     [Evidence IDA] [PMID 10082517]; GO_process: GO:0016573 -
                     histone acetylation [Evidence IDA] [PMID 10487762];
                     GO_process: GO:0018394 - peptidyl-lysine acetylation
                     [Evidence IMP] [PMID 23050233]; GO_process: GO:0016239 -
                     positive regulation of macroautophagy [Evidence IMP] [PMID
                     22539722]; GO_process: GO:0032968 - positive regulation of
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IGI,IMP] [PMID 19822662]; GO_process: GO:0051726
                     - regulation of cell cycle [Evidence IMP] [PMID 10082517];
                     GO_process: GO:0034401 - regulation of transcription by
                     chromatin organization [Evidence IMP] [PMID 11867538];
                     GO_process: GO:0006357 - regulation of transcription from
                     RNA polymerase II promoter [Evidence IMP] [PMID 11036083];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA,IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="NuA4 histone acetyltransferase complex catalytic
                     subunit ESA1"
                     /protein_id="XP_018733592.1"
                     /db_xref="GeneID:30035987"
                     /translation="MTDGTPSRTASVSPGPGSGTNGEGTPAPTLPAPTITITSTQQVR
                     VGFKCYVEKNGEKRLAEILSTHVRKGNLEFYVHYEDFNKRLDEWVSESRIDLSQPVTL
                     PRPEKPKKSGSETPKAGPHNKVGKKSTKKTTKAAAAAAAAAARHSGVSTPKNKKIGAG
                     KENEEPVSTPGNADVMDLDDIKVNTQQDPDDFNREEEIEKLRTSGSMTQNAHEVARVR
                     NVSKIIMGENEIEPWYFSPYPIELTEEDQIYICEFSLSYFGSKKQFERFRSKSTLRHP
                     PGNEIYRDENVSFFEIDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTKRDE
                     MGHHLVGYFSKEKESAEGYNVACILTLPQYQRHGYGRVLIDFSYNLSKKEGKVGSPEK
                     PLSDLGLLSYRAYWADSIVELLIESGKNDTTIEEISSSTAMTTTDIIHTLQTLGMLKY
                     YKGQHIICLTEAVVEKYDRQKARKRIRIDPSKLLWKPPVFTAAQLRFAW"
     gene            complement(<675743..>676891)
                     /gene="RRD2"
                     /locus_tag="AWJ20_3914"
                     /db_xref="GeneID:30035988"
     mRNA            complement(<675743..>676891)
                     /gene="RRD2"
                     /locus_tag="AWJ20_3914"
                     /product="peptidylprolyl isomerase RRD2"
                     /transcript_id="XM_018880954.1"
                     /db_xref="GeneID:30035988"
     CDS             complement(675743..676891)
                     /gene="RRD2"
                     /locus_tag="AWJ20_3914"
                     /inference="similar to AA sequence:KEGG_Orthology:K17605"
                     /note="Peptidyl-prolyl cis/trans-isomerase; also activates
                     the phosphotyrosyl phosphatase activity of protein
                     phosphatase 2A (PP2A); regulates G1 phase progression, the
                     osmoresponse, microtubule dynamics; subunit of the
                     Tap42p-Pph21p-Rrd2p complex; protein abundance increases
                     in response to DNA replication stress; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0000159 - protein phosphatase type 2A complex [Evidence
                     IDA] [PMID 17550305]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA]; GO_function: GO:0003755 -
                     peptidyl-prolyl cis-trans isomerase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003755 - peptidyl-prolyl
                     cis-trans isomerase activity [Evidence IDA] [PMID
                     16380387]; GO_function: GO:0019211 - phosphatase activator
                     activity [Evidence IEA]; GO_function: GO:0008601 - protein
                     phosphatase type 2A regulator activity [Evidence IGI,ISS]
                     [PMID 10660069]; GO_function: GO:0008601 - protein
                     phosphatase type 2A regulator activity [Evidence IMP]
                     [PMID 12952889]; GO_process: GO:0030472 - mitotic spindle
                     organization in nucleus [Evidence IMP] [PMID 11262194];
                     GO_process: GO:0043085 - positive regulation of catalytic
                     activity [Evidence IEA]; GO_process: GO:0006457 - protein
                     folding [Evidence IEA]; GO_process: GO:0000413 - protein
                     peptidyl-prolyl isomerization [Evidence IEA,IEA];
                     GO_process: GO:0006970 - response to osmotic stress
                     [Evidence IGI,IMP] [PMID 10660069]"
                     /codon_start=1
                     /product="peptidylprolyl isomerase RRD2"
                     /protein_id="XP_018733593.1"
                     /db_xref="GeneID:30035988"
                     /translation="MTDEKLETTEVVGSEPTNGFRVPVKRILSEKDMDLFKNSITKTE
                     LLGFVKDLNHAVTGITNDAEISGVAPERAVSRIVEILEKVTELIDAHPAADQTSRFGK
                     PEFRDLYDDIQRHSSQWIKEIVETDEKYCDGKDGNDSLVQELATYFNESWGNRQRIDY
                     GSGHELNFLCFLYCLKSLQLIVESEYTAVVVKIFVLYLRIMRRIQNTYWLEPAGSHGV
                     WGLDDYHFLPFLFGSSQLSTHKHLRPMSIHDPDIIEMYHKKYMYLGCIKFINDVKTAS
                     LRWHSPLIDDISGVKKWSKVNEGMLKMYNAEVLGKLPIMQHFMFGSLLPAPAGVSPES
                     EHSASEDDHGHVHIPNTWADCCGIKVPSAIAASEMDISGGLRRAIPFD"
     gene            <677182..>677685
                     /gene="ALG13"
                     /locus_tag="AWJ20_3915"
                     /db_xref="GeneID:30035989"
     mRNA            <677182..>677685
                     /gene="ALG13"
                     /locus_tag="AWJ20_3915"
                     /product="N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase catalytic subunit ALG13"
                     /transcript_id="XM_018880955.1"
                     /db_xref="GeneID:30035989"
     CDS             677182..677685
                     /gene="ALG13"
                     /locus_tag="AWJ20_3915"
                     /inference="similar to AA sequence:KEGG_Orthology:K07432"
                     /note="Catalytic component of UDP-GlcNAc transferase;
                     required for the second step of dolichyl-linked
                     oligosaccharide synthesis; anchored to the ER membrane via
                     interaction with Alg14p; similar to bacterial and human
                     glycosyltransferases; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0043541 - UDP-N-acetylglucosamine transferase complex
                     [Evidence IPI] [PMID 16100110]; GO_component: GO:0043541 -
                     UDP-N-acetylglucosamine transferase complex [Evidence IPI]
                     [PMID 16100113]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14690591]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 16100110]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 16100113];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0042406 -
                     extrinsic component of endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 16100110]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14690591]; GO_function:
                     GO:0004577 - N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase activity [Evidence IEA];
                     GO_function: GO:0004577 -
                     N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase activity [Evidence
                     IMP,ISS] [PMID 15615718]; GO_function: GO:0004577 -
                     N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase activity [Evidence
                     IDA,IMP,ISS] [PMID 16100113]; GO_function: GO:0030246 -
                     carbohydrate binding [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016758 - transferase activity, transferring hexosyl
                     groups [Evidence IEA]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0006488 - dolichol-linked oligosaccharide biosynthetic
                     process [Evidence IMP,ISS] [PMID 15615718]; GO_process:
                     GO:0006488 - dolichol-linked oligosaccharide biosynthetic
                     process [Evidence IDA,IMP,ISS] [PMID 16100113];
                     GO_process: GO:0030259 - lipid glycosylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="N-acetylglucosaminyldiphosphodolichol
                     N-acetylglucosaminyltransferase catalytic subunit ALG13"
                     /protein_id="XP_018733594.1"
                     /db_xref="GeneID:30035989"
                     /translation="MSVLVTSGATVPFEKLIRSTLSDGVLHQLAKQGYRQITVQYGSG
                     KAIFDESVSSCHDPKLSIDGFDFTTDMAREIAKYDLVISHAGTGSILDALRANKKLIA
                     VINTSLMDNHQAEIAHEFESQGYLVSTDTESISAALQRLDSTTLKQLPPADSLKLAAI
                     INEEAGL"
     gene            complement(<677907..>678563)
                     /gene="ISA2"
                     /locus_tag="AWJ20_3916"
                     /db_xref="GeneID:30035990"
     mRNA            complement(<677907..>678563)
                     /gene="ISA2"
                     /locus_tag="AWJ20_3916"
                     /product="Isa2p"
                     /transcript_id="XM_018880956.1"
                     /db_xref="GeneID:30035990"
     CDS             complement(677907..678563)
                     /gene="ISA2"
                     /locus_tag="AWJ20_3916"
                     /note="Protein required for maturation of mitochondrial
                     [4Fe-4S] proteins; functions in a complex with Isa1p and
                     possibly Iba57p; localizes to the mitochondrial
                     intermembrane space, overexpression of ISA2 suppresses
                     grx5 mutations; GO_component: GO:0005758 - mitochondrial
                     intermembrane space [Evidence IDA] [PMID 10805735];
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]; GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA]; GO_component: GO:0005739 - mitochondrion [Evidence
                     IDA] [PMID 16823961]; GO_function: GO:0005506 - iron ion
                     binding [Evidence IDA] [PMID 21987576]; GO_process:
                     GO:0009102 - biotin biosynthetic process [Evidence
                     IGI,IMP] [PMID 17259550]; GO_process: GO:0016226 -
                     iron-sulfur cluster assembly [Evidence IGI,IMP] [PMID
                     10805735]"
                     /codon_start=1
                     /product="Isa2p"
                     /protein_id="XP_018733595.1"
                     /db_xref="GeneID:30035990"
                     /translation="MASLYRPLVQTHSGLLAGALRLTAARATPISKRSVHSLIGSGLQ
                     RTQPLLTYNASAVASRSVRRIVSSPTLGPKSATKITNPIKSENGQILRVDVSQKAAEK
                     LNLLKSQDNNPDLALRISVESGGCHGFQYIYSLKTTKDIDSSNDSVFERDGAKVIIDA
                     TSLEIIQQSTIDYTTELIGSQFKVINSPFATSSCGCGSSFAFDPAAAAAAAAAATSSK
                     "
     gene            <679192..>680208
                     /locus_tag="AWJ20_3917"
                     /db_xref="GeneID:30035991"
     mRNA            <679192..>680208
                     /locus_tag="AWJ20_3917"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880957.1"
                     /db_xref="GeneID:30035991"
     CDS             679192..680208
                     /locus_tag="AWJ20_3917"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733596.1"
                     /db_xref="GeneID:30035991"
                     /translation="MGVIILDGTQLEEPVSAYHIPGDKGGPLFILIPGNPGVCQYYSE
                     YLDELKGLLPSYEFLCASHRGMDALLNPKGSVGKTTPYKLTDQVEHLCNVLEWATARA
                     TSSDPRDVIIMGHSMGAWLLQRVLVRFANSPKIRFKMAGLLTPTIRDLAGSPKGVKLS
                     WILDTVTQYPGYVMARTVQALYKTLPNFAFGYAIKLGLGGWSSTPSHAIVSTIAMLSR
                     PSILVQVGQLAADEISHIKSDLPEFWDASIATDRGFAIWAYFAQNDPWVSDTTRDEII
                     SEHSHLPSVHFDIAKGDPEDAIAHSFCLRQSSRFARITAYRISITPGLEPTKPQPPTI
                     SSQL"
     gene            complement(<682735..>684348)
                     /gene="PHO8"
                     /locus_tag="AWJ20_3918"
                     /db_xref="GeneID:30035992"
     mRNA            complement(<682735..>684348)
                     /gene="PHO8"
                     /locus_tag="AWJ20_3918"
                     /product="alkaline phosphatase PHO8"
                     /transcript_id="XM_018880958.1"
                     /db_xref="GeneID:30035992"
     CDS             complement(682735..684348)
                     /gene="PHO8"
                     /locus_tag="AWJ20_3918"
                     /inference="similar to AA sequence:KEGG_Orthology:K01077"
                     /codon_start=1
                     /product="alkaline phosphatase PHO8"
                     /protein_id="XP_018733597.1"
                     /db_xref="GeneID:30035992"
                     /translation="MADETLLPAWRRGGRSQEHNKTMVFLGIWATLATFLALYYSPGH
                     FSDLFKSHQSPKRNVIFFVSDGMGPASLSLTRSFRQYRDNLPIDDILHLDDHFIGHSR
                     TRSSDSLVTDSAAGATAFACGFKTYNGAIGVFPDTDPCGTVLEGAKLRGYHTGMVVTT
                     RITDATPASFSAHVLHREEEDLIAEHQLGMYPLGRMVDLMIGGGRCHFLPGSVDGGCR
                     HDSRNLVEEAVEDGWQYVENREQYDLLKGGNNISLPLLALLAPGDIPYDLDRDDSVYP
                     SLEDTTRTAIRALELATKHSDKGFFLLVEGSRIDHAGHQNDPAAQVREVLAFDRAFQA
                     AIEFSKKSNVETIVVSTSDHETGGLATARQLTPSYPDYLWYPEALDNATHSAEYLGHA
                     LRHYNGKDVYDFIKTDILKEGLGIPEPTEEQIKLLADNKKRSEDHIANIISLRSQTGW
                     STHGHSAVDVNVYGFSGHKRANRRILKTLGGSNENTDIGKFLADYLDVDVSKVTDLLQ
                     QDDITTDDLDDPHGLDSYHAHIMAVTNGL"
     gene            complement(<685842..>687503)
                     /gene="ARO8"
                     /locus_tag="AWJ20_3919"
                     /db_xref="GeneID:30035993"
     mRNA            complement(<685842..>687503)
                     /gene="ARO8"
                     /locus_tag="AWJ20_3919"
                     /product="bifunctional 2-aminoadipate
                     transaminase/aromatic-amino-acid:2-oxoglutarate
                     transaminase"
                     /transcript_id="XM_018880959.1"
                     /db_xref="GeneID:30035993"
     CDS             complement(685842..687503)
                     /gene="ARO8"
                     /locus_tag="AWJ20_3919"
                     /inference="similar to AA sequence:KEGG_Orthology:K00838"
                     /note="Aromatic aminotransferase I; expression is
                     regulated by general control of amino acid biosynthesis;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0047536 - 2-aminoadipate
                     transaminase activity [Evidence IEA]; GO_function:
                     GO:0047536 - 2-aminoadipate transaminase activity
                     [Evidence IDA] [PMID 19342587]; GO_function: GO:0080130 -
                     L-phenylalanine:2-oxoglutarate aminotransferase activity
                     [Evidence IEA]; GO_function: GO:0008793 -
                     aromatic-amino-acid:2-oxoglutarate aminotransferase
                     activity [Evidence IEA]; GO_function: GO:0008793 -
                     aromatic-amino-acid:2-oxoglutarate aminotransferase
                     activity [Evidence IDA] [PMID 9491082]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA]; GO_function: GO:0008483 - transaminase
                     activity [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0019509 - L-methionine salvage from methylthioadenosine
                     [Evidence IEA]; GO_process: GO:0009094 - L-phenylalanine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0009072 - aromatic amino acid family metabolic process
                     [Evidence IGI,IMP] [PMID 9491083]; GO_process: GO:0009058
                     - biosynthetic process [Evidence IEA]; GO_process:
                     GO:0019878 - lysine biosynthetic process via aminoadipic
                     acid [Evidence IEA]; GO_process: GO:0006571 - tyrosine
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional 2-aminoadipate
                     transaminase/aromatic-amino-acid:2-oxoglutarate
                     transaminase"
                     /protein_id="XP_018733598.1"
                     /db_xref="GeneID:30035993"
                     /translation="MVTNNEIGLPHYSYFPYDTLEAAVAQPHRFSGSDKGRAQSSHIV
                     VPKVDSSGVNASPLDIATVLQYGTAQGIPVLYEWLKEFTTKNLHPNIPYDGGADIILS
                     CGNTDGMHKTLATLANDWSPARNDVSEREGLLVEKFCYMSAVDSAKFKGLNIVPVDID
                     YQGLLADSLEFVLANWDYSIGKRPHLLYTVSTGQNPTGGVVSVERRKEIYKVCSKYDV
                     VIIEDEPYWFLQYPAADEEDPNPPSTDPGSTDGHAGTKKSSGYEFLDSLVQSYLEIDT
                     DGRVVRLDTFSKNVAPGCRLGWITAQPAVIERITRMTEGSTQQPSGFVQSMIAKLVGA
                     GAPNSSAVSETGPGSFVSTLARSKREPVPEAASWSFDGWVQWLSGLRDQYQRRMVVMC
                     QALDDAKISVDEMSDEQGWTSVSNLENVYYDFDWPRAGMFVWLKVHLDKHPLASNSYS
                     NEELSTALWVWMTRAPNLVLVSPGRMFSPAESLIEDASLYFRLCFAAIAEDELKASSQ
                     RIASAIHSFWSVDEDTVEELIDSTRDIESNDLNFDPTSFKSVFGC"
     gene            complement(<687566..>687775)
                     /locus_tag="AWJ20_3920"
                     /db_xref="GeneID:30035995"
     mRNA            complement(<687566..>687775)
                     /locus_tag="AWJ20_3920"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880961.1"
                     /db_xref="GeneID:30035995"
     CDS             complement(687566..687775)
                     /locus_tag="AWJ20_3920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733599.1"
                     /db_xref="GeneID:30035995"
                     /translation="MAPPRDLSHYYSENAKNRQGSEFKKFYKYFAIKGIGNLAGGKLC
                     ESPVSTPKARALQEIAWTPDRTAGA"
     gene            complement(<688549..>689145)
                     /gene="ARL3"
                     /locus_tag="AWJ20_3921"
                     /db_xref="GeneID:30035996"
     mRNA            complement(<688549..>689145)
                     /gene="ARL3"
                     /locus_tag="AWJ20_3921"
                     /product="Arf family GTPase ARL3"
                     /transcript_id="XM_018880962.1"
                     /db_xref="GeneID:30035996"
     CDS             complement(688549..689145)
                     /gene="ARL3"
                     /locus_tag="AWJ20_3921"
                     /inference="similar to AA sequence:KEGG_Orthology:K07952"
                     /note="ARF-like small GTPase of the RAS superfamily;
                     required for recruitment of Arl1p, a GTPase that regulates
                     membrane traffic, to the Golgi apparatus; NatC-catalyzed
                     N-terminal acetylation regulates Golgi membrane
                     association mediated by interaction with membrane
                     receptor, Sys1p; similar to ADP-ribosylation factor and
                     orthologous to mammalian ARFRP1; GO_component: GO:0005794
                     - Golgi apparatus [Evidence IEA,IEA]; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IDA] [PMID
                     15077113]; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IDA] [PMID 15077114]; GO_component: GO:0005622 -
                     intracellular [Evidence IEA]; GO_component: GO:0042175 -
                     nuclear outer membrane-endoplasmic reticulum membrane
                     network [Evidence IDA] [PMID 9920936]; GO_function:
                     GO:0005525 - GTP binding [Evidence IEA,IEA]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IDA,ISS] [PMID
                     9920936]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0043001 - Golgi to plasma
                     membrane protein transport [Evidence IMP] [PMID 16926193];
                     GO_process: GO:0006886 - intracellular protein transport
                     [Evidence IMP] [PMID 9920936]; GO_process: GO:0033365 -
                     protein localization to organelle [Evidence IMP] [PMID
                     12620189]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0007264 - small GTPase
                     mediated signal transduction [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Arf family GTPase ARL3"
                     /protein_id="XP_018733600.1"
                     /db_xref="GeneID:30035996"
                     /translation="MYHLARSLYANFTRKEEYAVLILGLDNAGKTTLLERLKTEYSNT
                     KGLAPDKIAPTVGQNVAHITKNGVMLKIWDLGGQEALRTLWESYYTEAHAVVFVVDST
                     DRTRIEQCRDALDKIVSSESIEGTPILMLANKQDQEDRLEVEDIKEIFNKIAEKMSAR
                     DSRVLPISALDGTGVEDATEWLVSRLVRNKQQRPPKLR"
     gene            <690026..>690946
                     /gene="ADE1"
                     /locus_tag="AWJ20_3922"
                     /db_xref="GeneID:30035997"
     mRNA            <690026..>690946
                     /gene="ADE1"
                     /locus_tag="AWJ20_3922"
                     /product="phosphoribosylaminoimidazolesuccinocarboxamide
                     synthase"
                     /transcript_id="XM_018880963.1"
                     /db_xref="GeneID:30035997"
     CDS             690026..690946
                     /gene="ADE1"
                     /locus_tag="AWJ20_3922"
                     /inference="similar to AA sequence:KEGG_Orthology:K01923"
                     /note="N-succinyl-5-aminoimidazole-4-carboxamide ribotide
                     synthetase; required for 'de novo' purine nucleotide
                     biosynthesis; red pigment accumulates in mutant cells
                     deprived of adenine; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0004639 -
                     phosphoribosylaminoimidazolesuccinocarboxamide synthase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004639 -
                     phosphoribosylaminoimidazolesuccinocarboxamide synthase
                     activity [Evidence IDA] [PMID 1756975]; GO_function:
                     GO:0004639 -
                     phosphoribosylaminoimidazolesuccinocarboxamide synthase
                     activity [Evidence IMP] [PMID 5767024]; GO_function:
                     GO:0004639 -
                     phosphoribosylaminoimidazolesuccinocarboxamide synthase
                     activity [Evidence IMP] [PMID 5767025]; GO_process:
                     GO:0006189 - 'de novo' IMP biosynthetic process [Evidence
                     IEA]; GO_process: GO:0006189 - 'de novo' IMP biosynthetic
                     process [Evidence IDA] [PMID 1756975]; GO_process:
                     GO:0006189 - 'de novo' IMP biosynthetic process [Evidence
                     IMP] [PMID 5767024]; GO_process: GO:0006189 - 'de novo'
                     IMP biosynthetic process [Evidence IMP] [PMID 5767025];
                     GO_process: GO:0006164 - purine nucleotide biosynthetic
                     process [Evidence IEA,IEA]; GO_process: GO:0006164 -
                     purine nucleotide biosynthetic process [Evidence IDA]
                     [PMID 1756975]; GO_process: GO:0006164 - purine nucleotide
                     biosynthetic process [Evidence IMP] [PMID 5767024];
                     GO_process: GO:0006164 - purine nucleotide biosynthetic
                     process [Evidence IMP] [PMID 5767025]"
                     /codon_start=1
                     /product="phosphoribosylaminoimidazolesuccinocarboxamide
                     synthase"
                     /protein_id="XP_018733601.1"
                     /db_xref="GeneID:30035997"
                     /translation="MSVVTTDLQGTLPLIARGKVRDLYQLSDDKLLFVATDRISAFDV
                     ILNNGIPSKGKLLTGLSEFWFELLADVTKNHLVPGVNSHNLAKALPQSVSSNDELISQ
                     LIGRSMVVNKYKVLPLEVIVRGYITGSAWAEYKKSGTVHGIPQKAGLQESEAFETPIY
                     TPSTKAEQGEHDENIHPDEAAKIVGPELAAKLEKLALKLYTTARDYALSKGIIIADTK
                     FEFGTDENGDIVLLDEVLTPDSSRFWRKDTYALGKSQDSYDKQFVRDWLISNNLKAVD
                     NVTIPDEIVEKTKAKYVEAYETLTGNKWVE"
     gene            <691740..>693089
                     /gene="PTC6"
                     /locus_tag="AWJ20_3923"
                     /db_xref="GeneID:30035998"
     mRNA            <691740..>693089
                     /gene="PTC6"
                     /locus_tag="AWJ20_3923"
                     /product="type 2C protein phosphatase PTC6"
                     /transcript_id="XM_018880964.1"
                     /db_xref="GeneID:30035998"
     CDS             691740..693089
                     /gene="PTC6"
                     /locus_tag="AWJ20_3923"
                     /inference="similar to AA sequence:KEGG_Orthology:K19708"
                     /note="Mitochondrial type 2C protein phosphatase (PP2C);
                     has similarity to mammalian PP1Ks; involved in mitophagy;
                     null mutant is sensitive to rapamycin and has decreased
                     phosphorylation of the Pda1 subunit of pyruvate
                     dehydrogenase; GO_component: GO:0005758 - mitochondrial
                     intermembrane space [Evidence IEA]; GO_component:
                     GO:0005758 - mitochondrial intermembrane space [Evidence
                     IDA] [PMID 17166847]; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IEA]; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IDA] [PMID
                     18180296]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0004741 -
                     [pyruvate dehydrogenase (lipoamide)] phosphatase activity
                     [Evidence IEA]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0004721
                     - phosphoprotein phosphatase activity [Evidence IEA];
                     GO_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IDA] [PMID 17002782];
                     GO_process: GO:0016236 - macroautophagy [Evidence IGI]
                     [PMID 17166847]; GO_process: GO:0000422 - mitochondrion
                     degradation [Evidence IMP] [PMID 17166847]; GO_process:
                     GO:0043085 - positive regulation of catalytic activity
                     [Evidence IMP] [PMID 18180296]; GO_process: GO:0006470 -
                     protein dephosphorylation [Evidence IMP] [PMID 18180296]"
                     /codon_start=1
                     /product="type 2C protein phosphatase PTC6"
                     /protein_id="XP_018733602.1"
                     /db_xref="GeneID:30035998"
                     /translation="MLRRPRSYDPASIHPVPTNVPKLARSVSAYYTVESDNHSKARIN
                     LLKNPSYLGHYTSRVNRTYNEDRYYAGVLKLPVGSSLTSKYVRQKFTHHDRQVFNFAV
                     FDGHGGSECSQFLQDHLAEYVENCDLSSGTALRDLYRKNVGGYWRAWGPELDRYVSRL
                     TAVDDFQLRLPLSFLKADYEFSEKFERAGSTATSVYLYSDEESISANGDGTNLIGKTA
                     AANDSEDAVDYSRTPKAFWDQDQVTTLVVAHVGDTRCILCDHHGNVHQLTTNHHPSTS
                     VENTRLKRYATSFFTDSFGEERFGSFANTRAFGDFAAKAKGITAEPEIVECRIGDKRK
                     IKSLSSTYPRHIKTFTGDEAFLVLMSDGVTEMISDQEVVDLVINTANKAGSGRGTPQD
                     AAKEIVHYAAAVGGDDNATCMVIRLSGWGKWDTWYDRTAPRREEKLSSYSVRAPRRT"
     gene            complement(<702558..>705455)
                     /gene="POL90"
                     /locus_tag="AWJ20_3924"
                     /db_xref="GeneID:30035999"
     mRNA            complement(<702558..>705455)
                     /gene="POL90"
                     /locus_tag="AWJ20_3924"
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 1"
                     /transcript_id="XM_018880965.1"
                     /db_xref="GeneID:30035999"
     CDS             complement(702558..705455)
                     /gene="POL90"
                     /locus_tag="AWJ20_3924"
                     /note="polyprotein of non-LTR retrotransposon Zorro 1 and
                     repeat region-related DNA"
                     /codon_start=1
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 1"
                     /protein_id="XP_018733603.1"
                     /db_xref="GeneID:30035999"
                     /translation="MSEDIHPVEYYKTLLPQIPELIIIAGDFNLHHPMWQSTEQVTRE
                     ANSWADWVNDNGLLLATVPNVPTHIFGNTIDLTFATPNITITPEKSEDVGSDHYLQKW
                     RIDTNPLDIELLQTYGGRYNYKRADWEKFEKVLDSRAALITIPKKLRGYSNRKSTHKV
                     ADRYATQLIGLLCDCLDEAVPKLKIVPRSKRWWTPELRQAKRDAVRARRRARSQPTEE
                     NRRLRQQANEEYASKILEAKTNTWNSYLASCRGTDIYDALKMIKPREPVPIMPALRLE
                     TGELAQTFEEQEEELYRGLFPQVKPSTRRLLKVVKTGQWKSLRMQEIEDAIRDQAPNK
                     APGPDGVKTVAIKRAWAVIRFRKLLKGLLQYCVRVGYHPKCFREGITVVIPKRKRDPA
                     LARSYRPITLLSTLGKVLEKIMQRRLTALTSGMLPVDQYGGRHGYSAVEAAHKLVHHA
                     EKRMKRDQVTSVLAIDIKGAFDHVHRDTLLNTMGGMGLPTAVQNWVYQFMRGRRTSLV
                     IDGKRTKERRIATGIPQGSPISPLLFLIYTSPLYPLIKSMGGKVIGFIDDITIYVSST
                     RYAENTAKLSNILARCHEWATSAHAFIDYGEKLGFMHIAKRVTPKGCRRLILPTGERI
                     QATSSLKLLGVTIDRQLKFEEHAKSVINKGQSALNVIRRLGGVTRGVTGATMRCLYKS
                     CVRSILEYASPIWYNRIRKGLKDAIQRIQNAALRSILGAYKPTAIVSLHRDAEIPPVE
                     HRMLETEQYYLVRLHRDLHRYNPHRIRARKLYFGTMLGDRLDELYRTVEVTDIKKDRY
                     RLWKPPWASRDSEAISKASSQKKSIRKEIRSQCYQKWEIEYTQSPKGAFYRSFTAPRL
                     YSTKHANALRPFLYESPRGELSKLVQLRTGMGAMGSFFQRFRISNRRYDCRCGVEETV
                     EHILRDCPLTEQHRPILRDASRELDLPSLLDTRKGLKAVASFLKANPSLLS"
     gene            complement(<717614..>718165)
                     /locus_tag="AWJ20_3925"
                     /db_xref="GeneID:30036000"
     mRNA            complement(<717614..>718165)
                     /locus_tag="AWJ20_3925"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880966.1"
                     /db_xref="GeneID:30036000"
     CDS             complement(717614..718165)
                     /locus_tag="AWJ20_3925"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733604.1"
                     /db_xref="GeneID:30036000"
                     /translation="MTDNYHASNDLLPGKASDVNDQSNNRHEEQFQDTAAKATNGIKH
                     EPQASNLEPLPPKKIRRKASTLPPPVARKDKGAALSLEEKKANHIASEQRRRQAIRQE
                     FDKICELVPDLDLSKSRSEVVVLERTVSFLLHLMEENKALRELATSHSIELPADLAAD
                     TDNRRIIPANSASGYETSTHSRS"
     gene            <718557..>718674
                     /locus_tag="AWJ20_3926"
                     /db_xref="GeneID:30036001"
     tRNA            <718557..>718674
                     /locus_tag="AWJ20_3926"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:30036001"
     gene            complement(<719248..>719544)
                     /locus_tag="AWJ20_3927"
                     /db_xref="GeneID:30036002"
     mRNA            complement(<719248..>719544)
                     /locus_tag="AWJ20_3927"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880967.1"
                     /db_xref="GeneID:30036002"
     CDS             complement(719248..719544)
                     /locus_tag="AWJ20_3927"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733605.1"
                     /db_xref="GeneID:30036002"
                     /translation="MSSAASKRLIKELSAFSHDPNPALDALQLQSEDDLFTWLAVLRG
                     PADSPYEGQYENDLNALHCVFAFYLLTQRRWTLAYTDKGSTKLSSSTADDAISY"
     gene            <720516..>724226
                     /gene="AOH2"
                     /locus_tag="AWJ20_3928"
                     /db_xref="GeneID:30036003"
     mRNA            <720516..>724226
                     /gene="AOH2"
                     /locus_tag="AWJ20_3928"
                     /product="xanthine dehydrogenase/oxidase"
                     /transcript_id="XM_018880968.1"
                     /db_xref="GeneID:30036003"
     CDS             720516..724226
                     /gene="AOH2"
                     /locus_tag="AWJ20_3928"
                     /inference="similar to AA sequence:KEGG_Orthology:K00106"
                     /codon_start=1
                     /product="xanthine dehydrogenase/oxidase"
                     /protein_id="XP_018733606.1"
                     /db_xref="GeneID:30036003"
                     /translation="MSLYALLRNCYNRHPTQQEISEAFDGNLCRCTGYKPILDAANSF
                     VEGGGIVSKENGNAETNGTSTGSGGCCRMSNDQACACMRNQKSPNGFPLKEHNFHEQA
                     RGQSGSPVELIFPPGLKKFEPVPLFYGNERKVWFRPLTKRQLLEIKDRYPKAKLVGGA
                     TEIQIEIKMKQMDYNVSVFANDIDELKQFHYDEERKGVEFGANIDLSTLEHRLNEMTS
                     LIGTEKSQIYQEIVKQLKYFAGRQIRNVATPAGNIATASPISDLNPVLVAADAVLTVE
                     SLSDGIQEIPISKFFIGYRKTLLPDGGIISKIFVPESLPQREVVRAFKQAKRKDDDIA
                     IVTACLRLVVDKDFKITKARLAYGGVAPMTVRALKTEERLLGMEVSDSTSDAIISLSV
                     NSLNNDDFKNITFGVPGGMAIFRRTLVTSFFYKFYQTVLQSFGFIRTLDGDAVEEVTR
                     NFPIGKRDLDNAFEKKVLGKSNPHMSALKQVTGEATYVDDIPPFHKELFGVQVMSTRA
                     HARIVSVDYSPIFEIDGVVGYANVDDIVSKQANMWGHFEDGKEEFFADGNVRYIGQCI
                     GLVVAKDRETAARGARAVVVEYEDIDPKVITIEDAIKYNSFFNLERKIVKGDVESAFQ
                     TAAHIVEGTTRIGAQEHFYLETHGCIAVPEEDNEMKIYTSGQAPNATQVSAAQVLGIP
                     ANRIVARVKRLGGGFGGKESRCCQISSIAAVAARKFKKPVRIILTRSEDMLTMGQRHP
                     FLIRWKVGLDKNFRFIGLKSKLYANAGWSLDLTAGVVERALFHMDNCYDFQNCHFEGF
                     ACKTNTASNTAFRGFGGPQGMFGAESLIYEVAETLGIEPDTLRELNYFRPGSSTAYQQ
                     PMNEDFTVPLLAKQVKEQANFQQLRAEVDAFNKEHKWIKRGLAHVPTAFGVSFGALFL
                     NQAGALIHIYEDGSVLLAHGGTEMGQGLFTKMAMVAAEELDVPLESVFTSESATNTVA
                     NASPTAASASSDLNGMAVKDACDQLNKRLKPYREKFGPEATMKELAHAAYFDRVNLSA
                     NGFYKTPDIGYVWGDPNPKPAFFYHTQGAAVSMVEVNTLTGDWSCLRTDIKMDVGRPL
                     NQAIDYGQIEGAYIQGQGLFTMEESLWLQSGALFTRGPGAYKIPGFRDIPQIFNVGIL
                     QDRPFKHLKTINRSKGIGEPPLFLGSTVFFAIRDALLAARKQNGKTEPLVGVQSPLTS
                     ERIRNLCGDSLVDLSIQAVQPTMDQKEFFVVA"
     gene            complement(<725372..>726289)
                     /gene="SAY1"
                     /locus_tag="AWJ20_3929"
                     /db_xref="GeneID:30036004"
     mRNA            complement(<725372..>726289)
                     /gene="SAY1"
                     /locus_tag="AWJ20_3929"
                     /product="Say1p"
                     /transcript_id="XM_018880969.1"
                     /db_xref="GeneID:30036004"
     CDS             complement(725372..726289)
                     /gene="SAY1"
                     /locus_tag="AWJ20_3929"
                     /note="Sterol deacetylase; component of the sterol
                     acetylation/deacetylation cycle along with Atf2p; active
                     both in the endoplasmic reticulum (ER) and in lipid
                     droplets; integral membrane protein with active site in
                     the ER lumen; green fluorescent protein (GFP)-fusion
                     protein localizes to the ER; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IDA] [PMID 24868093]; GO_component:
                     GO:0005788 - endoplasmic reticulum lumen [Evidence IDA]
                     [PMID 18034159]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IDA] [PMID 18034159]; GO_component:
                     GO:0005811 - lipid particle [Evidence IDA] [PMID
                     24868093]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0034084 - steryl
                     deacetylase activity [Evidence IDA,IMP] [PMID 18034159];
                     GO_process: GO:0009636 - response to toxic substance
                     [Evidence IMP] [PMID 18034159]; GO_process: GO:0034210 -
                     sterol deacetylation [Evidence IMP] [PMID 18034159];
                     GO_process: GO:0016125 - sterol metabolic process
                     [Evidence IMP] [PMID 18034159]"
                     /codon_start=1
                     /product="Say1p"
                     /protein_id="XP_018733607.1"
                     /db_xref="GeneID:30036004"
                     /translation="MPTSAAKVLGWTMKKPFKNYGKKYASDGFTAYWLVELDDRQPED
                     PVLIFCHGGGFVFPLSLPQVWLLTAIVRAFPSVRLNVLILDYSLSPEHRYPTQIEEIA
                     SLYRHLLDVEACENIVLAGESCGGNLILALLAHLKHGFPTASPTTSKCKDTAVKGAIL
                     ISPWVNLAIEAVVHDADSSYVKNAHEDILNTERLCFWANEYCPDKLTRQTSPWVSPVL
                     LIKENIGFWENVLPARTLITWGEEELMKDDVARFASMTNISNAFEVPNGVHVDVLFQS
                     KSPVYDKIIAFLEGVFEAKSVDSSTSTIL"
     gene            <728241..>729293
                     /locus_tag="AWJ20_3930"
                     /db_xref="GeneID:30036006"
     mRNA            <728241..>729293
                     /locus_tag="AWJ20_3930"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880971.1"
                     /db_xref="GeneID:30036006"
     CDS             728241..729293
                     /locus_tag="AWJ20_3930"
                     /inference="similar to AA sequence:KEGG_Orthology:K00459"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733608.1"
                     /db_xref="GeneID:30036006"
                     /translation="MATNWLFTELKLRIPVIQAPMAGVSSSSMVVAASKAGILGSLGG
                     GMMQPEVLRKEIEAIRNQTDRPFNINLFVIDNYEQGFDVRTKDIQWLKDYYKQEGVEF
                     NLPKSFAPKFQDQFETLLELAPPVASFAFGILSAEQVDACHERGIRVIGTATSGEEAV
                     AWEKVGADAICAQGTEAGGHRGNFINLDDPGLGLFALIPEIKRQVKIPVIAAGGIMSG
                     QGIVASRLLGADVAQLGTYFLASTEAGIPSGYLKSLAGQKSGSNTSLTKGFSGRYARG
                     IVNKFMNTSKEHSIYPYPIQNALTQPLRKATLAKGDAESYSLWSGQGLYQVKEGESIS
                     DLVDSLEREISQTKLP"
     gene            <729621..>731246
                     /gene="COQ6"
                     /locus_tag="AWJ20_3931"
                     /db_xref="GeneID:30036007"
     mRNA            <729621..>731246
                     /gene="COQ6"
                     /locus_tag="AWJ20_3931"
                     /product="putative N,N-dimethylaniline monooxygenase COQ6"
                     /transcript_id="XM_018880972.1"
                     /db_xref="GeneID:30036007"
     CDS             729621..731246
                     /gene="COQ6"
                     /locus_tag="AWJ20_3931"
                     /inference="similar to AA sequence:KEGG_Orthology:K06126"
                     /note="Putative flavin-dependent monooxygenase; involved
                     in ubiquinone (Coenzyme Q) biosynthesis; localizes to the
                     matrix face of the mitochondrial inner membrane in a large
                     complex with other ubiquinone biosynthetic enzymes; human
                     COX6 can rescue a yeast cox6 mutant and is implicated in
                     steroid-resistant nephrotic syndrome (SRNS); GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IDA] [PMID 12721307]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004499 -
                     N,N-dimethylaniline monooxygenase activity [Evidence ISA]
                     [PMID 12721307]; GO_function: GO:0050660 - flavin adenine
                     dinucleotide binding [Evidence IEA]; GO_function:
                     GO:0004497 - monooxygenase activity [Evidence IEA,IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016709 -
                     oxidoreductase activity, acting on paired donors, with
                     incorporation or reduction of molecular oxygen, NAD(P)H as
                     one donor, and incorporation of one atom of oxygen
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006744 - ubiquinone biosynthetic process
                     [Evidence IEA,IEA,IEA]; GO_process: GO:0006744 -
                     ubiquinone biosynthetic process [Evidence IMP] [PMID
                     21944752]; GO_process: GO:0006744 - ubiquinone
                     biosynthetic process [Evidence IMP] [PMID 9266513]"
                     /codon_start=1
                     /product="putative N,N-dimethylaniline monooxygenase COQ6"
                     /protein_id="XP_018733609.1"
                     /db_xref="GeneID:30036007"
                     /translation="MSGLIRLGWRPLSRARFIRKPSPAVGSHSKLLASRSQWGLIRHL
                     STVGPILQAEPSSIDNQSIDASKTDKAGAVNEQKVSYHDVVIIGGGPAGLTLFTALKN
                     SPVTSNLDIVLVEGSSLERLRSWSLPENLYENRVSSLTPRSVEFLKSIGAWDHVHHER
                     VQDYHEMKVWDGCSDSRIEFDPYILGENNEIAWMIENSNLQNSLLSRLAELDSSASVN
                     NVVDSAKVKSISRQPSEQNNKQDGQVSLGAATWDSSSWPVVELENGRKLSARLLVGAD
                     GGNSPVRTFAGIQSRGWDYERHGLVASVKLEWEDFRSIAWQRFLVTGPIALLPLPNGF
                     CSLVWSTTPENAQHLKSLTPAAFCAMVNAAFRLGPVDLKYLHTITDEATLIDEIEWRI
                     QNTNIVDEDNNVPVPISEVLDKSRASFPLKMKHADTYVSERVALVGDAAHTTHPLAGQ
                     GLNMGQSDVANLVQAIETATKRGLDIGSLLALEPYWASSYWSNHIKLGVVDKLHKLYS
                     SDFGPLVQLRSWGLDFFNESPFLKRLLMSNASK"
     gene            <731869..>733311
                     /locus_tag="AWJ20_3932"
                     /db_xref="GeneID:30036008"
     mRNA            <731869..>733311
                     /locus_tag="AWJ20_3932"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880973.1"
                     /db_xref="GeneID:30036008"
     CDS             731869..733311
                     /locus_tag="AWJ20_3932"
                     /inference="similar to AA sequence:KEGG_Orthology:K12735"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733610.1"
                     /db_xref="GeneID:30036008"
                     /translation="MVVKNIASNSDEPSLLAGSQFIVTLGDGLDSLDSRAVVFGRVEE
                     GYDTLDTISNAICDSDGRPLKDIRIKHTYILEDPFPDPNGLDELVRPNSPEPSEKQLS
                     TVRIGDDNDESNEDEENAENKHKEQDARAQALTLEMVGDLPFAEVKPMENVLFVCKLN
                     PVTNDEDLELIFSRFGPIISCEVIRDKDTGDSLQYAFIEFEDQEACERAYLKMDGVLI
                     DDNRIHVDFSQSVSRLSDGWRNETNAKRKNVHGSKFISNASTSVKSRNVDQRDIKRQR
                     LRDGNVNSTRYDGRESRRYGMDETHYERKVDSRYEDKKTHESYRQDERYEEDRLDKQY
                     HRKHDKSDNKRDERRGNRRDDRRDDKRDDRRDDQRDDRRDDRRDDRREDRRDDRRDDR
                     RDHRRDHRRDDGRDEKSDDRRSHRRDDTKYDRSDSTKDREDRSYRDRERYGHSRDSYR
                     DRRDRDQGRHARRDEGRHNRHNSDRTQSRD"
     gene            complement(<733458..>734279)
                     /locus_tag="AWJ20_3933"
                     /db_xref="GeneID:30036009"
     mRNA            complement(<733458..>734279)
                     /locus_tag="AWJ20_3933"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880974.1"
                     /db_xref="GeneID:30036009"
     CDS             complement(733458..734279)
                     /locus_tag="AWJ20_3933"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733611.1"
                     /db_xref="GeneID:30036009"
                     /translation="MGSPSFIHKPFPISQITPSTIVLGSSGFKNTTASAEDTSVGTEG
                     SIRTTSSDITEGSQDSLSDRNTDISSLSSTESASGTHADSKTNDFLATAVQTNIAINM
                     ASSATIRSNSQESDHNESASENNNDGNIRSTANSTTHSAANSSPASPLPSSPTIMNTI
                     LGPATQKTSSTITIPFSDTQIEASSVLVTSSDPPERCTSPRRDNVAIEKIGREKVQVL
                     RKEAQLIQESLTDILERIIKVKEDYDRLSNENRFLQDYIGNLMSTSNILNKAGHA"
     gene            <736051..>737364
                     /gene="TGL2"
                     /locus_tag="AWJ20_3934"
                     /db_xref="GeneID:30036010"
     mRNA            <736051..>737364
                     /gene="TGL2"
                     /locus_tag="AWJ20_3934"
                     /product="Tgl2p"
                     /transcript_id="XM_018880975.1"
                     /db_xref="GeneID:30036010"
     CDS             736051..737364
                     /gene="TGL2"
                     /locus_tag="AWJ20_3934"
                     /inference="similar to AA sequence:KEGG_Orthology:K01046"
                     /note="Triacylglycerol lipase that is localized to the
                     mitochondria; has lipolytic activity towards
                     triacylglycerols and diacylglycerols when expressed in E.
                     coli; GO_component: GO:0005739 - mitochondrion [Evidence
                     IDA] [PMID 19959834]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0016788 -
                     hydrolase activity, acting on ester bonds [Evidence IEA];
                     GO_function: GO:0004806 - triglyceride lipase activity
                     [Evidence IEA]; GO_function: GO:0004806 - triglyceride
                     lipase activity [Evidence IDA,IMP] [PMID 9544243];
                     GO_process: GO:0006505 - GPI anchor metabolic process
                     [Evidence IEA]; GO_process: GO:0006886 - intracellular
                     protein transport [Evidence IEA]; GO_process: GO:0016042 -
                     lipid catabolic process [Evidence IEA]; GO_process:
                     GO:0006629 - lipid metabolic process [Evidence IEA];
                     GO_process: GO:0019433 - triglyceride catabolic process
                     [Evidence IMP] [PMID 19959834]"
                     /codon_start=1
                     /product="Tgl2p"
                     /protein_id="XP_018733612.1"
                     /db_xref="GeneID:30036010"
                     /translation="MMSSTDLLLAYSAASQQRYQKETDDSGNSRARLMVVLKGVGVNG
                     GIAAVAGSAAKHLSFLCKVGGPYGLGLFNTTTPARFYSDNNGSGTGKGGNPNDQIDGL
                     KNRKEIEGDPANVRDGNLRKEESSDSTVIGKPGSSKSPPKTLLLKHEFENLKAKYTPT
                     KYPIILCHGLFGFDTLKSPVPIIVKDLSYWHGIKEALVDAGAKVLSASVPPVGPIETR
                     AEYLAQVIERWVKEENLDNGNGESDEPLKLNLIGHSMGGLDARYMISVLKPPNIKVLS
                     LTTIVTPHQGTSFADHIFKENPLYITKLLKAIACVGGVEEPSGIKQLTTEHMQNAFNP
                     HVPDDKDVYYSSYGARIGSRWTTVLKYSADYIKSVEGDNDGLVSVESAKWGEYLGTIE
                     NCDHLDVVNLVGVTHWLKWATFQKSSFNAIALYLHIMDSLAKKGF"
     gene            complement(<737539..>738930)
                     /gene="ALD5"
                     /locus_tag="AWJ20_3935"
                     /db_xref="GeneID:30036011"
     mRNA            complement(<737539..>738930)
                     /gene="ALD5"
                     /locus_tag="AWJ20_3935"
                     /product="aldehyde dehydrogenase (NAD(P)(+)) ALD5"
                     /transcript_id="XM_018880976.1"
                     /db_xref="GeneID:30036011"
     CDS             complement(737539..738930)
                     /gene="ALD5"
                     /locus_tag="AWJ20_3935"
                     /inference="similar to AA sequence:KEGG_Orthology:K00128"
                     /note="Mitochondrial aldehyde dehydrogenase; involved in
                     regulation or biosynthesis of electron transport chain
                     components and acetate formation; activated by K+;
                     utilizes NADP+ as the preferred coenzyme; constitutively
                     expressed; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0004029 - aldehyde dehydrogenase (NAD) activity
                     [Evidence IDA] [PMID 9473035]; GO_function: GO:0004030 -
                     aldehyde dehydrogenase [NAD(P)+] activity [Evidence IEA];
                     GO_function: GO:0004030 - aldehyde dehydrogenase [NAD(P)+]
                     activity [Evidence IDA] [PMID 9473035]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA,IEA];
                     GO_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA]; GO_process: GO:0019413 - acetate
                     biosynthetic process [Evidence IMP] [PMID 15256563];
                     GO_process: GO:0006068 - ethanol catabolic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (NAD(P)(+)) ALD5"
                     /protein_id="XP_018733613.1"
                     /db_xref="GeneID:30036011"
                     /translation="MLRGILRSQSSQWTKGFRQTVRQYSSSKSSDIADKAVESAFKSS
                     ATWKNVPVEEKRDIFYNASKLLKERREELVKLTNQEVGIPSLFAGFFVDDAVDFMTTM
                     GDLVTNSGYGQFLPPVKGRQPIVVREPIGPVFGIVPWNAPTILGLRAAACPLAAGCSV
                     VVKTSEYTPLTQRLTLQTLTDAGVPEGVVNILEVPLEDSPAVVEQVISDFRIRKVNFT
                     GSGRVGAIVAGLAGTHLKPILLELGGKAAAIVDETADFETAARNIVLGAWANSGQICM
                     STERIFVTKEAADGFNKAITKVSHEELNQDYLQCRQISPVNSKRIEQLAKDAVSKGAT
                     SIVNGIPKAKDGDVSKSILTNVSQDSELFDSETFAPLAFFNIVDSVDQAIDLVNSSKF
                     GLNSSVWTADTAKGIEIARKINSGTVHINGNTVFDHGSVPHGGVKNSGFGRFNGQWGI
                     DEFTVIKTITYPV"
     gene            <740233..>741807
                     /locus_tag="AWJ20_3936"
                     /db_xref="GeneID:30036012"
     mRNA            <740233..>741807
                     /locus_tag="AWJ20_3936"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880977.1"
                     /db_xref="GeneID:30036012"
     CDS             740233..741807
                     /locus_tag="AWJ20_3936"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733614.1"
                     /db_xref="GeneID:30036012"
                     /translation="MTLKSETSLKSVNVKLEGIAKTVIQVTEEVNDRGKKRETKTRDE
                     IEIHHVLYKTQTVFPPEDVRKSSTSNQFTLPPGSYTYAFRFKIPVNSDCRQNAASSAS
                     NSWGNGSNGWTPGGPGGSFAGGAFSSIANGRIGSSISNSINNVAGPGNKLLVTGRGID
                     IARAPSLQSHDGGVLPPSLSGIENSASIKYFVKVTVVRASMLKMNTRSHKPFIFLPLD
                     PPRLYDSSKMAFVRRQITVGTSVTSPGGSKGRSTSSSGGGGFFSSLLSSQKVSSFMGV
                     NTWPGETLSFTFEMRFPSVGTFVPLRPLPIELYALFPANPTTMTERKAIYISSFSVFL
                     YARTFIRAHEHNKEIPLQLNVCDKKNLRLAVSLADAQPVTRNGQTVFELRLPSDLLNG
                     VQFPSYVSPTFTTCNIARNYSIGVEMGFYCVQGIPVDHVGLLSDIIVRSGVSAPSENT
                     SSALPPPPPSRPVQSDPPPEKLKYHTNAEDTQENGELPSYNEVVAATVGTSSSTQPEP
                     RRKFEQAPDYYKISKE"
     gene            complement(<742105..>743130)
                     /locus_tag="AWJ20_3937"
                     /db_xref="GeneID:30036013"
     mRNA            complement(<742105..>743130)
                     /locus_tag="AWJ20_3937"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880978.1"
                     /db_xref="GeneID:30036013"
     CDS             complement(742105..743130)
                     /locus_tag="AWJ20_3937"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733615.1"
                     /db_xref="GeneID:30036013"
                     /translation="MGSGAEPQSPEAYNNNPTLAAGEGVYLDRDSSGDKGLCMHVPLK
                     RISVRNNCKAGVRLAHFSKVHGLFQYSQRFNVTGSRSFSVDIFLPLIFAQYLLASGYW
                     SHSHLNLKDNIRRNYKMTNDTASSYSDEYKVIRNHPYVIELLDSGNYEVNHAYDVPDD
                     QKDHSLTAGTLIGKDLISHTPLALFLRSDLITERQESELIVFYHLGSRLCGHKGIIHG
                     GLLATLIDETFCRCGFPLLPNKLGVTATLDIQYLAPTKAESIIVVRAKTTKVEGRKVW
                     IEGAVSALPYPDAYESGHELTPAVKAKVLLVEPRWVEKLPKFSEGKTELATEEGTSEA
                     QQQQPTA"
     gene            <746553..>748787
                     /gene="ORC1"
                     /locus_tag="AWJ20_3938"
                     /db_xref="GeneID:30036014"
     mRNA            <746553..>748787
                     /gene="ORC1"
                     /locus_tag="AWJ20_3938"
                     /product="origin recognition complex subunit 1"
                     /transcript_id="XM_018880979.1"
                     /db_xref="GeneID:30036014"
     CDS             746553..748787
                     /gene="ORC1"
                     /locus_tag="AWJ20_3938"
                     /inference="similar to AA sequence:KEGG_Orthology:K02603"
                     /note="Largest subunit of the origin recognition complex;
                     involved in directing DNA replication by binding to
                     replication origins; also involved in transcriptional
                     silencing; exhibits ATPase activity; ORC1 has a paralog,
                     SIR3, that arose from the whole genome duplication;
                     GO_component: GO:0031261 - DNA replication preinitiation
                     complex [Evidence IDA] [PMID 9554851]; GO_component:
                     GO:0005664 - nuclear origin of replication recognition
                     complex [Evidence IDA,IMP] [PMID 9372948]; GO_component:
                     GO:0005656 - nuclear pre-replicative complex [Evidence
                     IDA] [PMID 16824194]; GO_component: GO:0005656 - nuclear
                     pre-replicative complex [Evidence IDA] [PMID 9335335];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11168584]; GO_component: GO:0000808 - origin recognition
                     complex [Evidence IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IDA] [PMID 17825064]; GO_function:
                     GO:0005524 - ATP binding [Evidence IMP] [PMID 9038340];
                     GO_function: GO:0016887 - ATPase activity [Evidence IMP]
                     [PMID 9038340]; GO_function: GO:0003677 - DNA binding
                     [Evidence IEA]; GO_function: GO:0003688 - DNA replication
                     origin binding [Evidence IDA] [PMID 16824194];
                     GO_function: GO:0003682 - chromatin binding [Evidence
                     IEA]; GO_function: GO:0003682 - chromatin binding
                     [Evidence IDA] [PMID 11168584]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_process: GO:0006260 - DNA replication
                     [Evidence IEA,IEA]; GO_process: GO:0006270 - DNA
                     replication initiation [Evidence IMP] [PMID 16716188];
                     GO_process: GO:0030466 - chromatin silencing at silent
                     mating-type cassette [Evidence IDA] [PMID 12897051];
                     GO_process: GO:0030466 - chromatin silencing at silent
                     mating-type cassette [Evidence IDA,IGI] [PMID 16581798];
                     GO_process: GO:0006267 - pre-replicative complex assembly
                     involved in nuclear cell cycle DNA replication [Evidence
                     IDA] [PMID 16824194]; GO_process: GO:0006267 -
                     pre-replicative complex assembly involved in nuclear cell
                     cycle DNA replication [Evidence IMP] [PMID 9335335]"
                     /codon_start=1
                     /product="origin recognition complex subunit 1"
                     /protein_id="XP_018733616.1"
                     /db_xref="GeneID:30036014"
                     /translation="MSDEDEWKYIYPSSENDAPDDESPRKRRTGLRNTSVLSPIGVRR
                     LADEQEFYVGDCVLLDSGSDTPYVGIIESFFFSEKGFMETRTIWFRRFSEITRQSARK
                     NAPENLEGELFATPDMGRDSLDILLEPAIVLSYSEYQNRIAATSDTPIEEKNTFFCRR
                     TFNSDRGLFGKEDFDWSTVYAGRGSDMLQLLANLEDLTPSTRKKTATPRASPAKKQPP
                     KKKIIELSSSDEEDELLSGSDSDEFFDTAEDKAGIRTSPSPTPSKRKRTSASEPKTPT
                     KSRKKASISNTPKTPKSSTVSPVKKRSTATPRRKLNPLQPTAVHALPVRMSPTKQVPT
                     SPHKFARDVLHVATVPDSLPCRESEFSQIFLALESAISSESGTCVYISGTPGTGKTAT
                     VREVIAQLQLRVEDEELPAFKFVEINGMKLTNPHTAYEILYENISNKKAAAATAMVLL
                     EKQFKSSSDNNSMPVVVLMDELDQLVTKNQGVMYNFFNWPTFSHSKLIVVAVANTMDL
                     PERMLSNKISSRLGLTRIQFPGYSHEQLREIISTRLANLPEGAGIVEKDAIEFASRKI
                     AGVSGDARRALDICRRAVELAQPEEEEISDTLNDGEKGSLDEHKVTIDHIKKAIAEST
                     SSPTHTFLRGLSMSAKILVCAMLSRVRRSGLIDNPLGDVLQETERIVKLSNDSEKLTA
                     VLFNNNRVRIAGFQYALNELIEGGVLLQQMLRGERSANIRLSIGEEYVKSAFKNDLQV
                     AGML"
     gene            complement(<748898..>749689)
                     /gene="SEC14"
                     /locus_tag="AWJ20_3939"
                     /db_xref="GeneID:30036015"
     mRNA            complement(<748898..>749689)
                     /gene="SEC14"
                     /locus_tag="AWJ20_3939"
                     /product="phosphatidylinositol/phosphatidylcholine
                     transfer protein SEC14"
                     /transcript_id="XM_018880980.1"
                     /db_xref="GeneID:30036015"
     CDS             complement(748898..749689)
                     /gene="SEC14"
                     /locus_tag="AWJ20_3939"
                     /note="Phosphatidylinositol/phosphatidylcholine transfer
                     protein; involved in regulating PtdIns, PtdCho, and
                     ceramide metabolism, products of which regulate
                     intracellular transport and UPR; has a role in
                     localization of lipid raft proteins; functionally
                     homologous to mammalian PITPs; SEC14 has a paralog,
                     YKL091C, that arose from the whole genome duplication;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IDA]
                     [PMID 1997207]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IDA] [PMID 7816798]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 1997207]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 12869188];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     2466847]; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0008525 -
                     phosphatidylcholine transporter activity [Evidence
                     IDA,IMP] [PMID 10488334]; GO_function: GO:0008525 -
                     phosphatidylcholine transporter activity [Evidence IDA]
                     [PMID 10848624]; GO_function: GO:0008525 -
                     phosphatidylcholine transporter activity [Evidence IDA]
                     [PMID 2407740]; GO_function: GO:0008526 -
                     phosphatidylinositol transporter activity [Evidence
                     IDA,IMP] [PMID 10848624]; GO_function: GO:0008526 -
                     phosphatidylinositol transporter activity [Evidence
                     IDA,IMP] [PMID 2215682]; GO_function: GO:0008526 -
                     phosphatidylinositol transporter activity [Evidence IDA]
                     [PMID 2407740]; GO_function: GO:0005215 - transporter
                     activity [Evidence IEA]; GO_process: GO:0043001 - Golgi to
                     plasma membrane protein transport [Evidence IMP] [PMID
                     10848624]; GO_process: GO:0043001 - Golgi to plasma
                     membrane protein transport [Evidence IMP] [PMID 19129178];
                     GO_process: GO:0043001 - Golgi to plasma membrane protein
                     transport [Evidence IMP] [PMID 6754086]; GO_process:
                     GO:0006896 - Golgi to vacuole transport [Evidence IGI,IMP]
                     [PMID 18753406]; GO_process: GO:0048194 - Golgi vesicle
                     budding [Evidence IDA] [PMID 9553090]; GO_process:
                     GO:0048194 - Golgi vesicle budding [Evidence IDA] [PMID
                     9736710]; GO_process: GO:0030437 - ascospore formation
                     [Evidence IMP] [PMID 14528019]; GO_process: GO:2001246 -
                     negative regulation of phosphatidylcholine biosynthetic
                     process [Evidence IDA,IMP] [PMID 7816798]; GO_process:
                     GO:1901352 - negative regulation of phosphatidylglycerol
                     biosynthetic process [Evidence IMP] [PMID 12869188];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IGI,IMP] [PMID 10567405]; GO_process:
                     GO:0015914 - phospholipid transport [Evidence IDA] [PMID
                     10848624]; GO_process: GO:0015914 - phospholipid transport
                     [Evidence IDA,IMP] [PMID 2215682]; GO_process: GO:0015914
                     - phospholipid transport [Evidence IDA] [PMID 2407740];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="phosphatidylinositol/phosphatidylcholine
                     transfer protein SEC14"
                     /protein_id="XP_018733617.1"
                     /db_xref="GeneID:30036015"
                     /translation="MYIACEKWREEFGTNTILEDFVYEEKPQVAKYYPQYYHKTDKDG
                     RPVYIEQLGAVKISEMYKITSQERMLKNLVWEYEAFVRYRLPATSRQRGYLVETSCTI
                     LDLKGCSLSTASSVYSYLREASAIGQNYYPERMGKFYLLNAPFGFATVFSMIKGFLDP
                     VTVEKIHILGSKYQSELLSQIPAENLPAKFGGKSVSAGSVELADDGPWRDMQFVGPEG
                     LAPKSSVSVLSSIAGTPSPSSAASSRPPSRAASISSKRSQKLQPQ"
     gene            <751932..>753830
                     /gene="NUP84"
                     /locus_tag="AWJ20_3940"
                     /db_xref="GeneID:30036017"
     mRNA            <751932..>753830
                     /gene="NUP84"
                     /locus_tag="AWJ20_3940"
                     /product="Nup84p"
                     /transcript_id="XM_018880982.1"
                     /db_xref="GeneID:30036017"
     CDS             751932..753830
                     /gene="NUP84"
                     /locus_tag="AWJ20_3940"
                     /inference="similar to AA sequence:KEGG_Orthology:K14301"
                     /note="Subunit of the Nup84p subcomplex of the nuclear
                     pore complex (NPC); contributes to nucleocytoplasmic
                     transport and NPC biogenesis; also plays roles in several
                     processes that may require localization of genes or
                     chromosomes at the nuclear periphery, including
                     double-strand break repair, transcription and chromatin
                     silencing; homologous to human NUP107; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0031965 - nuclear
                     membrane [Evidence IEA]; GO_component: GO:0005643 -
                     nuclear pore [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005643 - nuclear pore [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0031080 - nuclear pore outer ring
                     [Evidence IDA] [PMID 11823431]; GO_component: GO:0031080 -
                     nuclear pore outer ring [Evidence IDA] [PMID 18046406];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0017056 - structural constituent of
                     nuclear pore [Evidence IMP] [PMID 22331846]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IMP] [PMID 12482937]; GO_process: GO:0030466 -
                     chromatin silencing at silent mating-type cassette
                     [Evidence IDA] [PMID 21818277]; GO_process: GO:0006302 -
                     double-strand break repair [Evidence IGI] [PMID 15725626];
                     GO_process: GO:0006302 - double-strand break repair
                     [Evidence IMP] [PMID 16418532]; GO_process: GO:0006302 -
                     double-strand break repair [Evidence IMP] [PMID 17538013];
                     GO_process: GO:0006406 - mRNA export from nucleus
                     [Evidence IMP] [PMID 8565072]; GO_process: GO:0031990 -
                     mRNA export from nucleus in response to heat stress
                     [Evidence IMP] [PMID 18258809]; GO_process: GO:0051028 -
                     mRNA transport [Evidence IEA]; GO_process: GO:0035392 -
                     maintenance of chromatin silencing at telomere [Evidence
                     IMP] [PMID 16418532]; GO_process: GO:0031081 - nuclear
                     pore distribution [Evidence IMP] [PMID 8565072];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 22110603]; GO_process: GO:0045893 - positive
                     regulation of transcription, DNA-templated [Evidence
                     IDA,IGI,IMP] [PMID 15817685]; GO_process: GO:0000973 -
                     posttranscriptional tethering of RNA polymerase II gene
                     DNA at nuclear periphery [Evidence IMP] [PMID 20932479];
                     GO_process: GO:0006606 - protein import into nucleus
                     [Evidence IMP] [PMID 12730220]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0034398 -
                     telomere tethering at nuclear periphery [Evidence IMP]
                     [PMID 16418532]; GO_process: GO:0006810 - transport
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Nup84p"
                     /protein_id="XP_018733618.1"
                     /db_xref="GeneID:30036017"
                     /translation="MGASALSTGLGANKGLFNNTGSRFRTDTSGISKDPNLVTELDAD
                     APLRSKKTLCPEDEEADRIAFKYVFELLRARKYEEALDICEKTGNWSLKVTISGHNDY
                     IDPEIDGGLLSNIDDSEPRGAEAKVLWQYMCRQLARQAQNIDAYERGIYGFLGGDLDS
                     VLKLCDTWETQFIAYMSHLMVCDADAALVSDKRLAPGLAISPSAIKANHSSSSAQKVL
                     DILSNSSNPVVAVQSEHMIRTLMGAVINGTVGYLVEEASGILRQVMTGAQGSSPLTDN
                     PYILRIFVHLILFLQSIDVPVGDAENVSVILCGYIELLRLQNMGTIAPLYIAYLPDDI
                     AIDTYSVLLATITEQDIRKEHLQLGHKYGLDMANTIRAAVERVFSENEHLYDDQEFTD
                     ISTTVSESDVKLYQSIEWFIDSNMWPDAVHSMAALYRRFLSAGRVGAAREFGNRISVS
                     YVVKRYDGHMIGSGHSLTKVSTDSQNELAGIERIQVLEFERLLNCINDIAKWDLHVQV
                     PDQSSKPWRMDALAIVDSISSQVYDLCLNWFRQEEFELDQRIQRLRSIYLPYIILELG
                     RVLISAQKVHSGFLKQAAELAVVIADEKQGLYRLFLASNQLESLLTIVATAVTDGMAR
                     GESGIFDA"
     gene            complement(<754109..>754190)
                     /locus_tag="AWJ20_3941"
                     /db_xref="GeneID:30036018"
     tRNA            complement(<754109..>754190)
                     /locus_tag="AWJ20_3941"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30036018"
     gene            complement(<754376..>756945)
                     /gene="TOP1"
                     /locus_tag="AWJ20_3942"
                     /db_xref="GeneID:30036019"
     mRNA            complement(join(<754376..756696,756882..>756945))
                     /gene="TOP1"
                     /locus_tag="AWJ20_3942"
                     /product="DNA topoisomerase 1"
                     /transcript_id="XM_018880983.1"
                     /db_xref="GeneID:30036019"
     CDS             complement(join(754376..756696,756882..756945))
                     /gene="TOP1"
                     /locus_tag="AWJ20_3942"
                     /inference="similar to AA sequence:KEGG_Orthology:K03163"
                     /note="Topoisomerase I; nuclear enzyme that relieves
                     torsional strain in DNA by cleaving and re-sealing the
                     phosphodiester backbone; relaxes both positively and
                     negatively supercoiled DNA; functions in replication,
                     transcription, and recombination; role in processing
                     ribonucleoside monophosphates in genomic DNA into
                     irreversible single-strand breaks; GO_component:
                     GO:0005694 - chromosome [Evidence IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IPI] [PMID 10967121];
                     GO_component: GO:0005654 - nucleoplasm [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     6088500]; GO_component: GO:0031298 - replication fork
                     protection complex [Evidence IDA] [PMID 16531994];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0003916 - DNA topoisomerase activity
                     [Evidence IEA]; GO_function: GO:0003917 - DNA
                     topoisomerase type I activity [Evidence IEA,IEA];
                     GO_function: GO:0003917 - DNA topoisomerase type I
                     activity [Evidence IMP] [PMID 2989818]; GO_function:
                     GO:0003917 - DNA topoisomerase type I activity [Evidence
                     IDA] [PMID 6088500]; GO_function: GO:0003918 - DNA
                     topoisomerase type II (ATP-hydrolyzing) activity [Evidence
                     IEA]; GO_function: GO:0031490 - chromatin DNA binding
                     [Evidence IBA]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006200
                     - ATP catabolic process [Evidence IEA]; GO_process:
                     GO:0006271 - DNA strand elongation involved in DNA
                     replication [Evidence IMP] [PMID 2549254]; GO_process:
                     GO:0006265 - DNA topological change [Evidence IEA];
                     GO_process: GO:0006265 - DNA topological change [Evidence
                     IMP] [PMID 2989818]; GO_process: GO:0006265 - DNA
                     topological change [Evidence IDA] [PMID 6088500];
                     GO_process: GO:0006333 - chromatin assembly or disassembly
                     [Evidence IMP] [PMID 9199287]; GO_process: GO:0000183 -
                     chromatin silencing at rDNA [Evidence IMP] [PMID
                     10082585]; GO_process: GO:0007076 - mitotic chromosome
                     condensation [Evidence IGI,IMP] [PMID 8895658];
                     GO_process: GO:0007097 - nuclear migration [Evidence
                     IGI,IMP] [PMID 8895658]; GO_process: GO:0000019 -
                     regulation of mitotic recombination [Evidence IMP] [PMID
                     2902925]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 1660829]; GO_process: GO:0006368 -
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IMP] [PMID 2840207]"
                     /codon_start=1
                     /product="DNA topoisomerase 1"
                     /protein_id="XP_018733619.1"
                     /db_xref="GeneID:30036019"
                     /translation="MPEPIMMDSDMSDDDIPLVSRVASYVEVSDDDDDDDLVLAKRTT
                     TATKRKAISVKTEVNGSPPTKKRASTTVKKEKTTTASKAKKASTATVNGKAKKEVTSK
                     TNGRVKKETGSTASGKTKKEPGAGSKSATIKKEEEEEGTPAIDDEDQDETFRWWEAQN
                     AEDGSDKWNTLEHNGVMFPPPYEPLPSHVRMKYDGKRVELDPVAEEVAGFFGAMLNTD
                     HAKNPTFTANFFNDFVEIVNSSGGAKVNNKKIELKSFEKCDFTEIFEYYDQQRQLKKA
                     IPSSEKKRLKAEKDRMEEKYKTCLLDGRKQPVGNFRIEPPGLFRGRGAHPKTGKLKAR
                     VQPEQVTINIGAEAKVPEPPAGHQWAEVRHDKTVSWLAMWRENINGAFKYVFLAQSSS
                     LKGMSDFKKFEKARELKNHVERIRADYRRELKDEVMLNRQRATAMYLIDVLALRAGGE
                     KGEDEADTVGCCSLRYEHVTLQPPNIVTFDFLGKDSIRYFQEVVVDKQVFKNLKIFKR
                     APKTIGDDIFDRLDPPLLNKHLQNYMPGLTAKVFRTYNASYTMQKQLDLIENKGSVNE
                     KVVAFNAANREVAILCNHQRTVAKSHEASVGKMEDRILELKYSIIKTKKMMLQLDPSL
                     KKKEKAYFEDIDSISKEDVIKIHQKILEREKDRIEKKFIRENEKLKAEGEEIMPEGEL
                     KKRLEAIDIMEKEFAAELKSGKPDIKGNATVEKLKVQVEKLEERITNTQLQLKDKEDN
                     STVALGTSKMNYIDPRLTVMFSKKFNVPIEKLFTKTLREKFAWAIHSADADWKF"
     gene            complement(<757564..>758625)
                     /gene="CBP3"
                     /locus_tag="AWJ20_3943"
                     /db_xref="GeneID:30036020"
     mRNA            complement(<757564..>758625)
                     /gene="CBP3"
                     /locus_tag="AWJ20_3943"
                     /product="Cbp3p"
                     /transcript_id="XM_018880984.1"
                     /db_xref="GeneID:30036020"
     CDS             complement(757564..758625)
                     /gene="CBP3"
                     /locus_tag="AWJ20_3943"
                     /inference="similar to AA sequence:KEGG_Orthology:K17662"
                     /note="Mitochondrial protein required for assembly of
                     cytochrome bc1 complex; forms a complex with Cbp6p that
                     binds to mt ribosomes near the polypeptide tunnel exit and
                     promotes efficient translation of the COB mRNA;
                     Cbp3p-Cbp6p complex also interacts with newly synthesized
                     cytochrome b (Cobp) and Cbp4p to promote assembly of Cobp
                     into the cytochrome bc1 complex; Cbp3p-Cbp6p complex is
                     sequestered if assembly of Complex III is blocked,
                     downregulating COB mRNA translation; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 23509072]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0032592 - integral component of mitochondrial membrane
                     [Evidence IDA] [PMID 11522252]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005761 - mitochondrial ribosome [Evidence IDA] [PMID
                     21670217]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 11522252]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0043022 - ribosome binding [Evidence IDA,IPI] [PMID
                     21670217]; GO_process: GO:0034551 - mitochondrial
                     respiratory chain complex III assembly [Evidence IMP]
                     [PMID 11522252]; GO_process: GO:0034551 - mitochondrial
                     respiratory chain complex III assembly [Evidence IMP]
                     [PMID 15759116]; GO_process: GO:0070131 - positive
                     regulation of mitochondrial translation [Evidence IMP]
                     [PMID 21670217]"
                     /codon_start=1
                     /product="Cbp3p"
                     /protein_id="XP_018733620.1"
                     /db_xref="GeneID:30036020"
                     /translation="MAGVFVGSLRNAGRLAINNSISARSAGASLRAGVSTISSSHNGR
                     FGIRGYSSTPAEDASKEKGADAVSEPATPTPVTTPPFIAKPGSLKDQILKQYQVVDST
                     YNVKLPAWQNMLGENLVKTFNLDMDRIRSGPVAGALFKDMCKAQAFYQKEGDKITMTP
                     RAKFYYETLGMPQTFNQWYQVTLLHVWILFVRMRSMPRKYCREYQQKLVNSIFEDIDF
                     RLREEIKINSDRMVNNYKKGFNDQLRGSIFAYDEGFYSDDTVLAGALWRNLFESKKDI
                     DMTHIEQLVHYVRTQLYVLDRMSDLDFAAGRFQFIDPSLRYQPLTEGEDKEIKSIVES
                     NRKESTDAASRSTLSKEGW"
     gene            <758904..>759806
                     /gene="EMC2"
                     /locus_tag="AWJ20_3944"
                     /db_xref="GeneID:30036021"
     mRNA            <758904..>759806
                     /gene="EMC2"
                     /locus_tag="AWJ20_3944"
                     /product="Emc2p"
                     /transcript_id="XM_018880985.1"
                     /db_xref="GeneID:30036021"
     CDS             758904..759806
                     /gene="EMC2"
                     /locus_tag="AWJ20_3944"
                     /note="Member of conserved ER transmembrane complex;
                     required for efficient folding of proteins in the ER; null
                     mutant displays induction of the unfolded protein
                     response; homologous to worm Y57G7A.10/EMC-2, fly CG17556,
                     human TTC35; GO_component: GO:0072546 - ER membrane
                     protein complex [Evidence IDA] [PMID 19325107];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0034975 -
                     protein folding in endoplasmic reticulum [Evidence IGI]
                     [PMID 19325107]"
                     /codon_start=1
                     /product="Emc2p"
                     /protein_id="XP_018733621.1"
                     /db_xref="GeneID:30036021"
                     /translation="MSSETKEKLLTSMANASYYNASPRDLESLHAESRQYLSKAQHLI
                     PEEQLLGLLEQHFYLALLTCKDSEAKLVLQRLTDRITEDPSRVAILKAQYIEATDGPE
                     AAQKFLSARPTGDLRAFKRKTVILKQKGDIKTYIKELLRYVEEVAPNDSEAWAELAEA
                     YVSIGQYPQAIHALEEVLISAPQASNIFARLGEVFLIEATTSSPNKVTSDQLTLLIHS
                     AQHFLRSVELSPDYIRGWCGALIASSKILAWPKLAAEESTKYTKISKIAKKQTQRLIK
                     TAKEAAISDEDIAAAKIIIAQYEN"
     gene            complement(<760023..>760913)
                     /gene="TIP41"
                     /locus_tag="AWJ20_3945"
                     /db_xref="GeneID:30036022"
     mRNA            complement(<760023..>760913)
                     /gene="TIP41"
                     /locus_tag="AWJ20_3945"
                     /product="Tip41p"
                     /transcript_id="XM_018880986.1"
                     /db_xref="GeneID:30036022"
     CDS             complement(760023..760913)
                     /gene="TIP41"
                     /locus_tag="AWJ20_3945"
                     /inference="similar to AA sequence:KEGG_Orthology:K17607"
                     /note="Protein that interacts with Tap42p, which regulates
                     PP2A; component of the TOR (target of rapamycin) signaling
                     pathway; protein abundance increases in response to DNA
                     replication stress; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11914276]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0009968 - negative regulation of
                     signal transduction [Evidence IEA]; GO_process: GO:0007165
                     - signal transduction [Evidence IMP,IPI] [PMID 11741537]"
                     /codon_start=1
                     /product="Tip41p"
                     /protein_id="XP_018733622.1"
                     /db_xref="GeneID:30036022"
                     /translation="MDHITDKENRQGVPVFQTPRNGFAVPSPSQTTRVWTSPDNEWKV
                     TTVKKPILNSSEIDAATEKLGIPIPEMIFGNNQVKIENVPSGLCICFSALDALDLVDK
                     TGSRDGLVKVAYAKEWMDSREKSPHINDDVKGIVKPFDWTYTSAYKGDTTVKGVLADP
                     WVEDKDVILPMELLSRPDPILFFDDVCLYEDELGDNGIANFSVKIRVMPERLLLLSRL
                     FIRVDDVLFRVRDTRIFVEFSQGVLVREYKAHEETYDKVKKRVPIGSQDYSQNLRDSN
                     WVVKNIACSKTVHEIIELRK"
     gene            complement(<765914..>767086)
                     /locus_tag="AWJ20_3946"
                     /db_xref="GeneID:30036023"
     mRNA            complement(<765914..>767086)
                     /locus_tag="AWJ20_3946"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880987.1"
                     /db_xref="GeneID:30036023"
     CDS             complement(765914..767086)
                     /locus_tag="AWJ20_3946"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733623.1"
                     /db_xref="GeneID:30036023"
                     /translation="MKSSKIFPFKGERKKGGDGVELNREIANVEAPIAQITSTHAGSM
                     LGHRTEQKYPPLESIISNQSSAPYTLSNLQEYLRTIHCQEPLDLILMGYQFSTLFTSD
                     ETSISIAEKADKINEVRQLWNKIVSTFLLDSSPQEVNLPGELREHFYLIPVSQSVTTE
                     NYKHLQQAIEYAKDIIKENNFMLFIRNTQTMGALKANTRAKIQLNTSFMDQDHSIGHG
                     RGYSIGSSPTLNNPPHPLGCPQSNERSLRAASLAVPSKRNHRCISPTFPQIVDDGNLI
                     TTTTTSTFPSTLNANVEEDISRWTLQEPVRMFNRSPSPGTGKSPGASPGRTISPSPTP
                     SPRLSPVPASKSKKDLKNGPGVDSVTAVNASTFPHLLKRMSGKLKIRQQSSAHTPP"
     gene            <769234..>770232
                     /gene="GOR1"
                     /locus_tag="AWJ20_3947"
                     /db_xref="GeneID:30036024"
     mRNA            <769234..>770232
                     /gene="GOR1"
                     /locus_tag="AWJ20_3947"
                     /product="Gor1p"
                     /transcript_id="XM_018880988.1"
                     /db_xref="GeneID:30036024"
     CDS             769234..770232
                     /gene="GOR1"
                     /locus_tag="AWJ20_3947"
                     /note="Glyoxylate reductase; null mutation results in
                     increased biomass after diauxic shift; the authentic,
                     non-tagged protein is detected in highly purified
                     mitochondria in high-throughput studies; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0051287 -
                     NAD binding [Evidence IEA]; GO_function: GO:0048037 -
                     cofactor binding [Evidence IEA]; GO_function: GO:0047964 -
                     glyoxylate reductase activity [Evidence IEA]; GO_function:
                     GO:0047964 - glyoxylate reductase activity [Evidence IMP]
                     [PMID 17173333]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0016616 -
                     oxidoreductase activity, acting on the CH-OH group of
                     donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence ISS] [PMID 9341119]; GO_process: GO:0009436 -
                     glyoxylate catabolic process [Evidence IMP] [PMID
                     17173333]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence ISS] [PMID 9341119]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Gor1p"
                     /protein_id="XP_018733624.1"
                     /db_xref="GeneID:30036024"
                     /translation="MTAIKNQILLLGSVSLAKKEYQELSELAELISYTSSSREEFIAD
                     LKTKYKEITAIYSTFAGEKAVGGIDEEIVSHFPPSLKYICHNGAGYDLVQVEYLTKRG
                     IQLSNTPDAVANATADTAVYLILSALRNFSRLSEELRKGNWLGTVPLAREPKDKVLGI
                     LGMGSIGHLVHEKVIPLGFSKVIYYNRHQLPKEKEKGAEYVTFDELLAQSDVLFVSVP
                     LNAGTRHIINAEALAKAKDGVVVVNTARGAVIDEEALVQALESGKVSNVGLDVFEFEP
                     KIHPGLLANPNAVLLPHVGTHTVESRTEMELTVIRNIRSALTTGKVIDVVPEQQKK"
     gene            complement(<770433..>771488)
                     /locus_tag="AWJ20_3948"
                     /db_xref="GeneID:30036025"
     mRNA            complement(<770433..>771488)
                     /locus_tag="AWJ20_3948"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880989.1"
                     /db_xref="GeneID:30036025"
     CDS             complement(770433..771488)
                     /locus_tag="AWJ20_3948"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733625.1"
                     /db_xref="GeneID:30036025"
                     /translation="MASSKDIHSTLLAEIANLLKILDHEGGNLDHAVTHKVENSLNAI
                     KDISSLWQAHTTKLALAFKPPISGEAALKCLEEAGKLPRLLVAAYNAIDEDDKTGLMK
                     PEVKDHIDMLFLAENSFLEELKEAVVRERLLLQNLRPASADSNARTLVSVGEVWESCK
                     KLQALIDNGPVAVLQGKITAYSGIIRDAVEEFKELMEEEREDSDDENNDDDVDKPPSA
                     VSDSEEVDDFEEFNFSAPSKPLSKELRQVGIKWKDMFIRLPTVTEVLCKTLCKRLENT
                     ESTKIIKINTCIKSISEATDDLVFGFSDNSITDVKEGFVVVTKELETIADLTTRPDDN
                     FSTQLRAYIEKFKANNS"
     gene            complement(<776972..>777658)
                     /locus_tag="AWJ20_3949"
                     /db_xref="GeneID:30036026"
     mRNA            complement(<776972..>777658)
                     /locus_tag="AWJ20_3949"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880990.1"
                     /db_xref="GeneID:30036026"
     CDS             complement(776972..777658)
                     /locus_tag="AWJ20_3949"
                     /note="expressed protein"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733626.1"
                     /db_xref="GeneID:30036026"
                     /translation="MPLEQRYDTLQDNYIVRLHRNVDPENPVNAESTWWRKHMEHNEL
                     VQRLYEVLPKEEIFQDRIRRRKPPWKKEDMECESKAWKVKSELKKKIYQRHHTIWETQ
                     YRTSAKGEFYRSYTLPRLYNADHKNPLRYFLNECSKNELSKLVQLRTAKGAFGMFFKR
                     FKINNRPHQCECGEEEDVKHLLCECPVTENHRQILRDASAMLDLKVLLDSKKGLKAVL
                     AFLAKAPQLL"
     gene            <781841..>782137
                     /locus_tag="AWJ20_3950"
                     /db_xref="GeneID:30036028"
     mRNA            <781841..>782137
                     /locus_tag="AWJ20_3950"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880992.1"
                     /db_xref="GeneID:30036028"
     CDS             781841..782137
                     /locus_tag="AWJ20_3950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733627.1"
                     /db_xref="GeneID:30036028"
                     /translation="MDPNSQPAFSSTVYFVPSGSSGHGLNLVKTLASVGNSVVITTAA
                     NPEMSIDLQNWVKNHSNVHVLKYDGSNESDADDVANQIIELTGGIDVVVNTRTW"
     gene            <783804..>787265
                     /gene="PBP1"
                     /locus_tag="AWJ20_3951"
                     /db_xref="GeneID:30036029"
     mRNA            <783804..>787265
                     /gene="PBP1"
                     /locus_tag="AWJ20_3951"
                     /product="Pbp1p"
                     /transcript_id="XM_018880993.1"
                     /db_xref="GeneID:30036029"
     CDS             783804..787265
                     /gene="PBP1"
                     /locus_tag="AWJ20_3951"
                     /note="Component of glucose deprivation induced stress
                     granules; involved in P-body-dependent granule assembly;
                     similar to human ataxin-2; interacts with Pab1p to
                     regulate mRNA polyadenylation; interacts with Mkt1p to
                     regulate HO translation; protein increases in abundance
                     and relative distribution to the nucleus increases upon
                     DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0010494 - cytoplasmic stress
                     granule [Evidence IDA] [PMID 18981231]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005844 - polysome [Evidence IDA] [PMID
                     15082763]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA] [PMID 23222640]; GO_process: GO:0006378 -
                     mRNA polyadenylation [Evidence IGI,IMP,IPI] [PMID
                     9819425]; GO_process: GO:0045727 - positive regulation of
                     translation [Evidence IMP,IPI] [PMID 15082763];
                     GO_process: GO:0034063 - stress granule assembly [Evidence
                     IMP] [PMID 18981231]"
                     /codon_start=1
                     /product="Pbp1p"
                     /protein_id="XP_018733628.1"
                     /db_xref="GeneID:30036029"
                     /translation="MSTTASRGGRQPSVSGRNGSNGGGRRFNGGGGGNSGQGSSSSAN
                     GNGINSGTNLAAVDPPLVRGGPGGRASLSGPSTTSGPGSNATAGSGSGAGSRGSGGIG
                     PKNAWSKPLQSSVTTTSGGSSGSGTTVSNNNSNSNSGALSNVAGSNESNSQNHSSAAA
                     ATPASSAFSSGSTESVASGDPEKHMNDRLTFLLAKSIGCTAIVTVASGHRYKGILAGA
                     LTDSDLGVVLRFAEKTSSVPGIEDEDAAADPNGNSGTSGTTGNKASGNNSTSAAGDDG
                     KNKRNGSEEQKRFDKLVIAPKDCVDIFIENPDLTPDVKSETPANSVSSGINKSSGAFK
                     TDTDISGRRNGLGGERELQRWTPDSNIELGVTLEETAGSNSGGWDQFSVNKQKFGVAS
                     TYDEHYYTTAIDKSHPEYQERARRAEQIAAEITKSGHGGNVHLAEERGLAIDDSGLDE
                     EDKYSGVDRGQQKRDSLGQTSGQSQRVPVQKLFQQAHREKLQGQGQAQTGYEPDQRQT
                     PSPPVPSGSTKAKKYTPPQFRAPTGVKGVPGVPYDPAIVSSSLASPDGSLAPRTQDMS
                     ARVGKSDDKSNTPTAVAPAATASATASAAPVVQAANSEGANASSNTSASDSPSGGIEK
                     ELAGNFRQFVSVEVQRLNQKKQYLQKREKSERLHDFKKFSEDYKINAPVPLDLVPILA
                     KGKDKQEEIVQRAAANAAAAHSPKTSPSTSKTSTVAPALPATGSPRGTSTESSPAITN
                     NTHPSTLDGATSTGTKAVLPNKPTTKPSTVQPTPAVPAVPVPVSTAPVTTSAPASTPA
                     TGTPVPSAAAAEKPKFNFKVPGFKPNPSAHSFTPFGAKGSPSPVASQISSPQTKVTAP
                     VPETGSATGRAPVATATANSATSGTATPNSFFGGRQPGAKSRQNKFNPFLEAKSHHKP
                     DETFTIERAFATPPTWTPGVEKSYSEVLTSLKISSPRIGGFFPPGSGGIGSPRPSVTG
                     FAPSASPMGMSGAANLVAMMPATAFDEVGNPIMTTSPPPIPGQMMPAGMVPVGYPQYV
                     PQYGAPQYYGRPPPMGFPMGYLPPQAGYGSPRMHQAMMVPPGQPSNGYYPPQHQFIPQ
                     QRTHHNNNNNYSRRGSAGPGNHGGGGGGPPTSLPPQMQGQFPPPPASNALNSKSPTPT
                     TPVEEEK"
     gene            <787754..>789199
                     /locus_tag="AWJ20_3952"
                     /db_xref="GeneID:30036030"
     mRNA            <787754..>789199
                     /locus_tag="AWJ20_3952"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880994.1"
                     /db_xref="GeneID:30036030"
     CDS             787754..789199
                     /locus_tag="AWJ20_3952"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733629.1"
                     /db_xref="GeneID:30036030"
                     /translation="MDKLITELIEQPKEGSHFRDPGLGPLPSAQNLDKARKVIAETSN
                     KLPLEGLGIEKVAGILTNDILPALPNQSSHYYGFVTGGATPAARLADHLAVWADTMPQ
                     VHLPEESVSTDVEDAALKLLLDLLKLERTQWLGRTITTGATASNVLALACARDWLVGS
                     DEASIAEHGFANALKASGVQDIKIYVCKSHSSIGKAASIVGLGRKSVVEISDAAHLWN
                     FDIAKLEEQLISDKSKSIRSIICANFGEVNTGQYTQDIKELRRLCDQYKAWLHIDGAF
                     GVYLRALADKYDSAYHQLAQRVTAGLELADSITGDSHKTLNVPYDSGVFFTKHKELLQ
                     HIFHNPGAVYLSGTSDSIPSPLNIGIENSRRFRALAVYSTLLAYGEAGYSQFIERIIR
                     FSQRLSAWIHQSPDYELLLESPKDAISVVLFRAKDTEANKTLKQRINQSGKIYVSGTV
                     WNGSPAVRIAPCNWNIADGDEQIVINVLSTF"
     gene            <789406..>791118
                     /gene="RRN7"
                     /locus_tag="AWJ20_3953"
                     /db_xref="GeneID:30036031"
     mRNA            <789406..>791118
                     /gene="RRN7"
                     /locus_tag="AWJ20_3953"
                     /product="Rrn7p"
                     /transcript_id="XM_018880995.1"
                     /db_xref="GeneID:30036031"
     CDS             789406..791118
                     /gene="RRN7"
                     /locus_tag="AWJ20_3953"
                     /inference="similar to AA sequence:KEGG_Orthology:K15219"
                     /note="Component of the core factor (CF) rDNA
                     transcription factor complex; CF is required for
                     transcription of 35S rRNA genes by RNA polymerase I and is
                     composed of Rrn6p, Rrn7p, and Rrn11p; GO_component:
                     GO:0070860 - RNA polymerase I core factor complex
                     [Evidence IDA] [PMID 7958901]; GO_component: GO:0070860 -
                     RNA polymerase I core factor complex [Evidence IDA] [PMID
                     8702872]; GO_component: GO:0070860 - RNA polymerase I core
                     factor complex [Evidence IDA] [PMID 8887672];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     22362748]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0001164 - RNA polymerase I CORE
                     element sequence-specific DNA binding [Evidence IDA] [PMID
                     18451108]; GO_function: GO:0001187 - RNA polymerase I CORE
                     element sequence-specific DNA binding transcription factor
                     recruiting transcription factor activity [Evidence IC];
                     GO_function: GO:0017025 - TBP-class protein binding
                     [Evidence IDA,IPI] [PMID 8702872]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_process: GO:0006355
                     - regulation of transcription, DNA-templated [Evidence
                     IEA]; GO_process: GO:0006361 - transcription initiation
                     from RNA polymerase I promoter [Evidence NAS] [PMID
                     7958901]; GO_process: GO:0042790 - transcription of
                     nuclear large rRNA transcript from RNA polymerase I
                     promoter [Evidence IDA,IMP] [PMID 7958901]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Rrn7p"
                     /protein_id="XP_018733630.1"
                     /db_xref="GeneID:30036031"
                     /translation="MSSIWVRGPVCGVDNCRSRLWRSVDGRKVCQYGHVKEGIEVGDD
                     DDDFLAFGRVISRPSSRRNSSAQEKEHALIGAAAQALYFQCLQVVLRQQVKWLIEEKG
                     VPSELEGVVRSLWTILVNQTKFGVSNMNSSRASSAAKSDASQDESEKYTTHNDEDTGN
                     DEDEDDYDDDGDEENNYRNDSDTERERRGRRKIKTEKLPEIKFGHLVVICYLGCVTIR
                     SPVYLYDFQKWIERLEFPFIRALAYLPLEMSQKVVGTHYRGLLSPEIPRDGKLHGLLA
                     ELGSFYIHSGVTFPPQPVEPLLFRMIKDLLLPPEIYVASEKLAEALEISLLVSISNHY
                     YPQFETALFGVIIIAVRLCYGVGDEWTRVPKSYSTPASKTIDWDLWCDIMRKIWVEDD
                     EFFDVNESDICYWDPEKSERYLSWVENSLLILPRFRSEYKRLLQLFPLGKYDKSGNPM
                     STKAFEPRQGHPRSDLAIHAGEKEIEELYRIVQSTTRNVECHYPEDVLDKIKVKGVLL
                     SPGARFETYRQNDKLPLFMTIVCHVGSKLCGVSFDSVKRLIHDLDRKCNKLDFSAMSE
                     QSFY"
     gene            complement(<791308..>792243)
                     /gene="CDC21"
                     /locus_tag="AWJ20_3954"
                     /db_xref="GeneID:30036032"
     mRNA            complement(<791308..>792243)
                     /gene="CDC21"
                     /locus_tag="AWJ20_3954"
                     /product="thymidylate synthase"
                     /transcript_id="XM_018880996.1"
                     /db_xref="GeneID:30036032"
     CDS             complement(791308..792243)
                     /gene="CDC21"
                     /locus_tag="AWJ20_3954"
                     /inference="similar to AA sequence:KEGG_Orthology:K00560"
                     /note="Thymidylate synthase; required for de novo
                     biosynthesis of pyrimidine deoxyribonucleotides;
                     expression is induced at G1/S; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 8132557]; GO_function:
                     GO:0008168 - methyltransferase activity [Evidence IEA];
                     GO_function: GO:0004799 - thymidylate synthase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004799 - thymidylate
                     synthase activity [Evidence IMP] [PMID 334734];
                     GO_function: GO:0004799 - thymidylate synthase activity
                     [Evidence IDA] [PMID 6287238]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0006231 - dTMP biosynthetic process [Evidence IEA];
                     GO_process: GO:0006231 - dTMP biosynthetic process
                     [Evidence IMP] [PMID 334734]; GO_process: GO:0006231 -
                     dTMP biosynthetic process [Evidence IMP] [PMID 794696];
                     GO_process: GO:0006235 - dTTP biosynthetic process
                     [Evidence IEA]; GO_process: GO:0032259 - methylation
                     [Evidence IEA]; GO_process: GO:0009165 - nucleotide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="thymidylate synthase"
                     /protein_id="XP_018733631.1"
                     /db_xref="GeneID:30036032"
                     /translation="MTSDESLTTGGPVKTNTENVEERAYLDLCKDIIEQGEFRADRTG
                     TGTYSLFAPNQLRFSLRNGTLPLLTTKRVYFKGVLEELLWFVKGSTDSKLLSDRGVHI
                     WDGNGSREFLDKRGLEHRREGDLGPVYGFQWRHFGAKYEDCDTDYSGKGVDQLAEVIR
                     KIKETPYDRRIIMSAWNPADMNDMALPPCHVFSQFYVSFRNGKPELSCQLYQRSCDMG
                     LGVPFNIASYALLTKMIAKVCGIECGDFIHTMGDAHVYADHVEALKVQIARTPTDFPT
                     LRFARDITDIDDFKYEDFVVEGYKPQSKIEMKMSV"
     gene            complement(<792503..>792573)
                     /locus_tag="AWJ20_3955"
                     /db_xref="GeneID:30036033"
     tRNA            complement(<792503..>792573)
                     /locus_tag="AWJ20_3955"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:30036033"
     gene            <798789..>802895
                     /gene="GIP3"
                     /locus_tag="AWJ20_3956"
                     /db_xref="GeneID:30036034"
     mRNA            join(<798789..799029,799108..>802895)
                     /gene="GIP3"
                     /locus_tag="AWJ20_3956"
                     /product="protein phosphatase regulator GIP3"
                     /transcript_id="XM_018880997.1"
                     /db_xref="GeneID:30036034"
     CDS             join(798789..799029,799108..802895)
                     /gene="GIP3"
                     /locus_tag="AWJ20_3956"
                     /codon_start=1
                     /product="protein phosphatase regulator GIP3"
                     /protein_id="XP_018733632.1"
                     /db_xref="GeneID:30036034"
                     /translation="MTANESTLNGVDHSSPINISPSARNPLLDSTSSLSRSVTSSQLE
                     LEPTHNGVSNTDVDWLSRGSSLKDRGQYPLPNSVAGGRVRTRSNSLPPVPSGERLPPQ
                     LGRSKATTGVSVEGGQASSKELGGSDQSGENIINNKKKIPAAAAAASTIEEDEEAEES
                     SEKGPPLSPTSTTLRNPAPGPGYANQAVTAHSKLSQGLRSSKTMPIALEKTQVGSELT
                     RSISVSSAALGKSPSDKLPSTSPSNARRGSWFHNLSSKFSSSSSHNNNGSSVVSNQRR
                     ASTSGLKNTVPGSTLSTGSVKDSPSSGLGLDVESHSNLAHAHVAGGNIPPSANPIFSP
                     SYTNNRNLPTNRILDTHPPRTSSPKLSPEIAVGGTAQSPSPSSAFPFKQEHNRSNSVS
                     STGSLVNRLRRLSTRSNGSQSDLISTQFKAESQQVRVILNKNHSKKPCKIPELEGVLP
                     PTVRFKAEVFETDPPQQIPARNPRTGNITFGPNGEINREPLPPNGYPMPLYVLPRNYG
                     ASTLAASQSAYESAIRVANSVKSSGGVSIFKSRNSLSSTTSFSSNNTEYDEEKDVSES
                     DRTQSLKIDKPMHSAERMGSGSTNTTTASTGDSSVEDDDLDEQGKELTLETIYTRCCH
                     LREILPIAATLKQIKDRKPPLEVIKMMNPRPTLIEILSLSDFLSVVPVRMLIFDNVSL
                     STEMFRIILSSVVTSDHLERLSLRNLILDDKGWKLFCAFFSENSSLVKLDLSIEKVNS
                     KQPSDRSLLDWDLFTKALVARGGVEELILNGCVVPSDELAPLIFNGCSLSTKRLGLAL
                     NDLLPEDLQVIMKWAADPSCVCEGLDLGGNLMDQSWDAIKEILKGKCLKFLSLNSTGL
                     ANVTKANEIFGGVCSHSNLIMLDLSSNPDLFPKFTHVLAKVLPTFTDLRRIHLESNNL
                     SPEDVMLLADAFARCPKLVHISVLDNRRLDSTACAALAIATHISNTIYRVESDNDLWP
                     VILQRRLAHNCLVNMELTAGRITQQEKDSDDDGLFGKEDLMNTGNYIAMAAEELLKSI
                     KEDDDNDSEDAQGHLVVSEMVRRAKQVRVKIRKTLDELFEKRRSGVGLVVEEKERLVR
                     LCFLDGTLEKVLDKYNQTKLYKHENQNEESTKGSGNDVSTQNRMGTTSLSGKSVPPLN
                     MPPLLPVDREVVLSTTVSTHPDFTIAPVSEYPEVQSLSRRSSVTSLHRKEQELEEGEL
                     HRFGTFIRSHRDSHTDLSDDDEDEDAHVVDSEEDIRRRSSDEGTGEELRQKILAAKGS
                     QSVSELIQQLQQMHGPELDRILAAGKDKSLSERDDILLRLNHAARPRSAQASTPPEDT
                     KLLAGDYVTLDSVVDDIARALT"
     gene            complement(<803096..>803986)
                     /gene="RPL5"
                     /locus_tag="AWJ20_3957"
                     /db_xref="GeneID:30036035"
     mRNA            complement(<803096..>803986)
                     /gene="RPL5"
                     /locus_tag="AWJ20_3957"
                     /product="ribosomal 60S subunit protein L5"
                     /transcript_id="XM_018880998.1"
                     /db_xref="GeneID:30036035"
     CDS             complement(803096..803986)
                     /gene="RPL5"
                     /locus_tag="AWJ20_3957"
                     /inference="similar to AA sequence:KEGG_Orthology:K02932"
                     /note="Ribosomal 60S subunit protein L5; homologous to
                     mammalian ribosomal protein L5 and bacterial L18; binds 5S
                     rRNA and is required for 60S subunit assembly;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0022625 - cytosolic large ribosomal
                     subunit [Evidence IDA] [PMID 11983894]; GO_component:
                     GO:0005622 - intracellular [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA,IEA];
                     GO_function: GO:0008097 - 5S rRNA binding [Evidence IEA];
                     GO_function: GO:0008097 - 5S rRNA binding [Evidence IDA]
                     [PMID 8764831]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0019843 - rRNA binding
                     [Evidence IEA]; GO_function: GO:0003735 - structural
                     constituent of ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IC] [PMID 11983894]; GO_process: GO:0002181 - cytoplasmic
                     translation [Evidence IC] [PMID 11983894]; GO_process:
                     GO:0000027 - ribosomal large subunit assembly [Evidence
                     IMP] [PMID 8474444]; GO_process: GO:0006412 - translation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L5"
                     /protein_id="XP_018733633.1"
                     /db_xref="GeneID:30036035"
                     /translation="MAFQKIEKTAAYHSRYQTPFRRRREGKTDYYARKRLVTQHKAKY
                     NSPKYRLVIRFTKKDIIAQVVSSQITGDVVLSAAYAHELPRYGIKHGLTNWSAAYAVG
                     LLIARRTLQKLGLDETYQGDEEASGEYSLTEAVEDGPRPFKVFLDVGLTRTTTGNRVF
                     GAMKGASDGGLYIPHSAKRFPGFDIETEELDADVLRKYIVGGHVAEYMEELADDDEER
                     YRTLFKSYIEDDIEADGVEDIYTEAHEKIRADPSFVPSNKKSKEEYKAISLKYKQKKL
                     TSEERKAKVAAKIAEFQANN"
     gene            complement(<807826..>808116)
                     /locus_tag="AWJ20_3958"
                     /db_xref="GeneID:30036036"
     mRNA            complement(<807826..>808116)
                     /locus_tag="AWJ20_3958"
                     /product="putative amidotransferase"
                     /transcript_id="XM_018880999.1"
                     /db_xref="GeneID:30036036"
     CDS             complement(807826..808116)
                     /locus_tag="AWJ20_3958"
                     /note="Putative glutamine amidotransferase; has
                     Aft1p-binding motif in the promoter; may be involved in
                     copper and iron homeostasis; YLR126C is not an essential
                     protein; relocalizes from nucleus to cytoplasmic foci upon
                     DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 22842922];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0006878 - cellular
                     copper ion homeostasis [Evidence IEP,ISS] [PMID 14534306];
                     GO_process: GO:0006879 - cellular iron ion homeostasis
                     [Evidence IEP,ISS] [PMID 14534306]; GO_process: GO:0006541
                     - glutamine metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="putative amidotransferase"
                     /protein_id="XP_018733634.1"
                     /db_xref="GeneID:30036036"
                     /translation="MEMHRDIVPDLPINTELLFSNDICYNQGFYRKDSILTVQGHPEF
                     NEDIINKIVDVRADTGVISPELANDARNRSGDRNDGPGLAKVMVKFITEGLE"
     gene            complement(<808285..>808620)
                     /locus_tag="AWJ20_3959"
                     /db_xref="GeneID:30036037"
     mRNA            complement(<808285..>808620)
                     /locus_tag="AWJ20_3959"
                     /product="amidotransferase (predicted)"
                     /transcript_id="XM_018881000.1"
                     /db_xref="GeneID:30036037"
     CDS             complement(808285..808620)
                     /locus_tag="AWJ20_3959"
                     /codon_start=1
                     /product="amidotransferase (predicted)"
                     /protein_id="XP_018733635.1"
                     /db_xref="GeneID:30036037"
                     /translation="MSHIAILEADTPMPSVAEVHGSYGDIFKRLLLNAKLDPKSVIKA
                     YDVVTKQEYPNSLDGVDAILITGSKHNAFGDDEWIIKLVNFTKQAIDAGIKVVGTYRI
                     YSWFPASYS"
     gene            complement(<809345..>810463)
                     /locus_tag="AWJ20_3960"
                     /db_xref="GeneID:30036039"
     mRNA            complement(<809345..>810463)
                     /locus_tag="AWJ20_3960"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881002.1"
                     /db_xref="GeneID:30036039"
     CDS             complement(809345..810463)
                     /locus_tag="AWJ20_3960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733636.1"
                     /db_xref="GeneID:30036039"
                     /translation="MTVLLFMSMTLKFWQIFDYKWIVLSYIITGIFGSGVLSAVMVSS
                     YVTDSIKPRDRATAMGYVTACVLTGKALGPLISSHVIRCMNGKLIGVPLVACLFDAAA
                     LVWWKFTPESRQLSVNTKSMPMSRREEGSALSLALDRLNIFRSLYTIKNIAASQPNPA
                     SKNIFILISIDLLFEIIISGRANIAILYPEMKFGWTAVEIGYLQSATAVYRIVLLVLL
                     IPHFIKLLQKYYDEDEEELTGQIAMQEHCITRSQKVIIAIGNCFECVGYMGYGIATKG
                     LEYSISYFISTTGVFSKPAVQSGLLNLIPADQVGEFLGAKGVLDGITGLMFSSIGLSF
                     YSYTVARNPAIIFYVCTFGYLIVVLLASRLRLNRQLHL"
     gene            complement(<811717..>812742)
                     /gene="YKU70"
                     /locus_tag="AWJ20_3961"
                     /db_xref="GeneID:30036040"
     mRNA            complement(<811717..>812742)
                     /gene="YKU70"
                     /locus_tag="AWJ20_3961"
                     /product="Yku70p"
                     /transcript_id="XM_018881003.1"
                     /db_xref="GeneID:30036040"
     CDS             complement(811717..812742)
                     /gene="YKU70"
                     /locus_tag="AWJ20_3961"
                     /inference="similar to AA sequence:KEGG_Orthology:K10884"
                     /note="Subunit of the telomeric Ku complex
                     (Yku70p-Yku80p); involved in telomere length maintenance,
                     structure and telomere position effect; required for
                     localization of telomerase ribonucleoprotein to nucleus
                     via interaction with the TLC1 guide RNA; relocates to
                     sites of double-strand cleavage to promote nonhomologous
                     end joining during DSB repair; GO_component: GO:0043564 -
                     Ku70:Ku80 complex [Evidence IEA]; GO_component: GO:0043564
                     - Ku70:Ku80 complex [Evidence IDA] [PMID 8754818];
                     GO_component: GO:0005694 - chromosome [Evidence IEA];
                     GO_component: GO:0000781 - chromosome, telomeric region
                     [Evidence IEA,IEA]; GO_component: GO:0000790 - nuclear
                     chromatin [Evidence TAS] [PMID 10367891]; GO_component:
                     GO:0005635 - nuclear envelope [Evidence IDA] [PMID
                     10638763]; GO_component: GO:0005724 - nuclear telomeric
                     heterochromatin [Evidence TAS] [PMID 12080091];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0004003 - ATP-dependent DNA helicase
                     activity [Evidence IEA]; GO_function: GO:0003677 - DNA
                     binding [Evidence IEA,IEA]; GO_function: GO:0003723 - RNA
                     binding [Evidence IDA] [PMID 12975323]; GO_function:
                     GO:0003684 - damaged DNA binding [Evidence IEA];
                     GO_function: GO:0003684 - damaged DNA binding [Evidence
                     TAS] [PMID 10367891]; GO_function: GO:0004386 - helicase
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_function:
                     GO:0042162 - telomeric DNA binding [Evidence IEA];
                     GO_process: GO:0032508 - DNA duplex unwinding [Evidence
                     IEA]; GO_process: GO:0006310 - DNA recombination [Evidence
                     IEA]; GO_process: GO:0006281 - DNA repair [Evidence IEA];
                     GO_process: GO:0006974 - cellular response to DNA damage
                     stimulus [Evidence IEA]; GO_process: GO:0006333 -
                     chromatin assembly or disassembly [Evidence IDA] [PMID
                     11553718]; GO_process: GO:0006342 - chromatin silencing
                     [Evidence IDA,IMP] [PMID 9501103]; GO_process: GO:0030466
                     - chromatin silencing at silent mating-type cassette
                     [Evidence IGI,IMP] [PMID 18791224]; GO_process: GO:0000727
                     - double-strand break repair via break-induced replication
                     [Evidence IGI,IMP] [PMID 17321803]; GO_process: GO:0000724
                     - double-strand break repair via homologous recombination
                     [Evidence IMP] [PMID 11016833]; GO_process: GO:0006303 -
                     double-strand break repair via nonhomologous end joining
                     [Evidence IEA]; GO_process: GO:0006303 - double-strand
                     break repair via nonhomologous end joining [Evidence IMP]
                     [PMID 10908335]; GO_process: GO:0097552 - mitochondrial
                     double-strand break repair via homologous recombination
                     [Evidence IMP] [PMID 22214610]; GO_process: GO:0000723 -
                     telomere maintenance [Evidence IEA]; GO_process:
                     GO:0000723 - telomere maintenance [Evidence IMP] [PMID
                     10818099]"
                     /codon_start=1
                     /product="Yku70p"
                     /protein_id="XP_018733637.1"
                     /db_xref="GeneID:30036040"
                     /translation="MQQFDDASNIKSSRRCFIVTDNEDPSFGNSQQRTAAKTNAEELV
                     NKNVIIEPAFLSHGDSKGEGSNFDMSQFWDSITFTKPMDDEENADVEPVPSSYLVSDL
                     TLKTSLLSRRSPKRALFTNRIELAPGIEIGVKGYLTFSKQLFVKDRYVYTQGEEKQIV
                     KSEVKITDDESVNTVSPDEIIRAYEFGDSYIYFTPEQVNQIRNLGRPLIRIIGFKSPS
                     FVPPEYNKRHSMFVYPSDSKLTGSIRAFHSLYQCMRQKGKVAIAWAIIRSNSIPEPCA
                     LFPVNEEVETKGSLTVQVTPPGFQLVILPYADDIRARPMSTITEGKAERIYNSFNRNK
                     LTINSPK"
     gene            complement(<812890..>813144)
                     /locus_tag="AWJ20_3962"
                     /db_xref="GeneID:30036041"
     mRNA            complement(<812890..>813144)
                     /locus_tag="AWJ20_3962"
                     /product="ATP-dependent DNA helicase II subunit 1"
                     /transcript_id="XM_018881004.1"
                     /db_xref="GeneID:30036041"
     CDS             complement(812890..813144)
                     /locus_tag="AWJ20_3962"
                     /codon_start=1
                     /product="ATP-dependent DNA helicase II subunit 1"
                     /protein_id="XP_018733638.1"
                     /db_xref="GeneID:30036041"
                     /translation="MLELRHHESFDEPKSAVVLALEAVYEAIKSRLIVSPGDKSGIIL
                     YGTKKTSDAAFAWCNILMPLGAPSASQLRRVRRIIESKFH"
     gene            <814621..>820464
                     /gene="POL2"
                     /locus_tag="AWJ20_3963"
                     /db_xref="GeneID:30036042"
     mRNA            <814621..>820464
                     /gene="POL2"
                     /locus_tag="AWJ20_3963"
                     /product="DNA polymerase epsilon catalytic subunit"
                     /transcript_id="XM_018881005.1"
                     /db_xref="GeneID:30036042"
     CDS             814621..820464
                     /gene="POL2"
                     /locus_tag="AWJ20_3963"
                     /inference="similar to AA sequence:KEGG_Orthology:K02324"
                     /codon_start=1
                     /product="DNA polymerase epsilon catalytic subunit"
                     /protein_id="XP_018733639.1"
                     /db_xref="GeneID:30036042"
                     /translation="MAYDIETTKAPLKFPDSAVDKIMMISYMIDGEGFLITNREIVSK
                     DIEDFEYTPKPEYKGVFTIFNEETEKELLVRFFDHIKEEKPTVIATFNGDFFDWPFVE
                     ARAAFHGIDMYQEIGFQKDAEEEYKSTHCVHMDCFRWVKRDSYLPQGSQGLKAVTTAK
                     LGYNPIEVDPEMMTPYAIEQPQVMAEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNP
                     DEVLRKGTGTLCEMLLMVQAYKNGILLPHKHKDPAERFYDGHLIESETYVGGHVESLE
                     AGVFRSDIPTDFNIDTTAIDELLKDLDSALNFTIEVEAKKKVSDITNYDEVKADVTAA
                     LIKLKTDPKRHERPSIYHVDVASMYPNIMTTNRLQPDSMISEEDCASCDFNRPGKTCD
                     RRLPWAWRGEFFPTKKDEYLMIRNSLQNERFPGRFPDSPSRDFKDLSSTEQAAAIKKR
                     ITEYSKKVYHKVKVTETIEREAIICQRENPFYVNTVRDFRDRRYEFKGLQKVWKRKVD
                     DIPASDVSGREEAKKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGVTCLTG
                     ATIIQMARSLVERIGRPLELDTDGIWCILPKTFPEDFTFNLTDGKKLPISYPCVMLNH
                     LVHAKFTNHQYQILEDSTTLRYKTISDNSIFFEVDGPYKAMILPTSKEEDKNLKKRYA
                     VFNPDGSLAELKGFEVKRRGELRLIKAFQSQVFSVFLKGTTLTECYAEVGKVANSWLD
                     ILDSKGKTLEEDDLIDLISENRSMSKTLQEYEGMKSTSICTARRLAEFLGSQMVKDKG
                     LACKYIISKKPLGAAITDRAVPVAIFSAETSVKSHYLKKWLKDPGLDDYDPRSILDWD
                     YYRERLASTIQKMVTIPAALQQVSNPVSRIQHPDWLLKRISTKNDKLKQKKLSSFFST
                     GSKPMTDASNKVNQLSGSILNNDRIHDIEDLTLGDARVTTAKIGKVAMKRKGNNSEAQ
                     SVALQEQFVSLSLEMPSPEEDYGEWLRYHKKKWAIQKQSRQNRQHLFGDSSRKIGVSG
                     LIMQQTETAYSNSWQFLQFCPSEKGGEARAFVYINDKIQTIRINVGRRLYVNFRRATP
                     SVYELPNCKVEKVNHTLPNGRTSDHLYRLHMSESAYETEMAKADSVLKHANIEGIYES
                     QLGAEDRSLLELGCTTILDNSKPGLLGAGLEKGFSLEWLKPYNEVYLLNSKLNYLFLC
                     HLVSHELQVFALVPSWSSQAFVFVLRPSRSAQGLPNLSKSYEEFLKESNVSMDPGSPI
                     FNYQDQLVFEESYFDDISKLYKKLGQAITKLHSENATKAILCIQSPQAGRLKKLLRPI
                     NDFPNIEIRSSTMAIPQIGWQTAAAKRICKSYLSLRSWIGLYCRLSRYSDVPIGNLKG
                     DDIRYLIDVIYARRLQQSNIVLWWSNSPIPDNGGSEKDSILPLIDPVSLPTVNNSGVY
                     SKICIDLQVRNLSVNTILTAAIINEAEGADLAGSIVQGDGSSNSTPFVENAFSTPALA
                     VLSNLVKEWWNQALANDETADDMVNCFISWVSSSNSFLYDQTLYYHVQNLSKKAFIQL
                     VREFRKAGSQLVFADQKRFVLMTPKKILENTYSYANFLIKTIRSKPLFNFLDISLTEY
                     WEVLVWMDDVNFCGKSCKSLSASGKDTVQTFFNWHIGRFLPPLLQTEFEESVLSFMEK
                     YCDYRDQFQKKQQETLGVRQTQISSTALQRVSTDEDNNDSEIDNHFANGIFEAIRPQL
                     VKRVKQLLKIYLDGKSNPDIAVQFEFPVLAGSRLQLSNPITQFVKSLCAVYGLSKELN
                     LESRTLRRNLLSILGIKEFTEEASFKNPSASLIIDSVVCENCYFVCNLDLCRQDDLVR
                     KDTVGNTVYYSWACENCGKDYNRIVLEERLIQNIQKLVTSYQIQDLKCEKCKKIKSDE
                     LSVRCECSGNWVETIPSSHVLKSIETYDRVAQFYELKFLQDVTSHLI"
     gene            complement(<820501..>820794)
                     /gene="RAD14"
                     /locus_tag="AWJ20_3964"
                     /db_xref="GeneID:30036043"
     mRNA            complement(<820501..>820794)
                     /gene="RAD14"
                     /locus_tag="AWJ20_3964"
                     /product="Rad14p"
                     /transcript_id="XM_018881006.1"
                     /db_xref="GeneID:30036043"
     CDS             complement(820501..820794)
                     /gene="RAD14"
                     /locus_tag="AWJ20_3964"
                     /inference="similar to AA sequence:KEGG_Orthology:K10847"
                     /note="Protein that recognizes and binds damaged DNA
                     during NER; subunit of Nucleotide Excision Repair Factor 1
                     (NEF1); contains zinc finger motif; homolog of human XPA
                     protein; NER stands for nucleotide excision repair;
                     GO_component: GO:0000110 - nucleotide-excision repair
                     factor 1 complex [Evidence IPI] [PMID 8621533];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     9852079]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0003684 - damaged DNA binding
                     [Evidence IEA]; GO_function: GO:0003684 - damaged DNA
                     binding [Evidence IDA] [PMID 23925126]; GO_function:
                     GO:0003684 - damaged DNA binding [Evidence IDA] [PMID
                     8516285]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0008270 - zinc ion binding
                     [Evidence IDA] [PMID 8516285]; GO_process: GO:0006281 -
                     DNA repair [Evidence IEA]; GO_process: GO:0006974 -
                     cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IEA]; GO_process: GO:0000715 -
                     nucleotide-excision repair, DNA damage recognition
                     [Evidence IDA] [PMID 8516285]"
                     /codon_start=1
                     /product="Rad14p"
                     /protein_id="XP_018733640.1"
                     /db_xref="GeneID:30036043"
                     /translation="MMLYLRYQVEEYAFKKWGSPEGLDKEYERREAAKKQRKEKKFLD
                     KLKDMRKKTRAEAITRHADERHEHEWSAPMDGLQGMVSRRCKVCGMTTEEIVF"
     gene            <822754..>823404
                     /gene="ORC5"
                     /locus_tag="AWJ20_3965"
                     /db_xref="GeneID:30036044"
     mRNA            <822754..>823404
                     /gene="ORC5"
                     /locus_tag="AWJ20_3965"
                     /product="origin recognition complex subunit 5"
                     /transcript_id="XM_018881007.1"
                     /db_xref="GeneID:30036044"
     CDS             822754..823404
                     /gene="ORC5"
                     /locus_tag="AWJ20_3965"
                     /inference="similar to AA sequence:KEGG_Orthology:K02607"
                     /note="Subunit of the origin recognition complex (ORC);
                     ORC directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing;
                     GO_component: GO:0031261 - DNA replication preinitiation
                     complex [Evidence IDA] [PMID 9554851]; GO_component:
                     GO:0005664 - nuclear origin of replication recognition
                     complex [Evidence IDA,IMP] [PMID 9372948]; GO_component:
                     GO:0005656 - nuclear pre-replicative complex [Evidence
                     IDA] [PMID 16824194]; GO_component: GO:0005656 - nuclear
                     pre-replicative complex [Evidence IDA] [PMID 9335335];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0000808 - origin recognition complex
                     [Evidence IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IMP] [PMID 9038340]; GO_function: GO:0003688 -
                     DNA replication origin binding [Evidence IDA] [PMID
                     16824194]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0006260 - DNA replication
                     [Evidence IEA,IEA]; GO_process: GO:0006270 - DNA
                     replication initiation [Evidence IMP] [PMID 16716188];
                     GO_process: GO:0006270 - DNA replication initiation
                     [Evidence IGI,IMP] [PMID 7579692]; GO_process: GO:0030466
                     - chromatin silencing at silent mating-type cassette
                     [Evidence IDA] [PMID 12897051]; GO_process: GO:0006267 -
                     pre-replicative complex assembly involved in nuclear cell
                     cycle DNA replication [Evidence IDA] [PMID 16824194];
                     GO_process: GO:0031938 - regulation of chromatin silencing
                     at telomere [Evidence IMP] [PMID 16980387]"
                     /codon_start=1
                     /product="origin recognition complex subunit 5"
                     /protein_id="XP_018733641.1"
                     /db_xref="GeneID:30036044"
                     /translation="MDTLVKMWPVFVDPILKGKYKISEFVRIYKENIYLFTGDAVVAD
                     RLVDLEAEDLIAMVKTRREIATQAKAYELPIQSKYVLCAAYLASYNPPRYDVRFFSKA
                     KDARAKRRDTGRRKSLKINPRSLAAPAFDLERMLAILHSIIPTDEEEKNVRAGSHIDI
                     GVQIATLTTLKLIIRTSNSDPLDSRTRWKVNASWTLVKRLADDINFPIEEFLLESE"
     gene            complement(<823526..>825286)
                     /gene="VPS27"
                     /locus_tag="AWJ20_3966"
                     /db_xref="GeneID:30036045"
     mRNA            complement(<823526..>825286)
                     /gene="VPS27"
                     /locus_tag="AWJ20_3966"
                     /product="ESCRT-0 subunit protein VPS27"
                     /transcript_id="XM_018881008.1"
                     /db_xref="GeneID:30036045"
     CDS             complement(823526..825286)
                     /gene="VPS27"
                     /locus_tag="AWJ20_3966"
                     /inference="similar to AA sequence:KEGG_Orthology:K12182"
                     /note="Endosomal protein that forms a complex with Hse1p;
                     required for recycling Golgi proteins, forming lumenal
                     membranes and sorting ubiquitinated proteins destined for
                     degradation; has Ubiquitin Interaction Motifs which bind
                     ubiquitin (Ubi4p); GO_component: GO:0033565 - ESCRT-0
                     complex [Evidence IPI] [PMID 12055639]; GO_component:
                     GO:0005768 - endosome [Evidence IEA]; GO_component:
                     GO:0005768 - endosome [Evidence IDA] [PMID 12055639];
                     GO_component: GO:0010008 - endosome membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA,IEA]; GO_function: GO:0032266 -
                     phosphatidylinositol-3-phosphate binding [Evidence IDA]
                     [PMID 9702203]; GO_function: GO:0043130 - ubiquitin
                     binding [Evidence IDA] [PMID 12055639]; GO_function:
                     GO:0043130 - ubiquitin binding [Evidence IDA] [PMID
                     20150893]; GO_process: GO:0006886 - intracellular protein
                     transport [Evidence IEA]; GO_process: GO:0045324 - late
                     endosome to vacuole transport [Evidence IMP] [PMID
                     12055639]; GO_process: GO:0045053 - protein retention in
                     Golgi apparatus [Evidence IMP] [PMID 8649377]; GO_process:
                     GO:0006623 - protein targeting to vacuole [Evidence
                     IMP,IPI] [PMID 12055639]"
                     /codon_start=1
                     /product="ESCRT-0 subunit protein VPS27"
                     /protein_id="XP_018733642.1"
                     /db_xref="GeneID:30036045"
                     /translation="MSWFSSVVSIDERIEKATSESLPSGEQDLALNLEICDLIRSKTV
                     PPKDAMRSLKKRLNHKNPNVQLLTLHLIDICIKNGGSHFLTEIASREFMDSFVSVLQP
                     SSGLVNRDVKELMLEYLQNWANAFEGQIQLVYVNKVYEKLKKDGFHFPSGAKISSSFI
                     DSSAPPEWVDADECMECNTPFSFVNRKHHCRNCGGVYIQKHCNNYTTLPHYGINQPVR
                     VCDSCFNKLRGSSSGGPSSRVHNSNDQVRSHTTSNNRDLSSVDDDNDSDLQRALKLSL
                     EESQNPGLTKPSPNRAPTNHLVQNDDDDEDMKAAIAASLRDMENEGKAIPSGTDTTNP
                     SNNLYQLAPPSVSIADVEPKSVENTVLSIVDDEFTSVDAEIIHRYVQIVESLQRNPSA
                     FAIRDTKLELLHNNVLSLRPKLSKDLRRTVEKCDQLEDLHGKLTAIVRYYDKLLEDRF
                     SYSMKKYGHMDEGNQYTSSVVSSQMPGGQYHQYQTGSGPVTYPEGNSPYYPPVQDSDP
                     HYGVNTETYYQQQHDGPLPSEPPLPEGNAGYQGFYPALDERGNISQNQSIQDPDNQSS
                     EPNYSKPGTKEEEEPILIEL"
     gene            <825831..>826754
                     /gene="IST1"
                     /locus_tag="AWJ20_3967"
                     /db_xref="GeneID:30036046"
     mRNA            join(<825831..825899,826146..>826754)
                     /gene="IST1"
                     /locus_tag="AWJ20_3967"
                     /product="Ist1p"
                     /transcript_id="XM_018881009.1"
                     /db_xref="GeneID:30036046"
     CDS             join(825831..825899,826146..826754)
                     /gene="IST1"
                     /locus_tag="AWJ20_3967"
                     /inference="similar to AA sequence:KEGG_Orthology:K19476"
                     /note="Protein with positive role in the multivesicular
                     body sorting pathway; functions and forms a complex with
                     Did2p; recruitment to endosomes is mediated by the
                     Vps2p-Vps24p subcomplex of ESCRT-III; also interacts with
                     Vps4p; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 18032584]; GO_component: GO:0005768 - endosome
                     [Evidence IEA,IEA]; GO_component: GO:0005768 - endosome
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005768 -
                     endosome [Evidence IDA] [PMID 18032584]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0032511 - late endosome to vacuole transport via
                     multivesicular body sorting pathway [Evidence IGI] [PMID
                     18032584]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Ist1p"
                     /protein_id="XP_018733643.1"
                     /db_xref="GeneID:30036046"
                     /translation="MAVNRLRLIEQKETALAKQARRESRDCDPGLEEAVKTIIYSAQR
                     TEVKELHQIREIFVHKFGKDFAQDSIDNLSNSIPEKVTKRLSTVPPSEELVTLYLAEI
                     ARAYHVPFSGLQLEGEDITEHDESGDEGPPSGRVPEEALSTGGSQTARVKVRRLSQVD
                     KLPNPSAPKSPVSVSTPAPTTDNPHPVLRVSTSGASQKGANGKANSADEQELDALRNR
                     FEALRRR"
     gene            complement(<826881..>827792)
                     /gene="TAM41"
                     /locus_tag="AWJ20_3968"
                     /db_xref="GeneID:30036047"
     mRNA            complement(<826881..>827792)
                     /gene="TAM41"
                     /locus_tag="AWJ20_3968"
                     /product="Tam41p"
                     /transcript_id="XM_018881010.1"
                     /db_xref="GeneID:30036047"
     CDS             complement(826881..827792)
                     /gene="TAM41"
                     /locus_tag="AWJ20_3968"
                     /inference="similar to AA sequence:KEGG_Orthology:K17807"
                     /note="Mitochondrial phosphatidate cytidylyltransferase
                     (CDP-DAG synthase); required for cardiolipin biosynthesis;
                     viability of null mutant is strain-dependent; mRNA is
                     targeted to the bud; mutant displays defect in
                     mitochondrial protein import, likely due to altered
                     membrane lipid composition; GO_component: GO:0031314 -
                     extrinsic component of mitochondrial inner membrane
                     [Evidence IDA] [PMID 16790493]; GO_component: GO:0031314 -
                     extrinsic component of mitochondrial inner membrane
                     [Evidence IDA] [PMID 16943180]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IDA] [PMID 16790493]; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IDA] [PMID 16943180];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14690591]; GO_function: GO:0004605 -
                     phosphatidate cytidylyltransferase activity [Evidence
                     IDA,IMP] [PMID 23623749]; GO_process: GO:0032049 -
                     cardiolipin biosynthetic process [Evidence IMP] [PMID
                     19114592]; GO_process: GO:0032049 - cardiolipin
                     biosynthetic process [Evidence IGI] [PMID 20485265];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tam41p"
                     /protein_id="XP_018733644.1"
                     /db_xref="GeneID:30036047"
                     /translation="MKQYPEHYSSLRFLGSGAVSALQDYVGSGVYFNPFVELNGLKIK
                     YGVVNIDTLLSDLQGWETLYLAGRLHKPVKILRDEPKVRFVNQANLISVLRTSLLLLP
                     EKFNEFELYKMIAGISYMGDPRMQFGENPNKVHNIVSNQFLNFRKLYSPLMDDLPNLS
                     ISSGESQVVSDGNQKVEAVNLIQDMSPLKRGNMVFRLPSEFRSKIYARYASKLNSPEL
                     AMASKSNSVNKNDPSVKSVSTDFDRQIADDKDLSLEVARAIRYTVSWPSLTQSAKGLL
                     TAGLVKSMKYSYEKISKYRLGKQAIIK"
     gene            <828540..>828628
                     /locus_tag="AWJ20_3969"
                     /db_xref="GeneID:30036048"
     tRNA            <828540..>828628
                     /locus_tag="AWJ20_3969"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:30036048"
     gene            complement(<832165..>833886)
                     /gene="DCR2"
                     /locus_tag="AWJ20_3970"
                     /db_xref="GeneID:30036050"
     mRNA            complement(<832165..>833886)
                     /gene="DCR2"
                     /locus_tag="AWJ20_3970"
                     /product="Dcr2p"
                     /transcript_id="XM_018881012.1"
                     /db_xref="GeneID:30036050"
     CDS             complement(832165..833886)
                     /gene="DCR2"
                     /locus_tag="AWJ20_3970"
                     /note="Phosphoesterase; involved in downregulation of the
                     unfolded protein response (UPR), at least in part via
                     dephosphorylation of Ire1p; dosage-dependent positive
                     regulator of the G1/S phase transition through control of
                     the timing of START; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_component: GO:0005737
                     - cytoplasm [Evidence IEA,IEA]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016788 - hydrolase activity, acting on ester bonds
                     [Evidence IMP,ISS] [PMID 15590836]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0004721 - phosphoprotein phosphatase
                     activity [Evidence IDA,IMP] [PMID 17673172]; GO_function:
                     GO:0042578 - phosphoric ester hydrolase activity [Evidence
                     IDA] [PMID 16990850]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0030968 - endoplasmic
                     reticulum unfolded protein response [Evidence IGI,IMP]
                     [PMID 16990850]; GO_process: GO:0006470 - protein
                     dephosphorylation [Evidence IDA] [PMID 16990850];
                     GO_process: GO:0006470 - protein dephosphorylation
                     [Evidence IDA,IMP] [PMID 17673172]; GO_process: GO:0007089
                     - traversing start control point of mitotic cell cycle
                     [Evidence IMP] [PMID 15590836]"
                     /codon_start=1
                     /product="Dcr2p"
                     /protein_id="XP_018733645.1"
                     /db_xref="GeneID:30036050"
                     /translation="MALLPRFWVRQLLKLGISIFVLSLLIVFVDFYFNFLPTSFQTRL
                     PLHQSTAVIVDLKVQSCLTVSGCAEPNGWYKIPKNLYLNTKWVRKGFVYVKRVEETEL
                     QDDHKVVLDLALAHSTEANGHGIPLYIVKDILGQATSEKEETEASRDAIRAIDDDEAA
                     KHGWTLRDEDSGLWVKQGKYHRSESVTGVDVLFGKDSVDPRPNWSLKPGFLFRDSGKE
                     AFASLTIRRGVENKPSKPVLRVNPSGKFKILQVADLHFSTGEGICRDTFPSDSAGNCL
                     ADPRTLDFIKLVLDQETPDFVVMTGDQIFGDTAPDAESALLKAVAPFIEREIPYAMVF
                     GNHDAQGSLSKEDLMSIIATLPFSLSEAGPEDVDGIGNYVLQALSPKNDHPAISFYFL
                     DSHSHVALPKGGSTYDHIKSNQLKFIENTSTKIKELQKDYTHIPLSMAFFHIPIPEYR
                     KTNVNPVVGSHREPVMGPTNDEGTRDVLAKVGVSVVSVGHDHVNDYCMFDKPDREGET
                     GIWLCYGGAVGEGGYAGYGGYVRRLRLFEIDTQSASIKSWKLTREQPELKLDEQTLVS
                     NGHVSNE"
     gene            complement(<834153..>834722)
                     /gene="FCF1"
                     /locus_tag="AWJ20_3971"
                     /db_xref="GeneID:30036051"
     mRNA            complement(<834153..>834722)
                     /gene="FCF1"
                     /locus_tag="AWJ20_3971"
                     /product="Fcf1p"
                     /transcript_id="XM_018881013.1"
                     /db_xref="GeneID:30036051"
     CDS             complement(834153..834722)
                     /gene="FCF1"
                     /locus_tag="AWJ20_3971"
                     /inference="similar to AA sequence:KEGG_Orthology:K14566"
                     /note="Putative PINc domain nuclease; required for early
                     cleavages of 35S pre-rRNA and maturation of 18S rRNA;
                     component of the SSU (small subunit) processome involved
                     in 40S ribosomal subunit biogenesis; copurifies with
                     Faf1p; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 16762320]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 16769905]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IEA]; GO_component:
                     GO:0032040 - small-subunit processome [Evidence IDA,IPI]
                     [PMID 16769905]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0000480 -
                     endonucleolytic cleavage in 5'-ETS of tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 16762320]; GO_process: GO:0000480 - endonucleolytic
                     cleavage in 5'-ETS of tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     16769905]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 16762320];
                     GO_process: GO:0000447 - endonucleolytic cleavage in ITS1
                     to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 16769905]; GO_process:
                     GO:0000472 - endonucleolytic cleavage to generate mature
                     5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
                     [Evidence IMP] [PMID 16762320]; GO_process: GO:0000472 -
                     endonucleolytic cleavage to generate mature 5'-end of
                     SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 16769905]; GO_process: GO:0006364 - rRNA
                     processing [Evidence IEA]; GO_process: GO:0042254 -
                     ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Fcf1p"
                     /protein_id="XP_018733646.1"
                     /db_xref="GeneID:30036051"
                     /translation="MGKAKKTRKFAQVKRVITSKDQRIKKNQEQQKPVDQDKELVKEI
                     PQVSSALFFQYNEAIKPPYQVLVDTNFINFSIQKKLDLVRGMMDTLYARCIPIVTDCV
                     MAELEKLGPKYRIALRMARDPRVQRLTCSHKGTYADDCLVHRIMQHKCYIVATNDADL
                     KRRIRKVPGVPLMSVGAHSYVIERLPDAF"
     gene            <835067..>837961
                     /gene="PEP5"
                     /locus_tag="AWJ20_3972"
                     /db_xref="GeneID:30036052"
     mRNA            <835067..>837961
                     /gene="PEP5"
                     /locus_tag="AWJ20_3972"
                     /product="tethering complex subunit PEP5"
                     /transcript_id="XM_018881014.1"
                     /db_xref="GeneID:30036052"
     CDS             835067..837961
                     /gene="PEP5"
                     /locus_tag="AWJ20_3972"
                     /codon_start=1
                     /product="tethering complex subunit PEP5"
                     /protein_id="XP_018733647.1"
                     /db_xref="GeneID:30036052"
                     /translation="MNVTISTKITNLQDPDVTAVAPGRDTIFLATSKGVIKEFDSSFR
                     LVQSFVAYSEPDWNITHLVFLEGTSLLMTVASKTNHPLTAHLWNLDKIDKQSNGPHCH
                     TTITVMNGSNTFPLSAFCISSDHSILGFGYADGTVILVRGDIVRDRGSRQRVVYRSNT
                     PVTGLEFYEGDENGSVVLMIATVSQILTVPTTGRNSGKPDIILDKKGAALGCVTMVKG
                     YRTQKDRLAVARDGEIAYYTPVMRGASIALDLPKKSIYSFGHYFLVTSILSADNSSVE
                     ASNSFSNFVGADTTRIFIIDTLNNFIAYTEQMAAGIKFIFTQWDKLHVLGSDGILYVF
                     KEKDIDTRLAILKTNNLYDIAIELSTKMDLERNKILRLEREYADFLYKGDQSAEALEH
                     YITSIELGQTSEVILKYRDSQKIDYLTRYLEALHSEGVATKQHTTLLFNSYAKLNNLE
                     KLTQFVEGSQNKESIAIDYETAIRICCQAGYFTLAVYLAQRSGDTDLAVQIKLRDLKD
                     YKGCLEYIRSLDVTDALRILIQFSRELLDTFPVETTALLVSLFTGKFSPTETELDINA
                     RREIQPQTFEGSSDSITAPVLQSYRALVNYMSNVGSNAPVGSDDASHVNGRSIPTYQP
                     PRPRLIFSSFIDHPNEFVIFLEECLESYDKFEANEKDRADLLSTLFEMYLTLSRKATD
                     HDTRHGWESKARSLAMTSKTHIDHNTILLLSHLASYHDGKLLAWDAREGYEVDLFRAC
                     IASGNVQEAIEILHKYGEHEHELFPLALNFFISSPSVLEEAGEEFDYVLKKIKEEQIM
                     TPLQVIQTISVNSVATIGHIRQYLVDIIDAEKQDIDRHTKLAESYRSETRSKQEQISK
                     ILNDPSIVQYTVCASCGSALDLPVVHFSCKHSYHQRCLANNLIGSRSIGGSEEPVCPR
                     CLPELENIRAIRRSHEDVADRNDLFEIALHGSDNKFKVVTDFISRGALTG"
     gene            complement(<838154..>840124)
                     /locus_tag="AWJ20_3973"
                     /db_xref="GeneID:30036053"
     mRNA            complement(<838154..>840124)
                     /locus_tag="AWJ20_3973"
                     /product="arginine--tRNA ligase"
                     /transcript_id="XM_018881015.1"
                     /db_xref="GeneID:30036053"
     CDS             complement(838154..840124)
                     /locus_tag="AWJ20_3973"
                     /inference="similar to AA sequence:KEGG_Orthology:K01887"
                     /note="Arginyl-tRNA synthetase; the authentic, non-tagged
                     protein is detected in highly purified mitochondria in
                     high-throughput studies; YDR341C has a paralog, MSR1, that
                     arose from the whole genome duplication; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0004812 -
                     aminoacyl-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004814 - arginine-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004814 -
                     arginine-tRNA ligase activity [Evidence IDA] [PMID
                     9622124]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA,IEA]; GO_process: GO:0006420 -
                     arginyl-tRNA aminoacylation [Evidence IEA]; GO_process:
                     GO:0006420 - arginyl-tRNA aminoacylation [Evidence IDA]
                     [PMID 9622124]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="arginine--tRNA ligase"
                     /protein_id="XP_018733648.1"
                     /db_xref="GeneID:30036053"
                     /translation="MSELHTLTERLNSLGLGSALTPFPGSDPVNNPFDLFRSYISEEL
                     SKITGVSRDLVYPALEWTNTPDRGDLVIPIPRLRVKGTPPIELAKKWAAEFPENSYLK
                     AVVANGPFIQFFFNPSVLFNLVLKDILTLNDDFGNSTIGKGKRTVVEFSSPNIAKPFH
                     AGHLRSTIIGGFISNLHEKLGYEVIRLNYLGDWGKQFGILAVGFKRYGSEQELESNPI
                     NHLFNVYVRINKDIEAEKEASTNAYYEDHPNEKPQEKVEVEEKKPQEIKKGDKKPELA
                     TPAVPGVPAFVPTSATDDEARSYFKKMEDGDEEALALWKKFRDLSIVKYKDTYKRLNI
                     EYDSYSGESQVSKEVMQKATKLFEEKNLLTEDKGAKLIDLTPYNKKLGKAIVQKKDGT
                     SLYLTRDVGAAMDRYEKYKFDKMIYVIASQQDLHTAQFFKILDLMGFEWASRLQHVNF
                     GMVQGMSTRKGTVVFLDNILEETKDAMHDVMKKNEAKYSQVENPDEIADLVGIAAVMI
                     QDMQAKRINNYAFNWSRMLSFEGDTGAYLQYAHSRLCSIERNAESLVDLSTLHEADFS
                     LLKEPIAEELVRILAQYPDILLASLRSLEPSTVVTYLFKLTHCVSSCYDILWVAGQTP
                     ELAKARLALYSSARRVLSNGMELLNLTPVKRM"
     gene            <840468..>841616
                     /locus_tag="AWJ20_3974"
                     /db_xref="GeneID:30036054"
     mRNA            <840468..>841616
                     /locus_tag="AWJ20_3974"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881016.1"
                     /db_xref="GeneID:30036054"
     CDS             840468..841616
                     /locus_tag="AWJ20_3974"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733649.1"
                     /db_xref="GeneID:30036054"
                     /translation="MSILEILAWIVLAKRDKCEAGGSFLDRITFALALHFYKFCTFVD
                     CLIHGLSRTEVLISRVREPQKTHVLKQLIWNVWAHSQLQDLQGEWSNEQELPLVGKTD
                     NIDSSFVGLLTDVPQSIGLVYEDLLERAANPTTWSDGKDRYIEIYNSVFQATNEAEID
                     IEESVILSSGLRHRRKTGRALSANKTTEEAVPAPKPHNRGNLDWVALGFQGSDPATDF
                     RGSGKFGEECFYRFCTVTNPKVVLRTIMLQSGSFNSGPVVLSKPWYSVALVSIHLSQF
                     ILTLIQRDTTRLAFYRGVLLSLSLESLNGANKLVDIEDCIYTLHSTLLTKFHKTWMEA
                     VAKGDITSVMDTEPFLENFKTTMTEWLWLEHSWAVDPEDTYEILEFSE"
     gene            complement(<841645..>843585)
                     /locus_tag="AWJ20_3975"
                     /db_xref="GeneID:30036055"
     mRNA            complement(<841645..>843585)
                     /locus_tag="AWJ20_3975"
                     /product="gephyrin"
                     /transcript_id="XM_018881017.1"
                     /db_xref="GeneID:30036055"
     CDS             complement(841645..843585)
                     /locus_tag="AWJ20_3975"
                     /inference="similar to AA sequence:KEGG_Orthology:K15376"
                     /codon_start=1
                     /product="gephyrin"
                     /protein_id="XP_018733650.1"
                     /db_xref="GeneID:30036055"
                     /translation="MFRVHLIIVSDTCSKDPSKDRVIPAVSEIINLRSDEYVLKGTSI
                     IPDEKTFIQSEISSVARDSKIDLIITSGGTGFGVRDVTPEAVAPLLDRQAPGLVQMMI
                     QESLKITPMAALSRPVAGVMGKCIVITLPGSPKGACENLTSIFPILSHALSLACGSSA
                     TPHGVSQKLQNVNSSHDVGHHKHNHPHNGACEHSHKGPKFYNRSNDLSRPVTERARQS
                     PYPMISVDEALDVINATVPTPRVEERNIDQTLIGYVIAENIYSTVNVPGYRASIVDGY
                     AVGNYSFPNTYDVSDISHANSLASSTRLESNTIVRVTTGAPVPNGTFAVIPVESTYVE
                     SSRVDSNGKEEEARVFIDVDEIVKEGDNIREPGSDVEINDLILSEGTEITAVGGEIGL
                     LSSVGLRTVNVYRKPIIGIMSTGDEVVDPSSCSSLIGGQVWDSNRPSLITACKGNNFE
                     VVDLGIVEDVANRLESSIRQAYSKRGVDIIITTGGVSMGELDLLKPTIERALNGIIHF
                     GRVAMKPGKPTTFGSFGNKLIFGLPGNPASALVTFHLFVLPCLRLWSGRSKNRYKLPT
                     VKVKLGEAFYLDPRPEYQRAKILQNDDGCLIAYSTGRQRSSRVGSMYTANGLLCLPSS
                     TNQSSPILPEGNVIEAIMIGPL"
     gene            <844164..>845768
                     /gene="PUT4"
                     /locus_tag="AWJ20_3976"
                     /db_xref="GeneID:30036056"
     mRNA            <844164..>845768
                     /gene="PUT4"
                     /locus_tag="AWJ20_3976"
                     /product="proline permease PUT4"
                     /transcript_id="XM_018881018.1"
                     /db_xref="GeneID:30036056"
     CDS             844164..845768
                     /gene="PUT4"
                     /locus_tag="AWJ20_3976"
                     /inference="similar to AA sequence:KEGG_Orthology:K16261"
                     /note="Proline permease; required for high-affinity
                     transport of proline; also transports the toxic proline
                     analog azetidine-2-carboxylate (AzC); PUT4 transcription
                     is repressed in ammonia-grown cells; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence ISS]
                     [PMID 10654085]; GO_function: GO:0015193 - L-proline
                     transmembrane transporter activity [Evidence IGI] [PMID
                     14968425]; GO_function: GO:0015193 - L-proline
                     transmembrane transporter activity [Evidence IMP] [PMID
                     3552672]; GO_function: GO:0015171 - amino acid
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015175 - neutral amino acid transmembrane
                     transporter activity [Evidence IDA] [PMID 10654085];
                     GO_process: GO:0003333 - amino acid transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA,IEA]; GO_process: GO:0015812
                     - gamma-aminobutyric acid transport [Evidence IDA,IGI]
                     [PMID 8455553]; GO_process: GO:0015804 - neutral amino
                     acid transport [Evidence IDA] [PMID 10654085]; GO_process:
                     GO:0015824 - proline transport [Evidence IDA] [PMID
                     10654085]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="proline permease PUT4"
                     /protein_id="XP_018733651.1"
                     /db_xref="GeneID:30036056"
                     /translation="MKNTENKVATFEYNVGIEEGSVEVVEVFKEEQRLEKRLEQRHIQ
                     MIALVGVIGTGLFLSSGSSLQKAGPLGMLLSYLTIAIIVSLNQLAMAETAALMPSTAS
                     SIRQAQHFIDPAMSFAYGWLQMWSIIVPSELVATAVIVSYWTDLSSGIWLTVFIVLSV
                     LSNCWSVRVYGELEFFFAILKILLILGLILAGLVLDLGGVPGQPRLGFHYWKDPGVFA
                     SFMKPGSAGKAIGFFSVLNSAVYSFGGVQNIAYLSGETKNPRRNIPKAAKRILYRVVS
                     FYMITLFIMSLIVPYNDPRISNGSGNASGSPFVVAFEQAGIKALPSIVNAIVLTSAWS
                     AANTGLVAGSRTLFSLANNGQAPKIFLRTNKRGLPWVGTIVTALFMPLSYMTLGSSSS
                     IVFGYLVNVTSSILLINWILISAIHYRLNRALEVQGYSRSDLPFHIRGGKALGLISGI
                     SSSLLLLIGGFTIFIKWDTADFVSAYVTIPLFVGFFTFWKLFKKTKWIRYEDIDLKSL
                     FQDVELNPEPPEEPLRGWKRLQFLWA"
     gene            <846185..>847399
                     /gene="SEN2"
                     /locus_tag="AWJ20_3977"
                     /db_xref="GeneID:30036057"
     mRNA            <846185..>847399
                     /gene="SEN2"
                     /locus_tag="AWJ20_3977"
                     /product="Sen2p"
                     /transcript_id="XM_018881019.1"
                     /db_xref="GeneID:30036057"
     CDS             846185..847399
                     /gene="SEN2"
                     /locus_tag="AWJ20_3977"
                     /inference="similar to AA sequence:KEGG_Orthology:K15322"
                     /note="Subunit of the tRNA splicing endonuclease; tRNA
                     splicing endonuclease is composed of Sen2p, Sen15p,
                     Sen34p, and Sen54p; Sen2p contains the active site for
                     tRNA 5' splice site cleavage and has similarity to Sen34p
                     and to Archaeal tRNA splicing endonuclease; GO_component:
                     GO:0012505 - endomembrane system [Evidence IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005741 - mitochondrial outer membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA,IMP] [PMID
                     12925762]; GO_component: GO:0005741 - mitochondrial outer
                     membrane [Evidence IDA] [PMID 16407407]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0000214 - tRNA-intron endonuclease
                     complex [Evidence IEA]; GO_component: GO:0000214 -
                     tRNA-intron endonuclease complex [Evidence IDA] [PMID
                     9200603]; GO_function: GO:0016829 - lyase activity
                     [Evidence IEA]; GO_function: GO:0004518 - nuclease
                     activity [Evidence IEA]; GO_function: GO:0003676 - nucleic
                     acid binding [Evidence IEA]; GO_function: GO:0000213 -
                     tRNA-intron endonuclease activity [Evidence IEA];
                     GO_function: GO:0000213 - tRNA-intron endonuclease
                     activity [Evidence IMP] [PMID 2182322]; GO_function:
                     GO:0000213 - tRNA-intron endonuclease activity [Evidence
                     IDA] [PMID 9200603]; GO_process: GO:0090501 - RNA
                     phosphodiester bond hydrolysis [Evidence IEA]; GO_process:
                     GO:0090502 - RNA phosphodiester bond hydrolysis,
                     endonucleolytic [Evidence IEA]; GO_process: GO:0090305 -
                     nucleic acid phosphodiester bond hydrolysis [Evidence
                     IEA]; GO_process: GO:0008033 - tRNA processing [Evidence
                     IEA]; GO_process: GO:0006388 - tRNA splicing, via
                     endonucleolytic cleavage and ligation [Evidence IEA];
                     GO_process: GO:0000379 - tRNA-type intron splice site
                     recognition and cleavage [Evidence IMP] [PMID 2182322];
                     GO_process: GO:0000379 - tRNA-type intron splice site
                     recognition and cleavage [Evidence IDA] [PMID 9200603]"
                     /codon_start=1
                     /product="Sen2p"
                     /protein_id="XP_018733652.1"
                     /db_xref="GeneID:30036057"
                     /translation="MKKSLNQLYGSPLPLVVRPLPPIIPHNPLSWIFWLWEYWFPEPE
                     YNLYDGILHALVLPSETTFYVRIDNGSDINSLWSMGFFGKGTLSRSEPSWYTRTARRL
                     GLQGGEQMTSEEVTAARREERKKFKMMRAQAEAEELARRKKLDEMKEVWAGQDSDSVS
                     TLVDEESKLTSTGVASEAGDSKHELTRTLEESQPAQAAAVLVESSASPEVSGNHATVI
                     RFEDQSIIDSNNKLIQQEYLQLMPQEAFFLSYGLGVLRITDHVTGKPLTSEELLTRFV
                     SANPRFLSQYAVYHHYRSLGWCVRSGVKFGSELLLYKRGPPFSHAEFCIRILTSPGDE
                     QHDWWWNTSIGRVVGGVKKGLVFCYVQGNDTENTAKILDASEGYSIKDILGSYQIREV
                     VYRRWIATRNRD"
     gene            <850123..>850623
                     /locus_tag="AWJ20_3978"
                     /db_xref="GeneID:30036058"
     mRNA            <850123..>850623
                     /locus_tag="AWJ20_3978"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881020.1"
                     /db_xref="GeneID:30036058"
     CDS             850123..850623
                     /locus_tag="AWJ20_3978"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733653.1"
                     /db_xref="GeneID:30036058"
                     /translation="MNKKRATVYFVSTLAVFAGIEAGCIIPFTRLYEKGIEWPTTLVG
                     IIAAVLLGVGLLPPYWEIYKRGGQVVGINFIFLTIDSGGALFSTLSLVFQKGSLDILG
                     CVLYIVILVLEGGIFLSQAIWLLRTRIVRRAASEERVCCDEVGSGLKGDKLVLSEAIP
                     DENEIV"
     gene            complement(<850722..>851177)
                     /locus_tag="AWJ20_3979"
                     /db_xref="GeneID:30036059"
     mRNA            complement(<850722..>851177)
                     /locus_tag="AWJ20_3979"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881021.1"
                     /db_xref="GeneID:30036059"
     CDS             complement(850722..851177)
                     /locus_tag="AWJ20_3979"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733654.1"
                     /db_xref="GeneID:30036059"
                     /translation="MSPSVLARVISGKLELDVKSLKVNPAKLENFKRHKVKDVDYPAV
                     IRGDDKDLVLGTVVYNLSEEEIIKLDMFEGEEYERLVLDVLDIAESRQVKAGVYVWVD
                     SQDRLLEEEWDFGYFVNHKMENWISDELKEMDKEAEARGGRFWDTTQCI"
     gene            complement(<852101..>852478)
                     /locus_tag="AWJ20_3980"
                     /db_xref="GeneID:30036061"
     mRNA            complement(<852101..>852478)
                     /locus_tag="AWJ20_3980"
                     /product="splicing factor, SYF2 family"
                     /transcript_id="XM_018881023.1"
                     /db_xref="GeneID:30036061"
     CDS             complement(852101..852478)
                     /locus_tag="AWJ20_3980"
                     /codon_start=1
                     /product="splicing factor, SYF2 family"
                     /protein_id="XP_018733655.1"
                     /db_xref="GeneID:30036061"
                     /translation="MSKSSSSPDLKLSREERFKSLRKRANESLKANRSEVYEEHKRSK
                     VDEKLQARLQRQREAAEFELAELESKETGEDFERKRVWDWTIEESEKWDQKKNKVEKS
                     IESSVFSGKFAISRIVLVQILGS"
     gene            <855167..>856948
                     /locus_tag="AWJ20_3981"
                     /db_xref="GeneID:30036062"
     mRNA            <855167..>856948
                     /locus_tag="AWJ20_3981"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881024.1"
                     /db_xref="GeneID:30036062"
     CDS             855167..856948
                     /locus_tag="AWJ20_3981"
                     /inference="similar to AA sequence:KEGG_Orthology:K12864"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733656.1"
                     /db_xref="GeneID:30036062"
                     /translation="MSSTDQIFKVSIGILRALKRVDLGSGANSRQVASGPAPSDESTK
                     TDGFEDDPRFYGNDLESSLQGQVLDYIELKEKAIGQLAGADSFHNRSLLKKVVARFVG
                     ARETNETLRVKHPDEPLQFLESEEELFERLKDLTILADVGLYREMSEMDDLKDGLLSL
                     LFHENSDIVVQLFVVLLELLQPDSETDVSSIHNFYRILINGGLLKGIEQYLIRLQKPN
                     QEAQEDDVLGRRVEEEKATLDLLSSLAEIDEFILNFSNCSDLFDSLITRIQNKEPGDL
                     VSENRLSCALIVQSLLSNGPLAKVLITASSVESILNVTSTYIYKDPEPYETDKLFSEC
                     VFDVLSSISVNSRDDFLNFEGPELMIKLLRDANWAVGPALRVLKTSVRDDDGRIANLI
                     IESGGLKHLFKLLYKGSKGEVDDVISVLANLLHWLPLESPGRIRVIGKLIEKDYRAVR
                     LLLRKRRKFCNLIGELRSRLSDSALEEKMEIITELEEAGVDKQNRIDIILAWLTVEST
                     RIGRDVIKLLSSEPGNLFQSLRSYISELNLIIRAETEEPAMPKDELEFLRMEEEMVSS
                     LVSQMKHSLQPGYVNLQQGSYKKIISQ"
     gene            <857672..>860077
                     /gene="SNF5"
                     /locus_tag="AWJ20_3982"
                     /db_xref="GeneID:30036063"
     mRNA            <857672..>860077
                     /gene="SNF5"
                     /locus_tag="AWJ20_3982"
                     /product="Snf5p"
                     /transcript_id="XM_018881025.1"
                     /db_xref="GeneID:30036063"
     CDS             857672..860077
                     /gene="SNF5"
                     /locus_tag="AWJ20_3982"
                     /inference="similar to AA sequence:KEGG_Orthology:K11648"
                     /note="Subunit of the SWI/SNF chromatin remodeling
                     complex; involved in transcriptional regulation; functions
                     interdependently in transcriptional activation with Snf2p
                     and Snf6p; relocates to the cytosol under hypoxic
                     conditions; GO_component: GO:0016514 - SWI/SNF complex
                     [Evidence IDA] [PMID 18644858]; GO_component: GO:0016514 -
                     SWI/SNF complex [Evidence IDA] [PMID 8016655];
                     GO_component: GO:0016514 - SWI/SNF complex [Evidence IDA]
                     [PMID 8127913]; GO_component: GO:0016514 - SWI/SNF complex
                     [Evidence IDA,IMP] [PMID 8159677]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 22932476];
                     GO_component: GO:0000228 - nuclear chromosome [Evidence
                     IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 2233708]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22932476]; GO_function: GO:0015616 -
                     DNA translocase activity [Evidence IDA] [PMID 17188033];
                     GO_function: GO:0001102 - RNA polymerase II activating
                     transcription factor binding [Evidence IPI] [PMID
                     11865042]; GO_function: GO:0001102 - RNA polymerase II
                     activating transcription factor binding [Evidence IMP,IPI]
                     [PMID 14580348]; GO_process: GO:0000436 - carbon
                     catabolite activation of transcription from RNA polymerase
                     II promoter [Evidence IGI] [PMID 14580348]; GO_process:
                     GO:0006338 - chromatin remodeling [Evidence IEA];
                     GO_process: GO:0006338 - chromatin remodeling [Evidence
                     IGI,IMP] [PMID 1459453]; GO_process: GO:0000724 -
                     double-strand break repair via homologous recombination
                     [Evidence IMP] [PMID 16024655]; GO_process: GO:0045944 -
                     positive regulation of transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 1339306]; GO_process:
                     GO:0045944 - positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IGI] [PMID 1901413];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 3542227]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0005987 - sucrose catabolic process
                     [Evidence IMP] [PMID 6392017]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Snf5p"
                     /protein_id="XP_018733657.1"
                     /db_xref="GeneID:30036063"
                     /translation="MSFPFEQQYNQFMVDESSGTQFNSDNGGSANMLISQVPGNTSNQ
                     QLMQQSSQPSQQQQFRNSFQFQGQPGSQMAGPRQNQGPAAVEQTRNVSMNQGQFHVNT
                     PQSQLQPQSSQGPVNQAKYAQFLQQQLQHQQHQTPALAGQADGLQTPPSAMVRGSQTN
                     QNAMVSGANPGNVQFQMSQYAPNTSGPQNQRINLGQSGSLGTKFAGSSALPGNPGDSA
                     PGGPVLSASGGPNAAGVHGIHPVPSNIGAPVVPITGHQPSDRSNIPPRPALPNEILSA
                     VKELPNSTLEEKTLIELLTKDAEQELIFAKQEQRHAGLIYRKQVEYDYYDQVRQLRQV
                     QPSAIFGDGYSGYGNSWTGSRMNLIYPRDRKRGKRESSELFLSMEQLEYIASIPELLA
                     PIRLDIDLDKYRLRDTFTWNLNEKLISVDLFAQNLAEDYNIPLSYAPLIANNINEVLN
                     DFHPHAFVEAAEDQDQASSGLHSSSATGEESSGTVITSVNTSTTSSNPAGDVTVTTTT
                     NDGISENLTPNGYATNPTLSNRNDDMRITIKLDITVGQHNLVDQFEWDLNCMDNNPEQ
                     FAEAMCRDLSLSGEFATAIAHAIREQTQLFTKTLFLVGHQFDGRPIEDDDIVRELCPP
                     VTSDAFLRNTSFIKDFSPVLFEIPHVELDRQDKDRDRDSRRKRRQGRAGRRGGPTLPD
                     LRETVRTFRTPVYSSLLPGGIDKVLELVRKQATKAEESDDDDDTPRPVTVGRRGRPPA
                     HAQLSGVSTFRASPAALPSSSSRMASPQFRYHQQIQSVEDHYLVKLRIPPRIRDEVNR
                     ISL"
     gene            complement(<860200..>861897)
                     /gene="HTS1"
                     /locus_tag="AWJ20_3983"
                     /db_xref="GeneID:30036064"
     mRNA            complement(<860200..>861897)
                     /gene="HTS1"
                     /locus_tag="AWJ20_3983"
                     /product="histidine--tRNA ligase"
                     /transcript_id="XM_018881026.1"
                     /db_xref="GeneID:30036064"
     CDS             complement(860200..861897)
                     /gene="HTS1"
                     /locus_tag="AWJ20_3983"
                     /inference="similar to AA sequence:KEGG_Orthology:K01892"
                     /note="Cytoplasmic and mitochondrial histidine tRNA
                     synthetase; efficient mitochondrial localization requires
                     both a presequence and an amino-terminal sequence;
                     mutations in human ortholog HARS2 are associated with
                     Perrault syndrome; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IMP] [PMID 3521891]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IMP]
                     [PMID 3521891]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004812 -
                     aminoacyl-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IDA] [PMID 16741232]; GO_function: GO:0004821 -
                     histidine-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA,IEA]; GO_process: GO:0006427 -
                     histidyl-tRNA aminoacylation [Evidence IEA]; GO_process:
                     GO:0006427 - histidyl-tRNA aminoacylation [Evidence IMP]
                     [PMID 1459448]; GO_process: GO:0006427 - histidyl-tRNA
                     aminoacylation [Evidence IDA] [PMID 16741232]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence IGI]
                     [PMID 16777356]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="histidine--tRNA ligase"
                     /protein_id="XP_018733658.1"
                     /db_xref="GeneID:30036064"
                     /translation="MRSFNRINSIRPYFESGLKSSITSASKVLAAYQMSTESTAPVET
                     AVPAKVRAPKAPAAPQFTLKTPKGTKDWADKDMTIRSAIFETITKVFKRHGGVTIDTP
                     VFELREILSGKYGEDSKLIYNLEDQGGELTSLRYDLTVPFARFVAMNGIQNIKRYHIA
                     KVYRRDQPAMTKGRMREFYQCDFDIAGSYENMVADSEILSIAAEGLTALGIEDFTIKV
                     NHRKILDGIFQHCGVKEQDVRKVSSAVDKLDKAPWSEVKKEMVVEKGQPEEVADRIGE
                     YVLIKGTISDVINKLKADSALSSNASAAQGIADMETALPYLEAFGVTKHISFDLSLAR
                     GLDYYTGLIYEAVTAASAPPEPSSKEAQSSNANKKSKKAKKLDDDDDNSENVGVGSIL
                     AGGRYDNLVGMFAGTSKKNASIPCVGVSFGVERLFSLIKARPGLYDNARSTSTQVFLM
                     AFGGGPTWTGFLNERLSVAKLLWDGGVEAEFMYKTKPKTPKQFEAAEKSGCPFAVILG
                     QEEYPKGIVKVKELGMGSDADQGTDVPLEQLVDFVKAKIAARNNGIDSALQLLRLDN"
     gene            <862339..>863472
                     /gene="TFA1"
                     /locus_tag="AWJ20_3984"
                     /db_xref="GeneID:30036065"
     mRNA            <862339..>863472
                     /gene="TFA1"
                     /locus_tag="AWJ20_3984"
                     /product="Tfa1p"
                     /transcript_id="XM_018881027.1"
                     /db_xref="GeneID:30036065"
     CDS             862339..863472
                     /gene="TFA1"
                     /locus_tag="AWJ20_3984"
                     /inference="similar to AA sequence:KEGG_Orthology:K03136"
                     /note="TFIIE large subunit; involved in recruitment of RNA
                     polymerase II to the promoter, activation of TFIIH, and
                     promoter opening; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005673 -
                     transcription factor TFIIE complex [Evidence IDA] [PMID
                     1429681]; GO_component: GO:0005673 - transcription factor
                     TFIIE complex [Evidence IDA] [PMID 7961670]; GO_function:
                     GO:0000993 - RNA polymerase II core binding [Evidence IPI]
                     [PMID 11779853]; GO_function: GO:0000993 - RNA polymerase
                     II core binding [Evidence IDA] [PMID 8702741];
                     GO_function: GO:0001097 - TFIIH-class transcription factor
                     binding [Evidence IDA] [PMID 8702741]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IEA]; GO_function: GO:0003697 - single-stranded
                     DNA binding [Evidence IDA] [PMID 9271406]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006366 - transcription
                     from RNA polymerase II promoter [Evidence IDA] [PMID
                     1331084]; GO_process: GO:0006366 - transcription from RNA
                     polymerase II promoter [Evidence IDA] [PMID 1429681];
                     GO_process: GO:0006366 - transcription from RNA polymerase
                     II promoter [Evidence IDA] [PMID 7961670]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IMP] [PMID 9188494]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 9271406]; GO_process: GO:0006367 -
                     transcription initiation from RNA polymerase II promoter
                     [Evidence IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0001113 -
                     transcriptional open complex formation at RNA polymerase
                     II promoter [Evidence IDA,IGI] [PMID 10973956]"
                     /codon_start=1
                     /product="Tfa1p"
                     /protein_id="XP_018733659.1"
                     /db_xref="GeneID:30036065"
                     /translation="MDALLIHGVLTDDELWHMLGINKKELRALCAKLKENHLLTDHVQ
                     REEGPAQRPITKTYYYIHYTETIDAIKWKMHSIVKKLKEEVGAESQPQGYVCDTCKSR
                     YATIDVIGNFNSDRGGFVCDVCDSLLREDDSSAESQAQQEKLGRLMSQIDPIIDALRQ
                     IDEVHIPENTFQSSLAHALPAPSSTGPTTATTTSSAIKFAKSANQGGVNGTTSLQVNI
                     TSDKESAEIERKNREERARLAEENALPTWHLESTVGKSLYDSTNSSATSGDKMDANAP
                     ILSDRSTIKLEDSDKPATSADNIVSSVNSTTNSVAEDKASEEALASYYAQLAARQEAS
                     DDEDEDDEEDEDEDEDDDAEFEDVITADVKSTIDDEDDDDDED"
     gene            complement(<864284..>866941)
                     /locus_tag="AWJ20_3985"
                     /db_xref="GeneID:30036066"
     mRNA            complement(<864284..>866941)
                     /locus_tag="AWJ20_3985"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881028.1"
                     /db_xref="GeneID:30036066"
     CDS             complement(864284..866941)
                     /locus_tag="AWJ20_3985"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733660.1"
                     /db_xref="GeneID:30036066"
                     /translation="MTTRSNKKRQKEDMKFSIGYSKDVYENPTGSASVVGDTSHNYEE
                     ETVEESDEDVDMQDMQDNSNSPRNNRNGNCRNIDPTMAVLPPNSKGIEGVFPEIINSF
                     VGFPVTYATNGPAPYTSESSLAVITTPKFTECQLNIIEIRRLAHTQNLLLKTKKVSEP
                     GNTHVAQRVKGHGILTFNEACIYYYDHTSREAIANCPYYISKATGETYPESIIFCSPV
                     TTSRYIIGSESGSLYYVDISFHENKSTVEDSHSSNGVKLDIEISCFPLAIISGANNVI
                     HLGGSYFMVTSHVNAPMLIELDVTRLNEGLFEEFVEGSTIVPDFVTPYRVIYQLDNLG
                     PILDFYVQNDVSTSANQIIACSAGGTIKRITCGNLPSGVSEFVPVDHIQNIWSGVDAH
                     GQLLIVVGCIGETRIFVLDENDPFFVKSELLEYNGLDLNTETLYFGTMETGTTVFLTE
                     SNIVVFPRRGVEILNPISLTPSNDGSKLVKAEIWKDMIVVTTRNTLLLFRYRADTLSL
                     EQISDISLVTVGHEISDLSFVSGYILVSFWHCTELHLYRVSDKKNKIIHVRTSDLADP
                     SCLLSKVALKSPGIRTVLLRGSMSHEDEIMDKLKAYVGLSDGKIIVFEDLTLSKGKDY
                     ILGRFPVGLVAHNELLFAISDTLSVSIDTDYNFKSIGGIEASPRTVLKVSEDEGSFAV
                     ALGKGFQLIQLNDLQDVQIDEIDLSIKSPTQPLPLSVKPIDDHLALVLWENRILETVD
                     TKKMKSVGEFCLLFNEEFSSLGIVEKDGFKYCYIGGEREAKKPLFSTIDWENYNVSRS
                     VATKGNDALKFGVVRRYMLSADGMPVPDSLQTVQTNGAVYSMFTDGDVALLGVQSSVS
                     KNRMNGISSASSNSLADYPSTIQKQRDLS"
     gene            complement(<868717..>869025)
                     /gene="VMA3"
                     /locus_tag="AWJ20_3986"
                     /db_xref="GeneID:30036067"
     mRNA            complement(<868717..>869025)
                     /gene="VMA3"
                     /locus_tag="AWJ20_3986"
                     /product="H(+)-transporting V0 sector ATPase subunit c"
                     /transcript_id="XM_018881029.1"
                     /db_xref="GeneID:30036067"
     CDS             complement(868717..869025)
                     /gene="VMA3"
                     /locus_tag="AWJ20_3986"
                     /inference="similar to AA sequence:KEGG_Orthology:K02155"
                     /note="Proteolipid subunit c of the V0 domain of vacuolar
                     H(+)-ATPase; dicyclohexylcarbodiimide binding subunit;
                     required for vacuolar acidification and important for
                     copper and iron metal ion homeostasis; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence IDA]
                     [PMID 15252052]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0033179 -
                     proton-transporting V-type ATPase, V0 domain [Evidence
                     IEA]; GO_component: GO:0033177 - proton-transporting
                     two-sector ATPase complex, proton-transporting domain
                     [Evidence IEA]; GO_component: GO:0005774 - vacuolar
                     membrane [Evidence IEA]; GO_component: GO:0000220 -
                     vacuolar proton-transporting V-type ATPase, V0 domain
                     [Evidence TAS] [PMID 10224039]; GO_component: GO:0000220 -
                     vacuolar proton-transporting V-type ATPase, V0 domain
                     [Evidence TAS] [PMID 9442887]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA]; GO_function: GO:0015078 - hydrogen
                     ion transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015078 - hydrogen ion transmembrane
                     transporter activity [Evidence TAS] [PMID 12482875];
                     GO_process: GO:0015991 - ATP hydrolysis coupled proton
                     transport [Evidence IEA]; GO_process: GO:0006878 -
                     cellular copper ion homeostasis [Evidence IMP] [PMID
                     9434348]; GO_process: GO:0006879 - cellular iron ion
                     homeostasis [Evidence IMP] [PMID 9434348]; GO_process:
                     GO:0006897 - endocytosis [Evidence IMP] [PMID 2145283];
                     GO_process: GO:0006811 - ion transport [Evidence IEA];
                     GO_process: GO:0006623 - protein targeting to vacuole
                     [Evidence IMP] [PMID 2145283]; GO_process: GO:0015992 -
                     proton transport [Evidence IEA]; GO_process: GO:0015992 -
                     proton transport [Evidence TAS] [PMID 12482875];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0007035 - vacuolar acidification [Evidence
                     TAS] [PMID 10224039]; GO_process: GO:0007035 - vacuolar
                     acidification [Evidence TAS] [PMID 9442887]; GO_process:
                     GO:0007033 - vacuole organization [Evidence IMP] [PMID
                     2145283]"
                     /codon_start=1
                     /product="H(+)-transporting V0 sector ATPase subunit c"
                     /protein_id="XP_018733661.1"
                     /db_xref="GeneID:30036067"
                     /translation="MAGIIAIYGLVVSVLVTGSLKQQQALYTGFIQLGAGLSVGLAGL
                     AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVTC
                     "
     gene            complement(<870547..>871992)
                     /gene="PRP46"
                     /locus_tag="AWJ20_3987"
                     /db_xref="GeneID:30036068"
     mRNA            complement(<870547..>871992)
                     /gene="PRP46"
                     /locus_tag="AWJ20_3987"
                     /product="Prp46p"
                     /transcript_id="XM_018881030.1"
                     /db_xref="GeneID:30036068"
     CDS             complement(870547..871992)
                     /gene="PRP46"
                     /locus_tag="AWJ20_3987"
                     /inference="similar to AA sequence:KEGG_Orthology:K12862"
                     /note="Member of the NineTeen Complex (NTC); this complex
                     contains Prp19p and stabilizes U6 snRNA in catalytic forms
                     of the spliceosome containing U2, U5, and U6 snRNAs;
                     GO_component: GO:0000974 - Prp19 complex [Evidence IPI]
                     [PMID 12088152]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005681 -
                     spliceosomal complex [Evidence IEA]; GO_component:
                     GO:0005681 - spliceosomal complex [Evidence IDA] [PMID
                     11884590]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008380 - RNA splicing
                     [Evidence IEA]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0006397 - mRNA processing
                     [Evidence IEA]; GO_process: GO:0000398 - mRNA splicing,
                     via spliceosome [Evidence IMP] [PMID 12554883]"
                     /codon_start=1
                     /product="Prp46p"
                     /protein_id="XP_018733662.1"
                     /db_xref="GeneID:30036068"
                     /translation="MSSEYIGRLTSQLFPDSPLESVLDVEYTGVPRLRIRRKLVDYNE
                     VKDLPQELADKLAQANAKKGKSTNGGRIKKRIQREKVNLGQDADVTTAKLIETVSEND
                     RNSAAKSGTGSSDLAVVVQTKTPLQKQELPSINRNNFSAESAVSVRSPLHAVHAQVRP
                     TWHPPWKLKRVLAGHQGWVRSVCVDPDNKFFATGSADRTIKIWDLASGRLRVTLTGHI
                     MAVRGLVISPRHPYLFSAGEDKMVKCWDLEHNKVVRQYHGHLSSVYSVDLHPTLDLLV
                     TAGRDSVARVWDIRTRHPVHVLTGHKATVSQVRCQSADPQVITTSMDSTVRLWDLAAG
                     KTQTVLTHHKKSVRALTLHPTEFTFATGSPDNIKQWKFPEGAFMHNFAPPQNAIINTL
                     SVNEDGVMFAGGDDGSMGFFDWSSGYKFQQFDTVAVPGSLSAESGIFASTFDRSGLRL
                     ITCEADKSVKIWAEDNEATEETHPLQWKPTL"
     gene            <884483..>885475
                     /gene="NUS1"
                     /locus_tag="AWJ20_3988"
                     /db_xref="GeneID:30036069"
     mRNA            <884483..>885475
                     /gene="NUS1"
                     /locus_tag="AWJ20_3988"
                     /product="Nus1p"
                     /transcript_id="XM_018881031.1"
                     /db_xref="GeneID:30036069"
     CDS             884483..885475
                     /gene="NUS1"
                     /locus_tag="AWJ20_3988"
                     /inference="similar to AA sequence:KEGG_Orthology:K19177"
                     /note="Putative prenyltransferase; required for cell
                     viability; proposed to be involved in protein trafficking
                     because tet-repressible mutant shows accumulation of
                     hypoglycosylated forms of CPY; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     11086160]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0005811 - lipid particle [Evidence
                     IEA,IEA]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 10515935]; GO_component: GO:0005811 -
                     lipid particle [Evidence IDA] [PMID 14690591];
                     GO_component: GO:0005811 - lipid particle [Evidence IDA]
                     [PMID 24390141]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 24868093]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005635 -
                     nuclear envelope [Evidence IDA] [PMID 14690591];
                     GO_component: GO:0031965 - nuclear membrane [Evidence
                     IEA]; GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0008834 -
                     di-trans,poly-cis-decaprenylcistransferase activity
                     [Evidence IEA]; GO_function: GO:0004659 -
                     prenyltransferase activity [Evidence ISS] [PMID 14690591];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016765 - transferase activity,
                     transferring alkyl or aryl (other than methyl) groups
                     [Evidence IEA]; GO_process: GO:0006486 - protein
                     glycosylation [Evidence IMP] [PMID 16943325]"
                     /codon_start=1
                     /product="Nus1p"
                     /protein_id="XP_018733663.1"
                     /db_xref="GeneID:30036069"
                     /translation="MSDSGDIGAFASAVRQTPETYRSRGQPRRVSNAIARAMVSSGAT
                     KDSRLEPDAPLSSHLTYLVFRFILQIFYFCFSGYQWVLYYYHRLRLRISSVAVYHNRT
                     PQLIRSDVVSLEKIPGHVATVLNLKNESEEGGGIDGLLHEVGELAAWCVGAGISVLTV
                     YEKRGILKSMPIQDVNRAITRKLENYFGISNTPKFRLVIPHLHSQSSIRPGDNGDDAT
                     DEKFDLVINLISLTDGRTSIVELSKTLADMAMEHKLSSRDLSLSLIDRHLRDILEEPD
                     LVILFSPDIDLQGFPPWQIRLSEIFYLPDNDEVSYVVFLKALQKYAKCKINVGR"
     gene            <885790..>888651
                     /gene="NPR3"
                     /locus_tag="AWJ20_3989"
                     /db_xref="GeneID:30036070"
     mRNA            <885790..>888651
                     /gene="NPR3"
                     /locus_tag="AWJ20_3989"
                     /product="Npr3p"
                     /transcript_id="XM_018881032.1"
                     /db_xref="GeneID:30036070"
     CDS             885790..888651
                     /gene="NPR3"
                     /locus_tag="AWJ20_3989"
                     /note="Subunit of SEA (Seh1-associated), Npr2/3, and Iml1p
                     complexes; Npr2/3 complex mediates downregulation of TORC1
                     activity upon amino acid limitation; SEA complex is a
                     coatomer-related complex that associates dynamically with
                     the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is required
                     for non-nitrogen-starvation (NNS)-induced autophagy;
                     required for Npr2p phosphorylation and Iml1p-Npr2p
                     interaction; null mutant shows delayed meiotic DNA
                     replication and double-strand break repair; GO_component:
                     GO:1990130 - Iml1 complex [Evidence IDA] [PMID 21900499];
                     GO_component: GO:0035859 - Seh1-associated complex
                     [Evidence IDA] [PMID 21454883]; GO_component: GO:0097042 -
                     extrinsic component of fungal-type vacuolar membrane
                     [Evidence IDA] [PMID 21454883]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0034198 -
                     cellular response to amino acid starvation [Evidence IMP]
                     [PMID 19521502]; GO_process: GO:0007126 - meiotic nuclear
                     division [Evidence IEA]; GO_process: GO:0007126 - meiotic
                     nuclear division [Evidence IMP] [PMID 18069899];
                     GO_process: GO:0032007 - negative regulation of TOR
                     signaling [Evidence IMP] [PMID 19521502]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA]; GO_process:
                     GO:0007124 - pseudohyphal growth [Evidence IMP] [PMID
                     24603354]; GO_process: GO:2000785 - regulation of
                     autophagic vacuole assembly [Evidence IMP] [PMID
                     21900499]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Npr3p"
                     /protein_id="XP_018733664.1"
                     /db_xref="GeneID:30036070"
                     /translation="MSYLNLPNPCLSAVLLTVSTHSGPQFVFNYPPVPTTIDTSLLKD
                     RETELLSDSESDSEWSYSSDDSNDGSDSLANEEVIQESDGGSGDSNGRSVNGTTPEPQ
                     YRGMPGSLLERLERPRGSTIRRHHRNLSVSQRRRSSSSVGTAVGSLKGLQKKKAHKRG
                     LGLSSTGNGRDTSARANGTAPHTNGNTTKNNTVTVNSKSGSGEGNIQDAEDLDITKVV
                     GFDTDFLGELLCPQRAMCNMRFEMCVDDTVFLGLPIHVQADGQWRKKKFSKAPRSVPS
                     TLMENGGINGLKARKRKTGARRARLGADGDRRLNLSGDEHGNIESTGPNETNVLSDEN
                     ESDASDISDVSDVGSDVSDSDGDGDGDDGTKVAQEQGEIRPGGSHPNRKADNLSASIS
                     SLPEFSDPQSPMRMFQVTFVMTPPVTEYKFRVDQMYYFVLANFVKTLRTEQAKSNYVW
                     NEVNTMLKIRDKALSTVDGNVDDGNNNGETKKKRLSPYELCDEMIEKSSLALAIAQLF
                     NAIDISDIANLRINNKLRSFQIPIEYEFTRLPAITEPYLSRSYLTSISDFDNIINEGV
                     AVGSGSSQFNVYCTILLLDSPDRIIKDIGVDPYSPLANFIRDINPTVTLQTLANTSGV
                     EVGHVIELMRSLIYWRKARPIAPLHHRNIYAVSPLASIGQIYKYIPLFKEEFPALPSL
                     PRMLSMLSTGKPRSYAFHIPSRDHRDVYLNALGWLFKYGFVMQLRTFVWLRVTKKIKM
                     AVNRDIQNEEQLRESIREAESTNNVQDENGGDLKNTDTSTDNTSKRDPDNIPSTNNTT
                     DNKATTSNTAHATTTTLISEVGGIKITSTTTPSASSNHLNELNTTTDAAGSTAGGKFS
                     SSSSRSDVSDMSAAAEDWKQDTILLDPTTATLLQKKWINKITESKPAEVVALFNRVVK
                     YFNGHTPMESVLLVENFPRQDFRKVLSTFDEFLIVVRHW"
     gene            complement(<888921..>889427)
                     /gene="UBC8"
                     /locus_tag="AWJ20_3990"
                     /db_xref="GeneID:30036072"
     mRNA            complement(<888921..>889427)
                     /gene="UBC8"
                     /locus_tag="AWJ20_3990"
                     /product="E2 ubiquitin-conjugating protein UBC8"
                     /transcript_id="XM_018881034.1"
                     /db_xref="GeneID:30036072"
     CDS             complement(888921..889427)
                     /gene="UBC8"
                     /locus_tag="AWJ20_3990"
                     /inference="similar to AA sequence:KEGG_Orthology:K10576"
                     /note="Ubiquitin-conjugating enzyme that regulates
                     gluconeogenesis; negatively regulates gluconeogenesis by
                     mediating the glucose-induced ubiquitination of
                     fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
                     that catalyzes the ubiquitination of histones in vitro;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     10811607]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA]; GO_function: GO:0016881 - acid-amino acid ligase
                     activity [Evidence IEA]; GO_function: GO:0016874 - ligase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0004842
                     - ubiquitin-protein transferase activity [Evidence IEA];
                     GO_function: GO:0004842 - ubiquitin-protein transferase
                     activity [Evidence IDA] [PMID 1869573]; GO_process:
                     GO:0045721 - negative regulation of gluconeogenesis
                     [Evidence IMP] [PMID 12686616]; GO_process: GO:0043161 -
                     proteasome-mediated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 12686616]; GO_process:
                     GO:0016567 - protein ubiquitination [Evidence IEA];
                     GO_process: GO:0042787 - protein ubiquitination involved
                     in ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 10811607]"
                     /codon_start=1
                     /product="E2 ubiquitin-conjugating protein UBC8"
                     /protein_id="XP_018733665.1"
                     /db_xref="GeneID:30036072"
                     /translation="MSDYEVTLVNDNMQEFFVKFKGPSETPFDGGAWKIHVELPDQYP
                     YKSPSIGFVNKIFHPNIDELSGSVCLDVINQTWSPMFDMVNIFEVFLPQLLRYPNPTD
                     PLNGEASALLLREPKAYEKRVQEYVKLYASGEALNNTDDNSDSDMEMSSVGSFDSDDD
                     EAAGQMEV"
     gene            <890923..>892407
                     /gene="SPO7"
                     /locus_tag="AWJ20_3991"
                     /db_xref="GeneID:30036073"
     mRNA            <890923..>892407
                     /gene="SPO7"
                     /locus_tag="AWJ20_3991"
                     /product="Nem1-Spo7 phosphatase regulatory subunit SPO7"
                     /transcript_id="XM_018881035.1"
                     /db_xref="GeneID:30036073"
     CDS             890923..892407
                     /gene="SPO7"
                     /locus_tag="AWJ20_3991"
                     /codon_start=1
                     /product="Nem1-Spo7 phosphatase regulatory subunit SPO7"
                     /protein_id="XP_018733666.1"
                     /db_xref="GeneID:30036073"
                     /translation="MNNIGISDLDESAETRPTQPSGGSEDERVYEEQSSIEIGEITSP
                     RFTGTEQFGDDVIEGYNNNSSLPALDNQESYLNLNSNSNRDIDTQRASHITSHNQGRN
                     VASTDSAGIYRSPTNLTSDDTPVDQDISSPIQSSGPVSESTYTTANYIKSAIESNNST
                     PSSSAPNTALPTPSPTPTPSLTPSPKPIVPAVDNDNPGIDTGAALPTAPVSSGTGASS
                     TGATETVARRRRKSSTTKSGSKSHSRNSSSISSISAEPIPPNNPTQIFRNLLIMEESF
                     RDQYIALRRTRRKNVIFFSFLMTAAVYFTYSVFVEPSIYRAVSFFDRLMFLVSIISVG
                     LFYLTGLYNQAFVLAPKFVHNANKGIRAFNIKLVVVKPTWTESVIRLLWDPVYTAKKG
                     GLIKLILSSRVFTTDTIETWDLYRERYWLKENERARRRVQNQTLSTSTPAAAASGLGR
                     KKNTTVSSDGSTALPRRSRLRNTAKTASSHLTVSTGVPSAPSAI"
     gene            <893079..>896186
                     /gene="GPI13"
                     /locus_tag="AWJ20_3992"
                     /db_xref="GeneID:30036074"
     mRNA            <893079..>896186
                     /gene="GPI13"
                     /locus_tag="AWJ20_3992"
                     /product="Gpi13p"
                     /transcript_id="XM_018881036.1"
                     /db_xref="GeneID:30036074"
     CDS             893079..896186
                     /gene="GPI13"
                     /locus_tag="AWJ20_3992"
                     /inference="similar to AA sequence:KEGG_Orthology:K05288"
                     /note="ER membrane localized phosphoryltransferase; adds
                     phosphoethanolamine onto the third mannose residue of the
                     glycosylphosphatidylinositol (GPI) anchor precursor;
                     similar to human PIG-O protein; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence ISS] [PMID
                     10793139]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0051377 - mannose-ethanolamine
                     phosphotransferase activity [Evidence IMP] [PMID
                     12441642]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016772 - transferase
                     activity, transferring phosphorus-containing groups
                     [Evidence IMP] [PMID 10793139]; GO_process: GO:0006506 -
                     GPI anchor biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IMP] [PMID 10793139]; GO_process: GO:0006506 -
                     GPI anchor biosynthetic process [Evidence IMP] [PMID
                     12441642]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Gpi13p"
                     /protein_id="XP_018733667.1"
                     /db_xref="GeneID:30036074"
                     /translation="MSSESVLPNSVPPTSNGNNISPNVLAREAKRKQQAADRRVQKAE
                     ALRKVNGAWIGAFGITIWVIVLQVAGLLLFKNGFLLSRPVFEDHSECSVLPETQDNIV
                     SQPSKGCWTEPSFDKAILIVIDALRFDFTIPSDKASPSHFENKLPFLYNEFINNPQNS
                     LLLKFMADPPTTTLQRLKGLTTGSLPTFIDAGSNFAGTDIAEDNWLAQATNDNKTIAF
                     VGDDTWTALFPNQFGNISFPYDSLNVWDLDSVDNGVIEHIFPIINGNYGHWDIAVGHL
                     LGVDHAGHKYGPNHNGMKDKLEQMNQFLENLVASISDDTLLVVMGDHGMDLKGDHGGE
                     SLLELEAALWMYSKKPFFGRKYGSDIYNTSDSGKNFRSVAQIDFVPTFSLLMGLPIPF
                     NNLGAPIVEAFIGPDSKNYQALARAEALTAGQIHRYTEKSTSASSAFSESTIQELWHN
                     VLSADSIGAGLSAAVAYQTAVIDHYREKWIKFHLPDIIRGVLIITASLLSVVIAASNI
                     NGSNMLQTAKRVTISALSFSAVGFVYRISQDLVYSVLATTSLGIVLGLVWTSRASHAV
                     SSSSPAPTPTPRSNTQEGQDEQGEEADLGTKKVKETKENSKLSAVPSVWTILAIFLSL
                     VHAVVFTSNSFTVWESSILNYLLATFGFVAFVYARRLDDVIRRTIATWHCVAFIVLTK
                     ISSFSVLCREEHGIGCKSTFYQDGSSISSPYALVGLVIVSLALPRIIVSFYKTSESYH
                     GAAPIWLSIGLQTIMTLSGLFWFLDGAETFNWKVAAAIDHELLHTVKILIARIGLGAS
                     LVAGNYGWLKGTLCCQLDFEGKRPILKGYYNIYGSFAFLFVLNFFAATLIVNKPMGGI
                     ILSVLIYHSMTLMEILHLLQIKESIIGPVVFGLLGSAYFFSTGHQATIPSVQWDVGFI
                     ASKTISFPLTHIAIFLNSLGPFIITALIVPIVPLWKVGPFKSGEAAFTRALKSALAFI
                     AYHTVVALSSMIWATYFRRHLMVWKIFAPRFMLAAVTLPAVGVSIALALLAVGYTVRQ
                     VSNIF"
     gene            complement(<896334..>897368)
                     /locus_tag="AWJ20_3993"
                     /db_xref="GeneID:30036075"
     mRNA            complement(<896334..>897368)
                     /locus_tag="AWJ20_3993"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881037.1"
                     /db_xref="GeneID:30036075"
     CDS             complement(896334..897368)
                     /locus_tag="AWJ20_3993"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733668.1"
                     /db_xref="GeneID:30036075"
                     /translation="MDDANGGIGDELDGISLRDISAVRYVRHHEWLELVVGTAIPTHQ
                     IQIPKIFTPIDADNSSPWSFNDSDSVKAKLESIENEIKQLESGAKSGWVEKPEEAAKS
                     DFYRAGIAKLREDFGSVSKDADYYGDITLKIETKFGARVIEKKRLRRVGVEVGDEVID
                     EDEEDKPETKKPALGEDKPQTVEKSDSQQASEISDVSNKSEDFDIKDSGDSNGTGPNI
                     NKTLQTGTSSTANESENVQTNGDSIGQESTPNSTTEVSDTNDESNFSQSVKTSVPQEY
                     DQQSEDQPVSEVQSDLLSLDQGEELLLGDDNLVDLDGNNDNVGEDIYMEGTSFEDAEL
                     GDVLGSLPES"
     gene            complement(<897589..>900696)
                     /locus_tag="AWJ20_3994"
                     /db_xref="GeneID:30036076"
     mRNA            complement(<897589..>900696)
                     /locus_tag="AWJ20_3994"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881038.1"
                     /db_xref="GeneID:30036076"
     CDS             complement(897589..900696)
                     /locus_tag="AWJ20_3994"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733669.1"
                     /db_xref="GeneID:30036076"
                     /translation="MSGNGGANNGIIIETGVIGGDGKVTSTISPPIAVPAGIEASGNS
                     DNNSVVKGEFSDPNLITLCIPLRYTYLTRPSETTEADYDGRKKIIVYETKSTSLWREA
                     DEDDKNKQFVKSMSGTQFIDCLPSLRAAVNQINNEKNSLVTARMGEDRLLENIVTVVL
                     DGPREEVNKQRAKLNRGYFQVERWDIGISKQLVSDSLNEQGDFKSALYLGLEEVAEYC
                     GVSIFVTSFTDKALFSVNSTEENNYLKHQYDRFDGDDYHILIYGDQDAARFANIRMRV
                     ILSKLANGSDFIADLVPLELSLQPLVAGPQAVNLHSIQEQASVDIFTMDYLPEVLGSL
                     NPQLFDGEAIVRDVDQLYIVGPSSANVELAKFLIEQVKTRTQMVVKDCVMSHAKLDLL
                     ISRYRNKIRDIMNRFATFVQLPYFSSNRSLVRVMGTTASSVEASIQELMRMAADFYEA
                     NYWIHGGKSDEEGILVRPNGVLNPKSIEALQKIAASNNCIVTTQNNTAFEIIGYGSDT
                     KRAIAMLKSLSLWDDDISRQNVQISYQLEVSLDLKSFMAGKKYGKMLRIMSNSNVWIK
                     FIPFNEYNFFVVLTADDYSSSDSGIQLLEDEYPSEISFHIPDTYHKEIIGAGGSGIQA
                     IMRKHNVFIKFGNSLELYPNAIAQHKLNNVVIRCPSKNAKSMTLARDELLISVRDRVA
                     EHYNTFVHMPRSHRRIILNENCGIIRQIESKTNSIIQIPDHDNYSDIENDLIEIRGLG
                     TSSEEASQLLRTALPTDYEFRVAHSSKFTSLVNEKQGDFYTKIVVPFRIAFQFEVMVY
                     NQVKSKKGDETAPPYHRIVISHSHEHIMGLDEAIQELTTFLRERELDIIDRSRVKDDP
                     IEYGSAATLGHKRANSALNVNHNRIPQKNLPHSLPTGPAAVSGGHSIPTGPTTPRRLR
                     YESKQLPPGVSYGDAFTSYDDRSGYYDSRSSAMYETGLGVAPVGSYRDHPLSRQLEAE
                     TNRQFQSRAYDGVSESAGNFPSGFTDRWQDDEVYEPRRRDRSPPAAPKYNESTIRKRG
                     YGSYY"
     gene            complement(<901035..>903077)
                     /locus_tag="AWJ20_3995"
                     /db_xref="GeneID:30036077"
     mRNA            complement(<901035..>903077)
                     /locus_tag="AWJ20_3995"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881039.1"
                     /db_xref="GeneID:30036077"
     CDS             complement(901035..903077)
                     /locus_tag="AWJ20_3995"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733670.1"
                     /db_xref="GeneID:30036077"
                     /translation="MPPSTLQLRCYSQWIRRKPAGRSCLFCGYGIMEQRRGIVVVPRH
                     PKYRAVTPAPTRTGYRDLAPDPDTALPHDTNNINHSRYNNQLRTESESKVRDLTNSER
                     AWPSIDVETRLDFQEFKMAALSLSFDMSEDLSYRMAPTNEPLESIASNHAISDQEDIT
                     TLQLSKHSEINLVEQYDNVLNSLINDHLDIFTNYFASNLSSETSISSMAIVQLASQEI
                     NSDYLRVRAKRSKLKRSPCPASLYNNFLRQLYWNGDGGPPSPRYIFQAYKRLPYPPPR
                     SINPVHLETLIAFFMGHASRSDPTMYLTILSDIAESGMPISIHEHSAALISLGKQLDK
                     TDKKHHAQILIEERVADLESQGSIGRNNDSQQELNKGLDTRDPLKFGTNDSNVHALNA
                     LLSIALKSGSSSSAVEKIFSELSGRADRFTRVLMLSYYGKKRDGRQVKTQYRNIIDSG
                     DIIDMPVLNLVMKYFLLCGYVEEAESMLHKLVRQKSKAEGSQIMGSHSHRKLESQLRS
                     RVTIMDYLLKILRDKNIDVGRRYSVPLVPDFYTFGNFFQYYCLGVGNFNKSVEILRLM
                     TEEAGYLPDKHIFINFYKAFYLHHHNMANEWTLQRLNYITELVCHYELLQAEKHGEHF
                     CTTNMAVAAFRAYRMLAPTSNTDFDALERQLSKKGSRKRFYNVFTTLKKLSTTRLE"
     gene            <907621..>908304
                     /gene="SVP26"
                     /locus_tag="AWJ20_3996"
                     /db_xref="GeneID:30036078"
     mRNA            <907621..>908304
                     /gene="SVP26"
                     /locus_tag="AWJ20_3996"
                     /product="Svp26p"
                     /transcript_id="XM_018881040.1"
                     /db_xref="GeneID:30036078"
     CDS             907621..908304
                     /gene="SVP26"
                     /locus_tag="AWJ20_3996"
                     /note="Integral membrane protein of the early Golgi
                     apparatus and ER; involved in COP II vesicle transport;
                     may also function to promote retention of proteins in the
                     early Golgi compartment; GO_component: GO:0030134 - ER to
                     Golgi transport vesicle [Evidence IDA] [PMID 16957051];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence
                     IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0030173 -
                     integral component of Golgi membrane [Evidence IDA] [PMID
                     16107716]; GO_component: GO:0030176 - integral component
                     of endoplasmic reticulum membrane [Evidence IDA] [PMID
                     16957051]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0097020 - COPII adaptor activity
                     [Evidence IMP,IPI] [PMID 20236934]; GO_process: GO:0006888
                     - ER to Golgi vesicle-mediated transport [Evidence
                     IDA,IMP] [PMID 16957051]; GO_process: GO:0031505 -
                     fungal-type cell wall organization [Evidence IGI,IMP]
                     [PMID 16107716]; GO_process: GO:0006486 - protein
                     glycosylation [Evidence IMP] [PMID 16107716]; GO_process:
                     GO:0045053 - protein retention in Golgi apparatus
                     [Evidence IMP] [PMID 16107716]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Svp26p"
                     /protein_id="XP_018733671.1"
                     /db_xref="GeneID:30036078"
                     /translation="MVVLTLLSYLGTLSAFVFLTMAVASGLYYLSEQVEEHTVWTKTV
                     LTRAIYGIIGIHVLLLIFDGFPWLLTVGSIATHILYLQNLKRFPFIQLYSGIFISSCI
                     AVVANHWLWFRYFSDPSIPPAIILIERPDYAGPTHPPFSQVASFFGICVWLIPFSLFI
                     SLSVGDNVLPTSYSTNFDNDQDESGAAKAKRRSAGLAKVAVEWFYKVIADIGRKFGYE
                     IETGKGPLI"
     gene            <909451..>910419
                     /gene="PRS2"
                     /locus_tag="AWJ20_3997"
                     /db_xref="GeneID:30036079"
     mRNA            <909451..>910419
                     /gene="PRS2"
                     /locus_tag="AWJ20_3997"
                     /product="ribose phosphate diphosphokinase subunit PRS2"
                     /transcript_id="XM_018881041.1"
                     /db_xref="GeneID:30036079"
     CDS             909451..910419
                     /gene="PRS2"
                     /locus_tag="AWJ20_3997"
                     /inference="similar to AA sequence:KEGG_Orthology:K00948"
                     /note="5-phospho-ribosyl-1(alpha)-pyrophosphate
                     synthetase, synthesizes PRPP; which is required for
                     nucleotide, histidine, and tryptophan biosynthesis; one of
                     five related enzymes, which are active as heteromultimeric
                     complexes; PRS2 has a paralog, PRS4, that arose from the
                     whole genome duplication; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0016301 - kinase activity [Evidence IEA]; GO_function:
                     GO:0000287 - magnesium ion binding [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0004749 - ribose phosphate
                     diphosphokinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004749 - ribose phosphate diphosphokinase activity
                     [Evidence IGI] [PMID 15280369]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0006015 - 5-phosphoribose 1-diphosphate biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006015 -
                     5-phosphoribose 1-diphosphate biosynthetic process
                     [Evidence IMP] [PMID 10212224]; GO_process: GO:0006015 -
                     5-phosphoribose 1-diphosphate biosynthetic process
                     [Evidence IGI] [PMID 15280369]; GO_process: GO:0044249 -
                     cellular biosynthetic process [Evidence IEA]; GO_process:
                     GO:0031505 - fungal-type cell wall organization [Evidence
                     IPI] [PMID 15470112]; GO_process: GO:0009165 - nucleotide
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]; GO_process:
                     GO:0009156 - ribonucleoside monophosphate biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="ribose phosphate diphosphokinase subunit PRS2"
                     /protein_id="XP_018733672.1"
                     /db_xref="GeneID:30036079"
                     /translation="MSVSTNSIKLLAGNSHPELAKLVSQKLGVELSKIQVSQYSNQET
                     SVTIGESVRDEDVFILQTGCGEVNDYLMELLIIIHACKTASARRITAVIPNFPYARQD
                     KKDKGRAPITAKLMANMLQTAGCNHVITMDLHASQIQGFFEVPVDNLYAEPTVLRYIR
                     DQVDYSNSVIVSPDAGGAKRAAALADRLDLNFALIHKERQKANEVSRMVLVGYVQDKV
                     CILVDDMADTCGTLVKAAETLISHGAKKVIAIVTHGIFSGDAVNRINNSPLDKVVSTN
                     TVPHDNIQAQCPKLDHIDISPTLAEAIRRLHNGESVSYLFTHAPLG"
     gene            complement(<910743..>912932)
                     /gene="SLY41"
                     /locus_tag="AWJ20_3998"
                     /db_xref="GeneID:30036080"
     mRNA            complement(<910743..>912932)
                     /gene="SLY41"
                     /locus_tag="AWJ20_3998"
                     /product="Sly41p"
                     /transcript_id="XM_018881042.1"
                     /db_xref="GeneID:30036080"
     CDS             complement(910743..912932)
                     /gene="SLY41"
                     /locus_tag="AWJ20_3998"
                     /inference="similar to AA sequence:KEGG_Orthology:K15283"
                     /note="Protein involved in ER-to-Golgi transport;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 23613772];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0005215 - transporter activity
                     [Evidence IEA]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IGI] [PMID 1903839];
                     GO_process: GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Sly41p"
                     /protein_id="XP_018733673.1"
                     /db_xref="GeneID:30036080"
                     /translation="MSTLSILHVQDFNKTISVDSSQYGETVSRTQTPLQAKWDIVPIR
                     DCNSSVLLSPRAENLPSPSRHNYPPRRTRSQTELVPASSGLAKSVSSPGTSISSPSTP
                     ANIGIPQAGYVAIFNLPDPSLTVMAGGGARSATATTSGTGPISGTASQLSSSATFSLR
                     GGGMDPGSSGTRARTNSGPPRPAIIKTTFVDQNNSSNGSDDTSSSPLTLNSASSGTSI
                     GTGFHNVEAVTGSVHGVSGKNPHVRHRDSLSLNGSSAQNFGVMPVTSGTKTATGSAAS
                     AGGAYEPGSLTGPVNGSVFSSDSSEETLVAALSPVGAPPGGLSSSFIPNHNNQHLHHI
                     HNQRATSGLLPLAGGNAARRHRSKSFSETVSETSQEAIRQLAPPISLPLVLTCIAWYS
                     TSAMSNTLNKSILTAFPYPVSLSMVQFTLAASFGISTMKLAQISPDIALALPKGIISP
                     GRVGFRPPTKAILMATAPMGMFQLSGHILSHMSTSLIPVSLVHTIKALSPLFTVAAYR
                     LLFGVSYKRSTYLSLIPLTLGVIMTCSVEFSSHFMGLVYALIAALIFVSQNMFSKKLL
                     TSGNTGGDESTKLDKLNVLCYCSSLAFIFTFPLWFFTEGIGLLGDYSRSSGNFFGASS
                     NGVDAGSIMSTSGLMLAFLINGFVHFAQNLLAFQVLGMVSPVTYSVASLIKRIVVITV
                     AIIWFGQRVTGTQGWGILLTFLGLYLYDRCGGDKTKNYEPKSSVLPK"
     gene            complement(<914141..>916000)
                     /gene="FRA1"
                     /locus_tag="AWJ20_3999"
                     /db_xref="GeneID:30036081"
     mRNA            complement(<914141..>916000)
                     /gene="FRA1"
                     /locus_tag="AWJ20_3999"
                     /product="Fra1p"
                     /transcript_id="XM_018881043.1"
                     /db_xref="GeneID:30036081"
     CDS             complement(914141..916000)
                     /gene="FRA1"
                     /locus_tag="AWJ20_3999"
                     /inference="similar to AA sequence:KEGG_Orthology:K01262"
                     /note="Protein involved in negative regulation of iron
                     regulon transcription; forms an iron independent complex
                     with Fra2p, Grx3p, and Grx4p; cytosolic; mutant fails to
                     repress transcription of iron regulon and is defective in
                     spore formation; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 18281282]; GO_function:
                     GO:0004177 - aminopeptidase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA,IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0008237 - metallopeptidase
                     activity [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0008233
                     - peptidase activity [Evidence IEA]; GO_process:
                     GO:0034396 - negative regulation of transcription from RNA
                     polymerase II promoter in response to iron [Evidence
                     IGI,IMP] [PMID 18281282]; GO_process: GO:0006508 -
                     proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="Fra1p"
                     /protein_id="XP_018733674.1"
                     /db_xref="GeneID:30036081"
                     /translation="MVDTSARLSALRSQLSKNNIGYYIVLTQDEHQSEYTSNADDRRE
                     FISGFTGSAGTAVIGHSKAVLATDGRYFLQAASQLDSNWELLKQGVKGVPTWQEWVAT
                     EATKTGSNIAVDPKLISYSEVKSLKSLLATKGGKAELISLEDNLIDLVWANDRPSRPL
                     TPVKILHSEYTGKSFQEKLTQLKDEIIKKNGTAFVLSALDDVAWLFNLRGEDIPYNPV
                     FFAYAIVTADGKASLYIDSNKVTEKVAEYLKSGNVSIYPYEKAFEDAAELGAALLRIN
                     KSTSGEKKKLIIPNAASWALVEALGGPDSVQMIESPVTVAKSVKNSTEVEGAKLAHIK
                     DGVAVIRYLAWLEKALTVDKLVLSDYEAAQKSLEFRSQMENFQGLSFETISSSGPKAA
                     VIHYSPATDSKEIVKLDQIYLLDSGGQYLEGTTDTTRTVHYGEPSDDEKRSYTLVLKG
                     HIALARAVFPEGSNGYMLDTLARQHLWKYGLDYRHGTGHGIGAFLNVHEGPMGIGFRP
                     AYQNAPLQVGNVISNEPGYYEDGKYGIRIESVVVVKEVKTPFNFGDTKFFGFETITQV
                     PLCQKLLDLSLLDVEEKQWINEYHASVYKTVRPYFSEEDPALEWLRRETLPIF"
     gene            complement(<916502..>917815)
                     /gene="ERG11"
                     /locus_tag="AWJ20_4000"
                     /db_xref="GeneID:30036085"
     mRNA            complement(<916502..>917815)
                     /gene="ERG11"
                     /locus_tag="AWJ20_4000"
                     /product="sterol 14-demethylase"
                     /transcript_id="XM_018881047.1"
                     /db_xref="GeneID:30036085"
     CDS             complement(916502..917815)
                     /gene="ERG11"
                     /locus_tag="AWJ20_4000"
                     /inference="similar to AA sequence:KEGG_Orthology:K05917"
                     /note="Lanosterol 14-alpha-demethylase; catalyzes the C-14
                     demethylation of lanosterol to form 4,4''-dimethyl
                     cholesta-8,14,24-triene-3-beta-ol in the ergosterol
                     biosynthesis pathway; member of the cytochrome P450
                     family; associated and coordinately regulated with the
                     P450 reductase Ncp1p; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 15951236]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_function:
                     GO:0020037 - heme binding [Evidence IEA]; GO_function:
                     GO:0005506 - iron ion binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004497 - monooxygenase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0016705 -
                     oxidoreductase activity, acting on paired donors, with
                     incorporation or reduction of molecular oxygen [Evidence
                     IEA]; GO_function: GO:0008398 - sterol 14-demethylase
                     activity [Evidence IEA]; GO_function: GO:0008398 - sterol
                     14-demethylase activity [Evidence IDA] [PMID 9087488];
                     GO_process: GO:0070988 - demethylation [Evidence IEA];
                     GO_process: GO:0006696 - ergosterol biosynthetic process
                     [Evidence IMP] [PMID 200835]; GO_process: GO:0006629 -
                     lipid metabolic process [Evidence IEA]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]; GO_process: GO:0006694 - steroid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0008202 - steroid
                     metabolic process [Evidence IEA]; GO_process: GO:0016126 -
                     sterol biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="sterol 14-demethylase"
                     /protein_id="XP_018733675.1"
                     /db_xref="GeneID:30036085"
                     /translation="MKIHTGRVQTTFDMNIITVHPENIKTILATNFKDYSLGVRYQQL
                     FPLLGNGIFTLSGEGWKHSRAMLRPQFSREQVSQIDTLRAHVSQLIHNFKTKSKNGTE
                     FFDAQVQFHNLTIDTATEFLFGESTDSLADSDKKVQGPTRLVSATDFAEHFTAALDVL
                     ALRTHVGPLYWLVDGWKFRNSIDICHNFVTYFVNKALQNPLEKGTETTGRYVFINELT
                     KETRDPIVIRDQAFNILLAGRDTTASLLSFIVFYLARDKRVWNTLRQAVLEEFGTEVE
                     SITFESLKRCTYLNYVINEVLRLHPIVPINFRTAIRDTVLPKGGGPDGNDTLFVPKGT
                     KIVYTVYTTQRLKEFWGEDSEEFRPERWAEGKSHTWDYLPFNGGPRICIGQQFALTET
                     GFTLVRIIQTFKDIIYQGSPSYENLSQWTKLTASVADGVWVSFVE"
     gene            <920607..>923210
                     /gene="KAP122"
                     /locus_tag="AWJ20_4001"
                     /db_xref="GeneID:30036086"
     mRNA            <920607..>923210
                     /gene="KAP122"
                     /locus_tag="AWJ20_4001"
                     /product="Kap122p"
                     /transcript_id="XM_018881048.1"
                     /db_xref="GeneID:30036086"
     CDS             920607..923210
                     /gene="KAP122"
                     /locus_tag="AWJ20_4001"
                     /note="Karyopherin beta; responsible for import of the
                     Toa1p-Toa2p complex into the nucleus; binds to
                     nucleoporins Nup1p and Nup2p; may play a role in
                     regulation of pleiotropic drug resistance; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005635 -
                     nuclear envelope [Evidence IEA]; GO_component: GO:0005643
                     - nuclear pore [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0008565 - protein transporter activity
                     [Evidence IMP,IPI] [PMID 10525531]; GO_process: GO:0006606
                     - protein import into nucleus [Evidence IDA,IMP] [PMID
                     10525531]; GO_process: GO:0008361 - regulation of cell
                     size [Evidence IMP] [PMID 12089449]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Kap122p"
                     /protein_id="XP_018733676.1"
                     /db_xref="GeneID:30036086"
                     /translation="MITFDDKDVDQLGSQLLAQLSAEDLNLILRFCKTLLDDYKSNSA
                     SDLKNAEVQATLISNLPYFLKIAQISFIGVEGAGGVNSSDNKVVELLLQCLETTSTWI
                     NHFLKYTEAEAQLKHFVPWFLTHLEASFSLQDDSIFKEICDMVVEMFRYNQNVWDRST
                     RERLYQFTFSVSPTILPPLLTLTEGLDDRNISYCRLVISIAEFLTPKYLQDPDNNGSF
                     KQLLELLIAFSSIQPTPMVEDTMAMEILEFWNGFVEEIVGGGYLSSEQPQTGYINQII
                     GIYWNRIMLPPDNITNTWEKDTWQEFLSFRRDFCDFLELAYPIVSSKLFGLLVNSIVE
                     NIQQSHKTDGTRDPSSMNWRQIECSLYCLNGLSEMIGTSGDEYSTVQLVFNSSLWEDL
                     SSCNSLRVRQTAVSLIGSFDTFFERPEGQPYLTTTLSYLFKSLSIPDLSLTASRSIQK
                     LCASSRKHLVSLLPTLMDLYCSRQYYKTTGTVAHERTVNAIACVIQALDNLEEKAQYA
                     DRLVSILVEQLPVTIENKSQLTDPEVMLLVVSLLKCIVNIGKGLRIPEETASPNREEL
                     QSLATFWNTYSSSTREKIVGTIQWLTMDAIPFSQDPQICEVCCDIFKSGFSEIVPNPF
                     VFDPDTILTFISAKHQYGPPTCYTTLIELSSCLVTSSSVGESTLATEYISELLQTFFS
                     STHENDYEPDIQIGNMQLLTQIYSHYPDSFLSNQSALPFLIGFATEMLASNDRFVIRA
                     TSKFWTTVITKDNARNETSRTRRSEILHSAGPLIVDKVVGKISGEAIRSDLECYTDVI
                     KKLVNKYPLESKPWFVNSIINNPRPDLAKQDLSLRTRFLTKIFNLRGSRETNEVVKNF
                     WSDCKGIANYT"
     gene            complement(<923609..>924694)
                     /gene="MAK32"
                     /locus_tag="AWJ20_4002"
                     /db_xref="GeneID:30036087"
     mRNA            complement(<923609..>924694)
                     /gene="MAK32"
                     /locus_tag="AWJ20_4002"
                     /product="Mak32p"
                     /transcript_id="XM_018881049.1"
                     /db_xref="GeneID:30036087"
     CDS             complement(923609..924694)
                     /gene="MAK32"
                     /locus_tag="AWJ20_4002"
                     /note="Protein necessary for stability of L-A
                     dsRNA-containing particles; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0003674
                     - molecular_function [Evidence ND]; GO_process: GO:0044419
                     - interspecies interaction between organisms [Evidence
                     IMP] [PMID 3551911]"
                     /codon_start=1
                     /product="Mak32p"
                     /protein_id="XP_018733677.1"
                     /db_xref="GeneID:30036087"
                     /translation="MGESMRREDVTPVFTSLGMFIIDEIHFTDAPSVYNVIGGAGTFG
                     AIGARLFLPSPTESQKVGWIVDMGSDFPGSVREEIERWQTGVVLRSDASRLTTRGWNQ
                     YADNEERLFKYLAPKLRITAADIIANPPLIKSKSFHLICSPNRCEELTRHIVDASNYD
                     PRAIIIWEPVPDECKPETYGECIKVLRSPGLVSIFSPNAKEAAQFFGLAEPMTKKDIE
                     DVVDRFVNALNDSRIEPGTNSNMCKLIVLRCGSLGCLVCYTDISNRQPYKWFPAYHNP
                     ANEDYRVIDPTGGGNSFVGGFATGYVISGGDIVEAAVYGNVAAGLVIEQIGLPILGKD
                     QDGNEIWNGETISTRIARYRQRSELPS"
     gene            complement(<925146..>927719)
                     /gene="NUP116"
                     /locus_tag="AWJ20_4003"
                     /db_xref="GeneID:30036088"
     mRNA            complement(<925146..>927719)
                     /gene="NUP116"
                     /locus_tag="AWJ20_4003"
                     /product="FG-nucleoporin NUP116"
                     /transcript_id="XM_018881050.1"
                     /db_xref="GeneID:30036088"
     CDS             complement(925146..927719)
                     /gene="NUP116"
                     /locus_tag="AWJ20_4003"
                     /inference="similar to AA sequence:KEGG_Orthology:K14297"
                     /codon_start=1
                     /product="FG-nucleoporin NUP116"
                     /protein_id="XP_018733678.1"
                     /db_xref="GeneID:30036088"
                     /translation="MFGATNTSPFGATNNATNTGTGLFGSTNNNTATSPFGASTGTQS
                     SLFGAKPATATGGMFGSNTATTTNNAFGGTSNTGAFGSSGGFGTNTNTNSTSPFGSTF
                     GANNNSTTNTGGGLFGQQAAKPAFGGFGATNNTATTSPFGTTTNNTSGGLFGQNNNAG
                     NTGTGLFGANNTNTSSPFGSASSTTNAPAASSGFGGFGGTATQQQNKPAFGFGNSGTT
                     NTTTTSPFGQSTTNTGTGLFGQTNTANTGGSGLFGNTSSQNTNTGTGLFGQNNTAGGA
                     TGTSGTGLFGQSNNNATSNTASPFGGFGAANNQQNTGATTGGLFSNAAKPAGSLFGGG
                     ATTTAPATSGLFGGSTPGATATGSFGVDGGANSAKPSLFGTAPAATAKPTTGLFGGAN
                     NPLGTRGTFGAPNDTTPRFGLAGNTSAQQQGTSLFGQAAKPSLFSQPSNASTNGGLSL
                     SGSTGATQLNNSQLLASVDQNPYGNNPLFTSVNGQQAQSQPGTPVATPLSTTPSSNRK
                     KQGIVSAYKLAPKPLFSPRPRHVGSGSPGNRSSIMGSSATGADDSINGDRTLGKLTRT
                     GSNSPNAVANSVYSLHADEAILSSNAFSPHGSSVRRLIIDRKRTPNNSLLLTDGRSVA
                     DESSQLLTPGPSNTSVLPGSIASLDLSETTIPGTPSPNGALRTSVSPEKPFNRGMNNN
                     GVANDSATTASAPAKPKPVLPDNEIVDEHGYWISPSQEKLDHMSLKELEGVKNFTVGR
                     KGFGFVRFDVPIDLSQYSSVFKQIPGRIVIFGKKSCVIYPDTSSKPAPGSELNVKATI
                     SLEGVWIMTKDTREPVKDPNHPLYDKHLQRLKNLKFTTFVSWDKETGTWVFKIDPSAE
                     S"
     gene            complement(<927802..>928641)
                     /gene="NUP116"
                     /locus_tag="AWJ20_4004"
                     /db_xref="GeneID:30036089"
     mRNA            complement(<927802..>928641)
                     /gene="NUP116"
                     /locus_tag="AWJ20_4004"
                     /product="FG-nucleoporin NUP116"
                     /transcript_id="XM_018881051.1"
                     /db_xref="GeneID:30036089"
     CDS             complement(927802..928641)
                     /gene="NUP116"
                     /locus_tag="AWJ20_4004"
                     /inference="similar to AA sequence:KEGG_Orthology:K14297"
                     /codon_start=1
                     /product="FG-nucleoporin NUP116"
                     /protein_id="XP_018733679.1"
                     /db_xref="GeneID:30036089"
                     /translation="MFGNTNRVGGFGTSNTTNTTGSGGLFGSSPSTGAFGSSTTGQAT
                     SPFGQAASSTGGTGLFGQTTNNSGGGLFGSSTSGQTSNVFGSANSANNASSTSPFGQA
                     NTGASGGLFGATKPTTGFGGFSNTATNSSPFGQSTAATSFGSSANNNQNQGTSVVPFE
                     PFSEKDTTKANMSNYYQSITSMPQYQNFSFEVSIRYYIYNGPIIELVLRIYSLKLHKF
                     NHRYGNHKIVQLNCGPTSCFQLTVNGLNGQKISSKFDSLLTHKGIEVSGLSTKSSLWK
                     RWC"
     gene            <929516..>930553
                     /gene="RAD27"
                     /locus_tag="AWJ20_4005"
                     /db_xref="GeneID:30036090"
     mRNA            <929516..>930553
                     /gene="RAD27"
                     /locus_tag="AWJ20_4005"
                     /product="multifunctional nuclease RAD27"
                     /transcript_id="XM_018881052.1"
                     /db_xref="GeneID:30036090"
     CDS             929516..930553
                     /gene="RAD27"
                     /locus_tag="AWJ20_4005"
                     /inference="similar to AA sequence:KEGG_Orthology:K04799"
                     /note="5' to 3' exonuclease, 5' flap endonuclease;
                     required for Okazaki fragment processing and maturation,
                     for long-patch base-excision repair and large loop repair
                     (LLR), ribonucleotide excision repair; member of the S.
                     pombe RAD2/FEN1 family; relocalizes to the cytosol in
                     response to hypoxia; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 22932476]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 19699691];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005654 - nucleoplasm [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 19699691]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22932476]; GO_function: GO:0008409 -
                     5'-3' exonuclease activity [Evidence IEA]; GO_function:
                     GO:0008409 - 5'-3' exonuclease activity [Evidence IDA]
                     [PMID 9166764]; GO_function: GO:0017108 - 5'-flap
                     endonuclease activity [Evidence IEA]; GO_function:
                     GO:0017108 - 5'-flap endonuclease activity [Evidence IDA]
                     [PMID 11825897]; GO_function: GO:0003677 - DNA binding
                     [Evidence IEA,IEA]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0004519 -
                     endonuclease activity [Evidence IEA]; GO_function:
                     GO:0004527 - exonuclease activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016788 - hydrolase activity, acting
                     on ester bonds [Evidence IEA]; GO_function: GO:0000287 -
                     magnesium ion binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004518 - nuclease activity [Evidence
                     IEA,IEA]; GO_process: GO:0000737 - DNA catabolic process,
                     endonucleolytic [Evidence IEA]; GO_process: GO:0006281 -
                     DNA repair [Evidence IEA,IEA]; GO_process: GO:0006260 -
                     DNA replication [Evidence IEA]; GO_process: GO:0043137 -
                     DNA replication, removal of RNA primer [Evidence IEA];
                     GO_process: GO:0043137 - DNA replication, removal of RNA
                     primer [Evidence IDA] [PMID 16837458]; GO_process:
                     GO:0006284 - base-excision repair [Evidence IEA];
                     GO_process: GO:0006286 - base-excision repair, base-free
                     sugar-phosphate removal [Evidence IGI,IMP] [PMID 9927726];
                     GO_process: GO:0006974 - cellular response to DNA damage
                     stimulus [Evidence IEA]; GO_process: GO:0006303 -
                     double-strand break repair via nonhomologous end joining
                     [Evidence IDA] [PMID 15342630]; GO_process: GO:0000734 -
                     gene conversion at mating-type locus, DNA repair synthesis
                     [Evidence IMP] [PMID 10025407]; GO_process: GO:0035753 -
                     maintenance of DNA trinucleotide repeats [Evidence
                     IGI,IMP] [PMID 16079237]; GO_process: GO:0090305 - nucleic
                     acid phosphodiester bond hydrolysis [Evidence
                     IEA,IEA,IEA]; GO_process: GO:0001302 - replicative cell
                     aging [Evidence IMP] [PMID 12024027]"
                     /codon_start=1
                     /product="multifunctional nuclease RAD27"
                     /protein_id="XP_018733680.1"
                     /db_xref="GeneID:30036090"
                     /translation="MSLYQFLIAVRQQDGQQLTNEDGETTSHLIGIFYRTLKIVENGI
                     KPVYVFDGKPPEMKGSELAKRLVRREEAEKQAAELKETGTAEDVSRFERRTVRVSKEQ
                     NEEAQKLLKLMGIPFVLAPGEAEAQCAALAAADKVFASASEDMDTLTFGTPFLLRHLT
                     ASDQKKMPIAEVNLKKAMEGLEMSKDEFIDLCILLGCDYCDPIRGVGPTTALKLIQEH
                     RSIEKIKAALASKESSKVQIPDDWPYEEVRKLFHSPDVMPPSEIDLKWGVPDVEGLVD
                     FLVKEKGFSEDRVRNAAAKLTKGAKSTPQGRLTDFFKPKPVDPAKAAEMAKRKKAAAA
                     ADNKVKKKARK"
     gene            <931642..>932619
                     /gene="APN1"
                     /locus_tag="AWJ20_4006"
                     /db_xref="GeneID:30036091"
     mRNA            <931642..>932619
                     /gene="APN1"
                     /locus_tag="AWJ20_4006"
                     /product="DNA-(apurinic or apyrimidinic site) lyase APN1"
                     /transcript_id="XM_018881053.1"
                     /db_xref="GeneID:30036091"
     CDS             931642..932619
                     /gene="APN1"
                     /locus_tag="AWJ20_4006"
                     /inference="similar to AA sequence:KEGG_Orthology:K10771"
                     /note="Major apurinic/apyrimidinic endonuclease; 3'-repair
                     diesterase; involved in repair of DNA damage by oxidation
                     and alkylating agents; also functions as a 3'-5'
                     exonuclease to repair 7,8-dihydro-8-oxodeoxyguanosine;
                     genetically interacts with NTG1 to maintain mitochondrial
                     genome integrity; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 11238901]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 7690756]; GO_function:
                     GO:0017005 - 3'-tyrosyl-DNA phosphodiesterase activity
                     [Evidence IDA] [PMID 12397185]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0003906 -
                     DNA-(apurinic or apyrimidinic site) lyase activity
                     [Evidence IEA]; GO_function: GO:0003906 - DNA-(apurinic or
                     apyrimidinic site) lyase activity [Evidence IDA] [PMID
                     12767225]; GO_function: GO:0003906 - DNA-(apurinic or
                     apyrimidinic site) lyase activity [Evidence IMP,ISS] [PMID
                     1693433]; GO_function: GO:0008311 - double-stranded DNA
                     3'-5' exodeoxyribonuclease activity [Evidence IDA] [PMID
                     16024777]; GO_function: GO:0004519 - endonuclease activity
                     [Evidence IEA]; GO_function: GO:0016829 - lyase activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0008081 -
                     phosphoric diester hydrolase activity [Evidence IDA] [PMID
                     3056935]; GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]; GO_process: GO:0000737 - DNA catabolic
                     process, endonucleolytic [Evidence IEA]; GO_process:
                     GO:0006281 - DNA repair [Evidence IEA,IEA]; GO_process:
                     GO:0006284 - base-excision repair [Evidence IDA] [PMID
                     9295360]; GO_process: GO:0006974 - cellular response to
                     DNA damage stimulus [Evidence IEA]; GO_process: GO:0090305
                     - nucleic acid phosphodiester bond hydrolysis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="DNA-(apurinic or apyrimidinic site) lyase APN1"
                     /protein_id="XP_018733681.1"
                     /db_xref="GeneID:30036091"
                     /translation="MHPGSTLGSDKPSAIKQIGDSINEMHGKTEFVKIVLENMTGQDR
                     IVGSNIADLRDIITYVKNKERVGVCIDTCHSFCAGYDLRTENTFNKFWDLFDKTVGYK
                     YLSGIHLNDSKFPFDSKRDVHYNIGLGFLGLEAFRLIMNKEELQNIPLILETPIEHED
                     GKTPDDDPRADEIALLRWLVGKEKDDKEVLDKSIQLQKLGAKVREKNLLVVDKKKPIS
                     SKKPVKNDGTITFAKAKKVKTEVQERNLENQETALESELELKDEQATIVKAEAKDGPD
                     PEVDQTDVAAIGAASVPELSVDDNKLTSRKRATRVSTSTRKTKVRKPSA"
     gene            <933560..>935002
                     /locus_tag="AWJ20_4007"
                     /db_xref="GeneID:30036092"
     mRNA            <933560..>935002
                     /locus_tag="AWJ20_4007"
                     /product="arrestin (or S-antigen), N-terminal domain
                     protein"
                     /transcript_id="XM_018881054.1"
                     /db_xref="GeneID:30036092"
     CDS             933560..935002
                     /locus_tag="AWJ20_4007"
                     /codon_start=1
                     /product="arrestin (or S-antigen), N-terminal domain
                     protein"
                     /protein_id="XP_018733682.1"
                     /db_xref="GeneID:30036092"
                     /translation="MTYLHRPQAPPYIETDQTVLADDDNSFDASHNLPEYTSTTTCEI
                     TTNPQRSIYDEVLRVSIDTEVVASRRNIFDVGDVLTGSVTVAPIKNMEFYLLLVDLVG
                     TEMSIRGKGYAETRYTRVFSLARYTLSQRTFSGVMEQGSKYKFTYSMIIPDKIPHERC
                     VCGNNQHSQVPPSIGRPFELTTPCGGEHLVSEQFGRILYQVRAKLVKPETLWKSSAPE
                     FWSEGRKYLVIRPSYPPPMLEQLCDVNGKPLRLPVYMSSKSLKKGLVRKTDIGKIELR
                     TSEALDVYLGVPHTNVLNLEVLYTPSPNLSGVFPPPVEIENVSYQVDSLAFSSTQSMV
                     TYPSHESVIMKTDPCTILSKHTLLRQKLTISKPAWTVSTPKDPSEPRSYLTKLTLPFT
                     FPVYHSRVVDTYFSCLTSRQYELIVSVGFGHSIGSHRLTVPVLVSSAKDVTLSVAPSF
                     SSIDTTSNLSTYTDLSIPSYQETFDTVDSS"
     gene            <937968..>939551
                     /locus_tag="AWJ20_4008"
                     /db_xref="GeneID:30036093"
     mRNA            <937968..>939551
                     /locus_tag="AWJ20_4008"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881055.1"
                     /db_xref="GeneID:30036093"
     CDS             937968..939551
                     /locus_tag="AWJ20_4008"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733683.1"
                     /db_xref="GeneID:30036093"
                     /translation="MTIRPLDQLTEDPPSYIEPTQPLLEITDQDDPISSATTDLPRYI
                     SGTTCEIAPCNTTSIYEPVVGVGIDPSPTRRDPLSLDLGDVITGKVVITPRKSMDFSI
                     LLVDLVGEEISLRDRGYSESHHKRVFTVARYEIPHQHISGPLEEGFVYTFTYSLVVPE
                     RLPREFCPCGTGNPIHSQLPPSYGLPLENYTPRNHEENEECARVLYRVRARLYKNLRN
                     SREETLKIWAQGHKTVSIRSSLYPPLVLEELKDSNGNILRLPVYSTSKQLSHGLIRKV
                     AIGTVELKTSEPLNIYLNNPSTKLVSLDVIYTPPSDQKSTSPLEIHHVSYKVNALTFA
                     SIEAMAEIPSRQSVMSNKKSPVYMSKDNILRQNLTICKPLWRLNENNDSKTKGNSYVT
                     TLKLPFSFPVTNKKVVSTYFSCLTSRQYELTVTVNFGSSIGSHSITIPVLVTNYKSRE
                     SSVASVYSVEDISPLRSDASSYFSYSIPTYQESVGSSTASSTGAITPPTPGHNFTWGG
                     GARRIARTCEQAAMIIASI"
     gene            <940062..>940955
                     /gene="YPR1"
                     /locus_tag="AWJ20_4009"
                     /db_xref="GeneID:30036094"
     mRNA            <940062..>940955
                     /gene="YPR1"
                     /locus_tag="AWJ20_4009"
                     /product="trifunctional aldehyde reductase/carbonyl
                     reductase (NADPH)/glucose 1-dehydrogenase (NADP(+)) YPR1"
                     /transcript_id="XM_018881056.1"
                     /db_xref="GeneID:30036094"
     CDS             940062..940955
                     /gene="YPR1"
                     /locus_tag="AWJ20_4009"
                     /note="NADPH-dependent aldo-keto reductase; reduces
                     multiple substrates including 2-methylbutyraldehyde and
                     D,L-glyceraldehyde, expression is induced by osmotic and
                     oxidative stress; functionally redundant with other
                     aldo-keto reductases; protein abundance increases in
                     response to DNA replication stress; YPR1 has a paralog,
                     GCY1, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0004032 -
                     alditol:NADP+ 1-oxidoreductase activity [Evidence IDA,ISS]
                     [PMID 11306085]; GO_function: GO:0004090 - carbonyl
                     reductase (NADPH) activity [Evidence IDA] [PMID 19016485];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_process: GO:0042843 - D-xylose
                     catabolic process [Evidence IDA] [PMID 12271459];
                     GO_process: GO:0019568 - arabinose catabolic process
                     [Evidence IDA,IMP] [PMID 12271459]; GO_process: GO:0034599
                     - cellular response to oxidative stress [Evidence IGI]
                     [PMID 17919749]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="trifunctional aldehyde reductase/carbonyl
                     reductase (NADPH)/glucose 1-dehydrogenase (NADP(+)) YPR1"
                     /protein_id="XP_018733684.1"
                     /db_xref="GeneID:30036094"
                     /translation="MAPTLNKQTVTLNDGSKLPVVGYGTYAVTDETNGYDALLEALKK
                     GYRHIDTAFIYNNEEVVGKAVKDSGIPRDEIFIVTKIWNNDHQDPAHALERSLRLMEL
                     DYVDLLLIHWPVPQKAEGGETVVDKEWSHVKTWQLLQELPREKVRSIGVSNYDTVLLE
                     ELLNAPSTKVLPSVNQVELHPYLPQDKLRDYCQKKKIVLEAYCPLGSGAKLLENPLLK
                     ELAEKYEATPAQIALSWGISRGYVVLTKSSTPSRIESNIQTVELSPEDITKITNLSKT
                     HPHRIVVPTWAKGVTFHDDDF"
     gene            <941544..>943850
                     /locus_tag="AWJ20_4010"
                     /db_xref="GeneID:30036096"
     mRNA            <941544..>943850
                     /locus_tag="AWJ20_4010"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881058.1"
                     /db_xref="GeneID:30036096"
     CDS             941544..943850
                     /locus_tag="AWJ20_4010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733685.1"
                     /db_xref="GeneID:30036096"
                     /translation="MSTDEGLPPYQVVDERQAWSTNNDNVPASTNAVDGGVTEDKPVS
                     LNLTENTSGGLPTPDQCIAHLALLEAFYMLRFDIANRDGLFGISNSMAEKFTGDEKTR
                     AMASLCEKRWATYLVRAEERFSKWWATLPRESPMPTQSEIIANPTVFSYIPITGTKIP
                     FTRDNLPPADVLMVWHSYMLNPRNYLQDCIRQGMRDVWRTGMPWKALYSCISGDSVYK
                     SSDGAKNNFKNLTGCEWDNLDDPPVKTLQCPNCKVDIQVPWTSGSLGDDLSKPFENSR
                     GYGDKNFAVQCYSCSLYINHPFLRLQKFRTDFLLLATKDVPMPGTLLTRDGYPVSSRP
                     PSESHQSYFFINRLLMFQMNSFDQICDPAITLKEQRQGDLQFEMSSVRKLLEMCLVRR
                     DIVRKVNSGVVNTQKGLINGKIAVRRMMACYWENSSPFSIDLVGAMTRQGTFIEKMHN
                     IDWLHSPTVSSTMKYALIKYSRFMDIIATNPSRVAVPTLDVDLAWHTHQLSPSDYYHY
                     SDKTTHKFIDHDDKIEESKLSDAYEWTCKTYQRLYKEPYSSCMCWYCEAIRETNRSIL
                     HSRSDAKVDEKLFNHSDISADPNKNPHISAHNAVQTMVVDTVKRAHLRRKEQKMKQLE
                     KAYMLAQKRAKKKGRNLPDRNYDPYYSSYWGWGYPIIFPLGYAPFFGYPLGGEYLYPS
                     NPACMSADPGAVGNCCNGTCGGNVAQGGCAGMTGACAGGTVGACAGGGGVGGACGGGL
                     GGCGGGGGGGGGCGGGGGGGCGGGGGSC"
     gene            complement(<946717..>948507)
                     /gene="RFA1"
                     /locus_tag="AWJ20_4011"
                     /db_xref="GeneID:30036097"
     mRNA            complement(<946717..>948507)
                     /gene="RFA1"
                     /locus_tag="AWJ20_4011"
                     /product="replication factor A subunit protein RFA1"
                     /transcript_id="XM_018881059.1"
                     /db_xref="GeneID:30036097"
     CDS             complement(946717..948507)
                     /gene="RFA1"
                     /locus_tag="AWJ20_4011"
                     /inference="similar to AA sequence:KEGG_Orthology:K07466"
                     /codon_start=1
                     /product="replication factor A subunit protein RFA1"
                     /protein_id="XP_018733686.1"
                     /db_xref="GeneID:30036097"
                     /translation="MTELTVCFAEFGRTSNPSEVVPKFPQLKLQVLKVKLIQGAEPSQ
                     NRMRLTVSDGVHYSQAIVNLNEEKGGAQSDISVGSVIEVKSYDSHRLQTGKIVFVLYE
                     WDVVGVESPIGHPTSLEANTEAKANDSMSPAPAPVAPVVAPPAPAPVTKPKAKPAAAP
                     GNFTAIIPIDILSPYHNKWTIRARVSNKSDIRTFTNARGEGKLFNVTLVDESGEIRAT
                     GFSQQVDAFYDLLQEGKVYYISKCRVQVAKKQFSNVQNDFELVFDRDSQIELCTDEVD
                     VPKIKFDFTSIKDLGTADINGTVDFIGVLKSINPAEQITSKNTGRPYDKRDVVLVDEG
                     DYSIRATFWGKSAVDFSTPLESVIAIKGAKISDFNGRNISILNSSTVSVDPDVPEAHA
                     LKGWYSTNGRDKTFEQLPGPSGATSTGNSDDKNRTTIEKVISDQLGMTDQTDYFTIKG
                     TISYIRNENMWYPSCTNADCNKKVIQDTTDEWRCEKCNITIAEPNYRYIISMIVSDST
                     GQIWVSSFDDIGNIVIGMSAKELYQLQEQDLNGFTEVITKALYKEYVLRCRARKDNYN
                     DQVSVRYSAVRCTPVDYAHETQLLLQQLGI"
     gene            <952156..>954954
                     /locus_tag="AWJ20_4012"
                     /db_xref="GeneID:30036098"
     mRNA            <952156..>954954
                     /locus_tag="AWJ20_4012"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881060.1"
                     /db_xref="GeneID:30036098"
     CDS             952156..954954
                     /locus_tag="AWJ20_4012"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733687.1"
                     /db_xref="GeneID:30036098"
                     /translation="MDYNSQPAGGYPQPQTGVAGAGSNRSTAISHNGMPRSRHQQQLE
                     DMLLSPGGGVDSHMDDMIQRPGSRANVNVNGPSNTGPGYLPRSASAMSFGRRISTSSV
                     TSGSGRNSTANNAGFFGWGKKKFSNQDFDDDDDEGGTGAIGKAEDVPDISMNELTGLR
                     DRDRYPTFGGAPGTPGGPTSPGTGVPSNGRTMSISSTMSGGGFDTTPVIPTLRMGSGT
                     AGPQGTGQYRKNLTNSLKQAIRSSDGRLVGLSQSSPGQGPVPGPGYGLSGPNGMSGGN
                     GYPMQQQRPYTQHQRPPSLQNSRPNSDPRLRSLTGPPNHDFIGPPHNGGSARTMSMGG
                     GIGYFPPNANGIVGPSGPGAQGVIGGSPTMSGSQGFGPGPGPNVGLGQGAGRPTQRLS
                     RPPSRLSQQHAPMVTASTMTDPIDLGDLPSLPREPGTNANKSSNSSTNSTDSTVDGTV
                     TTATTMSSVTGSPIKAIPLSAGNNSADLNELRALNKALLDEVRLVTSELADSIRRELG
                     LSTHEDDSSIDNVSISSSNGDNEIIEARQRAQKLVILERELDLERRKRMVAQQKHEVD
                     EQHQLLTSNQYKIIELEKELAEKNRLYANERRESEMLRDNVSALTNEYEELQLETNQL
                     KNGILPELKSHVADLEVLTAAGNPIELLKQIEELKVENKKLQGLVEENSMRGPLGEKI
                     KAVESQRDALREALRSLKERNDHEIRQSTERVRQLEGKLEKEKVITNQMQRKLVQTRS
                     PSAYVALNSPYEVPSSANNHHTLSTSSSSGSLNSGLNGSNNVDVGLASSTGLGQNTGG
                     SGSTLSIPKRRGIGNLPGITPPAMSFSEMRPASPSPVNFEISQDPAWIDYVNPSKLPV
                     SQAHARQFSSTSYSSQASNSPTSETASLFKTPTYRSNASNSPTTGLSASSLSISNGRT
                     EHLPLSLAPAAATATTSS"
     gene            <970817..>972613
                     /gene="SAS10"
                     /locus_tag="AWJ20_4013"
                     /db_xref="GeneID:30036099"
     mRNA            <970817..>972613
                     /gene="SAS10"
                     /locus_tag="AWJ20_4013"
                     /product="Sas10p"
                     /transcript_id="XM_018881061.1"
                     /db_xref="GeneID:30036099"
     CDS             970817..972613
                     /gene="SAS10"
                     /locus_tag="AWJ20_4013"
                     /inference="similar to AA sequence:KEGG_Orthology:K14767"
                     /note="Subunit of U3-containing Small Subunit (SSU)
                     processome complex; involved in production of 18S rRNA and
                     assembly of small ribosomal subunit; disrupts silencing
                     when overproduced; mutant has increased aneuploidy
                     tolerance; essential gene; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 12068309]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9611201];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0032040 - small-subunit
                     processome [Evidence IDA] [PMID 12068309]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0000480 - endonucleolytic cleavage in 5'-ETS of
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 15489292]; GO_process:
                     GO:0000447 - endonucleolytic cleavage in ITS1 to separate
                     SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic
                     rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 15489292]; GO_process: GO:0000472 -
                     endonucleolytic cleavage to generate mature 5'-end of
                     SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 15489292]; GO_process: GO:0000462 - maturation
                     of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID 12068309];
                     GO_process: GO:0000462 - maturation of SSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 12837249]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Sas10p"
                     /protein_id="XP_018733688.1"
                     /db_xref="GeneID:30036099"
                     /translation="MARKSRGINTSSRRDERDEEELDLDEIDQFHKNQEEILLDQAGL
                     ARKGRSGLDEEMEMSDEEVLGLDNDEEEDEEDMEMDDDALYGGNNEEDEEEEGWGSSK
                     NNYYGADEPQDEESAKQEEQEALRLQKAHLAELAEDDYYEDEDLDEWKESAMATESDL
                     LDSTGGVHHEALPEQDPTLLSETERLNLLQTWYPEVLPFIGELEKYSGLLESLKKTVK
                     ESENKIASIKFAALSSYLGTLSAYFALFVGTIENGKVSLKDHDVVKGILKARELWRLA
                     SNLDDEQDESVKNKSKSNSGSSVAVTNASSSDTADDTIWQSASEGYSSEDETATINSK
                     SSATKRKRAALDRNESGSDSDSEFSVGAPVVKHVKRTRGIKSDYREEDIDEVSIADKL
                     ARKKSLRFYTSKIDQQTNKANNGREKFSGDADLPYKERHFERQQRLMEEARKRGLKTS
                     GGAYDPADDFGSDDDNDRSTAKLVNDGFSEDYYNTIKAASEKRKEEKRNNHLLAKQAA
                     KEGRLEELASELATDGDKRAINYQILKNKGLTPKRNKDNRNSRVKKRKRYEAAKKKLP
                     SVRQVYKAPTSSYQGEQTGIKKNLIRSVRFAN"
     gene            <973080..>973805
                     /locus_tag="AWJ20_4014"
                     /db_xref="GeneID:30036100"
     mRNA            <973080..>973805
                     /locus_tag="AWJ20_4014"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881062.1"
                     /db_xref="GeneID:30036100"
     CDS             973080..973805
                     /locus_tag="AWJ20_4014"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733689.1"
                     /db_xref="GeneID:30036100"
                     /translation="MSSSKAFKSHYEQDERWTAVDEYTNGHLHNPDTHGNSKVLSEAL
                     SNSIDKGLPDISTFPSYGKLLALQAKLAGADYALEVGTLGGYTSIWLATENPNIKIVT
                     LEVNQHHADVALENLRRAGVADRVEIIVGPALETLPKLAEEIAAGKRQKFGFTFIDAD
                     KTNNWNYFDWAVKISRSRAVIVVDNVVRNGTIVAKEKLNDPNVSGARNVIERVGKDNR
                     VDAVVQQTVGEKNYDGFLLAIVK"
     gene            <976058..>976879
                     /gene="AIM2"
                     /locus_tag="AWJ20_4015"
                     /db_xref="GeneID:30036101"
     mRNA            join(<976058..976133,976176..>976879)
                     /gene="AIM2"
                     /locus_tag="AWJ20_4015"
                     /product="protein AIM2"
                     /transcript_id="XM_018881063.1"
                     /db_xref="GeneID:30036101"
     CDS             join(976058..976133,976176..976879)
                     /gene="AIM2"
                     /locus_tag="AWJ20_4015"
                     /codon_start=1
                     /product="protein AIM2"
                     /protein_id="XP_018733690.1"
                     /db_xref="GeneID:30036101"
                     /translation="MRKPAITPRPAGALPQTPLLFWLGTTGESVGRLIDLNGVETYIS
                     GEKNASSKKAVLFLTDVFGHKYINNQLLADEYAKAGYLVVVPDLFKGDPRSPDSVPGA
                     DPNELRTKWLPNHTPEITRPIVEKAVEGLKKEYSPEFVGTVGYCFGARYVLQQLATDN
                     VNAGAIAHPSGVTIEDVRAVRKPLLIIGAETDGAYTPELQKQTEDVLREIKATYFTTL
                     ASGVSHGFAVRGDITNPIVKFAKEKALRDTVDWFNAFNSRK"
     gene            <977848..>979965
                     /gene="mei2"
                     /locus_tag="AWJ20_4016"
                     /db_xref="GeneID:30036102"
     mRNA            <977848..>979965
                     /gene="mei2"
                     /locus_tag="AWJ20_4016"
                     /product="RNA-binding protein involved in meiosis Mei2"
                     /transcript_id="XM_018881064.1"
                     /db_xref="GeneID:30036102"
     CDS             977848..979965
                     /gene="mei2"
                     /locus_tag="AWJ20_4016"
                     /codon_start=1
                     /product="RNA-binding protein involved in meiosis Mei2"
                     /protein_id="XP_018733691.1"
                     /db_xref="GeneID:30036102"
                     /translation="MNSLELTRYSLNASVSGPSLDTSSGRIVSTCLRHSSSGNDANNS
                     PVRFAVGHEVHMATSEGKFGSIQTGVQAVDSSQPGINSRADSLRQIPISDYISCGMHE
                     KTREPSPTSTSLRSLWFSGPQPVSSSESSRPFNPIGFGSNIYPRDESLSPCQNNHTLF
                     SLGSVIDSLGLVSGPLVRLEHRIEPIDTSSICADSERQTRLVKVSNLPINPTDQNTVS
                     FSLSPQSVLESCIAAGGTVPGSTFIEGSTVVALYYDLRDSVRLVDKLRERLAESNRSS
                     HRVTGNWANIQVAFIPVHEFDIVYRASTFLEHLALHKKVAVHLVIKENMRYCGYTTES
                     IGQILTKSIGDIRYIRKLPTTYAVVFVCEFFDIRARLNCINATREESSTLPFYCLSSY
                     SSENNMVKSTEAVSGVSQNQEQQLQPNENICYPHHQLNKSGTIASKPPISIYSTNSPT
                     SASKRSFASVASSGLNRNNEFVLRGSSDHSGIRPVPDLSGKTLKGKGNENPFGISQKH
                     FGFQIVDQNSRNGDSTSWEDSQEQIISTTATDTTLPAPIASSSPVLAPKSVAPLLTTI
                     LSPLSSSQMNRMNADTTSGISGSIVTRAAVPSKSIIDLDRIEQGLDTRKTIMIRNIPN
                     KIDQQMLKEYIDVTNRNTYDFLYLRIDFNNKCNVGYAFISFIDPRHIITFARARAGTR
                     WNKFNSAKICDMSYAAIYVESPL"
     gene            <981659..>983995
                     /gene="HSL7"
                     /locus_tag="AWJ20_4017"
                     /db_xref="GeneID:30036103"
     mRNA            <981659..>983995
                     /gene="HSL7"
                     /locus_tag="AWJ20_4017"
                     /product="Hsl7p"
                     /transcript_id="XM_018881065.1"
                     /db_xref="GeneID:30036103"
     CDS             981659..983995
                     /gene="HSL7"
                     /locus_tag="AWJ20_4017"
                     /inference="similar to AA sequence:KEGG_Orthology:K02516"
                     /note="Protein arginine N-methyltransferase; exhibits
                     septin and Hsl1p-dependent bud neck localization and
                     periodic Hsl1p-dependent phosphorylation; required along
                     with Hsl1p for bud neck recruitment, phosphorylation, and
                     degradation of Swe1p; relocalizes away from bud neck upon
                     DNA replication stress; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IEA]; GO_component: GO:0005935
                     - cellular bud neck [Evidence IDA] [PMID 10490648];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 10805747]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0032174 - cellular bud neck septin collar [Evidence
                     IDA] [PMID 23389636]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_function: GO:0008469 -
                     histone-arginine N-methyltransferase activity [Evidence
                     IEA]; GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA,IEA]; GO_function: GO:0035241 -
                     protein-arginine omega-N monomethyltransferase activity
                     [Evidence IDA] [PMID 16426232]; GO_function: GO:0035241 -
                     protein-arginine omega-N monomethyltransferase activity
                     [Evidence IDA] [PMID 18515076]; GO_function: GO:0035243 -
                     protein-arginine omega-N symmetric methyltransferase
                     activity [Evidence IDA] [PMID 18515076]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0000086 - G2/M transition of mitotic cell
                     cycle [Evidence IGI,IMP] [PMID 10490630]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0044257 - cellular protein catabolic process [Evidence
                     IMP] [PMID 23042131]; GO_process: GO:0034969 - histone
                     arginine methylation [Evidence IEA]; GO_process:
                     GO:0032259 - methylation [Evidence IEA]; GO_process:
                     GO:0007067 - mitotic nuclear division [Evidence IEA];
                     GO_process: GO:0006479 - protein methylation [Evidence
                     IEA]; GO_process: GO:0051726 - regulation of cell cycle
                     [Evidence IMP] [PMID 8647431]"
                     /codon_start=1
                     /product="Hsl7p"
                     /protein_id="XP_018733692.1"
                     /db_xref="GeneID:30036103"
                     /translation="MSDGTSTTSTVSMKPPLFVGVNLPAKHGVSDHLVVEAALDQGYD
                     MVTSRLTSRSYRKRIQALFHELEMVTPSPDEHLGNQGSNNNHGAFSFSQHQASHSHSH
                     SYPHRIFSDGADLSPYNSPSMSHSNGVNGARDTAIVSRQSSEPPIQQLPTGTLVEAEI
                     PAPELEDVVVHPGDHVSNTIALAAPWVEIDSKNPRVANLSLQVLSHELKYATFCGLPY
                     VIISGPKRRTNVIQYAQALNTLLMANPTLQVSIHLPLTEEFTKSATLVPPSDYLSIWE
                     VWNTIRNTCNYPHNISVALQLPRHTLPDYVVNRWFAEPVSMIIVSSRSFVRNAKGYPV
                     LPKSSQTVLNKFFKKNPFLIIEDPQDSTSFVGGDTAFLLYLRHLYQTSPPPSIIEGFA
                     AGYTDYLQAPLQPLIDNLDSAMYEVFERDPIKYNQYEKAIFHALLDRPGKEVVIGVVG
                     AGRGPLIDRVLKAASAANRTVKVLALEKNDSAYIYLLKRQAQDWGSAVQIIRGDMRTW
                     VPPPNTPAVNILVSELLGSFGDNELSPECLDGAQRLLDPVNGITIPSSYSSHITPIFS
                     PKLFASAWSLSAANSSGSQSGNGPATNSHSIASIRASRPGMCSADALHSPYVVMMEQV
                     DFVSEKIIQAWTFTHPIQNMLPNNQHNVRKCKATFPVPHKTVVHGIAGYFEAVLYKDI
                     HLSIRPDTIEAKSKDMVSWFPIWFPLSQPLVLGDDSEVDVSIWRLSDGRSVWYEWAAE
                     GYATVTMPDTGRGTSVRRIRSGSTAFHNSGGKYSSMTL"
     gene            complement(<990502..>993891)
                     /gene="RRP5"
                     /locus_tag="AWJ20_4018"
                     /db_xref="GeneID:30036104"
     mRNA            complement(<990502..>993891)
                     /gene="RRP5"
                     /locus_tag="AWJ20_4018"
                     /product="Rrp5p"
                     /transcript_id="XM_018881066.1"
                     /db_xref="GeneID:30036104"
     CDS             complement(990502..993891)
                     /gene="RRP5"
                     /locus_tag="AWJ20_4018"
                     /inference="similar to AA sequence:KEGG_Orthology:K14792"
                     /note="RNA binding protein involved in synthesis of both
                     18S and 5.8S rRNAs; component of both the ribosomal small
                     subunit (SSU) processosome and the 90S preribosome; acts
                     as part of a Mak21p-Noc2p-Rrp5p module that associates
                     with nascent pre-rRNA during transcription and has a role
                     in bigenesis of the large ribosomal subunit; has binding
                     preference for single stranded tracts of U's; relocalizes
                     from nucleolus to nucleus upon DNA replication stress;
                     GO_component: GO:0030686 - 90S preribosome [Evidence IDA]
                     [PMID 12150911]; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 8896463]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0032040 - small-subunit processome
                     [Evidence IDA] [PMID 12068309]; GO_function: GO:0003723 -
                     RNA binding [Evidence IEA]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0008266 - poly(U) RNA binding [Evidence IDA] [PMID
                     16428605]; GO_process: GO:0006396 - RNA processing
                     [Evidence IEA]; GO_process: GO:0000480 - endonucleolytic
                     cleavage in 5'-ETS of tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     8896463]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 8896463]; GO_process:
                     GO:0000464 - endonucleolytic cleavage in ITS1 upstream of
                     5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID 8896463];
                     GO_process: GO:0000472 - endonucleolytic cleavage to
                     generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 8896463]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Rrp5p"
                     /protein_id="XP_018733693.1"
                     /db_xref="GeneID:30036104"
                     /translation="MKTPGSIVVLQPKGAVVEFFGGVRGYLPVAEISEAFIKDPKDHF
                     RLGQSVAVRVLSVDPEAERLLVSCRTDSSNSQAQLESLGPGTVVSASIVEKTKDGVVV
                     NVEPQNVRGVIPLGHLTDGNDTRAQMKSLKVGENLESLVILERNFSKRFVMLSAKKSL
                     VEDARAGKFPSDISQISVGDKLHGYVKNATIKGLFVGFAGSLTGLALKQDLSTEFVSD
                     PAEKFSPMQSVECYVVNIDDAIGRFQLSLLAPKPKTLKKETSSGGFTPVDEAVTSIDE
                     FVPGKITKAQIVSVKETQLNVKLAENVQGRIDVSQIYDDYKSIPNSKDPLGEFKKGEI
                     VDVKIIGYHDARNHTFLAISHRSASHLVYELSAKKSDLNSSSYKPLTLEDVKVGSSWL
                     AFINNLTVDFAWVNLSPTVRGRIPLFDLTNNADELEDVEAHYPIGSAIECSVIEVDIK
                     TSNLKLSVRAHNGTAVNDYSDVKVGQTLPTLVTKVTETLVFVKLGANISGAAYISDAL
                     DDYSADLKLTYLPHQLVKAKIIDVDTSNKRISVTLRPSQTEKDAEKPVDQHIQSIEDV
                     QKGSIVRAFVKNVADKGLFVSLGRNITARIQIKNLSDSYLKDWKKYYTVGQVVTGKVL
                     SVDEHNSRVELSLKESAVTGKDPREVSGLGSINENDIFDGVITKVEDFGVFVKLDGTS
                     ITGLCHKSEVADVPLQDMSKVFSEGDKVKAKILKIDTEKRRVSLGLKASYFTELESDV
                     EMEEFDVNNDEDDDDDDELDNSVAFEDDSEEEEEGDESDDESDEDNGIAVTASKKSSN
                     GLSVGFDWTGTNVLDEMNTKEDGDDNEDDDSSNEEEGRSRKRRKRSKFVEDKTGTLNT
                     KLPQSIQDFERLLVGSPNSSIMWMNYMAFQLQLSEIEKAREIAQRALKTINFREEQER
                     LNVWIALLNLENSFGTNQTAEDTFKEAIQFMDSKTIHMKYAGILSQSEGKAKKAEELY
                     DVAMKKFGGEDMSIWITYANFLFDHDNAAKARSLLDRSLRMLPARNHKEIITKFAQLE
                     YTKGEAERGRTLFEGLISSYPRRIDLWIVYLDYEIKNGDKETVEKLFERVIGVKLTMK
                     QAKFFFKKWLGFEDKLGDSKKVDYVKAKASEYVSSRTEQEE"
     gene            complement(<994013..>995830)
                     /gene="RRP5"
                     /locus_tag="AWJ20_4019"
                     /db_xref="GeneID:30036105"
     mRNA            complement(join(<994013..995530,995642..>995830))
                     /gene="RRP5"
                     /locus_tag="AWJ20_4019"
                     /product="Rrp5p"
                     /transcript_id="XM_018881067.1"
                     /db_xref="GeneID:30036105"
     CDS             complement(join(994013..995530,995642..995830))
                     /gene="RRP5"
                     /locus_tag="AWJ20_4019"
                     /inference="similar to AA sequence:KEGG_Orthology:K14792"
                     /note="RNA binding protein involved in synthesis of both
                     18S and 5.8S rRNAs; component of both the ribosomal small
                     subunit (SSU) processosome and the 90S preribosome; acts
                     as part of a Mak21p-Noc2p-Rrp5p module that associates
                     with nascent pre-rRNA during transcription and has a role
                     in bigenesis of the large ribosomal subunit; has binding
                     preference for single stranded tracts of U's; relocalizes
                     from nucleolus to nucleus upon DNA replication stress;
                     GO_component: GO:0030686 - 90S preribosome [Evidence IDA]
                     [PMID 12150911]; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 8896463]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0032040 - small-subunit processome
                     [Evidence IDA] [PMID 12068309]; GO_function: GO:0003723 -
                     RNA binding [Evidence IEA]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0008266 - poly(U) RNA binding [Evidence IDA] [PMID
                     16428605]; GO_process: GO:0006396 - RNA processing
                     [Evidence IEA]; GO_process: GO:0000480 - endonucleolytic
                     cleavage in 5'-ETS of tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     8896463]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 8896463]; GO_process:
                     GO:0000464 - endonucleolytic cleavage in ITS1 upstream of
                     5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID 8896463];
                     GO_process: GO:0000472 - endonucleolytic cleavage to
                     generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 8896463]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Rrp5p"
                     /protein_id="XP_018733694.1"
                     /db_xref="GeneID:30036105"
                     /translation="MSFKRKRDEESAGVAPVSQPPSALRMEDTAFPRGGASTVLTPLE
                     IKQATNEATRDLFTVRFYWASESNAANGKKKSKKQHRNKVHQKSEAGSDKAGEKHKIK
                     VESLSFGKLTAGSVVLGQVVQINTLDIALSLPNNLLGYVPITNISAKLSERISKAEDD
                     DESGSEDEDNEDSDLPQLSQLFKVGQWLRALVVENEKVNNKKRIELSIDPLQVNEEIE
                     TDDLVAGIAVQGSVQSVEDHGIIVDIGRDDVSGFLSNKELSHAGIEASSLGVGQVLLL
                     TILSKSANGRTVTLTASATAKKMTIVKAVTLNKSLLAGTLVEVLITDIRSNGLVGKVF
                     GSIDATIDIVHSGIYDRAVLEQNFKEGKVVKGRVIYSPPAAVSESDDENSTKVFVSLL
                     ETTIELKVAEDGDALPIGQILEAKVKIVDANGLYVDIGTKSLGFVHVSRVADKRIEDL
                     SIEEAYSVGTTHPARILNYNYADNLYIVSTEKSVIEQKYLRVEDVSVGEKVTGTVDRI
                     LPKGGVLIKLWEGFSGIANDIHLSDIKLAHPEKKFKPGMKVTARVSSIICFKVDCGYL
                     RY"
     gene            <996712..>997326
                     /gene="MXR1"
                     /locus_tag="AWJ20_4020"
                     /db_xref="GeneID:30036107"
     mRNA            <996712..>997326
                     /gene="MXR1"
                     /locus_tag="AWJ20_4020"
                     /product="Mxr1p"
                     /transcript_id="XM_018881069.1"
                     /db_xref="GeneID:30036107"
     CDS             996712..997326
                     /gene="MXR1"
                     /locus_tag="AWJ20_4020"
                     /inference="similar to AA sequence:KEGG_Orthology:K07304"
                     /note="Methionine-S-sulfoxide reductase; involved in the
                     response to oxidative stress; protects iron-sulfur
                     clusters from oxidative inactivation along with MXR2;
                     involved in the regulation of lifespan; reduced activity
                     of human homolog implicated in Alzheimer disease;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 20799725]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_function:
                     GO:0016671 - oxidoreductase activity, acting on a sulfur
                     group of donors, disulfide as acceptor [Evidence IEA];
                     GO_function: GO:0008113 - peptide-methionine (S)-S-oxide
                     reductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0008113 - peptide-methionine (S)-S-oxide reductase
                     activity [Evidence IDA,IMP] [PMID 15141092]; GO_function:
                     GO:0008113 - peptide-methionine (S)-S-oxide reductase
                     activity [Evidence IDA,IMP,ISS] [PMID 9275166];
                     GO_process: GO:0034599 - cellular response to oxidative
                     stress [Evidence IGI,IMP] [PMID 11929995]; GO_process:
                     GO:0034599 - cellular response to oxidative stress
                     [Evidence IMP] [PMID 9275166]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0030091 - protein repair [Evidence IEA];
                     GO_process: GO:0006979 - response to oxidative stress
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Mxr1p"
                     /protein_id="XP_018733695.1"
                     /db_xref="GeneID:30036107"
                     /translation="MASGNFFPKLLVRLLSSSSPKMSATKISPTLDTVGYQVATVGAG
                     CFWGVEHIYRKHFGNGKGLIDARVGYSGGTTTNPSYKQVCTSGTGHAEALQITFDPSL
                     VTYDTLIDFFFRMHDPTQLNRQGPDQGTQYRSVIFTHDDEQQKVAEEVKERMQKTFYK
                     DPIVTKIEPIEAFWDAETYHQLYLHKNPTGYECPSHYVRTKPQL"
     gene            <999749..>1000363
                     /locus_tag="AWJ20_4021"
                     /db_xref="GeneID:30036108"
     mRNA            <999749..>1000363
                     /locus_tag="AWJ20_4021"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881070.1"
                     /db_xref="GeneID:30036108"
     CDS             999749..1000363
                     /locus_tag="AWJ20_4021"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733696.1"
                     /db_xref="GeneID:30036108"
                     /translation="MAVVGISGYAVYAFDVLVAHLEGRAPVTLAQCLAAVPGSPPLTG
                     KSPLFVTWNTIAKDGDASLRGCIGTFQEEELESGVASYSLTAALEDPRFRPIQKRELP
                     HLECGVTILKNFESAANPMDWEIGVHGIKGVFTHRGRRTSATFLPDVAVEQGWDKETT
                     LVYLADKANAHPDSTISLTRYQGEKSAIRYEEYLDILKQIDARE"
     gene            complement(<1001193..>1002584)
                     /locus_tag="AWJ20_4022"
                     /db_xref="GeneID:30036109"
     mRNA            complement(<1001193..>1002584)
                     /locus_tag="AWJ20_4022"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881071.1"
                     /db_xref="GeneID:30036109"
     CDS             complement(1001193..1002584)
                     /locus_tag="AWJ20_4022"
                     /inference="similar to AA sequence:KEGG_Orthology:K01443"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733697.1"
                     /db_xref="GeneID:30036109"
                     /translation="MPRISTSTPNTSGYVDSDADDSLVSPNSPSSVFSQEDKFLTGVT
                     APIIRFINATLCEEGKSYPNSQLWVDAESGVILKSSIDTEFSDDQEPSPEEVTTIDLN
                     GDILSPGFIDAQLNGAFGMDFCDVNYGDGSIKAFEEGVAYIGRQLFKTGVTSYCPTLP
                     STYPHVYQKVLPSLKPKRISTAAESLGYHLEGPFLSPKKPGCHPRDAIVTAPKHFQSF
                     EEIYGADNIDGAAIITLAAEQEGVMESIPDLTKRGITVSLGHSVLDYDGGCKAVNLGA
                     KMITHVYNAMTQPHHREPGLFGLLGAPNKDLPDSSCQLTKPYYGIIVDGVHVHRSGVA
                     VAYHAHPEGCCLVTDAMFPMGLPSGTYTWGEQTIVKDDLLLFLNGTNTIAGSGVELDT
                     CLRNLMAWAEIPIETALKTVTTHPARVLGVENKKGTLRAKADADLTILDAAGNIKHVY
                     KLGQCVYRAADKK"
     gene            <1004474..>1007383
                     /locus_tag="AWJ20_4023"
                     /db_xref="GeneID:30036110"
     mRNA            <1004474..>1007383
                     /locus_tag="AWJ20_4023"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881072.1"
                     /db_xref="GeneID:30036110"
     CDS             1004474..1007383
                     /locus_tag="AWJ20_4023"
                     /inference="similar to AA sequence:KEGG_Orthology:K01207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733698.1"
                     /db_xref="GeneID:30036110"
                     /translation="MDFEFSDQLPVQLTELGKAIGQMFLVGFAEDYVTDETRELITKY
                     HIGSIMLRAKNLRDAETTRNLILELQQIAHDAGHEHPLLIAIDQENGMLNNLNDEEYL
                     SQFPGPMAIVATKSLNLARQVAHATGQQLKSLGVNWLLGPVLDVLTNSTNRLLGVRTM
                     GDDAQEVTRFSLAFMEGYESAGICQCGKHFPGYGNATVDSTVSLPVVPESIEQLETSS
                     LIPFREAIKANIDAIMVGGCALPKIAMNEMHACLSERVVRELLREDMGYDGVIVSECL
                     EMDALYENVGVRQGAVMTAIAGCDVVLVCSSYRLQIEAISGIFGAVTSGILEHEAIYN
                     SAKRVAKLKSKHLSWQEALNPKPLSYLKELKKTHLQLSKTAYQQSITLVRDHSKCIPL
                     SESIERDSDIVLLTPLVTPLVSTKHDANLDHLLLGENVFQEFGRSLARLHTGKVLHAS
                     YTANGVISMHDQLIERAQAVIIVTTDAHRNMYQVGFTKHVGIICAQQRKPVIAIAASS
                     PYDLALDRAIGTYLCLYEFTNEALDTTAKVLFGQLPARGHFPGSGLYQRTQNRPTTNG
                     NRTNRNKWLVEKWSHERDMKRLKTLWENCFSDRHLGPGVGGAFQLLLTSGQTHFIVRN
                     SSTNNLYGFCATWVYEKQGIGCIAMIFVEPSRRGMSIGRSLHDRAVKYLIRERNVSSV
                     KIGCSIPSFFHGIPTNNYGPLMKWFQEAGWVIDVNLAQVLAADSSDTDPILPQQTFNS
                     TYPQPTNSISHPHSGHSALHLTDGSIDLGDTVSNPTDGSTITVLSTMLLTSLSEWSPS
                     KTLIRQLEVLGIKFDICLNEDRFSEIMAFANSPKYAQFEGLTELYREALSSGDSKIIV
                     ALDPVKKTVVGSIILFTRGSSIASYMPWIVEFEDARVGGLCGVITDPQYNKELESVFN
                     CGLVGCGVRQFKLQGFERCVIDRATGHQAEGYAENGFYTLRRYLQVSNVAQSFVV"
     gene            <1009856..>1011643
                     /gene="HXK2"
                     /locus_tag="AWJ20_4024"
                     /db_xref="GeneID:30036111"
     mRNA            <1009856..>1011643
                     /gene="HXK2"
                     /locus_tag="AWJ20_4024"
                     /product="hexokinase 2"
                     /transcript_id="XM_018881073.1"
                     /db_xref="GeneID:30036111"
     CDS             1009856..1011643
                     /gene="HXK2"
                     /locus_tag="AWJ20_4024"
                     /inference="similar to AA sequence:KEGG_Orthology:K00844"
                     /note="Hexokinase isoenzyme 2; catalyzes phosphorylation
                     of glucose in the cytosol; predominant hexokinase during
                     growth on glucose; functions in the nucleus to repress
                     expression of HXK1 and GLK1 and to induce expression of
                     its own gene; antiapoptotic;
                     phosphorylation/dephosphorylation at serine-14 by protein
                     kinase Snf1p and protein phosphatase Glc7p-Reg1p regulates
                     nucleocytoplasmic shuttling of Hxk2p; HXK2 has a paralog,
                     HXK1, that arose from the whole genome duplication;
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     11311123]; GO_component: GO:0005829 - cytosol [Evidence
                     IDA] [PMID 9563516]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16962558];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11311123]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 9563516]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0004396 -
                     hexokinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004396 - hexokinase activity [Evidence IDA] [PMID
                     12611889]; GO_function: GO:0004396 - hexokinase activity
                     [Evidence IDA] [PMID 332086]; GO_function: GO:0004396 -
                     hexokinase activity [Evidence IMP] [PMID 6341351];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0016773 - phosphotransferase
                     activity, alcohol group as acceptor [Evidence IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0005975 - carbohydrate metabolic
                     process [Evidence IEA]; GO_process: GO:0046835 -
                     carbohydrate phosphorylation [Evidence IEA,IEA];
                     GO_process: GO:0032445 - fructose import [Evidence IGI]
                     [PMID 6300872]; GO_process: GO:0006000 - fructose
                     metabolic process [Evidence IMP] [PMID 6300872];
                     GO_process: GO:0046323 - glucose import [Evidence IGI]
                     [PMID 6300872]; GO_process: GO:0006006 - glucose metabolic
                     process [Evidence IMP] [PMID 6300872]; GO_process:
                     GO:0006096 - glycolytic process [Evidence IEA,IEA];
                     GO_process: GO:0006096 - glycolytic process [Evidence IDA]
                     [PMID 332086]; GO_process: GO:0006096 - glycolytic process
                     [Evidence IDA,IMP] [PMID 8917466]; GO_process: GO:0019318
                     - hexose metabolic process [Evidence IEA]; GO_process:
                     GO:0006013 - mannose metabolic process [Evidence IDA]
                     [PMID 332086]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0016310 - phosphorylation
                     [Evidence IEA]; GO_process: GO:0008361 - regulation of
                     cell size [Evidence IMP] [PMID 12089449]; GO_process:
                     GO:0046015 - regulation of transcription by glucose
                     [Evidence IDA] [PMID 11311123]; GO_process: GO:0001302 -
                     replicative cell aging [Evidence IMP] [PMID 15722108]"
                     /codon_start=1
                     /product="hexokinase 2"
                     /protein_id="XP_018733699.1"
                     /db_xref="GeneID:30036111"
                     /translation="MNTIVPLSTRGPSSPEGSITASTTSTTPSSSPPSSSKSAPSSAG
                     FLSPPASPQPEKHAASGIMGSSTVSTSTTTARTSSRTATKSNLISGTVLDGLNDNLHR
                     LVTPALSPTSSDRNNDENVHEIDHEIDISLPTPVSSTGDHFKLFASSYDLLSLDAVAK
                     RTTSHLTRVLGTNHHTPTMIPTCMTCLPSGKEIGTFLSVDLGGSTFRVAFVCLKGPGK
                     QSEIVYMSVVPVPDSVKQGSGNDFFLWMAHEVKKGVDKVLPNQPKSVPINMGISWSFP
                     FVQTAMHTAIIEKMGKGYNVADEISGWNLGKSFENAFEKLDLNIKVTAIVNDGGACMI
                     SRAYADNATKISLILGTGINAGIMVPSHLIGEAKLESIASGKPAPTYMINTEISMLDD
                     TIVPASIWDVELDAAIERPGFQPLETKVSGRYLGEISRLIIRDLVLNNTLCGGILPEK
                     LDVPYSLESSLMSDIEEHFRNSRLDLARDAFLRAHPHPYLSDSDLDQICDVFVNVSNR
                     SAAFTAAVLVGLADIIYQNTAHSSAESQSCIISYTGTVIEKYPLFRKRCQQFLDSLCA
                     SRGIQLRLESSENGSIFGPVIAAAMNHCN"
     gene            complement(<1013454..>1015280)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4025"
                     /db_xref="GeneID:30036112"
     mRNA            complement(<1013454..>1015280)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4025"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881074.1"
                     /db_xref="GeneID:30036112"
     CDS             complement(1013454..1015280)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4025"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733700.1"
                     /db_xref="GeneID:30036112"
                     /translation="MGAFFLTNGDYRPSNGTHKVPRHPVLSDVHCGVSVPKYGACAQL
                     ENRRPARRSAFAYHKVLILECSPDDSGVSVGSDETLNEPTVWKPIDIVSEQAYCNSAP
                     IDNDDDNSSEWSFETEDEAAFTTRQIETASSKEDTEATWSAPAASWALSDCPIEIDEN
                     DFTPESHGEVTLAESPLETSHSDLAESEVITPAKVDEQTTWPTADAPAPTIEGSCSID
                     SLVAEIIAVANLFKDLPQLIVSGGLQAGPESELPKTAPLALSKPIAQTPSDDLVIQVE
                     EVDKSKTPLLLTRAKAKLTSFIGHAAPISKSTLMFNGVQTATYATPLSSQEALSMENK
                     KYRLDGGAIIKVYSPTVYQNIRTLCGIDYHEFLNSFVLQSDLTKTKSPGKSGSDFLFT
                     PDGKYIIKTIKRKEHNVIANADFLADYYNHVKAHPGTQLPFYLGNYTLVAGGKKTHFV
                     IMKNLLQKETDLIYDLKGSSHDRRAGPRKDNRGRVVFKDLDWTDKHEAISMSQEDRDK
                     LLVQVSKDVGLLKRHNIMDYSLLVGFQSDTRTCEQQPVIGMIDTLCPFSWRKRAETTA
                     KGLFFGRSAVDVVHPQKYGARFLNFVQSAVVPGPGRSDSTRC"
     gene            complement(<1030228..>1031409)
                     /locus_tag="AWJ20_4026"
                     /db_xref="GeneID:30036113"
     mRNA            complement(<1030228..>1031409)
                     /locus_tag="AWJ20_4026"
                     /product="homogentisate 1,2-dioxygenase"
                     /transcript_id="XM_018881075.1"
                     /db_xref="GeneID:30036113"
     CDS             complement(1030228..1031409)
                     /locus_tag="AWJ20_4026"
                     /inference="similar to AA sequence:KEGG_Orthology:K00451"
                     /codon_start=1
                     /product="homogentisate 1,2-dioxygenase"
                     /protein_id="XP_018733701.1"
                     /db_xref="GeneID:30036113"
                     /translation="MRPAVAHKGYTDLPDKPDMESVFLSTNPKVHVSPTQLAWSPFDI
                     PTEKTTFVDGLKTVAGSGEPSLREGLATHVYTANASMKNQAFVNQDGEFLIMPQQGRV
                     DVQTEFGWLYVQPGEFLVVQRGIRFSVNLPDGPSRGYILEIWGSNFELPDLGPLGGYG
                     MANARDFLYPQASYDLEPVSNFEIITKLNGKFFKSTQDHTPYDVVAWHGNYVPYKYDM
                     TKFVNIGSISVDHIDPSVFTIMTAKSRDPNAALADVMIFMPRWDVASHTYRPPYYHRN
                     VASELMGLIYGDYGGRSDSFQPGSVSYETGMTPHGVAYPEFKAASENPPPTQQISLGS
                     MAFMFESSRPFTITDYAWKSDKIHFHETGMWDDLVNNFTLHLEEVKKLTNGKHEHGVN
                     H"
     gene            <1032590..>1033435
                     /locus_tag="AWJ20_4027"
                     /db_xref="GeneID:30036114"
     mRNA            <1032590..>1033435
                     /locus_tag="AWJ20_4027"
                     /product="Mediator of RNA polymerase II transcription
                     subunit 18"
                     /transcript_id="XM_018881076.1"
                     /db_xref="GeneID:30036114"
     CDS             1032590..1033435
                     /locus_tag="AWJ20_4027"
                     /inference="similar to AA sequence:KEGG_Orthology:K15136"
                     /codon_start=1
                     /product="Mediator of RNA polymerase II transcription
                     subunit 18"
                     /protein_id="XP_018733702.1"
                     /db_xref="GeneID:30036114"
                     /translation="MMYQQLSLVGSLKDAEIKITLHTLAALSGMKPTRIFNHHLVWIP
                     TYPFNPVLAAGEVNQIEQYRITCDTSLVDPASEDEYLPPAGFKENKDFLQTMPWKMII
                     SEVPEAGKRQVTSQSILESAIVEGSPFEFMEKMGYKFSHEYWSKGSEFVFGNIVVRIF
                     RICVKDQITAPTTEDQNLADTTEGSGTADNAMVIDDDSFGDKITAETALASQKAAYQP
                     LKLLDKSGQWSIKAFLSVKQLTDLESIITGTAQLEKFQAEMAGLFELKMADRNSYDTR
                     LRANR"
     gene            complement(<1033650..>1035482)
                     /gene="NOP7"
                     /locus_tag="AWJ20_4028"
                     /db_xref="GeneID:30036115"
     mRNA            complement(<1033650..>1035482)
                     /gene="NOP7"
                     /locus_tag="AWJ20_4028"
                     /product="Nop7p"
                     /transcript_id="XM_018881077.1"
                     /db_xref="GeneID:30036115"
     CDS             complement(1033650..1035482)
                     /gene="NOP7"
                     /locus_tag="AWJ20_4028"
                     /inference="similar to AA sequence:KEGG_Orthology:K14843"
                     /note="Component of several different pre-ribosomal
                     particles; forms a complex with Ytm1p and Erb1p that is
                     required for maturation of the large ribosomal subunit;
                     required for exit from G0 and the initiation of cell
                     proliferation; GO_component: GO:0070545 - PeBoW complex
                     [Evidence IDA,IPI] [PMID 16287855]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     10684247]; GO_component: GO:0005654 - nucleoplasm
                     [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 10684247]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IEA];
                     GO_component: GO:0030687 - preribosome, large subunit
                     precursor [Evidence IDA] [PMID 11583614]; GO_component:
                     GO:0030687 - preribosome, large subunit precursor
                     [Evidence IDA] [PMID 23212245]; GO_function: GO:0003729 -
                     mRNA binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0043021 - ribonucleoprotein complex binding [Evidence
                     IEA]; GO_process: GO:0044786 - cell cycle DNA replication
                     [Evidence IMP] [PMID 12110181]; GO_process: GO:0000466 -
                     maturation of 5.8S rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IEA];
                     GO_process: GO:0000463 - maturation of LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IEA]; GO_process: GO:0000462 -
                     maturation of SSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     12837249]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IEA]; GO_process: GO:0042273
                     - ribosomal large subunit biogenesis [Evidence IDA] [PMID
                     11911362]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IDA] [PMID 16888624];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Nop7p"
                     /protein_id="XP_018733703.1"
                     /db_xref="GeneID:30036115"
                     /translation="MRIKKKHQAGAAKNFITRTQAVKKLQVSLADFRRLCIFKGIYPR
                     EPRNKKKANKGSTKPTTFYYTKDIQYLLHEPVLNKFREHKIFARKLSRALGRGEVGDA
                     KRLDDNRPRYKLDHIIKERYPTFNDALRDLDDPLCMLFLFAAMPATNSVNYKVIEDAD
                     RLCNQWMAYVARERLLRKVFVSIKGVYYQARVKGQDILWLVPFKFPQNIPDDIDFRIM
                     LTFLEFYTTLLQFVLYRLYTESGLVYPPQINASKMKGVGGISAYLLESRQNGLSLLGA
                     KASENTNGKATTNGATPNLKMDRIAQADEEADHDGDEQEEDENDAANESALDTFQPIP
                     ATETAASDILAQPAPESEREGQLFSNFTFFVGREVSLDIVEFLIIAFDGKVISESAID
                     ELIDNENEESSNDATEAYKKIDLSTVTHQICDRPTVPNKVPGRTYIQPQWIFDSINKG
                     QLLPVANYAPGEALPPHLSPWGDAANYDPEAALEDGEGESSSEAEEEETIEGEALPDE
                     DEEEVDEEAEEALERQRDLEKEAAGIKFSEQQSSAESKKRKKKTAADKEQEEKDLRKI
                     MMSNKQKKLYNKMQYGIDKKQAREEELKKKRRKIEATKEKLKSS"
     gene            complement(<1038269..>1039882)
                     /gene="STL1"
                     /locus_tag="AWJ20_4029"
                     /db_xref="GeneID:30036116"
     mRNA            complement(<1038269..>1039882)
                     /gene="STL1"
                     /locus_tag="AWJ20_4029"
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /transcript_id="XM_018881078.1"
                     /db_xref="GeneID:30036116"
     CDS             complement(1038269..1039882)
                     /gene="STL1"
                     /locus_tag="AWJ20_4029"
                     /codon_start=1
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /protein_id="XP_018733704.1"
                     /db_xref="GeneID:30036116"
                     /translation="MVDISGGIRSRTNTGGLTGRRLRWAITLVATIGFSLFGYDQGLM
                     SGQITAPQFNKEFPATAGTSSHATVIQGAVTSCYELGCFFGAMFALFKGEKIGRRPLI
                     LLGSSIIILGTVISVTAFGPHWGLGQFVVGRVITGLGNGINTSQIPIWQSEISKAENR
                     GRLVNLEGSVIAVGTFIAYWLDYGFSFTNTSVQWRFPVAFQIFFAGLLFFGMWSLPES
                     PRWLISQGRHEEAISILAALNNTDINDEQIIAEARVVMEVVSRNKDQASIREVFTGGK
                     TQHFRRMLIGSSTQFFQQFTGCNSSIYYSTVLMKTSMNVSDSLALILGGVFATVYALS
                     TIPSFFLIDSIGRRKLFIIGALGQGISFTITFACLIPNTMEASKGAIVGLYLFIFFFA
                     FTILPLPWVYPPEINPTRTRTVATGFSTCTNWLSNFVIVMITPIFVTNTRWGCYLFFA
                     LINFLFVPIIYFFYPETAGRSLEEMDIIFAKGYVEKKPYFRVAQQLPSLTPEQVENEA
                     ISLGLYEAPSEKGDADYVDDITNSETTSS"
     gene            complement(<1042292..>1043908)
                     /gene="SGA1"
                     /locus_tag="AWJ20_4030"
                     /db_xref="GeneID:30036118"
     mRNA            complement(<1042292..>1043908)
                     /gene="SGA1"
                     /locus_tag="AWJ20_4030"
                     /product="glucan 1,4-alpha-glucosidase"
                     /transcript_id="XM_018881080.1"
                     /db_xref="GeneID:30036118"
     CDS             complement(1042292..1043908)
                     /gene="SGA1"
                     /locus_tag="AWJ20_4030"
                     /inference="similar to AA sequence:KEGG_Orthology:K01178"
                     /note="Intracellular sporulation-specific glucoamylase;
                     involved in glycogen degradation; induced during
                     starvation of a/a diploids late in sporulation, but
                     dispensable for sporulation; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 2493265];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 24390141]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0004339 - glucan
                     1,4-alpha-glucosidase activity [Evidence IEA,IEA];
                     GO_function: GO:0004339 - glucan 1,4-alpha-glucosidase
                     activity [Evidence IDA] [PMID 2493265]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0016798 - hydrolase activity, acting on
                     glycosyl bonds [Evidence IEA]; GO_function: GO:0004553 -
                     hydrolase activity, hydrolyzing O-glycosyl compounds
                     [Evidence IEA]; GO_process: GO:0030437 - ascospore
                     formation [Evidence IEP] [PMID 350852]; GO_process:
                     GO:0005975 - carbohydrate metabolic process [Evidence
                     IEA]; GO_process: GO:0005980 - glycogen catabolic process
                     [Evidence IMP] [PMID 11486014]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0000272 -
                     polysaccharide catabolic process [Evidence IEA];
                     GO_process: GO:0005976 - polysaccharide metabolic process
                     [Evidence IEA]; GO_process: GO:0030435 - sporulation
                     resulting in formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="glucan 1,4-alpha-glucosidase"
                     /protein_id="XP_018733705.1"
                     /db_xref="GeneID:30036118"
                     /translation="MLVEKFLILLASCSVTSSLPIYESLSSFVGFTSPDEQKLLNGVD
                     ATRSSSSKGGHRVPGSLINEIEYEDWLKTETDLAFDRVISNIGGYGQGLDDVLPGAVI
                     ASPSKSKPNYYYIWTRDAAISINSLITRYDDQKGQNETLRSIINDYLNSSAIMQHVDN
                     PSGTFENLEGLGEPKFMVDGRPFTSTWGRPQRDGPPLRASTMINYVNSEVRNNNLQYK
                     DFEDLYYNVIRPDLDYVVQHWKDKSFDLWEEVYGNHFFTSMVQLKSLIHGAEIAHELG
                     DKISFYVFRGVASELREYIRQYWDSSRKHLVETLDSKERSGLDTALFLGSIHAIDLYN
                     WDGIDTDELVFPPYSDEVIASIDHLVNDMRYRFPINARRLDEFSKQGKNNSLAGVGIG
                     RYPEDVYDGADVTTGNPWFLCTATVSQTLYLLADHLITRPDSYKLVISDITKPFYSLF
                     LSDNENFDSPDFSIARTNEAYTALVKRIIEYADSFLDVIREHHANDGSMSEQFSRYDG
                     YMRGATHLTWSYSAFWAASRQRNLTLSRLY"
     gene            <1046236..>1049613
                     /gene="ARK1"
                     /locus_tag="AWJ20_4031"
                     /db_xref="GeneID:30036119"
     mRNA            <1046236..>1049613
                     /gene="ARK1"
                     /locus_tag="AWJ20_4031"
                     /product="serine/threonine protein kinase ARK1"
                     /transcript_id="XM_018881081.1"
                     /db_xref="GeneID:30036119"
     CDS             1046236..1049613
                     /gene="ARK1"
                     /locus_tag="AWJ20_4031"
                     /inference="similar to AA sequence:KEGG_Orthology:K08853"
                     /codon_start=1
                     /product="serine/threonine protein kinase ARK1"
                     /protein_id="XP_018733706.1"
                     /db_xref="GeneID:30036119"
                     /translation="MQKQAPPGAYPPGTQLTVGSHAVTIKSYISEGGFAHVYVVKISP
                     STLEGEIACLKRVVVPDKIHLNLLRAEVDAMKRLKGHPNIVRYIDSHAARLNAQGGLP
                     ASAQAQLQAQGHGQGGSQVYEVFLLMEYCSGNGLIDFMNTRLREQLTESEILKITSDV
                     TYGLACMHYLQPPLIHRDLKIENILISGDGTYKLCDFGSVSPILRPPRNPGEYHILEQ
                     DIQRHTTAQYRSPEMIDIYRGHPIDEKSDIWALGVFLYKLCYYTTPFEREGSLAILHA
                     SFSFPPKPVYSDRLKGVISALLREDPRARPNVYQVLKEICAMRGLEVPIKDIYSGATS
                     TAATMVQPTTSVQLAHPAQDNQNHSLSASQQQPDNVSTAQGIVRSIPKEQQQRQWVPE
                     VTPMFRGRITVQQNNSMPSLDKFDNGDENHESRGSFTTGLASAANFDDDPFSSLDSSA
                     KQQRAKTQPVTPVHSSTPQEFTFDEADIESRFPSVEDLARELERTPFEFAQAHKPIQQ
                     QTNLQARTQPQVQKQTQTAPQPQFKPQMQSQLRSQPEGQVSQEMPRQVQSQQAIPQPA
                     TRLEQSTTSVSRSSRDSTPGEPLKTKPPPTMRKPGTTGTPSGYSAYPLKSASPPMPAP
                     KKLSQTSQPKPEKPALNTMPSGLSINISSASSGSDSEPTPSESYSKPLPRPPPHQIRP
                     RPLSMYSQSNTDAYFEASYNSVNQSPSPVIDQSQKFSYLPEDSNAIANTGNANHTGSL
                     IDTMPPEDREQLKVILTGLSQRSNTVVLDNSENHIDSNVDFLKALDNENTGSRPHHHR
                     KPSQSQYLYPSGTGDGSGGVGNGGSTGGSGWMNRSSSTSRRSGSTSRHSKKPSMTSLK
                     GKIGDAFKKFDNAAGAYRSTSDSSMMGPPVAAPRTVSAGSNPGGYRSSSRMSYTAESP
                     GDYAFSPKKEDDEFKYPVSSSTSVKHGPPHVHMHRSKSRNNGSSSIQSRVQQFLSRSE
                     SPPKKTASGYGKYTEEERQVSSSTHSPSPPNDTSSMPPPPPSKQYAAQKLGREVHREI
                     KRASMESTRDWINSDGSGRRNSKMHLPGRTDSQHSRKLSNISSESSGSNSGSKRPPVR
                     PKKPAHLQSPRRTVDKVQKAIDDDWEASFNQKYPSLG"
     gene            <1055708..>1056874
                     /gene="PCP1"
                     /locus_tag="AWJ20_4032"
                     /db_xref="GeneID:30036120"
     mRNA            <1055708..>1056874
                     /gene="PCP1"
                     /locus_tag="AWJ20_4032"
                     /product="Pcp1p"
                     /transcript_id="XM_018881082.1"
                     /db_xref="GeneID:30036120"
     CDS             1055708..1056874
                     /gene="PCP1"
                     /locus_tag="AWJ20_4032"
                     /inference="similar to AA sequence:KEGG_Orthology:K09650"
                     /note="Mitochondrial serine protease; required for the
                     processing of various mitochondrial proteins and
                     maintenance of mitochondrial DNA and morphology; belongs
                     to the rhomboid-GlpG superfamily of intramembrane
                     peptidases; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     12774122]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0008233 -
                     peptidase activity [Evidence IEA]; GO_function: GO:0004252
                     - serine-type endopeptidase activity [Evidence IEA];
                     GO_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IMP] [PMID 12774122]; GO_function:
                     GO:0004252 - serine-type endopeptidase activity [Evidence
                     IMP] [PMID 20558178]; GO_function: GO:0008236 -
                     serine-type peptidase activity [Evidence IEA]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]; GO_process:
                     GO:0010821 - regulation of mitochondrion organization
                     [Evidence IMP] [PMID 11907266]; GO_process: GO:0010821 -
                     regulation of mitochondrion organization [Evidence IMP]
                     [PMID 12707284]; GO_process: GO:0006465 - signal peptide
                     processing [Evidence IMP] [PMID 12417197]"
                     /codon_start=1
                     /product="Pcp1p"
                     /protein_id="XP_018733707.1"
                     /db_xref="GeneID:30036120"
                     /translation="MRNLSSNLSRSAFHVSGQLFGISRQKAFSSEAIGQVLIRGVAAR
                     HYSRNVTSSFSTLGSKYEAFTRSHTSINTPEKSVSVKHFTAGFFTNTFHTQNGPFLQS
                     FTKSVSPRQSILFMATHRDHGYGGSNGGSSYGRGGNWGKFNRYKNILVNHRVPLLFTG
                     AVLTVTTFIFPVLFQMPGMGVVKQNPQLVVYALIGLNVAGFLAWKTKQGSRFMYRYGL
                     LHKDSQFNKWSMIGSAFSHQEFWHIGINMYVLYNFGTTVASWVGTEQFLAAYIDGAVI
                     SSLASLMLPVLVRRFQNIPSLGASGAVFTTFGLFSYLAPHAKLALMFIPLPFGAWTVF
                     LGTMAYNGAGLFMRFGLSDYAGHLGGSIVGIIWGYYLTQRARRIRQRRSVINYR"
     gene            complement(<1069797..>1072009)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4033"
                     /db_xref="GeneID:30036121"
     mRNA            complement(join(<1069797..1071562,1071847..>1072009))
                     /gene="MSS4"
                     /locus_tag="AWJ20_4033"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881083.1"
                     /db_xref="GeneID:30036121"
     CDS             complement(join(1069797..1071562,1071847..1072009))
                     /gene="MSS4"
                     /locus_tag="AWJ20_4033"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733708.1"
                     /db_xref="GeneID:30036121"
                     /translation="MLALDTGLFPVSTPAGSPAGVPAAAGCRLQVAATGYVNQDYVVG
                     ADINIIFRAPCSHRVPRRPVLSDVNHGIVVPKYGACAQQENRRLARRSAFAYHKVLIL
                     ECSPDDSGVSVGSDETLNEPTVWKPIDIVAEQAYCSSAPIDNDDDNSSEWSFETGDEA
                     AFTTGQFGTTWSEEDTEATWSAPAASWALSDCPIEIDENESTPESHGEVTLVESPLET
                     SRSDLAESEEITPSKVAEVPCAIADIPTSNSSIDSLVAEIIAVATLYKGLPQLVVSGG
                     LQADSEFELPKTAPLALSKPIAQTPSDDLVIQVEEVDKSKTTLLLTRAKAKLTSFTGH
                     ASPILKSTLMFNGVQTAVYATPLSSHETLTMENKKYRLDGGAIIKAYSPIVYQSIRTL
                     CGIDCHEFLNSFVLQSDLTKTKSPGKSGSDFLFTPDGKYIIKTIKRKEHNVIANSEFL
                     ADYYNHVKAQSSTQLPFYLGNYTLVAGGKKTHFVIMKNLLQKETQLIYDLKGSTHDRR
                     AGPRKDNRGRVVFKDLDWTDKHEAIFMSQEDRDKLMVQVSKDVDFLKQHNIMDYSLLV
                     GLQSDTRTCQQQPVIGMIDTLCPFSWRKRAETISKSLIFGSSAIDVVHPSKYGARFLN
                     FVQSAVVPRPGRSVSTRC"
     gene            complement(<1073340..>1074926)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4034"
                     /db_xref="GeneID:30036122"
     mRNA            complement(<1073340..>1074926)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4034"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881084.1"
                     /db_xref="GeneID:30036122"
     CDS             complement(1073340..1074926)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4034"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733709.1"
                     /db_xref="GeneID:30036122"
                     /translation="MYHYDIPLRRSLANYARPVRYMARNLIKFTDHLYTCSYLLPEVN
                     IPQLLWDRSVQSKFHSANELAVKYLESKGYCNTYVCEKLCEKKTQELVRKARLSQSSA
                     WSTLTSAIADLNETIEIARDQIDRSEVELWRAIRGVEKHLNFVLTLGATVSTESIKKA
                     ESHLSGRLSTWETARAPRPKKRVPSATKSSTNPRDTRGTRPSSSHQQKVSIPTTAKRS
                     YEKKTPTRSLRTAILFDGVYRCVCTSLTPGVSHISSPTIYAVAGGTIEGHSQDLFNTI
                     RRLQGIRTSDYLSAFDLNSAGIAIKSPGRSGSDLLYTENGKYIIKTIPSSEHEVLIDL
                     LPSYVEHLERHKNSLLPVFLGHYTHEDNGKRTHFVVMKNLFSGHGLVDKVFDLKGSTY
                     NRAVDENTDNVGRLVYKDIEWMKHKETIQMNEEERTKFMIQLMNDIAFLKRNNIFDYS
                     MLVGKYDDSKKGVMGIIDILTPYNKPQALKRTALGLLHDPTTLSCMKPCDYAARFFNF
                     MESKVVPAVITGRVSRHHKH"
     gene            complement(<1078022..>1078540)
                     /gene="UBC6"
                     /locus_tag="AWJ20_4035"
                     /db_xref="GeneID:30036123"
     mRNA            complement(<1078022..>1078540)
                     /gene="UBC6"
                     /locus_tag="AWJ20_4035"
                     /product="E2 ubiquitin-conjugating protein UBC6"
                     /transcript_id="XM_018881085.1"
                     /db_xref="GeneID:30036123"
     CDS             complement(1078022..1078540)
                     /gene="UBC6"
                     /locus_tag="AWJ20_4035"
                     /inference="similar to AA sequence:KEGG_Orthology:K04554"
                     /note="Ubiquitin-conjugating enzyme involved in ERAD;
                     located at the cytosolic side of the ER membrane; tail
                     region contains a transmembrane segment at the C-terminus;
                     substrate of the ubiquitin-proteasome pathway;
                     ER-associated protein degradation is also known as ERAD;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IDA] [PMID
                     8396728]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0016881 -
                     acid-amino acid ligase activity [Evidence IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004842 - ubiquitin-protein
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0004842 - ubiquitin-protein transferase activity
                     [Evidence IMP] [PMID 18191224]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence IDA,IMP]
                     [PMID 8396728]; GO_process: GO:0030433 - ER-associated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 18191224]; GO_process: GO:0030433 -
                     ER-associated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 8393731]; GO_process:
                     GO:0030433 - ER-associated ubiquitin-dependent protein
                     catabolic process [Evidence IGI] [PMID 8396728];
                     GO_process: GO:0030433 - ER-associated ubiquitin-dependent
                     protein catabolic process [Evidence IGI,IMP] [PMID
                     8641272]; GO_process: GO:0030433 - ER-associated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IGI,IMP] [PMID 8781238]; GO_process: GO:0006513 - protein
                     monoubiquitination [Evidence IDA,IMP] [PMID 8396728];
                     GO_process: GO:0000209 - protein polyubiquitination
                     [Evidence IMP] [PMID 19345192]; GO_process: GO:0016567 -
                     protein ubiquitination [Evidence IEA]"
                     /codon_start=1
                     /product="E2 ubiquitin-conjugating protein UBC6"
                     /protein_id="XP_018733710.1"
                     /db_xref="GeneID:30036123"
                     /translation="MMTPSGRFKTSTRLCLSISDYHPKTWNPAWSVSTILTGLLSFMV
                     SDESTAGSMISTDEQKRKLARESLAWNVKYNVNFNIHFPEVAKKNSADLVAQQAQEAL
                     AASANSTASQKPNGVTQSGTATLVQAGAGQETEKTATTNTSGFSLGQKALCVVVVVAS
                     YVLASHLIQVYR"
     gene            complement(<1081739..>1081837)
                     /locus_tag="AWJ20_4036"
                     /db_xref="GeneID:30036124"
     tRNA            complement(<1081739..>1081837)
                     /locus_tag="AWJ20_4036"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30036124"
     gene            complement(<1082163..>1083047)
                     /locus_tag="AWJ20_4037"
                     /db_xref="GeneID:30036125"
     mRNA            complement(<1082163..>1083047)
                     /locus_tag="AWJ20_4037"
                     /product="U4/U6.U5 small nuclear ribonucleoprotein"
                     /transcript_id="XM_018881086.1"
                     /db_xref="GeneID:30036125"
     CDS             complement(1082163..1083047)
                     /locus_tag="AWJ20_4037"
                     /codon_start=1
                     /product="U4/U6.U5 small nuclear ribonucleoprotein"
                     /protein_id="XP_018733711.1"
                     /db_xref="GeneID:30036125"
                     /translation="MSRQSRASAADFMDYDADSYSADKKDELDSISESRPSDSSKDGD
                     ENTNDPRSRSREYGRDSDRYGDRSGSRETVRRATRYERDDRDSKRRSERSYSPYRGDS
                     RRYDRRDDRITDRGDRGDRSGRYERDETPRGRGRYEDSRYDDRYYDPKREIEEDRGDR
                     RERGRDFGRNRDSYRRYNSARSRSRSRSGEFDSKTKTSNGLSKSRYDSYRDNKAGNDT
                     DKKQQIDNTPATEAAPEDPEELMRKMMGFSGFSTTKGQKVVGADVSGIAKTAKSSTFR
                     QYMNRTRGFNRDLSPTRE"
     gene            <1083338..>1084726
                     /locus_tag="AWJ20_4038"
                     /db_xref="GeneID:30036126"
     mRNA            <1083338..>1084726
                     /locus_tag="AWJ20_4038"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881087.1"
                     /db_xref="GeneID:30036126"
     CDS             1083338..1084726
                     /locus_tag="AWJ20_4038"
                     /inference="similar to AA sequence:KEGG_Orthology:K15053"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733712.1"
                     /db_xref="GeneID:30036126"
                     /translation="MSLIDTVLANKLFTDRRRVSLYSNFRKLKDSNIDGYEANIAAWK
                     ILLTDALDQGNFEDATAIPGGPGLLEALYDPDNGRPLALDVVIDELVADKVLIPLPIY
                     MAEKSSIYSQGAWLTKMLNPKVVTSWVLSYTKVWDSSWKSIGPKAELGTLKKEKYISI
                     QALETIGNAIWANLENEHGITASYTNGVFTKEMLTSLLSEVSVTKKIHNTVQTSRVLL
                     SPTDIEVVLKYLVRDKNKLISDGQIYKVNSRNASPLITQKDIAIANLRSTILQVTDRV
                     NGLSDQIADCDLKARNALERKNKPVAVYALKSKKLAESSQVKALDMLSNLELLVGKID
                     DATDQAEIVSALSSGAEILTTLNSTIGGAEKVGDLMDQLRDQADETDEIGREISSMVG
                     RSVDEDEVESELDLMLAEERQKQLDKLPVPPTNSTHATPAKDSQEDPAIASLSDELSA
                     TSLEPRKKVLAE"
     gene            complement(<1084955..>1086989)
                     /gene="UBX7"
                     /locus_tag="AWJ20_4039"
                     /db_xref="GeneID:30036127"
     mRNA            complement(join(<1084955..1086664,1086873..>1086989))
                     /gene="UBX7"
                     /locus_tag="AWJ20_4039"
                     /product="Ubx7p"
                     /transcript_id="XM_018881088.1"
                     /db_xref="GeneID:30036127"
     CDS             complement(join(1084955..1086664,1086873..1086989))
                     /gene="UBX7"
                     /locus_tag="AWJ20_4039"
                     /note="UBX (ubiquitin regulatory X) domain-containing
                     protein; interacts with Cdc48p; UBX7 has a paralog, UBX6,
                     that arose from the whole genome duplication;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA,IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005635 -
                     nuclear envelope [Evidence IDA] [PMID 14755638];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IMP] [PMID
                     14755638]; GO_process: GO:0006511 - ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 14755638]"
                     /codon_start=1
                     /product="Ubx7p"
                     /protein_id="XP_018733713.1"
                     /db_xref="GeneID:30036127"
                     /translation="MSNSSSSLFRVSFRRFAMGGQAREPASGEFYPKRAREPGAESYI
                     QTKFVPLEVVAGSQQYVFFSQVFPVAKIPSIFIINQSVVVDRFDSEVDAQEFLDRLAQ
                     ADQGLVRGVRDVSGNTSGAGNDTGSTANVQNQSSLDSSNGSSLDQNAIAAAAAAAVAA
                     LTGRSGSASGLPAGSSASVPSVSSVTPSAGSDSSNSTGAGNSTADDSAVTRGSDAATD
                     RSASTSHNNTISTSGSGSTTTSTNSASNSGANDVSSSSPEPTNPPVPRKEKSSTPTNS
                     VAASASTNTSNTHSSSTSSSSGLSDTQRYQIQLRKQRQADAEERKRILRLLETDREER
                     RAQRLHHQQEQQDVPLAAESTTIPQKKKQTRSLSLSQSNQCALVIRLFDGQALKNIFN
                     NSDTLDIVRKWVDENRTDSEDPYQFYQTFPKRSFGPGEENSTLLELDLCPSSTLILKP
                     AENVLNAYSSSYSPSAWLQGGTRTISDAIYTFLGIGYKPPPPAPSEPSDEPSRSASPV
                     PNPRRSGYSTPLPTPRPSDNTNPSSPSPPKSENPAPATLLSANSFSQPRDDVHPSKPN
                     SISSSRSSSAVNVRTLHDNDDAKDDRLTYNGNQLNLEDDNNS"
     gene            complement(<1087593..>1089275)
                     /gene="PDC1"
                     /locus_tag="AWJ20_4040"
                     /db_xref="GeneID:30036129"
     mRNA            complement(<1087593..>1089275)
                     /gene="PDC1"
                     /locus_tag="AWJ20_4040"
                     /product="indolepyruvate decarboxylase 1"
                     /transcript_id="XM_018881090.1"
                     /db_xref="GeneID:30036129"
     CDS             complement(1087593..1089275)
                     /gene="PDC1"
                     /locus_tag="AWJ20_4040"
                     /inference="similar to AA sequence:KEGG_Orthology:K01568"
                     /note="Major of three pyruvate decarboxylase isozymes; key
                     enzyme in alcoholic fermentation; decarboxylates pyruvate
                     to acetaldehyde; involved in amino acid catabolism;
                     subject to glucose-, ethanol-, and autoregulation;
                     activated by phosphorylation in response to glucose
                     levels; N-terminally propionylated in vivo; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     2665820]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 16850348]; GO_function: GO:0047433 -
                     branched-chain-2-oxoacid decarboxylase activity [Evidence
                     IMP] [PMID 9546164]; GO_function: GO:0016831 -
                     carboxy-lyase activity [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA,IEA];
                     GO_function: GO:0016829 - lyase activity [Evidence IEA];
                     GO_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0004737 - pyruvate
                     decarboxylase activity [Evidence IEA]; GO_function:
                     GO:0004737 - pyruvate decarboxylase activity [Evidence
                     IDA] [PMID 23423327]; GO_function: GO:0004737 - pyruvate
                     decarboxylase activity [Evidence IDA] [PMID 2404950];
                     GO_function: GO:0030976 - thiamine pyrophosphate binding
                     [Evidence IEA]; GO_process: GO:0006559 - L-phenylalanine
                     catabolic process [Evidence IEA]; GO_process: GO:0006559 -
                     L-phenylalanine catabolic process [Evidence IGI] [PMID
                     12499363]; GO_process: GO:0000955 - amino acid catabolic
                     process via Ehrlich pathway [Evidence IEA]; GO_process:
                     GO:0000949 - aromatic amino acid family catabolic process
                     to alcohol via Ehrlich pathway [Evidence IGI] [PMID
                     12499363]; GO_process: GO:0009083 - branched-chain amino
                     acid catabolic process [Evidence IEA]; GO_process:
                     GO:0019655 - glucose catabolic process to ethanol
                     [Evidence IDA] [PMID 2404950]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0006090 -
                     pyruvate metabolic process [Evidence IDA] [PMID 2404950];
                     GO_process: GO:0006569 - tryptophan catabolic process
                     [Evidence IEA]; GO_process: GO:0006569 - tryptophan
                     catabolic process [Evidence IGI] [PMID 12499363]"
                     /codon_start=1
                     /product="indolepyruvate decarboxylase 1"
                     /protein_id="XP_018733714.1"
                     /db_xref="GeneID:30036129"
                     /translation="MAQLHCQLTQLTQLTILTKRQVFGVPGDFNLALLDHIYEVEGIR
                     WAGNTNELNAGYAADGYSRIKRLAALVTTFGVGELSALAAVAGSYAEHVGLLHVVGVP
                     SMSAQNKHLLLHHTLGNGDFTVFKSMSGRITEHASVITDITTAAEQIDKAIRTAYIYQ
                     RPVYLAIPANLSDVKLDADLLRQPINLELEPNPPEAEAEVIEVVAEMVLKADHPILLI
                     DACASRHNVMKEVAEIARVTQFPVFTTPMGKGSFDEHDPRFGGVYVGSLTLPEVAKVV
                     EHADLILSFGALLSDFNTGSFSYHYDTKNIVEFHSDSTKIRSATYPEVKMQLILDKVA
                     KRLSALPQKKLCEVPPYPPLIKATPESPLKQEWLWTRLTSWLRKGDIIVSETGTSNFG
                     IIQTKFPQGAVGISQVLWGSIGYSVGALVGATMAASEVDPSRRVILFVGDGSLQLTVT
                     EISTLVRWGLKPYIFILNNDGYTIERLIRGEKATYNDVHMWKYSKLLDLFNAKDHDAL
                     QVSTTGELDDLFNDAKFASPTKIRTIELFLPQMDAPTNLIKQAKITAATNSE"
     gene            complement(<1092052..>1093860)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4041"
                     /db_xref="GeneID:30036130"
     mRNA            complement(<1092052..>1093860)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4041"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881091.1"
                     /db_xref="GeneID:30036130"
     CDS             complement(1092052..1093860)
                     /gene="MSS4"
                     /locus_tag="AWJ20_4041"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733715.1"
                     /db_xref="GeneID:30036130"
                     /translation="MGASFFTNGDYCSSNGGVLSDVNRGIVVPKYGACAQQENRRAAR
                     RSAFAYHKVLILECSDDDSGVSVGSDETLNEPTVWKPIDIVSEQPYCEESSHTYSAPV
                     DNDDVNCSEWSFEAGDEAAFTTRQIESARSEEDTEATWSAPAAYWALSDCPIEVDESD
                     SPIESHGDATLVELPLETTSSDLAESEEITPAKVAETPCAIADIPTSNSSIDSLIAEI
                     ISVATLYKDLPQLIVSGGHKADSEFELLKTAPLALSKPITHTPSDNLVIQVEEVDKSK
                     TPLLLTRAKAKLTSFTGRTAPITKSTLMFNGIQTAVYATPLSSHENLTMENKKYRLDG
                     GAIIKAYSPIVYQNIRTLCGIDCHEFLNSFVLQSDLTKTKSPGKSGSDFLFTPDGKYI
                     IKTIKRKEHNVIANAEFLADYYNHVKAHPSTQLPFYLGNYTLVAGGKKTHFVIMKNLL
                     QKETQLIYDLKGSTHDRRAGPRKDNRGRVVFKDLDWTDKHEAISMSQEDRDKLMVQVS
                     KDVDFLKRHNIMDYSLLVGLQSDTRTCQQQPVIGMIDTLCPFSWRKRAETISKSLIFG
                     SSAIDVVHPSKYGARFLNFVQSAVVPRPGRSVSIRC"
     gene            complement(<1096481..>1096882)
                     /gene="PMU1"
                     /locus_tag="AWJ20_4042"
                     /db_xref="GeneID:30036131"
     mRNA            complement(<1096481..>1096882)
                     /gene="PMU1"
                     /locus_tag="AWJ20_4042"
                     /product="Pmu1p"
                     /transcript_id="XM_018881092.1"
                     /db_xref="GeneID:30036131"
     CDS             complement(1096481..1096882)
                     /gene="PMU1"
                     /locus_tag="AWJ20_4042"
                     /note="Putative phosphomutase; contains a region
                     homologous to the active site of phosphomutases;
                     overexpression suppresses the histidine auxotrophy of an
                     ade3 ade16 ade17 triple mutant and the temperature
                     sensitivity of a tps2 mutant; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0016853 - isomerase activity [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Pmu1p"
                     /protein_id="XP_018733716.1"
                     /db_xref="GeneID:30036131"
                     /translation="MIYTWDGILLDPPPLVVDDLRETIGLEPCNKRRSRTHISTRFGH
                     VVNIEDSFPEEDTTWRPDHRETPLEHSIRTKRFLTRLFDSDWHSPTPDDYVSVTSHMG
                     TINSFLLVINHRPFTVLPGGMIPVIIRADRV"
     gene            <1098756..>1100837
                     /gene="CDC5"
                     /locus_tag="AWJ20_4043"
                     /db_xref="GeneID:30036132"
     mRNA            <1098756..>1100837
                     /gene="CDC5"
                     /locus_tag="AWJ20_4043"
                     /product="polo kinase CDC5"
                     /transcript_id="XM_018881093.1"
                     /db_xref="GeneID:30036132"
     CDS             1098756..1100837
                     /gene="CDC5"
                     /locus_tag="AWJ20_4043"
                     /inference="similar to AA sequence:KEGG_Orthology:K06660"
                     /note="Polo-like kinase; controls targeting and activation
                     of Rho1p at cell division site via Rholp guanine
                     nucleotide exchange factors; regulates Spc72p; also
                     functions in adaptation to DNA damage during meiosis; has
                     similarity to Xenopus Plx1 and S. pombe Plo1p; possible
                     Cdc28p substrate; GO_component: GO:0005935 - cellular bud
                     neck [Evidence IDA] [PMID 10594031]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9819423];
                     GO_component: GO:0000922 - spindle pole [Evidence IDA]
                     [PMID 10594031]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0008047 - enzyme
                     activator activity [Evidence IDA] [PMID 16763112];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004672 - protein kinase activity
                     [Evidence IEA]; GO_function: GO:0004672 - protein kinase
                     activity [Evidence IDA] [PMID 12637549]; GO_function:
                     GO:0004672 - protein kinase activity [Evidence IDA] [PMID
                     16319894]; GO_function: GO:0004672 - protein kinase
                     activity [Evidence IDA,IMP] [PMID 17122856]; GO_function:
                     GO:0004672 - protein kinase activity [Evidence IDA,IMP]
                     [PMID 8321244]; GO_function: GO:0004674 - protein
                     serine/threonine kinase activity [Evidence IEA,IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016772 - transferase activity,
                     transferring phosphorus-containing groups [Evidence IEA];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0007067 - mitotic nuclear division
                     [Evidence IEA]; GO_process: GO:0016310 - phosphorylation
                     [Evidence IEA]; GO_process: GO:0010696 - positive
                     regulation of spindle pole body separation [Evidence
                     IGI,IMP] [PMID 18500339]; GO_process: GO:0008104 - protein
                     localization [Evidence IMP] [PMID 16763112]; GO_process:
                     GO:0006468 - protein phosphorylation [Evidence IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IDA] [PMID 16319894]; GO_process: GO:0006468 - protein
                     phosphorylation [Evidence IDA,IMP] [PMID 17122856];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IDA,IMP] [PMID 8321244]; GO_process: GO:0000712 -
                     resolution of meiotic recombination intermediates
                     [Evidence IMP] [PMID 12717442]; GO_process: GO:0090306 -
                     spindle assembly involved in meiosis [Evidence IMP] [PMID
                     20237423]; GO_process: GO:0070194 - synaptonemal complex
                     disassembly [Evidence IGI] [PMID 18832066]"
                     /codon_start=1
                     /product="polo kinase CDC5"
                     /protein_id="XP_018733717.1"
                     /db_xref="GeneID:30036132"
                     /translation="MIYAAKTVAKASLKSSKTKEKLLAEIKIHKSMHHPNIVQFVDCF
                     EDDDNVYILLEICENQSLMEMLRARSRLTEEETKYYIVQILGAVRYMHKRRVLHRDLK
                     LGNIFIGDNMDVKIGDFGLATVLASDSDRRRTICGTPNYIAPEVLFGKKVGHSYEADI
                     WSVGIILYTMLFGKPPFQTKEIEDIYDRIANLSYSFPEKVKVSEDAKDLIRKLLVTDP
                     VERLSIEKVLEHPFFEYQFPAMVPSFALTKKPIYAAMTEHDARKNFINCQVQAKIRLA
                     ESTEVASTDVKPIKIDERAATSAQNSQTENGPAAVLPTSLSPASTKDKYKMVIVPRKS
                     GLDLKQQQQQKLKLTGEYAGKAVEGNKQTAEQNQDRAYDRHSASPRPRWTRAVTALAT
                     GNRNQTDKQVAVEQRVTRSATAPPKTGQTNTASRTAVAAAAAAAAAPAASAVSGRTTH
                     DGKSMLYRTLKTLTIAINSYESKETLAPAQSSPRVPAVFISKWVDFSDKYGLAYQTSE
                     SNDGVLFRNGTVLLMNPENETYLMLDKDDTTEKPLVCKWTGKAIYPSTENASEHKVIR
                     LINTFHRYMQDHLQKSNYGIQRASDDLSVNPVFVTYYERQPEYVMLCLNNGTFQFNFP
                     DHMKLIVSSGASQIDLIDNDQRLHTWSIQEALAFTHRAQHKKLVSDPAYTLIHKLAMC
                     RTAVKKEYNSL"
     gene            <1104184..>1104855
                     /gene="SIN3"
                     /locus_tag="AWJ20_4044"
                     /db_xref="GeneID:30036133"
     mRNA            <1104184..>1104855
                     /gene="SIN3"
                     /locus_tag="AWJ20_4044"
                     /product="transcriptional regulator SIN3"
                     /transcript_id="XM_018881094.1"
                     /db_xref="GeneID:30036133"
     CDS             1104184..1104855
                     /gene="SIN3"
                     /locus_tag="AWJ20_4044"
                     /codon_start=1
                     /product="transcriptional regulator SIN3"
                     /protein_id="XP_018733718.1"
                     /db_xref="GeneID:30036133"
                     /translation="MPGHPSPPPPPPPPPPSQSHNMLSIQSLSGAGGPPPPASQSNRS
                     PPVGPTAALAQQQQQQPSSGPGTSSVGPLPPQQSPQLQTVPPPPSQASGLSSLAQLGG
                     AAAGTAAQGPPGGHGPPPPSQTASQTGPAPGGLGQPQIPPTSPNQQHQQQQQSAGLPP
                     SAAQVLQPSPIQSAQQIAEAAAYRPLNVKDALSYLDQVKVQFQNQPDVYNHFLDIMKD
                     FKSHR"
     gene            <1105161..>1109414
                     /gene="SIN3"
                     /locus_tag="AWJ20_4045"
                     /db_xref="GeneID:30036134"
     mRNA            <1105161..>1109414
                     /gene="SIN3"
                     /locus_tag="AWJ20_4045"
                     /product="transcriptional regulator SIN3"
                     /transcript_id="XM_018881095.1"
                     /db_xref="GeneID:30036134"
     CDS             1105161..1109414
                     /gene="SIN3"
                     /locus_tag="AWJ20_4045"
                     /inference="similar to AA sequence:KEGG_Orthology:K11644"
                     /codon_start=1
                     /product="transcriptional regulator SIN3"
                     /protein_id="XP_018733719.1"
                     /db_xref="GeneID:30036134"
                     /translation="MDPNPIRVTTPMGTTSRPDGEPTIPYPGDGRWGGPPQGPGQGLP
                     PVAGQPQLQGPGQVQVLEQQQVQPPGVPGQQPQGPHPQYQRVPSVTELGPGGAGGLPP
                     QLQQPQQPPQQPGQQQPQYPGYLAEQQQQQQQQQQQQQQQQQQQQQQQQQQQHPMGPP
                     DPQTQPFNSNGAMSELHAAANGGRPPMMTEQQRRQGGGPVEFNHAINYVNKIKNRFAS
                     QPEIYKNFLEILQTYQREQLRIAEVYTQVTLLFKEAPDLLEDFKQFLPDTSQPQGQMG
                     PGAGGQEAMRLPPVGNFAPPGSIGAGGPAAAIGRDAGIGPGGKKKKGGATNAEQAYQQ
                     QQQQQQQQLQMQQQQQAISQQYGGYNIDSNNGVPVSSLRSGGPTIAGTGRGGKGKGAG
                     GNMMIREPSPTLVPAIPEPLPPPSRSGGLHDEIAFFDKVKKFIGNKQTYNEFLKIINL
                     FTQKIIDKNVLVERVDGFIGNNKELMDWFKRFVKYEGKPLHIENIVHKKHNLDLSLCR
                     SYGPSYRLLPKSETLMPCSGRDEMCWEVLNDEWVVHPTWASEDSGFVSHRKNQYEEIL
                     YRVEEERHEYDYYIGSNLRTIQTLETIANRIANLTNEEKAIFKLQPKLGTDSTIYQKI
                     IRKIYDKEKGLEVIEALHENPAVAVPIVLRRLKQKDEEWKRAHREWNKVWRETEQKIF
                     YKSLDHIGLTFKQTDKKLLTTRSLVSEITTVKAEQNSKRKNPALPLPKSQLVFKMADN
                     DVLLDILRLVLSFLEHGGSYSSNDRERMEAFFRSFLELFFSLPPNLISERFPENEGRK
                     SSSPEAEDESKTDGGAAATAAGAVSNGSTGAGGSKKRAREPSGDLLRDVLKKSRFNGR
                     ADLSPSAEVELDTETDSPAETPVPSAEDTTGAENTNIPRFGDSEDAWLKHAQTSPSPE
                     LGAKNDNQKREVFNLFANTTIYVFVRILQILYDRLEEVKGYESLVSEEIANSFNVDFA
                     NDLGLYDTKLADMGLRFDSKDCYGQLLSLSERLIEGEVEHQWFEEAIRQAYRNRAYKF
                     YTIDKIVQALVKHVHAIVGDQKSSDVLVLFQADRVEPLSDIKKQIAYRMQVKKIIGSD
                     ESLFRIDWNDEEKRIGFQFLGNYDLTMRDIKKAEDKWNYYLTSYMMSVPTEGVALDRI
                     KAPLLYRSMIELVDENYPFVIIEQGLMARVCMNTYKLFFEAGTVDFFTRPGVDNSVLR
                     TPAVLEGRKNRWSSIIDGPDGWKSGLSETDIKNTEDRFKIWEEQGPEAFEKWEAPVVA
                     VEPEATANGTSDEQTNQTEAAVVPTGETTVDEAKPLEAPADAMEVETTSNGVKAADDT
                     TSEPAAGEPSSEKSEVVAPESKLTTDDEPKPKLDASSEVKSENDSKPEPSAGEQEASA
                     AAATETSSPSSAPTSTTNPAGDADQQPPKAADGDVEMSG"
     gene            complement(<1112750..>1113700)
                     /gene="PFA4"
                     /locus_tag="AWJ20_4046"
                     /db_xref="GeneID:30036135"
     mRNA            complement(<1112750..>1113700)
                     /gene="PFA4"
                     /locus_tag="AWJ20_4046"
                     /product="Pfa4p"
                     /transcript_id="XM_018881096.1"
                     /db_xref="GeneID:30036135"
     CDS             complement(1112750..1113700)
                     /gene="PFA4"
                     /locus_tag="AWJ20_4046"
                     /inference="similar to AA sequence:KEGG_Orthology:K18932"
                     /note="Palmitoyltransferase with autoacylation activity;
                     required for palmitoylation of amino acid permeases
                     containing a C-terminal Phe-Trp-Cys site; required for
                     modification of Chs3p; member of the DHHC family of
                     putative palmitoyltransferases; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     16647879]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016409 - palmitoyltransferase activity
                     [Evidence IMP] [PMID 16818716]; GO_function: GO:0019706 -
                     protein-cysteine S-palmitoyltransferase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016746 - transferase
                     activity, transferring acyl groups [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_process: GO:0018345 - protein palmitoylation [Evidence
                     IMP] [PMID 16751107]; GO_process: GO:0018345 - protein
                     palmitoylation [Evidence IMP] [PMID 16818716]"
                     /codon_start=1
                     /product="Pfa4p"
                     /protein_id="XP_018733720.1"
                     /db_xref="GeneID:30036135"
                     /translation="MTSPGSPTSDFKPLPGEWTRWCIKCNGYKPERTHHCRQCKKCVL
                     KMDHHCPWTYNCVGHANMPHFVRFLAWVLISASYAFYHVWARGFFLYSKRHLPLSTYD
                     VTKTEIAFTIVLIPVVSFVLFSVGLLSIRVAWNMVEGQTQIETWEVERIETLVRRKLV
                     QNVEFPYDLDPWTNVANAMGGNNPLAWMWPFGGPVGDGMHFEKNEAADDGSVWPPDHR
                     DQGPPRSGSAGASSSPSGDIGIRTAAPRGHYPRTLGYMRHRGNGEYAEDDGDDGYDSD
                     SEDEEVERLPEENDFYKRDQWMNFEGESIADFGVDVDTES"
     gene            <1114610..>1116007
                     /gene="ARG4"
                     /locus_tag="AWJ20_4047"
                     /db_xref="GeneID:30036136"
     mRNA            <1114610..>1116007
                     /gene="ARG4"
                     /locus_tag="AWJ20_4047"
                     /product="argininosuccinate lyase ARG4"
                     /transcript_id="XM_018881097.1"
                     /db_xref="GeneID:30036136"
     CDS             1114610..1116007
                     /gene="ARG4"
                     /locus_tag="AWJ20_4047"
                     /inference="similar to AA sequence:KEGG_Orthology:K01755"
                     /note="Argininosuccinate lyase; catalyzes the final step
                     in the arginine biosynthesis pathway; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 205532];
                     GO_function: GO:0004056 - argininosuccinate lyase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004056 -
                     argininosuccinate lyase activity [Evidence IDA] [PMID
                     4578972]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0016829 - lyase activity
                     [Evidence IEA]; GO_process: GO:0006526 - arginine
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0042450 - arginine biosynthetic process via ornithine
                     [Evidence IEA]; GO_process: GO:0042450 - arginine
                     biosynthetic process via ornithine [Evidence IDA] [PMID
                     4578972]; GO_process: GO:0008652 - cellular amino acid
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="argininosuccinate lyase ARG4"
                     /protein_id="XP_018733721.1"
                     /db_xref="GeneID:30036136"
                     /translation="MSSEQPAELKLWGGRFTGGTDPLMELYNASLPYDKKMYVADLEG
                     TRVYTSALHKVGLLNDHELSEIHRGLKLVEAEWAEGKFVEKPGDEDIHTANERRLGEL
                     IGRDISGKVHTGRSRNDQVATDMRLYVREELAKIRAILVGLIKVFVSRAEKEMDILMP
                     GYTHLQRAQPIRWSHWLSSHATYLANDLERLDQVIKRVNRSPLGAGALAGHPYGVDRE
                     YIADNLGFESVIGNSLTAVADRDFVVETLFWGSLVLNHLSKFSEDLIIYSTAEFGFIK
                     LADAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAGFMMSLKATPSTYNKDLQEDKE
                     PLFDCLTTVSHSLSIATGVISTLSVDAAKMRAALTMDMLATDLADYLVRKGVPFRETH
                     HISGEAVATSEKLGLSGIDQLTLEQYKQIDARFDADVVNVFNFETSVERRTATGGTAK
                     SAVLAQLKNIASSLN"
     gene            <1117079..>1118902
                     /gene="MSS4"
                     /locus_tag="AWJ20_4048"
                     /db_xref="GeneID:30036137"
     mRNA            <1117079..>1118902
                     /gene="MSS4"
                     /locus_tag="AWJ20_4048"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881098.1"
                     /db_xref="GeneID:30036137"
     CDS             1117079..1118902
                     /gene="MSS4"
                     /locus_tag="AWJ20_4048"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733722.1"
                     /db_xref="GeneID:30036137"
                     /translation="MGAFFFTNGDYCPSNGTHKVPRRPVLSDVHCGVSVPKYGACAQL
                     ESRRPARRSAFAYHKVLILECSPDDSGVSVGSDETLNEPTIWKPVDIVSEQAYCEESS
                     NISSAPIDNDDDNSSEWSFETGDEAAFTTRQIETAWSEEDTEATWYAPAASWALSGFP
                     IEIYENDSTPESHGEVTLVELPLETPRSDLAESEEITPAKVAETPCAIADIPTSNPSI
                     DSLVAEIIAVATLYKNLPQLIVSGGLQADSEFELPKTAPLALSKPIAQTPSDDLVIEE
                     VDKSKTPLLLTRAKAKLTSFTGHASPITKSTLMFNGIQTAVYATPLSSHENLTMENKK
                     YRLDGGAIIKAYSPIIYQSIRTLCGIDCHEFLNSFVLQSDLTKTKSPGKSGSDFLFTP
                     DGKYIIKTIKRKEHNVIANAEFLADYYNHVKAHPSSQLPFYLGNYTLVAGGKKTHFVI
                     MKNLLQKETQLIYDLKGSTHDRRAGARKDNRGRVVFKDLDWTDKDEAISMSQEDRDKL
                     MVQVSKDVDFLKRHNIMDYSLLVGLQSDTRTCQQQPVIGMIDTLCPFSWRKKAETISK
                     SLIFGSSAIDVVHPSKYGARFLNFVQSAVVPGPGRSVSTRC"
     gene            <1120783..>1121862
                     /locus_tag="AWJ20_4049"
                     /db_xref="GeneID:30036138"
     mRNA            <1120783..>1121862
                     /locus_tag="AWJ20_4049"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881099.1"
                     /db_xref="GeneID:30036138"
     CDS             1120783..1121862
                     /locus_tag="AWJ20_4049"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733723.1"
                     /db_xref="GeneID:30036138"
                     /translation="MVDTTKVQVLLVGSGGVGTIASLALEQSHQVEVTSVIRSDYDIV
                     VEKGFTIESIDYGNLTGWRPTRVVKTVQEAVNVANGRPYDYIVVCTKVLPEIFKTEDL
                     IRPAVQDAKTIIVLIQNGIDIEKSVSEAFPANVVLSGVSMIGSTNYGGKIVQFEHDKL
                     GVGYYSSETTDSKHSKDQLEAEAKKFVDLYSVACKNCTYYPDLKRARWRKLVYNSTIN
                     TICALTQVDTGRAYLSQLDHALIYPAMAEIITIAETALGEPLDKGIDKIMLESDDGFY
                     YKPSMQVDVDKGNPIEVEAILGNPLRTAKELNIKTPVLTVVYNLLRALQFRLMESRGY
                     ITVPENPSRKVSAPLLEPTTLPIEP"
     gene            <1124805..>1126031
                     /gene="IME2"
                     /locus_tag="AWJ20_4050"
                     /db_xref="GeneID:30036140"
     mRNA            <1124805..>1126031
                     /gene="IME2"
                     /locus_tag="AWJ20_4050"
                     /product="protein kinase IME2"
                     /transcript_id="XM_018881101.1"
                     /db_xref="GeneID:30036140"
     CDS             1124805..1126031
                     /gene="IME2"
                     /locus_tag="AWJ20_4050"
                     /inference="similar to AA sequence:KEGG_Orthology:K12765"
                     /codon_start=1
                     /product="protein kinase IME2"
                     /protein_id="XP_018733724.1"
                     /db_xref="GeneID:30036140"
                     /translation="MDCMDGTLQDFILSQDGIPPDPSIYQNILKQVLKGLDHIHSHQF
                     IHRDIKPENILITGDISGPNLVVKVADFNLSKDLSDGPDDAFTSYIGTRWYRAPEVLI
                     KCERYSTAIDIWAFAAVAYEMATCCVLFEGRDQIHQLKLQVQLLGAPGPNSVCGEFQP
                     LTNFLEEMSNDAYNEIIEVCDYLNFEPEYLRLFSGDDFWQQLSDECRGDIGSTVFGRK
                     EKRADDENDPENQISSFNSFSGLNRFCTINHGGKLVPSYTGLSDFNKLLLPILRWDPS
                     TRPTAGQLLCHPILADEYDHTAGPLTAVPPLVLERTDTAESDDEDQDDDYNIQAPNMI
                     NRPPLSLAEPNNAPHPQPSNSKNKTSAPFNPRLAQIAAAPNENSEEPFDDNHPSHILS
                     PNHLYNYWASPYSFHY"
     gene            complement(<1126288..>1126947)
                     /gene="TEM1"
                     /locus_tag="AWJ20_4051"
                     /db_xref="GeneID:30036141"
     mRNA            complement(<1126288..>1126947)
                     /gene="TEM1"
                     /locus_tag="AWJ20_4051"
                     /product="Ras family GTPase TEM1"
                     /transcript_id="XM_018881102.1"
                     /db_xref="GeneID:30036141"
     CDS             complement(1126288..1126947)
                     /gene="TEM1"
                     /locus_tag="AWJ20_4051"
                     /inference="similar to AA sequence:KEGG_Orthology:K06682"
                     /note="GTP-binding protein of the Ras superfamily;
                     involved in termination of M-phase; controls actomyosin
                     and septin dynamics during cytokinesis; GO_component:
                     GO:0005816 - spindle pole body [Evidence IDA] [PMID
                     19154724]; GO_function: GO:0005525 - GTP binding [Evidence
                     IEA,IEA]; GO_function: GO:0003924 - GTPase activity
                     [Evidence IDA] [PMID 12048186]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0005515
                     - protein binding [Evidence IPI] [PMID 10688190];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0007067 - mitotic nuclear division
                     [Evidence IEA]; GO_process: GO:0007096 - regulation of
                     exit from mitosis [Evidence TAS] [PMID 16039591];
                     GO_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Ras family GTPase TEM1"
                     /protein_id="XP_018733725.1"
                     /db_xref="GeneID:30036141"
                     /translation="MSTSQPSHGSTGASGSEPIDLAVPQKNSVSLKVGMIGDAQIGKT
                     SLMVRYVEGSFDEDYIQTLGVNFMEKSVNIRNTEIKFSIWDLGGQREFVNMLPLVSND
                     AVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPFLVGTKFDAFAEMPDADQEEISR
                     QAKKFAKAMKASLVFCSTKEMINVQKIFKIVLSKAFQLKLNMNEYTETGEPLLIYQQW
                     S"
     gene            <1128006..>1128641
                     /locus_tag="AWJ20_4052"
                     /db_xref="GeneID:30036142"
     mRNA            <1128006..>1128641
                     /locus_tag="AWJ20_4052"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881103.1"
                     /db_xref="GeneID:30036142"
     CDS             1128006..1128641
                     /locus_tag="AWJ20_4052"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733726.1"
                     /db_xref="GeneID:30036142"
                     /translation="MIPLTETGETDADDSVTVMSKRLFHSLRPLGKNPYYFYDLAKKQ
                     PRQSFDPGHYSFGNLASTEERARQVFGDLGSRDASRMDALHKARTIAGVRVPEKPEEP
                     TNCCMSGCVNCVWEMYKDDLEDWRAKRKEAKHRLLTDPKYASTKWPSDFGPEPPSRSI
                     ETNISEEAGELPLDDDEAWDGVDVNIKVFVETEKRLHALRRQRAATSSASL"
     gene            <1131271..>1132494
                     /gene="ILV5"
                     /locus_tag="AWJ20_4053"
                     /db_xref="GeneID:30036143"
     mRNA            <1131271..>1132494
                     /gene="ILV5"
                     /locus_tag="AWJ20_4053"
                     /product="ketol-acid reductoisomerase"
                     /transcript_id="XM_018881104.1"
                     /db_xref="GeneID:30036143"
     CDS             1131271..1132494
                     /gene="ILV5"
                     /locus_tag="AWJ20_4053"
                     /inference="similar to AA sequence:KEGG_Orthology:K00053"
                     /note="Acetohydroxyacid reductoisomerase and mtDNA binding
                     protein; involved in branched-chain amino acid
                     biosynthesis and maintenance of wild-type mitochondrial
                     DNA; found in mitochondrial nucleoids; GO_component:
                     GO:0042645 - mitochondrial nucleoid [Evidence IDA] [PMID
                     10869431]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 18193418]; GO_function: GO:0050662 -
                     coenzyme binding [Evidence IEA]; GO_function: GO:0003690 -
                     double-stranded DNA binding [Evidence IDA] [PMID
                     18023287]; GO_function: GO:0004455 - ketol-acid
                     reductoisomerase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004455 - ketol-acid reductoisomerase activity
                     [Evidence IMP] [PMID 14124940]; GO_function: GO:0004455 -
                     ketol-acid reductoisomerase activity [Evidence IMP] [PMID
                     3027658]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016616 -
                     oxidoreductase activity, acting on the CH-OH group of
                     donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_process: GO:0009082 - branched-chain amino acid
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0009082 - branched-chain amino acid biosynthetic
                     process [Evidence IMP] [PMID 14124940]; GO_process:
                     GO:0008652 - cellular amino acid biosynthetic process
                     [Evidence IEA,IEA]; GO_process: GO:0009097 - isoleucine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0000002 - mitochondrial genome maintenance [Evidence
                     IGI] [PMID 18826960]; GO_process: GO:0000002 -
                     mitochondrial genome maintenance [Evidence IMP] [PMID
                     7621838]; GO_process: GO:0055114 - oxidation-reduction
                     process [Evidence IEA,IEA]; GO_process: GO:0009099 -
                     valine biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="ketol-acid reductoisomerase"
                     /protein_id="XP_018733727.1"
                     /db_xref="GeneID:30036143"
                     /translation="MSSKMLRTAARAARNARIATAPSEKRAFSALAKAAIARPTIAAT
                     TRVASGVASVEARRGLKQINFGGTEETVYERADWPREKLLDYFKNDTLALIGYGSQGH
                     GQGLNLRDNGLNVIVGVRKDGASWQQAIDDGWVPGTNLFDVNEAINKGTIVMNLLSDA
                     AQSETWPQIKPLLTEGKTLYFSHGFSPVFKDLTKVDTPKNIDVILVAPKGSGRTVRTL
                     FKEGRGINSSYAVWQDVTGKAEEKAQALAVAVGSGYVYKTTFEREVHSDLYGERGCLM
                     GGIHGMFLAQYEVLRERGHSPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARR
                     GALDWSPRFKDALKPVFNQLYDSVLDGSETKRSLEFNSQKDYREKFEKELQEIRDLEI
                     WRVGKEVRKLRPENN"
     gene            <1135285..>1137090
                     /gene="MSS4"
                     /locus_tag="AWJ20_4054"
                     /db_xref="GeneID:30036144"
     mRNA            <1135285..>1137090
                     /gene="MSS4"
                     /locus_tag="AWJ20_4054"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881105.1"
                     /db_xref="GeneID:30036144"
     CDS             1135285..1137090
                     /gene="MSS4"
                     /locus_tag="AWJ20_4054"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018733728.1"
                     /db_xref="GeneID:30036144"
                     /translation="MGTFFLTNGDYRPSNGTHKVPRRPVLSDVHCGISVPKYGACAQQ
                     ENRRPARRSAFAYHKVLILECSDDSGVSVGSDETLNEPTVWKPIDIVAEQTYCEFAPI
                     YNDDDNSSEWSFETGDEAAFTTRQIETAWSEEDTEATWSAPAASWALSGCPIETDENE
                     YTPESHGEVTLVESPSETSRSDLAESEEITPAKMAETPCAIADITTSSSSIDSLIAEI
                     ISVATLYKDLPQLIVSGGLQADSEFELLKTAPLALSKPITHTPSDDLVIQVEEVDKSK
                     TPLLLTRAKAKLTSFSGRTAPITKSTLMFNGVQTAVYATPLSSHETLTMENKKYRLDG
                     GAIIKAYSPIVYQSIRSLCGIDCHEFLNSFVLQSDLTKTKSPGKSGSDFLFTPDGKYI
                     IKTIKRKEHNVIANSEFLADYYNHMKAHPSTQLPFYLGNYTLVAGGKKTHFIIMKNLL
                     QKETQLIYDLKGSTHDRRAGPRKDNRGRVVFKDLDWTDKHEAISMSREDRDKLLVQVS
                     EDVEFLKRHNIMDYSLLVGLQSGTRTCQQPVIGMIDTLCPFSWRKKAETISKSLIFGS
                     SAIDVVHPSKYGARFLNFVQSAVVPGPDRSVSIRC"
     gene            complement(<1138124..>1140604)
                     /gene="ERB1"
                     /locus_tag="AWJ20_4055"
                     /db_xref="GeneID:30036145"
     mRNA            complement(<1138124..>1140604)
                     /gene="ERB1"
                     /locus_tag="AWJ20_4055"
                     /product="Erb1p"
                     /transcript_id="XM_018881106.1"
                     /db_xref="GeneID:30036145"
     CDS             complement(1138124..1140604)
                     /gene="ERB1"
                     /locus_tag="AWJ20_4055"
                     /inference="similar to AA sequence:KEGG_Orthology:K14824"
                     /note="Constituent of 66S pre-ribosomal particles; forms a
                     complex with Nop7p and Ytm1p that is required for
                     maturation of the large ribosomal subunit; required for
                     maturation of the 25S and 5.8S ribosomal RNAs; homologous
                     to mammalian Bop1; GO_component: GO:0070545 - PeBoW
                     complex [Evidence IDA,IPI] [PMID 16287855]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA,IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005654 - nucleoplasm [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IEA]; GO_component: GO:0030687
                     - preribosome, large subunit precursor [Evidence IDA]
                     [PMID 11583614]; GO_component: GO:0030687 - preribosome,
                     large subunit precursor [Evidence IDA] [PMID 17443350];
                     GO_component: GO:0030687 - preribosome, large subunit
                     precursor [Evidence IDA] [PMID 23212245]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND];
                     GO_function: GO:0043021 - ribonucleoprotein complex
                     binding [Evidence IEA]; GO_process: GO:0000466 -
                     maturation of 5.8S rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IEA];
                     GO_process: GO:0000463 - maturation of LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IEA]; GO_process: GO:0006364 - rRNA
                     processing [Evidence IEA,IEA]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IMP] [PMID 11522832];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IEA]; GO_process: GO:0042273 -
                     ribosomal large subunit biogenesis [Evidence IPI] [PMID
                     16287855]; GO_process: GO:0042254 - ribosome biogenesis
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Erb1p"
                     /protein_id="XP_018733729.1"
                     /db_xref="GeneID:30036145"
                     /translation="MAKRKASELKQAESRVDSAKTKDEEEDVLALSGGLVAESDDDSD
                     AEDRELEKLLGEEADEEDENEDDEEEEENEDEDDEEEDDEDEEEDEEDVDPRILKDLE
                     NIKFRSLSDDSEDESNVRYEPGSDGKLRPIRPEIDPVYDSDDTDGEETNTIGNIPISA
                     YDKLPHIGYDIDGKRVMRPASASALDTLLESIDLPEGWTGLLDKNTGGGLKLSAEELD
                     LIKKIQRGENPDDSVNPYEDTIEYFSSQTEVMPLTAIPEPKRRFIPSKHEAKRVMKIV
                     RAIREGRIVLKSAEEKAKELEEATHYDIWADNADEIPDHIMTLRAPKLPPPTHDESYN
                     PPEEYLPDEEEIEQWKNMDPADRERNYVPKKYGSLRRVPGYSEGVRERFERSLDLYLA
                     PRVRRQKLNIDPDSLIPDLPSPKDLRPFPIKCATIFRGHVGKVRSVSFDPSGQFVATG
                     GDDGTVRVWELLTGRELWRLDVLKHDNYDNQDESDDEDDEDQMKERASGEDHVEAVEW
                     NPQTGTGLLAISAGENIYLVVPPVFDVEIENRGREIIEAGWGYASNGASGPSQVKSKD
                     LREDGDDDEDEVEAAAAEAKKKIFAKWTKPVAKLSDNGVGVVVRCKRTVKKLSWHRRG
                     DYFVTVSPEGANSAVLIHQLSKHSSQSPFRKSKGIVQDAMFHPFRPHLYVGTQRYVRI
                     YDLAAQVLTKKLLPGVRWLSSFDIHPRGDNVITSSYDKRMTWHDLDLSSKPYKTLRYH
                     EKAVRDVSFHKGGLPLFCSASDDGNINVFHGSVYDDMMKNPLLVPLKVLKGHEIKNSL
                     GILNVVWHPKEAWLLSAGADGTARLWTA"
     gene            <1141005..>1141865
                     /gene="HSH49"
                     /locus_tag="AWJ20_4056"
                     /db_xref="GeneID:30036146"
     mRNA            <1141005..>1141865
                     /gene="HSH49"
                     /locus_tag="AWJ20_4056"
                     /product="Hsh49p"
                     /transcript_id="XM_018881107.1"
                     /db_xref="GeneID:30036146"
     CDS             1141005..1141865
                     /gene="HSH49"
                     /locus_tag="AWJ20_4056"
                     /inference="similar to AA sequence:KEGG_Orthology:K12831"
                     /note="U2-snRNP associated splicing factor; similar to the
                     mammalian splicing factor SAP49; proposed to function as a
                     U2-snRNP assembly factor along with Hsh155p and binding
                     partner Cus1p; contains two RNA recognition motifs (RRM);
                     GO_component: GO:0005686 - U2 snRNP [Evidence IDA] [PMID
                     15565172]; GO_component: GO:0005686 - U2 snRNP [Evidence
                     IDA] [PMID 16314500]; GO_component: GO:0071004 - U2-type
                     prespliceosome [Evidence IDA] [PMID 16618970];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IDA] [PMID
                     9436903]; GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006397 - mRNA
                     processing [Evidence IEA]; GO_process: GO:0000398 - mRNA
                     splicing, via spliceosome [Evidence IPI] [PMID 16314500];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IMP,IPI] [PMID 9436903]"
                     /codon_start=1
                     /product="Hsh49p"
                     /protein_id="XP_018733730.1"
                     /db_xref="GeneID:30036146"
                     /translation="MSNRLARAGERNPALTVYVGNLHEEVDEELLYELGIQAGPVVNV
                     HIPLDRVNGKNSGFGFLEYRSEKDVDYAAQILNGIMLFGQPLRVNKSQQEKANSIDVG
                     AQVFVGSLDPLVDEKTLSDTFSVFGRLIRPATIMRDENGRSRGFGFISFADFESSDRA
                     IESMNDQYLMNRKVQLNYAFKKDGKGERHGDEAERLLAAEAKKHNYSLTLGEGGVSSP
                     GNSSIPKGPRASHSSRDDGPESDSDGDVLNDLSQSKKPRNRGRKRQPRTKHRDDLSGA
                     NAIPTGPKRG"
     gene            complement(<1142101..>1143663)
                     /gene="STE50"
                     /locus_tag="AWJ20_4057"
                     /db_xref="GeneID:30036147"
     mRNA            complement(<1142101..>1143663)
                     /gene="STE50"
                     /locus_tag="AWJ20_4057"
                     /product="Ste50p"
                     /transcript_id="XM_018881108.1"
                     /db_xref="GeneID:30036147"
     CDS             complement(1142101..1143663)
                     /gene="STE50"
                     /locus_tag="AWJ20_4057"
                     /note="Protein involved in mating response;
                     invasive/filamentous growth, and osmotolerance, acts as an
                     adaptor that links G protein-associated Cdc42p-Ste20p
                     complex to the effector Ste11p to modulate signal
                     transduction; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 9742096]; GO_function: GO:0032093 -
                     SAM domain binding [Evidence IDA] [PMID 16337230];
                     GO_function: GO:0019887 - protein kinase regulator
                     activity [Evidence IDA,IPI] [PMID 10397774]; GO_process:
                     GO:0000161 - MAPK cascade involved in osmosensory
                     signaling pathway [Evidence IMP,IPI] [PMID 9742096];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0007050 - cell cycle arrest [Evidence IEA];
                     GO_process: GO:0034605 - cellular response to heat
                     [Evidence IMP] [PMID 12455951]; GO_process: GO:0007232 -
                     osmosensory signaling pathway via Sho1 osmosensor
                     [Evidence IMP] [PMID 11370856]; GO_process: GO:0000750 -
                     pheromone-dependent signal transduction involved in
                     conjugation with cellular fusion [Evidence IMP,IPI] [PMID
                     8793874]; GO_process: GO:0019236 - response to pheromone
                     [Evidence IEA]; GO_process: GO:0007165 - signal
                     transduction [Evidence IEA]; GO_process: GO:0001402 -
                     signal transduction involved in filamentous growth
                     [Evidence IMP,IPI] [PMID 9738877]"
                     /codon_start=1
                     /product="Ste50p"
                     /protein_id="XP_018733731.1"
                     /db_xref="GeneID:30036147"
                     /translation="MAAFSSQRHSIGNSPLSSDSVMTWDCDTVGKWVSNLGLSSYAQS
                     FIDNKISGDVLIYLDHEDLIDVGVKSVGHRLTILKSIYQLIVDGNIEVDHSHYVPPTV
                     VERNSLGLSLSDSVLPGSGAATGSSNGIGSSNGASSSTNGAGNTGSHGPVDMSSSTNS
                     IYSNNRAGVGSMSDVWAEKIITSFEVRDERISYAEAEIKRLMDGYVRLREDLLPIFRI
                     VKESKPLPTPDAPLPSPGNTLTAGPSASQSQTPSSHGNTHAQPSPTIVPYANSPTPTS
                     PPAFMTTFPPGSSNPVNSINNNINTSERGPLSASSISGHPSSASLQLQSNNNSASSSN
                     LGVTASNQKKTGSSSKGMSPSMAPVNIKSPTGNLSEYYDDAATIRPTARVTRKASLNG
                     IAPSFNNSSASTPISSAGGSSSSLNTPNSSSSTEPFKSFRVSMDDPCYKVLPAALRKY
                     KINGDPRQYALLVCYGDQERLLGLEEKPLIIFKELQDAGKRPVFMLRHIEGSHSGAQA
                     GVVVSGTPGGVL"
     gene            complement(<1148799..>1151465)
                     /locus_tag="AWJ20_4058"
                     /db_xref="GeneID:30036148"
     mRNA            complement(<1148799..>1151465)
                     /locus_tag="AWJ20_4058"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881109.1"
                     /db_xref="GeneID:30036148"
     CDS             complement(1148799..1151465)
                     /locus_tag="AWJ20_4058"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733732.1"
                     /db_xref="GeneID:30036148"
                     /translation="MSGELGSWADSDPESPPPVPRGSSGGGASVGASSSQENGGDGGG
                     DGDTSQVSSESLDLNNSGSTGTSELWTDRSNGFDAQSNRLRRKTGFSQLPMASEGDLG
                     PADTGSHVRSDVDGSSDPQSDNRAGSGAGGDIGTRRYNNGSGKGVDSAAESGLLYVTG
                     GSSNHQPVANDSTGDKFVSDAKGSGDASKGNVAGSNREVGYGSMGDSLSGSGHVNRAN
                     RVFGSNTGSGVNRVNGANSSNGVNSNDASNGGNRETGSKGVNGVNGVNGRNSGNGANG
                     VDDSNSSDGANGTVRLSKSQSPRVLGPKGFVKDVETSLEQEIINESSPLLHRLEDSLL
                     GDSGNTGYTGGVSEDPDEPDSSSPYDDPLNSLSIRSLRVLLYVLTTLWSGWITLLIIN
                     VFSHISWLDEPSVSSAFTQLDMALMSLAQVISSLMFFRNTNSADRSIEYVTTAIVLLD
                     LVVVLAVPSQRIKNGSKGGLITTVGSLVTFVLTPLTDRVVEYAGKRRDEGRIHQSVRG
                     LPINMSSFSQYARMTALFFIRGLILVSVALISTNMVLETYDSAVLQPPGKIIPISLQN
                     ITYSPIPSPTPSPPYSASFFSPFSIYDESTPNANNNDTTTINNSTIGIHIYCTDINKD
                     TTNPNLTVLLETGDSPALSFSSWALELHERGDIAQVCYWDRPGFGFSDQAPSPLSAGV
                     VANILFETLNRTLDEELPSKYVLVSHDVGGLYSRIFASRHCSSIHSMVLVDNLHEDLF
                     FRRNSPWQGFKYWIQGVFASLGYRNAFGIIFKREGPFHRVYGSAYQRQPKYFFAKLQE
                     QLSARTRTKSEIIDSNASLASDIPILVITSSASIRTDSEWSDKQRQLTKLTSNTLAWE
                     ILDGPHDLWRNDATKHELQKLLLDDIKYSRRS"
     gene            <1152565..>1153131
                     /locus_tag="AWJ20_4059"
                     /db_xref="GeneID:30036149"
     mRNA            <1152565..>1153131
                     /locus_tag="AWJ20_4059"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881110.1"
                     /db_xref="GeneID:30036149"
     CDS             1152565..1153131
                     /locus_tag="AWJ20_4059"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733733.1"
                     /db_xref="GeneID:30036149"
                     /translation="MGEPDSLPENLHSVGVKPIIDGQIFKVEGATLVSHYTPGHTDDH
                     MVFWLEEEEALFSADNVLGGSTTVFSDLKVYLETLNKMAKIGNGKLGKIYPGHGPVIY
                     DGPQVIKDYISHRKAREDQILELLNGSSEPLSLSDIAAELYKDISAEASAYIERGVLL
                     HLDKLLQENRAFKDPDSGEWTSLSRAKL"
     gene            complement(<1155794..>1157035)
                     /gene="PSA1"
                     /locus_tag="AWJ20_4060"
                     /db_xref="GeneID:30036151"
     mRNA            complement(<1155794..>1157035)
                     /gene="PSA1"
                     /locus_tag="AWJ20_4060"
                     /product="mannose-1-phosphate guanylyltransferase"
                     /transcript_id="XM_018881112.1"
                     /db_xref="GeneID:30036151"
     CDS             complement(1155794..1157035)
                     /gene="PSA1"
                     /locus_tag="AWJ20_4060"
                     /inference="similar to AA sequence:KEGG_Orthology:K00966"
                     /note="GDP-mannose pyrophosphorylase (mannose-1-phosphate
                     guanyltransferase); synthesizes GDP-mannose from GTP and
                     mannose-1-phosphate in cell wall biosynthesis; required
                     for normal cell wall structure; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0005525 - GTP binding [Evidence IEA];
                     GO_function: GO:0004475 - mannose-1-phosphate
                     guanylyltransferase activity [Evidence IEA]; GO_function:
                     GO:0004475 - mannose-1-phosphate guanylyltransferase
                     activity [Evidence IDA,IMP] [PMID 9195935]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0016779 - nucleotidyltransferase activity
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA,IEA]; GO_process: GO:0009298 -
                     GDP-mannose biosynthetic process [Evidence IEA];
                     GO_process: GO:0009298 - GDP-mannose biosynthetic process
                     [Evidence IDA,IMP] [PMID 9195935]; GO_process: GO:0009058
                     - biosynthetic process [Evidence IEA]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0000032 - cell wall mannoprotein biosynthetic process
                     [Evidence IMP] [PMID 11055399]; GO_process: GO:0006486 -
                     protein glycosylation [Evidence IMP] [PMID 9195935]"
                     /codon_start=1
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="XP_018733734.1"
                     /db_xref="GeneID:30036151"
                     /translation="MSTKALILVGGGTRGTRFRPISLDTPKVLFPVAGKPMLSHAIDA
                     VATLPSVKEIILFGFYEEYVFRDFIHDTVRQYPHLSIKYLREYKAMGTAGGLYHFRDE
                     ILKGSPQHFYVIHADVCSSFPLKELATFFEEKKAKAVILGTRVPAKIANNFGAIVADE
                     DQKVVHYVEKPESHISTLINAGVYLFDKSFFQVMKEARQKKVQDANDHVYFSEDQNDQ
                     DILRLEQDVLVKFAEREELYVYETKDFWRQVKEAGSAVAVNSLYLQQLFQSNPKAPGL
                     AAPSANIVPPVFIDPLAEVDVSAKLGPDVSIGPHAKIGKGARIKDSIILEHAQVKDNG
                     VVLHSILCSGTKVGQWSRVEGSPNNHNTYTATTEKDGVRMQTVSILATNVSVADEVHV
                     QNTIVLPHKEIKNDVKNEVIM"
     gene            complement(<1160690..>1162867)
                     /gene="YME1"
                     /locus_tag="AWJ20_4061"
                     /db_xref="GeneID:30036152"
     mRNA            complement(<1160690..>1162867)
                     /gene="YME1"
                     /locus_tag="AWJ20_4061"
                     /product="i-AAA protease YME1"
                     /transcript_id="XM_018881113.1"
                     /db_xref="GeneID:30036152"
     CDS             complement(1160690..1162867)
                     /gene="YME1"
                     /locus_tag="AWJ20_4061"
                     /inference="similar to AA sequence:KEGG_Orthology:K08955"
                     /note="Catalytic subunit of the i-AAA protease complex;
                     complex is located in the mitochondrial inner membrane;
                     responsible for degradation of unfolded or misfolded
                     mitochondrial gene products; serves as a nonconventional
                     translocation motor to pull PNPase into the intermembrane
                     space; also has a role in intermembrane space protein
                     folding; mutation causes an elevated rate of mitochondrial
                     turnover; GO_component: GO:0031942 - i-AAA complex
                     [Evidence IDA] [PMID 16267274]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IDA] [PMID 8688560]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0004176 -
                     ATP-dependent peptidase activity [Evidence IMP] [PMID
                     15772085]; GO_function: GO:0004176 - ATP-dependent
                     peptidase activity [Evidence IGI] [PMID 8688560];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0004222 -
                     metalloendopeptidase activity [Evidence IEA]; GO_function:
                     GO:0008237 - metallopeptidase activity [Evidence IEA];
                     GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0008233 - peptidase activity [Evidence IEA];
                     GO_process: GO:0006515 - misfolded or incompletely
                     synthesized protein catabolic process [Evidence IMP] [PMID
                     18843051]; GO_process: GO:0006457 - protein folding
                     [Evidence IMP] [PMID 22993211]; GO_process: GO:0045041 -
                     protein import into mitochondrial intermembrane space
                     [Evidence IDA,IMP] [PMID 16966379]; GO_process: GO:0051604
                     - protein maturation [Evidence IMP] [PMID 16966379];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="i-AAA protease YME1"
                     /protein_id="XP_018733735.1"
                     /db_xref="GeneID:30036152"
                     /translation="MLSRSRFALGPLRMVASTGRRNAVMSRSQIRSFWTPFSQTSSSS
                     SLSASPSTPATSATHLLSIKEQSANRSLTNPMVQADFYRNLLASNYPHLVVSRYETPG
                     VGRNSECDALYVQALKVIGHTEKAEAIERSLMAQAQAQAQAQAQAAAAVSASAGFPSG
                     PVVGSTTTPDGFNSVLNSPVGRGTRTDPVHIIINETALSSVLKWLKWLIPMGLAGWGL
                     IVGLTFFTESASILKGAGSDIGSSKLDGANGSQSNVKFSDVHGVDEARAELEEIVDFL
                     KDPSKFTGLGGKLPKGILLTGPPGTGKTLLARAVAGEAGVPFFFMSGSEFDELYVGVG
                     AKRVRELFAAARAKAPAIVFIDELDAIGSKRNPKDHAYSKQTLNQLLVDLDGFSQTTG
                     VIFIAATNFPEMLDKALTRPGRFDKIVHVELPDVRGRVAILKHHMKKVETAVDVDPTT
                     IARGTSGFSGADIMNLVNQAAIFASQQKAVSVDMSHFEWAKDKILLGAARKTMVLTEE
                     SRRNTAFHEAGHAIMALYTPGATSLYKATILPRGSALGITFQLPEMDKYDQSKKELLA
                     RLDVCMGGKIAEEMVNGPENVTSGCSSDLKNATQVARAMVTSFGMCDTIGPVELAENW
                     SDWSAETRHLAEQEIRNLLVTSENRTREMLKEKYVELERLANGLLEYETLDKDEIEKV
                     VQGLKIEREKTVTNTVVRGNDIKDERSKGGTKVGLAGPGVKLG"
     gene            <1161813..>1162091
                     /locus_tag="AWJ20_4062"
                     /db_xref="GeneID:30036153"
     mRNA            <1161813..>1162091
                     /locus_tag="AWJ20_4062"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881114.1"
                     /db_xref="GeneID:30036153"
     CDS             1161813..1162091
                     /locus_tag="AWJ20_4062"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018733736.1"
                     /db_xref="GeneID:30036153"
                     /translation="MAGALARAAANNSRTRLAPTPTYNSSNSEPLIKKKGTPASPATA
                     LARRVLPVPGGPVRRIPLGSLPPKPVNLEGSFRKSTISSSSARASSTP"
     gene            complement(<1170305..>1171174)
                     /locus_tag="AWJ20_4063"
                     /db_xref="GeneID:30036154"
     mRNA            complement(<1170305..>1171174)
                     /locus_tag="AWJ20_4063"
                     /product="S-formylglutathione hydrolase"
                     /transcript_id="XM_018881115.1"
                     /db_xref="GeneID:30036154"
     CDS             complement(1170305..1171174)
                     /locus_tag="AWJ20_4063"
                     /inference="similar to AA sequence:KEGG_Orthology:K01070"
                     /note="Esterase that can function as an
                     S-formylglutathione hydrolase; non-essential intracellular
                     esterase; may be involved in the detoxification of
                     formaldehyde, which can be metabolized to
                     S-formylglutathione; similar to human esterase D;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     10427036]; GO_function: GO:0018738 - S-formylglutathione
                     hydrolase activity [Evidence IEA,IEA]; GO_function:
                     GO:0018738 - S-formylglutathione hydrolase activity
                     [Evidence IDA] [PMID 10427036]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_process: GO:0046294
                     - formaldehyde catabolic process [Evidence IEA];
                     GO_process: GO:0046294 - formaldehyde catabolic process
                     [Evidence IMP] [PMID 10427036]"
                     /codon_start=1
                     /product="S-formylglutathione hydrolase"
                     /protein_id="XP_018733737.1"
                     /db_xref="GeneID:30036154"
                     /translation="MAGFKTNSTIASCGGKLLKLNHESKVLKSAMDVNVFLPPAAVDG
                     KKKVPVLFFLSGLTCTPQNCSEKGFFQSAAAQHGIAIVYPDTSPRGSDHPGENDSWDF
                     GSGAGFYINATEKPWSDNYNMYDYVVSELPEALFEEFPQLDADRVSITGHSMGGHGAL
                     TLFLRNPGKYKSVSAFSPISNPINAPWGIKAFSGYFGEQNKAKWAEHDATELIKKYSG
                     PSPEILIDVGTGDQFYKDKQLLPENLVEAANDSANYKGKVNLRLQPDYDHSYYFISSF
                     AKDHVEHAAKYLL"
     gene            complement(<1171610..>1173238)