GenomeNet

Database: RefSeq
Entry: NC_031672
LinkDB: NC_031672
Original site: NC_031672 
LOCUS       NC_031672            5930846 bp    DNA     linear   CON 25-OCT-2016
DEFINITION  Sugiyamaella lignohabitans strain CBS 10342 chromosome A, complete
            sequence.
ACCESSION   NC_031672
VERSION     NC_031672.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
            Assembly: GCF_001640025.1
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 5930846)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5930846)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5930846)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP014501.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5930846
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="genomic DNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Sugiyamaella
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="A"
     gene            <3059..>4897
                     /gene="ITR2"
                     /locus_tag="AWJ20_1"
                     /db_xref="GeneID:30032752"
     mRNA            <3059..>4897
                     /gene="ITR2"
                     /locus_tag="AWJ20_1"
                     /product="myo-inositol transporter ITR2"
                     /transcript_id="XM_018877845.1"
                     /db_xref="GeneID:30032752"
     CDS             3059..4897
                     /gene="ITR2"
                     /locus_tag="AWJ20_1"
                     /note="Myo-inositol transporter; member of the sugar
                     transporter superfamily; expressed constitutively; ITR2
                     has a paralog, ITR1, that arose from the whole genome
                     duplication; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016020 - membrane [Evidence
                     ISS] [PMID 2040626]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 16233524];
                     GO_function: GO:0005365 - myo-inositol transmembrane
                     transporter activity [Evidence IMP,ISS] [PMID 2040626];
                     GO_function: GO:0022891 - substrate-specific transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0022857 - transmembrane transporter activity [Evidence
                     IEA]; GO_function: GO:0005215 - transporter activity
                     [Evidence IEA]; GO_process: GO:0015798 - myo-inositol
                     transport [Evidence IMP] [PMID 2040626]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="myo-inositol transporter ITR2"
                     /protein_id="XP_018734259.1"
                     /db_xref="GeneID:30032752"
                     /translation="MSGAKADAAHLEHYDKEHVEAFEKSFQNPLAGIDRETLLSRVRT
                     FAKEKGLEDKIPQLEKGALVAQDPENFESLSDLDDDEKRILQQEVDHKWHHPKAMYWT
                     IIVCSIGAAVQGWDQTGSNGANLSFPQEFGIDISDPANPDYEKNNWLVGMINSAPYMC
                     AAIISCWLSDPINYLIGRRGTIFIAAIFCLLTPIGQAVTQNWHQLFVCRLLLGFGIGL
                     KEVTAPVFAAENAPARIRGAMVMTWQMWTAFGILLGFSANLILYRVGKIAWRLQVGSA
                     FIPAVPLLLGIFFCPESPRWLMKKDRYRQAYDSLCRLRFSEVQAARDLYYIHAQLVIE
                     DEMIGNRTYITRFIELFTVGRLRRATLASWVVMIAQQMCGINIISFFSSSIFVEAGQS
                     EKSALLASWGFGMVNFVFAWPAFYTIDTFGRRALLLFTFPNMAWTLLAAGMSFFIPEG
                     SRARLGLVALFIFLFDAFYSPGEGPIPFTYSAEVFPLSHREMGMSWAVATNNFFAAIL
                     SLSYFRIQAAFTIQGAFGFYTGLNLVAFVMIFLWLPETKQRTLEELDYVFSIPTKDFM
                     RYQLTESLPYWCKRWILWKRNIKLRPLYYFEYSDHHQGNSNTYEVA"
     gene            complement(<4990..>6651)
                     /gene="DUR3"
                     /locus_tag="AWJ20_2"
                     /db_xref="GeneID:30033862"
     mRNA            complement(<4990..>6651)
                     /gene="DUR3"
                     /locus_tag="AWJ20_2"
                     /product="Dur3p"
                     /transcript_id="XM_018878922.1"
                     /db_xref="GeneID:30033862"
     CDS             complement(4990..6651)
                     /gene="DUR3"
                     /locus_tag="AWJ20_2"
                     /note="Plasma membrane transporter for both urea and
                     polyamines; expression is highly sensitive to nitrogen
                     catabolite repression and induced by allophanate, the last
                     intermediate of the allantoin degradative pathway;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 17218313]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IMP,ISS] [PMID 8335627];
                     GO_function: GO:0015489 - putrescine transmembrane
                     transporter activity [Evidence IDA,IMP] [PMID 17218313];
                     GO_function: GO:0015606 - spermidine transmembrane
                     transporter activity [Evidence IDA,IMP] [PMID 17218313];
                     GO_function: GO:0005215 - transporter activity [Evidence
                     IEA]; GO_function: GO:0015204 - urea transmembrane
                     transporter activity [Evidence IMP,ISS] [PMID 8335627];
                     GO_process: GO:0015847 - putrescine transport [Evidence
                     IDA,IMP] [PMID 17218313]; GO_process: GO:0015848 -
                     spermidine transport [Evidence IDA,IMP] [PMID 17218313];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence
                     IEA,IEA]; GO_process: GO:0043419 - urea catabolic process
                     [Evidence IEP] [PMID 8335627]; GO_process: GO:0015840 -
                     urea transport [Evidence IMP,ISS] [PMID 8335627]"
                     /codon_start=1
                     /product="Dur3p"
                     /protein_id="XP_018734260.1"
                     /db_xref="GeneID:30033862"
                     /translation="MILSGSQLVIGITGMHYVAATIILPFGVILYTVVGGLKATFLTD
                     YLHTTIALILIMFFTISVLVNEHIGGLSGLYDKLQATAHLHPIPGNYQGSLLTIKSPD
                     AVMWGLTLKFGNLALVVMDTAFWQKSFASKPSATVPGYLLTAVSIFAIPLGLGTVVGL
                     AGRVIESTPLSPTYPNTFSADAVNRGYVMPYVVKGLLGKGATGGILLLLFMALTSTVS
                     SSLIAVSSILSYDGYRTYINPKASDKTMIRVSHLTVVLYGAFIAGYTILLNYVGANMT
                     FYGYLQPVVSCPGIFPLIFAIFSDRQSKPAAVLSPILGLLCGVLTWVYTARSIYGGIS
                     MEDTSNPAPGLYGSIVSLFSPIFFSIIISILRPSKFDWNEYLKIKLLDDVDSQTVAIS
                     DNTSVDQERKNSVQENSKEAIYTEHSSIDDEEKTTGNRGLNKVANYFRTKDSDYTNLE
                     DIYDQETIREMRRWLKIAAVALVVIVLVTFVAWPMPLYRNYVFTKPFFSGWVTVAIIW
                     QFQAFFTVAVYPLWDGRKSIQLALRGIKQQFRFKRSQESHSTEEN"
     gene            <8242..>9495
                     /locus_tag="AWJ20_3"
                     /db_xref="GeneID:30034972"
     mRNA            <8242..>9495
                     /locus_tag="AWJ20_3"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879985.1"
                     /db_xref="GeneID:30034972"
     CDS             8242..9495
                     /locus_tag="AWJ20_3"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734261.1"
                     /db_xref="GeneID:30034972"
                     /translation="MVRPFKLIFDEFECLNLMITRPVMTDPAIKLPVVVWIHGGGNVA
                     GTPYRTICDPSDWISQSIKMAKPVIFVSLQYRVHLFGALPYEGIGNFFLHDQRLGLQW
                     VHEYIDYFGGDKNRVTLIGQSAGSCCVAAQASAKGAEQLFKRAALMSGSISSMPFMTL
                     DQYGAKSKEIAEAAGLETVEELSNLPWKQLVDAGVKCNFNVAYAVDDGKFLGYGQLNR
                     AHTLVESIILSDCIEDGYFFTDYFTQGIGDLFTEIKQIACDEKVSQQLLAAYNIVEDE
                     SIIKRIGDLLTDAIFCQGNENMDIEVRKSGATKVFRQFFDANNPFNPTLGNNHMVEVL
                     YLFNAYNVAAKYQPITRDVQSRWINFFYGHDPWSSECCLRVSDTGVEEISYNQRGQYR
                     RIKNFDLLSSLDPKSMHRLTGDGWD"
     gene            complement(<9623..>10366)
                     /gene="RNA15"
                     /locus_tag="AWJ20_4"
                     /db_xref="GeneID:30036082"
     mRNA            complement(<9623..>10366)
                     /gene="RNA15"
                     /locus_tag="AWJ20_4"
                     /product="Rna15p"
                     /transcript_id="XM_018881044.1"
                     /db_xref="GeneID:30036082"
     CDS             complement(9623..10366)
                     /gene="RNA15"
                     /locus_tag="AWJ20_4"
                     /inference="similar to AA sequence:KEGG_Orthology:K14407"
                     /note="Component of the cleavage and polyadenylation
                     factor I (CF I); CF 1, composed of the CF 1A complex
                     (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in
                     cleavage and polyadenylation of mRNA 3' ends; interacts
                     with the A-rich polyadenylation signal in complex with
                     Rna14p and Hrp1p; mutant displays reduced transcription
                     elongation in the G-less-based run-on (GLRO) assay;
                     required for gene looping; GO_component: GO:0005849 - mRNA
                     cleavage factor complex [Evidence IPI] [PMID 11344258];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 17684230]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0046982
                     - protein heterodimerization activity [Evidence IPI] [PMID
                     15215336]; GO_process: GO:0006379 - mRNA cleavage
                     [Evidence IDA] [PMID 11344258]; GO_process: GO:0006378 -
                     mRNA polyadenylation [Evidence IDA] [PMID 11344258];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="Rna15p"
                     /protein_id="XP_018734262.1"
                     /db_xref="GeneID:30036082"
                     /translation="MDGPTKVVYVGSIPYDHTEEQMLDIFKSVGPVANIRLVFDKDTG
                     KSKGFGFVEYHDEETAASAVRNLNNYSIGPRALKVAFSHETPVGGLFKDSKISSDLPP
                     LPQGPIPARGVSGNELISQTIDGFSQERKVQVIVDMKTLISNNPTLATDLLKAAPQLS
                     FAVVQTLSALQLITPQQITNLTPDSNPASESHAPAPAPAPVAVDPQQAALIKQVVQLT
                     DDQINALPADQKETILTLKAKVKSGEIKI"
     gene            <11423..>11992
                     /gene="DST1"
                     /locus_tag="AWJ20_5"
                     /db_xref="GeneID:30037192"
     mRNA            <11423..>11992
                     /gene="DST1"
                     /locus_tag="AWJ20_5"
                     /product="Dst1p"
                     /transcript_id="XM_018882109.1"
                     /db_xref="GeneID:30037192"
     CDS             11423..11992
                     /gene="DST1"
                     /locus_tag="AWJ20_5"
                     /inference="similar to AA sequence:KEGG_Orthology:K03145"
                     /note="General transcription elongation factor TFIIS;
                     enables RNA polymerase II to read through blocks to
                     elongation by stimulating cleavage of nascent transcripts
                     stalled at transcription arrest sites; maintains RNAPII
                     elongation activity on ribosomal protein genes during
                     conditions of transcriptional stress; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9334234];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0000993 - RNA polymerase II core binding
                     [Evidence IPI] [PMID 6985606]; GO_function: GO:0000993 -
                     RNA polymerase II core binding [Evidence IPI] [PMID
                     8876173]; GO_function: GO:0001012 - RNA polymerase II
                     regulatory region DNA binding [Evidence IDA] [PMID
                     15767671]; GO_function: GO:0001139 - core RNA polymerase
                     II recruiting transcription factor activity [Evidence IMP]
                     [PMID 15767671]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0003676 - nucleic
                     acid binding [Evidence IEA]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IEA]; GO_process: GO:0006379 -
                     mRNA cleavage [Evidence IDA] [PMID 12692127]; GO_process:
                     GO:0006379 - mRNA cleavage [Evidence IMP] [PMID 9712888];
                     GO_process: GO:0001193 - maintenance of transcriptional
                     fidelity during DNA-templated transcription elongation
                     from RNA polymerase II promoter [Evidence IMP] [PMID
                     14531857]; GO_process: GO:0001193 - maintenance of
                     transcriptional fidelity during DNA-templated
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IMP] [PMID 16492753]; GO_process: GO:0001193 -
                     maintenance of transcriptional fidelity during
                     DNA-templated transcription elongation from RNA polymerase
                     II promoter [Evidence IGI] [PMID 17535246]; GO_process:
                     GO:0045899 - positive regulation of RNA polymerase II
                     transcriptional preinitiation complex assembly [Evidence
                     IDA,IMP] [PMID 17913884]; GO_process: GO:0032968 -
                     positive regulation of transcription elongation from RNA
                     polymerase II promoter [Evidence IDA] [PMID 8876173];
                     GO_process: GO:0032784 - regulation of DNA-templated
                     transcription, elongation [Evidence IEA]; GO_process:
                     GO:0031440 - regulation of mRNA 3'-end processing
                     [Evidence IGI,IMP] [PMID 15531585]; GO_process: GO:0006357
                     - regulation of transcription from RNA polymerase II
                     promoter [Evidence IEA]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence
                     IEA,IEA]; GO_process: GO:0042797 - tRNA transcription from
                     RNA polymerase III promoter [Evidence IMP] [PMID
                     18628399]; GO_process: GO:0031564 - transcription
                     antitermination [Evidence IDA] [PMID 8636112]; GO_process:
                     GO:0031564 - transcription antitermination [Evidence IDA]
                     [PMID 9037112]; GO_process: GO:0031564 - transcription
                     antitermination [Evidence IDA] [PMID 9169440]; GO_process:
                     GO:0006362 - transcription elongation from RNA polymerase
                     I promoter [Evidence IDA] [PMID 7002153]; GO_process:
                     GO:0006368 - transcription elongation from RNA polymerase
                     II promoter [Evidence IDA] [PMID 7002153]; GO_process:
                     GO:0006368 - transcription elongation from RNA polymerase
                     II promoter [Evidence IDA] [PMID 7020755]; GO_process:
                     GO:0006368 - transcription elongation from RNA polymerase
                     II promoter [Evidence IDA,IMP] [PMID 8288647]; GO_process:
                     GO:0006368 - transcription elongation from RNA polymerase
                     II promoter [Evidence IDA] [PMID 9334234]; GO_process:
                     GO:0006383 - transcription from RNA polymerase III
                     promoter [Evidence IDA] [PMID 18628399]; GO_process:
                     GO:0006367 - transcription initiation from RNA polymerase
                     II promoter [Evidence IMP] [PMID 15767671]; GO_process:
                     GO:0006367 - transcription initiation from RNA polymerase
                     II promoter [Evidence IDA,IGI,IMP] [PMID 17901206];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Dst1p"
                     /protein_id="XP_018734263.1"
                     /db_xref="GeneID:30037192"
                     /translation="MTERFSNHGKPRNAKNDGVRTDLYSDKVRNSCIDLCYTALALDS
                     VAAPADILGHAKAIEAVVFENNKGNTAAPAYRNKMRSLYMNLKDKANPMLRKRVVSGE
                     ISAQRLATMTPQEMASEELKEEIQRLDKENLFKAQGATEKRATTDRFTCGKCKQKKVS
                     YYQMQTRSADEPLTTFCTCENCGNRWKFS"
     gene            complement(<14738..>14832)
                     /locus_tag="AWJ20_6"
                     /db_xref="GeneID:30037649"
     tRNA            complement(<14738..>14832)
                     /locus_tag="AWJ20_6"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:30037649"
     gene            complement(<16235..>17284)
                     /gene="PEX14"
                     /locus_tag="AWJ20_7"
                     /db_xref="GeneID:30037760"
     mRNA            complement(<16235..>17284)
                     /gene="PEX14"
                     /locus_tag="AWJ20_7"
                     /product="Pex14p"
                     /transcript_id="XM_018882654.1"
                     /db_xref="GeneID:30037760"
     CDS             complement(16235..17284)
                     /gene="PEX14"
                     /locus_tag="AWJ20_7"
                     /inference="similar to AA sequence:KEGG_Orthology:K13343"
                     /note="Central component of the peroxisomal protein import
                     machinery; peroxisomal membrane peroxin; interacts with
                     both PTS1 (Pex5p) and PTS2 (Pex7p), peroxisomal matrix
                     protein signal recognition factors and membrane receptor
                     Pex13p; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005778 - peroxisomal membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005778 - peroxisomal
                     membrane [Evidence IDA] [PMID 9094717]; GO_component:
                     GO:0005778 - peroxisomal membrane [Evidence IDA] [PMID
                     9312008]; GO_component: GO:0005777 - peroxisome [Evidence
                     IEA]; GO_function: GO:0030674 - protein binding, bridging
                     [Evidence IPI] [PMID 9094717]; GO_function: GO:0030674 -
                     protein binding, bridging [Evidence IPI] [PMID 9312008];
                     GO_process: GO:0016560 - protein import into peroxisome
                     matrix, docking [Evidence IEA]; GO_process: GO:0016560 -
                     protein import into peroxisome matrix, docking [Evidence
                     IMP,IPI] [PMID 16107331]; GO_process: GO:0016560 - protein
                     import into peroxisome matrix, docking [Evidence IPI]
                     [PMID 9094717]; GO_process: GO:0016560 - protein import
                     into peroxisome matrix, docking [Evidence IPI] [PMID
                     9312008]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Pex14p"
                     /protein_id="XP_018734264.1"
                     /db_xref="GeneID:30037760"
                     /translation="MREELVRSAVSFLNDPQVADATLAKRIEFLESKGLTKEEVEEAL
                     TQATNGNSSPKSPSSLASVPITGVNSTTVKTAYLNQPHIPPLSLPPPVPKRDWKDYFV
                     MATVSAGVAYGLYEVTRRYVLPLILPPTPSSLESDKEALEAEFTRAESLLEQLHKDTE
                     EIKEAELQRKEQFTTVLQEAQDAIETVKGQSQQIEADMKLIKTQVDTIKDTLPKSLEK
                     NRDQQDKALLEIQEELKSLKQLITNRLKSSSLPASLPPASSVPSTIPKFAASSVSSTS
                     GPSPSSTSTNEGSTSLPVLGTNSSIVSPFSKPSVPYSEQTSPATSSTTPTPKPGLPAW
                     QVAAASKYSENEAAS"
     gene            <19673..>20566
                     /gene="lys7"
                     /locus_tag="AWJ20_8"
                     /db_xref="GeneID:30037871"
     mRNA            <19673..>20566
                     /gene="lys7"
                     /locus_tag="AWJ20_8"
                     /product="alpha-aminoadipate reductase phosphopantetheinyl
                     transferase Lys7"
                     /transcript_id="XM_018882764.1"
                     /db_xref="GeneID:30037871"
     CDS             19673..20566
                     /gene="lys7"
                     /locus_tag="AWJ20_8"
                     /codon_start=1
                     /product="alpha-aminoadipate reductase phosphopantetheinyl
                     transferase Lys7"
                     /protein_id="XP_018734265.1"
                     /db_xref="GeneID:30037871"
                     /translation="MRVTKLKFIDDAKMSLASHLLQRHLVWKFVQEKDKGTKLSFLKD
                     IRFHSGKFGRPYFRSSPESDYVIDFNISTVSGRVIIAHIVRSKNCSERLEKSIQAQTD
                     CPVLGIDLTDPPSLQSAEWMDEFAPMVSTPDELLAIKAASSINIGISDIDRTLLSGIS
                     LAIRWAIKESYIKGIGAGLVGAVDISQVEVDKESNDSIDKLVIDEYLKQARSAASHKN
                     GGDNFSVSKSNNITAKYFSAQKVIVASSEQADWRVKIFTFDGIIAAIMLHQDICVSEE
                     PELNLNRLALQTILDDIATSC"
     gene            <21028..>22089
                     /locus_tag="AWJ20_9"
                     /db_xref="GeneID:30037982"
     mRNA            <21028..>22089
                     /locus_tag="AWJ20_9"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882870.1"
                     /db_xref="GeneID:30037982"
     CDS             21028..22089
                     /locus_tag="AWJ20_9"
                     /inference="similar to AA sequence:KEGG_Orthology:K15118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734266.1"
                     /db_xref="GeneID:30037982"
                     /translation="MSDSTPQPQQITAIKTPLPSKSCSKPLSISKDDSSSTEPDTKPK
                     DKPLRKASPTSHLYAGFASGITSSILLQPLDLLKTRVQQSGEATITSAFKELTSFRAL
                     WRGTVPSALRMSIGSGLYFTTLNSTRAYLQQRNYNKLLQDHDKDTTSKAGNAGLGDSS
                     SLPKLGMYENLASGAFVRGVVGFMTMPITVIKVRYESSMYNYTSMWNAVQSVYRNHGV
                     RGYFYGYGATFARDAPYAGLYVLFYEKSKEIVNNLFPSTERRSTVTAAIMNSSSAFFS
                     AGLATTITSPFDTIKTRVQLNPVKYKGFFQAAKIMVKEDGFIRFFDGLSLRLSRKALS
                     AGISWCIYEEIVRRLQQPL"
     gene            complement(<22567..>23658)
                     /gene="PRX1"
                     /locus_tag="AWJ20_10"
                     /db_xref="GeneID:30032753"
     mRNA            complement(join(<22567..23382,23440..>23658))
                     /gene="PRX1"
                     /locus_tag="AWJ20_10"
                     /product="Prx1p"
                     /transcript_id="XM_018877846.1"
                     /db_xref="GeneID:30032753"
     CDS             complement(join(22567..23382,23440..23658))
                     /gene="PRX1"
                     /locus_tag="AWJ20_10"
                     /inference="similar to AA sequence:KEGG_Orthology:K03386"
                     /note="Mitochondrial peroxiredoxin with thioredoxin
                     peroxidase activity; has a role in reduction of
                     hydroperoxides; reactivation requires Trr2p and
                     glutathione; induced during respiratory growth and
                     oxidative stress; phosphorylated; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA,ISS] [PMID 10681558]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 10821871];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0016209 -
                     antioxidant activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA,IEA];
                     GO_function: GO:0004601 - peroxidase activity [Evidence
                     IEA]; GO_function: GO:0051920 - peroxiredoxin activity
                     [Evidence IEA,IEA]; GO_function: GO:0008379 - thioredoxin
                     peroxidase activity [Evidence IDA,IMP,ISS] [PMID
                     10681558]; GO_function: GO:0008379 - thioredoxin
                     peroxidase activity [Evidence IDA] [PMID 10821871];
                     GO_process: GO:0045454 - cell redox homeostasis [Evidence
                     IDA,IMP] [PMID 10681558]; GO_process: GO:0034599 -
                     cellular response to oxidative stress [Evidence IGI] [PMID
                     15051715]; GO_process: GO:0055114 - oxidation-reduction
                     process [Evidence IEA,IEA]; GO_process: GO:0046686 -
                     response to cadmium ion [Evidence IMP] [PMID 19332553]"
                     /codon_start=1
                     /product="Prx1p"
                     /protein_id="XP_018734267.1"
                     /db_xref="GeneID:30032753"
                     /translation="MSTGNHAMARAHAYKQEDICLTLANSFFNSIDPEMSVLTLARKT
                     LLTSARRSRSGARIVVPAVRHFAFNAADQPRIRIGSTAPNFKALTTDGEIDFHEFVGD
                     SWTILFSHPADFTPVCTTELGAFAALQEEFTKRNAKLIGLSADGLESHGEWVKDIEET
                     STSGKKFDFPIIADKDRNVAFLYDMVDEEGFKNINSGMAMTIRNVFIIDPKKKVRLFL
                     VYPASTGRNTAEVLRVLDALQLADGQGIATPVDWVPGKDVIVPVSVSTSDAAKKFGEV
                     REVKPYLRFVKHNVKSSVLSLFGGPSYSSSSNYTTFALIAAGVGAALVGSEGLSKDSR
                     VADLENVVGK"
     gene            complement(<23784..>24494)
                     /locus_tag="AWJ20_11"
                     /db_xref="GeneID:30032864"
     mRNA            complement(<23784..>24494)
                     /locus_tag="AWJ20_11"
                     /product="chitin synthase 6"
                     /transcript_id="XM_018877953.1"
                     /db_xref="GeneID:30032864"
     CDS             complement(23784..24494)
                     /locus_tag="AWJ20_11"
                     /note="Fungal Genetics Stock Center 12450; Fungal Genetics
                     Stock Center 12449"
                     /codon_start=1
                     /product="chitin synthase 6"
                     /protein_id="XP_018734268.1"
                     /db_xref="GeneID:30032864"
                     /translation="MDNFSWGNTRIVVEENAGKRKLKVDPNEVFDPRSVPLESWQSYA
                     NRNNLPGEERRIVFDDRKGRVINNVEYTDYGYDMQDLSARKSVMFDAATETRSTRPFS
                     QFSMDINRVGTPTTAVGGEARSLRLSLAPTELLDDQAQFDEHREVQVRETIKTVLRGA
                     DLDTMTKRQLRQKVEDILGMDFVGNKVAAVDRLIDEELESMENEESEIPEHPPADLIS
                     TAPENEVVKDGPPSPNIP"
     gene            complement(<24844..>28581)
                     /gene="CHS3"
                     /locus_tag="AWJ20_12"
                     /db_xref="GeneID:30032975"
     mRNA            complement(<24844..>28581)
                     /gene="CHS3"
                     /locus_tag="AWJ20_12"
                     /product="chitin synthase CHS3"
                     /transcript_id="XM_018878056.1"
                     /db_xref="GeneID:30032975"
     CDS             complement(24844..28581)
                     /gene="CHS3"
                     /locus_tag="AWJ20_12"
                     /inference="similar to AA sequence:KEGG_Orthology:K00698"
                     /note="Chitin synthase III; catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin; required for
                     synthesis of the majority of cell wall chitin, the chitin
                     ring during bud emergence, and spore wall chitosan;
                     contains overlapping di-leucine and di-acidic signals that
                     mediate, respectively, intracellular trafficking by AP-1
                     and trafficking to plasma membrane by exomer complex;
                     requires AP-3 complex for its intracellular retention;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 15470103]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 8909536]; GO_component:
                     GO:0045009 - chitosome [Evidence IDA] [PMID 8970154];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     9008706]; GO_component: GO:0000131 - incipient cellular
                     bud site [Evidence IDA] [PMID 15470103]; GO_component:
                     GO:0000131 - incipient cellular bud site [Evidence IDA]
                     [PMID 9008706]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 15755916]; GO_function: GO:0004100 - chitin
                     synthase activity [Evidence IEA]; GO_function: GO:0004100
                     - chitin synthase activity [Evidence IMP] [PMID 9760183];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016758 - transferase activity, transferring hexosyl
                     groups [Evidence IEA]; GO_process: GO:0030476 - ascospore
                     wall assembly [Evidence IMP] [PMID 1293886]; GO_process:
                     GO:0034221 - fungal-type cell wall chitin biosynthetic
                     process [Evidence TAS] [PMID 7565410]"
                     /codon_start=1
                     /product="chitin synthase CHS3"
                     /protein_id="XP_018734269.1"
                     /db_xref="GeneID:30032975"
                     /translation="MTALTPQNLSTRFHDGLGVKFELNARGDIVSTRILVPENPFSSL
                     DQLLNLPSKESNRVFDVFYHLLLNESSETRGTYLSLKSSPDQYDLLKKSGTYKLPDWV
                     NFSDDYALAKDWSDALRQCGFKASTLRGVLSTLSGILLLGNRDPNDIAEGASLIGIDP
                     KTQSRYAPRELIVSSYIALVKNVVSELNAFLAKLDKPNDNNENEVVSVVTIAECADDH
                     RKDVLRNVFDNSIGINQELFDDGLSIPKSPVAVTRAIQKMSTQTTNNSVTRTVAMIPN
                     FEDILDSSLSYLSSRKPSISPDEEESAFEIADLIARNRIWVALNLTSCGDAAGLAADR
                     WSSSVVSAQVREFFVTEWAQKRRQIDFTADFEPYEFIERYSALLPPNITFSDLEHWAI
                     HDKRWGHNDFAKGSKRIWISESVWRDLELGLDGLSGNSPYVNDSTDTFGQSYPSDEYV
                     ASNPFDQTERLLPMQNVDHGYNNGSHDMTGYNKELNRAPQYQQTPGGDMDPSDDELDD
                     ADFDNDYGLKERGGDIEHNTAGRITKIEKMTTERRVWVFFVWLFTFWIPSPFLKYIMR
                     MKRPEIRMAWREKLLLCFIIFLINAGIIFYMIFLGKFVCSDYDKVWNSKEIATHQGEN
                     DFYVSIHGNVYDLTKFYKIQHSDSSIQTTPSRMLEFAGQDLSDYFPPPLTVACPALVT
                     DVSISLSYNETKSPISSGLHNSGAYLVPANNTALHKYTWYNSVFQPKIKNYYKGRVVA
                     KRNDLLKTAQANNQYTFILNNQIYDVTNYFLTTAIYPDNDPVTKPWNFFSDTVVNMFV
                     NGQGQDITEQFNGDQLDALTRQNTLQCLNNAFRAGEVDFRDSVRCQVANVILLVFAGI
                     LTSVTLVKFLASIRFGSKRVPSPQDKFVLCQIPIYTESETDFRLAVDSLTNLKYDNRR
                     KLLLLVCDGMIVGAGNDKPTPNIVLDMLGVDERVNPPALAYESIGEGANQLNFAKVYS
                     GLYENEGNVVPFIVVVKVGRPQETSKPGNRGKRDSQIMIMRFLNKVHYQKPMSPLELE
                     LFHHMTNIIGVDPELYEYIFMVDADTSVAEDSLTRLVSACANDSRIAGICGETGLQNE
                     EKSWTTMIQVYEYFISHHLTKQFESLFGSVTCLPGCFSLYRLKTAKKYAPLFISNEVI
                     RDYSIINVDTLHKKNLFSLGEDRYLTTLMSKYFPKMKYSFIPDAYCQTAAPEDFSVLL
                     SQRRRWINSTVHNLMELLRLNTMCGFGFFSMRGVVFIDLIG"
     gene            <32456..>37627
                     /gene="CHS3"
                     /locus_tag="AWJ20_13"
                     /db_xref="GeneID:30033086"
     mRNA            <32456..>37627
                     /gene="CHS3"
                     /locus_tag="AWJ20_13"
                     /product="chitin synthase CHS3"
                     /transcript_id="XM_018878167.1"
                     /db_xref="GeneID:30033086"
     CDS             32456..37627
                     /gene="CHS3"
                     /locus_tag="AWJ20_13"
                     /inference="similar to AA sequence:KEGG_Orthology:K00698"
                     /note="Chitin synthase III; catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin; required for
                     synthesis of the majority of cell wall chitin, the chitin
                     ring during bud emergence, and spore wall chitosan;
                     contains overlapping di-leucine and di-acidic signals that
                     mediate, respectively, intracellular trafficking by AP-1
                     and trafficking to plasma membrane by exomer complex;
                     requires AP-3 complex for its intracellular retention;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 15470103]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 8909536]; GO_component:
                     GO:0045009 - chitosome [Evidence IDA] [PMID 8970154];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     9008706]; GO_component: GO:0000131 - incipient cellular
                     bud site [Evidence IDA] [PMID 15470103]; GO_component:
                     GO:0000131 - incipient cellular bud site [Evidence IDA]
                     [PMID 9008706]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 15755916]; GO_function: GO:0004100 - chitin
                     synthase activity [Evidence IEA]; GO_function: GO:0004100
                     - chitin synthase activity [Evidence IMP] [PMID 9760183];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016758 - transferase activity, transferring hexosyl
                     groups [Evidence IEA]; GO_process: GO:0030476 - ascospore
                     wall assembly [Evidence IMP] [PMID 1293886]; GO_process:
                     GO:0034221 - fungal-type cell wall chitin biosynthetic
                     process [Evidence TAS] [PMID 7565410]"
                     /codon_start=1
                     /product="chitin synthase CHS3"
                     /protein_id="XP_018734270.1"
                     /db_xref="GeneID:30033086"
                     /translation="MTLFCLRRLGLCPRPRGSSRYARVDLSTSSKFGEFVPFSATNLV
                     QHHLLPLSIYGKLTGSALSNNPLSTKIKNADFVFQAFTTTKTAQSLASSRAGNVLEFQ
                     YGTDATLIGASILDYRLERSRITKVPTGERNYHVFYSLMAGISDTEREHLALSDLNTA
                     RYRYLGHHSQLRVGIDDRQRFKQLRSSLKSLEFTRADIANICQILAAILHIGQLMFRS
                     TGADGMSSAAIEVTNTDVLNCIAGFLGVRPHILESTLSYKTVKIQKDRVTLVLDQLGA
                     RENADELARTLYTLLFSWIMEKINSRISQAESRSGSTAGFENEIESLVDNTITVVDFP
                     GFTISSSVPTLDKLLHNSANEMFYNFMLKSYFEKPLEKFDSEEVAVPAAEYFDNSDTV
                     RMLFRPTMGLLSVIDDYSRREKDDSALMHTLRQRYDKSGIIDTVTARRSFSIRHFAGE
                     VEYEVDNLIGSNTESISGDIISLFTSSSSSDFLKSIFGSSAVVDSTFGTEVVQAHLSS
                     KPLRAPSVVRRNTTSGANTKQDAEKKINRKNKQLNGCGQFISAIDRLLDSFEGANPYF
                     VICLKPNDHRLSNSFDARCVRQQIKAFGLPEIARAVKQTDFRVFLTFNEFITAMSASE
                     GHNSNLLQTADGVTEREKAIEMMHSLSWPERDARYGFTGIFLSEHAWLQIVDPKMSFA
                     QSAAQRYIDSGADLTPAARGYADNDAFYYDPDSKSIAGATIGGDLFKYNDGRSINNQA
                     YIRTKEMGESEQDQTDQYAVTGARKRWMFLVWLWTWWIPDWFIKILGRIPRKDIRTAW
                     REKFAINLMIWAACAFCVVFLIGFPILICPLQNVMSTEELSQYSSKLNPGKTLTQVRG
                     VVFDLTTFAPSHYPQVVSTDDILNYGGRDSSPIFPVPVSGVCRGTNGSISEYVVYGQT
                     SNFSDANAVYHDFRYFTGDYRPDWYLQQMQFLNANFRKAYIGMTPSVLSKTVSQHKNV
                     MASLNGYVYDLSSYTAGEVTTKAPHGKKVPADVDTHFMDSRLVNLFEQYSGTDITKRF
                     NELDMSEETRVEMNRCLRNLFMVGKLDTRDSVRCVFARYFLLAITIFVVLIILVKFLA
                     ALQFGKSHIPDELDKFFICQVPAYTEDEESLRRAIDSLAATQYDDKRKLLIVVCDGMI
                     VGAGNERPTPRIVLDILGCPPDVDPPALSFESLGEGAKQHNMGKVYSGLYEVHGHIVP
                     YLVLVKVGKPTEINRPGNRGKRDSQMVLMRFLNRVHYNLPMSPLELELYHQIQNVIGV
                     NPAYYEYLLQVDADTMVGPTSASQFVSSMVNDRKLQAICGETALSNAKSSIVTMVQVY
                     EYYISHNLAKAFESLFGSVTCLPGCFSMYRIYDNETGKPLFVSHPVVKGYAENRVDTL
                     HMKNLLHLGEDRYLTTLLLKYNPRYKTKFTRHAEAWTVAPDTWSVFLSQRRRWINSTV
                     HNLIELVPMGNMCGFCCFSMRFIVVVDLFSTIIQPVTVAYLAYLVYLLVTKTDGVPIT
                     SIAMLGAIYGLQAFIFLLRRRWEMIGWMLIYILAIPIFSLALPLYAFWHMDDFSWGNT
                     RVVNGEKAGTKVVLSDEGTFDPSEIPLRRWQEYQAEAWQTSEARNAPDAMSIARSQYS
                     ASQYSVPAPPAGGNVSIAPTERSSGGTPAGSAAATPSIRGEEHELHSLPPQLPILPSD
                     GEITNAVREILRTADLMMVTKKSIRLQLEQQFGVKLASRRDYINYVTEAILTGEL"
     gene            complement(<37767..>40277)
                     /gene="RPN1"
                     /locus_tag="AWJ20_14"
                     /db_xref="GeneID:30033197"
     mRNA            complement(<37767..>40277)
                     /gene="RPN1"
                     /locus_tag="AWJ20_14"
                     /product="proteasome regulatory particle base subunit
                     RPN1"
                     /transcript_id="XM_018878275.1"
                     /db_xref="GeneID:30033197"
     CDS             complement(37767..40277)
                     /gene="RPN1"
                     /locus_tag="AWJ20_14"
                     /inference="similar to AA sequence:KEGG_Orthology:K03028"
                     /note="Non-ATPase base subunit of the 19S RP of the 26S
                     proteasome; may participate in the recognition of several
                     ligands of the proteasome; contains a leucine-rich repeat
                     (LRR) domain, a site for protein-protein interactions; RP
                     is the acronym for regulatory particle; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 11914276]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 15210724]; GO_component: GO:0000502 -
                     proteasome complex [Evidence IEA,IEA]; GO_component:
                     GO:0008540 - proteasome regulatory particle, base
                     subcomplex [Evidence IDA] [PMID 9741626]; GO_component:
                     GO:0034515 - proteasome storage granule [Evidence IDA]
                     [PMID 18504300]; GO_function: GO:0004175 - endopeptidase
                     activity [Evidence TAS] [PMID 8982460]; GO_function:
                     GO:0004175 - endopeptidase activity [Evidence TAS] [PMID
                     9697412]; GO_function: GO:0030234 - enzyme regulator
                     activity [Evidence IEA]; GO_function: GO:0030674 - protein
                     binding, bridging [Evidence IPI] [PMID 12198498];
                     GO_function: GO:0030674 - protein binding, bridging
                     [Evidence IPI] [PMID 12200120]; GO_process: GO:0050790 -
                     regulation of catalytic activity [Evidence IEA];
                     GO_process: GO:0042176 - regulation of protein catabolic
                     process [Evidence IEA]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     TAS] [PMID 8982460]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     TAS] [PMID 9697412]"
                     /codon_start=1
                     /product="proteasome regulatory particle base subunit
                     RPN1"
                     /protein_id="XP_018734271.1"
                     /db_xref="GeneID:30033197"
                     /translation="MTAVPKPLKFLRPHYPALSELYDKWPKGELQNQLADVLSVLGMT
                     YSGEGKLESLKYRLLSGIDDVGSWGHEYVRHLALEIGEEFGTRSEKEESTDDLLDLSL
                     KIVPFFLKHNAEADAVDLLLEIEAIDRLTEFVDANTFGRVCLYMVSCVPLLAPPDDLN
                     FLHTAYEIYLRHGQLTQALALAIRIDNEDLIRSVFNATTDELVQQQLAFIVARQQYWF
                     QVDNEEVQKCLSNVSLSEHFLYLGKELNLLDPKTPEDIYKSHLEHSTLGTSTGILDSA
                     KQNLAAAFVNAFVNCGYGADKLLMNDEESNSWIYKTKGPGMASTTASIGSLFQWNFDK
                     GLQQLDKYTYSSEEQIKAGSLLGIGIVNAGVHDESDPAFALLSEYVDNPSVHLRASAI
                     VGLGLSYAGSRREDLAELLLPIVTDSGLTMQLSSLAALSLGHIFVGSANGDISSSILQ
                     TLLERDHIQLSDKWTRFMALGLALLYMGKYEDTEEVLETLKAIDHPISQIIEVLLTIC
                     SYSGTGNVLQIQKLLQDCTTRPEPEKKDSDAAEQPPAEGQTEEQQQQQADKEKEEAEE
                     KAKQESVFQGYSVLGLAVIAMGEEIGQDMVLRHFGHLMHYGDAHIRRAVPLAMGLVSA
                     SNPQMKVFDTLSRYSHDSDLDVAVNSIWAMGLVGAGTNNARLAQLLRQLAMYYSRDPD
                     SLFMVRIAQGLIHLGKGTLTVNPFNTDRQILSRVSLAGLLTVSVALLDPKSFILSSAH
                     SLLYFVTTAVRPRMLITLDEKLEPIKVNVRVGQAVDVVGQAGRPKTITGWVTHSTPVL
                     LGYGERAELEDDEYISLASSLEGVVILKKNHDRMEVDG"
     gene            complement(<40500..>40793)
                     /locus_tag="AWJ20_15"
                     /db_xref="GeneID:30033308"
     mRNA            complement(<40500..>40793)
                     /locus_tag="AWJ20_15"
                     /product="26S proteasome regulatory subunit rpn1"
                     /transcript_id="XM_018878385.1"
                     /db_xref="GeneID:30033308"
     CDS             complement(40500..40793)
                     /locus_tag="AWJ20_15"
                     /note="Fungal Genetics Stock Center 13879"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit rpn1"
                     /protein_id="XP_018734272.1"
                     /db_xref="GeneID:30033308"
                     /translation="MAPSKDTTTPNNNDGSEPTDSTQPQQTAAGSSKDAKDVKDVKGK
                     KKDGKKKKGEEDVEELSEEDQKLKGELEMLVERLKVCFWTGFAMTRDSTHISS"
     gene            complement(<42237..>44834)
                     /gene="DAP2"
                     /locus_tag="AWJ20_16"
                     /db_xref="GeneID:30033419"
     mRNA            complement(<42237..>44834)
                     /gene="DAP2"
                     /locus_tag="AWJ20_16"
                     /product="Dap2p"
                     /transcript_id="XM_018878492.1"
                     /db_xref="GeneID:30033419"
     CDS             complement(42237..44834)
                     /gene="DAP2"
                     /locus_tag="AWJ20_16"
                     /inference="similar to AA sequence:KEGG_Orthology:K01282"
                     /note="Dipeptidyl aminopeptidase; synthesized as a
                     glycosylated precursor; localizes to the vacuolar
                     membrane; similar to Ste13p; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     2647766]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0004177 -
                     aminopeptidase activity [Evidence IEA]; GO_function:
                     GO:0008239 - dipeptidyl-peptidase activity [Evidence IDA]
                     [PMID 2647766]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0008233 -
                     peptidase activity [Evidence IEA]; GO_function: GO:0004252
                     - serine-type endopeptidase activity [Evidence IEA];
                     GO_function: GO:0008236 - serine-type peptidase activity
                     [Evidence IEA,IEA]; GO_process: GO:0016485 - protein
                     processing [Evidence ISS] [PMID 3305478]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Dap2p"
                     /protein_id="XP_018734273.1"
                     /db_xref="GeneID:30033419"
                     /translation="MVARSRDYEPLRVDDQGEIDSPRSSTSSILEKFTGHGRSESDAE
                     RQWRGESEFDYGSEPRPKKVKRSRLIVLAVLSVITLVLFVSTSVSYIKSSPSGSFRQT
                     TFSGTVDIATGKKLLTLEELRTGAYAANHQSISWIEPIPSAKENLGDFVLQKDNKFLL
                     SHWANRSDEKLIVENVVEIEGTPRAINSVTLNRDQTKAILSTDRKKNWRHSSFSLFWV
                     LDLETREITPVNTKDSSRPIALAEWSPRGDRIAFVADNNIFLRYVGGEDDGTVKQITT
                     DGGDEIFYGRPDWVYEEEVFSGSKALWWSLNGEYLAFLRTNDTEVPEFPIPYFVQHGD
                     DGSDPYPELVNLKYPKPGFPNPIVNILFLEISTEEYYAVPVEENPAIDNLITEVLWTD
                     NSKVILRVTSRESDILKISVVDAKTRTGKIVRSSDETGDDGGWFEVSQDTVFIPADPE
                     NGRPEEGYIDTIFVDGYNHLAFFSPVDSSEPKTILTRGEWEVTDVSSVDLKNNKVYFL
                     STKKSAVERQLYSVNLDGTGLTSVSDDSQDGYYRASFSADSRYVLLSYDGPEVPWQKV
                     VDLHSESPLSHAETIESNSGLRDRLKDYALPKINHFQLKVATDEETGADIVANVKEIL
                     PASFNPAKKYPVLFFVYGGPGSQTVTKAFALDFQRILSGLEDIIVVSVDGRGTGFMGR
                     KFRTVVRDKLGHFEPLDQITTAKYYASKPYVDAEHIAIWGWSYGGYMTLKTLETDAGQ
                     TFRYGMSVAPVTNWRFYDSVYTERYMHTPQNNPKGYAEAAIHNVTAIAQNERFLLMHG
                     TGDDNVHVQNSLVLLDLFDQNNVENYDVHVFPDSDHSISFNNANTIIYDKLHHWITSA
                     FQGKFKTIL"
     gene            complement(<45313..>46773)
                     /gene="SLT2"
                     /locus_tag="AWJ20_17"
                     /db_xref="GeneID:30033530"
     mRNA            complement(<45313..>46773)
                     /gene="SLT2"
                     /locus_tag="AWJ20_17"
                     /product="mitogen-activated serine/threonine-protein
                     kinase SLT2"
                     /transcript_id="XM_018878598.1"
                     /db_xref="GeneID:30033530"
     CDS             complement(45313..46773)
                     /gene="SLT2"
                     /locus_tag="AWJ20_17"
                     /inference="similar to AA sequence:KEGG_Orthology:K04464"
                     /note="Serine/threonine MAP kinase; involved in regulating
                     maintenance of cell wall integrity, cell cycle
                     progression, and nuclear mRNA retention in heat shock;
                     required for mitophagy and pexophagy; affects recruitment
                     of mitochondria to phagophore assembly site (PAS); plays a
                     role in adaptive response of cells to cold; regulated by
                     the PKC1-mediated signaling pathway; SLT2 has a paralog,
                     KDX1, that arose from the whole genome duplication;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 12361575]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 23924898]; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     12361575]; GO_component: GO:0005934 - cellular bud tip
                     [Evidence IDA] [PMID 23924898]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0043332 - mating projection tip [Evidence IDA] [PMID
                     12361575]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 12361575]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 23924898]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0004707 -
                     MAP kinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004707 - MAP kinase activity [Evidence ISS] [PMID
                     8386319]; GO_function: GO:0016301 - kinase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0004672 - protein
                     kinase activity [Evidence IEA]; GO_function: GO:0004672 -
                     protein kinase activity [Evidence IDA] [PMID 16319894];
                     GO_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004674 -
                     protein serine/threonine kinase activity [Evidence IDA]
                     [PMID 20823268]; GO_function: GO:0004674 - protein
                     serine/threonine kinase activity [Evidence IDA] [PMID
                     24554767]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016772 - transferase
                     activity, transferring phosphorus-containing groups
                     [Evidence IEA]; GO_process: GO:0000165 - MAPK cascade
                     [Evidence IEA,IEA]; GO_process: GO:0030969 - UFP-specific
                     transcription factor mRNA processing involved in
                     endoplasmic reticulum unfolded protein response [Evidence
                     IMP] [PMID 18971375]; GO_process: GO:0000917 - barrier
                     septum assembly [Evidence IGI] [PMID 19633265];
                     GO_process: GO:0030968 - endoplasmic reticulum unfolded
                     protein response [Evidence IDA,IMP] [PMID 16380504];
                     GO_process: GO:0009272 - fungal-type cell wall biogenesis
                     [Evidence IGI] [PMID 16524906]; GO_process: GO:0030242 -
                     peroxisome degradation [Evidence IMP] [PMID 20385774];
                     GO_process: GO:0016310 - phosphorylation [Evidence IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]; GO_process: GO:0006468 - protein phosphorylation
                     [Evidence IMP] [PMID 14703512]; GO_process: GO:0006468 -
                     protein phosphorylation [Evidence IDA] [PMID 16319894];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IMP] [PMID 20219973]; GO_process: GO:0008361 - regulation
                     of cell size [Evidence IMP] [PMID 17302939]; GO_process:
                     GO:0060237 - regulation of fungal-type cell wall
                     organization [Evidence IGI,IMP] [PMID 8386319];
                     GO_process: GO:0042990 - regulation of transcription
                     factor import into nucleus [Evidence IMP] [PMID 20219973];
                     GO_process: GO:0001101 - response to acid [Evidence IMP]
                     [PMID 16087742]; GO_process: GO:0007165 - signal
                     transduction [Evidence IMP] [PMID 8386319]"
                     /codon_start=1
                     /product="mitogen-activated serine/threonine-protein
                     kinase SLT2"
                     /protein_id="XP_018734274.1"
                     /db_xref="GeneID:30033530"
                     /translation="MIKAERHVYKVFNQDFTIDKRFHITKELGHGAYGIVCAARCPGS
                     PEIPGIAIKKVTNIFSKKILCKRALRELRLLNHFRGHKNITCLYDMDIVDTNNFNELY
                     LYEELMECDMHQIIRSQQPLTDAHYQSFIYQILVGLKYIHSANVLHRDLKPGNLLVNA
                     DCELKICDFGLARGFSSDPERNAGFLTEYVATRWYRAPEIMLSFQSYTKAIDIWSVGC
                     ILAELLGGKPFFKGKDYVDQLNQILHYLGTPSEETLQRIGSPRAQEYVRSLPYMPRIP
                     FESLFPNANPEALDLLNKMLAFDPADRITVEEALEHPYLRIWHDPADEPVCPSEFDFS
                     FEAVDDMDQMRQMILDEVMKFREMVRQPIPNQRQQEEAEAQAHAHAQAQAQAQAQAQA
                     QAEAQAQAQAQAQAQAQAQAQQYADSSLAVEYTSPISMDQQHSLNAAFSRTDQLGIPS
                     EEFRYQDQPPKPQENVGAPASAFDLERELEFGLDAR"
     gene            <49037..>49366
                     /gene="RPB8"
                     /locus_tag="AWJ20_18"
                     /db_xref="GeneID:30033641"
     mRNA            <49037..>49366
                     /gene="RPB8"
                     /locus_tag="AWJ20_18"
                     /product="DNA-directed RNA polymerase core subunit RPB8"
                     /transcript_id="XM_018878706.1"
                     /db_xref="GeneID:30033641"
     CDS             49037..49366
                     /gene="RPB8"
                     /locus_tag="AWJ20_18"
                     /inference="similar to AA sequence:KEGG_Orthology:K03016"
                     /note="RNA polymerase subunit ABC14.5; common to RNA
                     polymerases I, II, and III; GO_component: GO:0005736 -
                     DNA-directed RNA polymerase I complex [Evidence IDA] [PMID
                     11486042]; GO_component: GO:0005736 - DNA-directed RNA
                     polymerase I complex [Evidence IDA] [PMID 9837969];
                     GO_component: GO:0005665 - DNA-directed RNA polymerase II,
                     core complex [Evidence IDA] [PMID 1331084]; GO_component:
                     GO:0005665 - DNA-directed RNA polymerase II, core complex
                     [Evidence IDA] [PMID 2183013]; GO_component: GO:0005665 -
                     DNA-directed RNA polymerase II, core complex [Evidence
                     IDA] [PMID 2186966]; GO_component: GO:0005666 -
                     DNA-directed RNA polymerase III complex [Evidence IDA]
                     [PMID 10611227]; GO_component: GO:0005666 - DNA-directed
                     RNA polymerase III complex [Evidence IDA] [PMID 3905793];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003899 - DNA-directed RNA polymerase
                     activity [Evidence IEA]; GO_function: GO:0001054 - RNA
                     polymerase I activity [Evidence IDA] [PMID 9837969];
                     GO_function: GO:0001055 - RNA polymerase II activity
                     [Evidence IDA] [PMID 8288647]; GO_function: GO:0001056 -
                     RNA polymerase III activity [Evidence IDA] [PMID 3905793];
                     GO_function: GO:0003968 - RNA-directed RNA polymerase
                     activity [Evidence IDA] [PMID 18004386]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA];
                     GO_process: GO:0042797 - tRNA transcription from RNA
                     polymerase III promoter [Evidence IDA] [PMID 3905793];
                     GO_process: GO:0006360 - transcription from RNA polymerase
                     I promoter [Evidence IPI] [PMID 11486042]; GO_process:
                     GO:0006360 - transcription from RNA polymerase I promoter
                     [Evidence IDA] [PMID 9837969]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IPI] [PMID 11486042]; GO_process: GO:0006383 -
                     transcription from RNA polymerase III promoter [Evidence
                     IPI] [PMID 11486042]; GO_process: GO:0006383 -
                     transcription from RNA polymerase III promoter [Evidence
                     IGI] [PMID 9927738]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase core subunit RPB8"
                     /protein_id="XP_018734275.1"
                     /db_xref="GeneID:30033641"
                     /translation="MSATLFDDIFKVTSVDSSRYDRVSRITGQSSTSADIHLTLDVNT
                     ELFPVTKGTTLTVAVAQTISLDGEPSISSAGWREPKAGEKSLADDYDYVMYGTVYKFE
                     ESSADKM"
     gene            complement(<51420..>51490)
                     /locus_tag="AWJ20_19"
                     /db_xref="GeneID:30033752"
     tRNA            complement(<51420..>51490)
                     /locus_tag="AWJ20_19"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:30033752"
     gene            <52538..>53896
                     /gene="YPS3"
                     /locus_tag="AWJ20_20"
                     /db_xref="GeneID:30033863"
     mRNA            <52538..>53896
                     /gene="YPS3"
                     /locus_tag="AWJ20_20"
                     /product="Yps3p"
                     /transcript_id="XM_018878923.1"
                     /db_xref="GeneID:30033863"
     CDS             52538..53896
                     /gene="YPS3"
                     /locus_tag="AWJ20_20"
                     /note="Aspartic protease; member of the yapsin family of
                     proteases involved in cell wall growth and maintenance;
                     attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor; GO_component:
                     GO:0031225 - anchored component of membrane [Evidence
                     IEA]; GO_component: GO:0046658 - anchored component of
                     plasma membrane [Evidence IDA,IPI] [PMID 11016834];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_function: GO:0004190 - aspartic-type
                     endopeptidase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004190 - aspartic-type endopeptidase activity
                     [Evidence IDA,ISS] [PMID 10191273]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_process: GO:0031505 - fungal-type cell wall
                     organization [Evidence IGI] [PMID 16087741]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Yps3p"
                     /protein_id="XP_018734276.1"
                     /db_xref="GeneID:30033863"
                     /translation="MIGNNALLFVSALACTGAFALSDNTTSQVPKKTGSGYVLTDIVG
                     KRADAHPNPRIYQYPQFLPDVVDTLLGDNILGNILLKERSDPAPVPVSNKFSYYEIDI
                     EVGTPGQQLSLILDTGSSDLWGVSTSDIRCSNNGQGSLDCSQNTFNQEKSSTWQVNSS
                     APNFGIQYVDGSGAKGVWGNDVVSFGDVSLDSCSFGLATDSNSSTGIMGIAFPGQEST
                     PYPYPNVPQLLKDQGYIETVAYSLWLNDVQASTGNILFGAVDHGKYDGPLYTIPIINT
                     GSGSEPWDMAVTFSNITVCLGGVFSTIEFTEGTVILDSGTTFSYLPSNMVQPILKGLN
                     AQYNSDISGYTVPCDVDDGGFIEFNLDGAIVVVLIQEFLLHLKTASGDIAYQNGKPLC
                     QVGLVEQDDANSIHILGDTFLRSAYVVYDLQNYEISMANSALNSSFSDIEVIGSGGVR
                     AL"
     gene            complement(<54211..>54303)
                     /locus_tag="AWJ20_21"
                     /db_xref="GeneID:30033973"
     tRNA            complement(<54211..>54303)
                     /locus_tag="AWJ20_21"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:30033973"
     gene            <55160..>56650
                     /gene="TPO3"
                     /locus_tag="AWJ20_22"
                     /db_xref="GeneID:30034084"
     mRNA            <55160..>56650
                     /gene="TPO3"
                     /locus_tag="AWJ20_22"
                     /product="Tpo3p"
                     /transcript_id="XM_018879127.1"
                     /db_xref="GeneID:30034084"
     CDS             55160..56650
                     /gene="TPO3"
                     /locus_tag="AWJ20_22"
                     /note="Polyamine transporter of the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; specific for spermine; localizes to the
                     plasma membrane; TPO3 has a paralog, TPO2, that arose from
                     the whole genome duplication; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IMP] [PMID
                     11171066]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 12562762]; GO_function: GO:0015297 -
                     antiporter activity [Evidence IEA]; GO_function:
                     GO:0000297 - spermine transmembrane transporter activity
                     [Evidence IMP] [PMID 11171066]; GO_process: GO:0000296 -
                     spermine transport [Evidence IMP] [PMID 11171066];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tpo3p"
                     /protein_id="XP_018734277.1"
                     /db_xref="GeneID:30034084"
                     /translation="MNIPTAEKLSDLEKGPEPHPVSSLQDSTGTGTGPSPIIHVKAFE
                     EGDPENPHNFPLSRKLYHTIVLVLFCFTCSMSSAMYTPALGDIEEKYNVTREVALMST
                     GVLLMGFIIGPIIWSAVNEAFGRWYSWTIGFFLFQLFQIPTGVDPNFRTLLVGRFFQG
                     LFGVSTLVTFGASMSDIWGYKTRGFSAAIAVFSIFAAPALGPFIGSLLVEFAGFGYIS
                     WLVMMLGAILLVLNMFVKETAAPVIFHRKAIRMRKEGLNARAPIEEVPPTLMNLATKY
                     CIRPFIMLVEDKALAFLCVYAGISYGLLYTILIALPVTFAEYRHFSFIPTYLPSIAVL
                     VGVVITSLHLCVTNGAYIRAAEKAGVLMLPDQRLKPMMCGAIFLPIGLFIFGWTAPFT
                     NVHWMGPIVGAAIVGYATSIIFIAAIMYMIESYGHFASSAFAANAIIRSMVAVLFLLV
                     FSRMVEAMTLQGAFSFFGGISILIAPGPFILFKYGKVWRSLSKWTP"
     gene            <57051..>57665
                     /gene="MRPL25"
                     /locus_tag="AWJ20_23"
                     /db_xref="GeneID:30034195"
     mRNA            <57051..>57665
                     /gene="MRPL25"
                     /locus_tag="AWJ20_23"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_018879237.1"
                     /db_xref="GeneID:30034195"
     CDS             57051..57665
                     /gene="MRPL25"
                     /locus_tag="AWJ20_23"
                     /inference="similar to AA sequence:KEGG_Orthology:K17438"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; mutation confers increased replicative lifespan;
                     GO_component: GO:0005762 - mitochondrial large ribosomal
                     subunit [Evidence IPI] [PMID 12392552]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IPI] [PMID 12392552]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 12392552]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_018734278.1"
                     /db_xref="GeneID:30034195"
                     /translation="MRATQLLARSERLLASEVLANARQLKLAQETNVEAPQKGDAVTS
                     TESASRDPFYAQLPSPLRKFFEKYPPSPFRKYSDKPTSTHAEDANPFLPNKHPITNSW
                     HDPKYSLRRQADLYKMAYRFGVTHLLPKLGNGKTFYEEKYLTKTPPAGAMAFKLSKGE
                     RIAPIRQKEVDTAIAKADETIAKARGTKFLRKIEKKNNQGKRFV"
     gene            complement(<57742..>59451)
                     /gene="PCS60"
                     /locus_tag="AWJ20_24"
                     /db_xref="GeneID:30034306"
     mRNA            complement(<57742..>59451)
                     /gene="PCS60"
                     /locus_tag="AWJ20_24"
                     /product="Pcs60p"
                     /transcript_id="XM_018879343.1"
                     /db_xref="GeneID:30034306"
     CDS             complement(57742..59451)
                     /gene="PCS60"
                     /locus_tag="AWJ20_24"
                     /note="Oxalyl-CoA synthetase; capable of catalyzing
                     conversion of oxalate to oxalyl-CoA; catalyzes first step
                     in pathway of oxalate degradation that functions to
                     protect yeast from inhibitory effects of oxalate;
                     peroxisomal protein that binds mRNA; localizes to both
                     peroxisomal peripheral membrane and matrix, expression is
                     highly inducible by oleic acid; similar to E. coli long
                     chain acyl-CoA synthetase; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005782 - peroxisomal
                     matrix [Evidence IEA]; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 8841414];
                     GO_component: GO:0005778 - peroxisomal membrane [Evidence
                     IEA]; GO_component: GO:0005778 - peroxisomal membrane
                     [Evidence IDA] [PMID 8841414]; GO_component: GO:0005777 -
                     peroxisome [Evidence IEA]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0016874
                     - ligase activity [Evidence IEA]; GO_function: GO:0003729
                     - mRNA binding [Evidence IDA] [PMID 20844764];
                     GO_function: GO:0050203 - oxalate-CoA ligase activity
                     [Evidence IDA,IMP] [PMID 24291261]; GO_process: GO:0008152
                     - metabolic process [Evidence IEA]; GO_process: GO:0033611
                     - oxalate catabolic process [Evidence IDA,IMP] [PMID
                     24291261]"
                     /codon_start=1
                     /product="Pcs60p"
                     /protein_id="XP_018734279.1"
                     /db_xref="GeneID:30034306"
                     /translation="MILLRFPTFIRAGPSTQAFKLRYKRKFSMTRQFSILADHPIVGK
                     LKNHPRDKVAIRHVISGNSYTYGQLSDDIYKWHNILQSKLPSSGNGSRIAIMGENSYQ
                     FAVLFFATLMLPKTLAMPLCTNHTSAEIKYQLENSESSTIITPERFVDKVEEFVSPER
                     KLIVFEEFDGNDVEASTSTSESTVSSPSTSDSSTPSGYMLYTSGTSGNPKGVVTPLET
                     YVAQADALTKAWDINSNTAMLQTLPLHHVHGLVIGMTLPLLAGGSVDFLFPFSPKVFV
                     DRITDASLPPINTYTAVPTIYTKLVSYVKQFQSDKEQFEKINSGLHNLHLAMCGSAAL
                     PSPLRNDWNKIVGDKVPLLERYGMTETSITLSQPLDPQYRVDGSVGAPVPSVIARLVD
                     PDTSKVIYQSNEKSSHDTEASGELQLAGPVVFKEYWNKPEATSETFTEDGWFRTGDIC
                     RADASGNIFILGRASMDIIKSGGEKLSALEIEREILSLEEVDECSVVGVASEEWGQEV
                     AVVAVLSEKGRASNFDLARLKSALKKTLANYKIPKKLLVVESIPRNQMGKVNKKTLVK
                     IFD"
     gene            complement(<60984..>61322)
                     /gene="SMD1"
                     /locus_tag="AWJ20_25"
                     /db_xref="GeneID:30034417"
     mRNA            complement(<60984..>61322)
                     /gene="SMD1"
                     /locus_tag="AWJ20_25"
                     /product="Smd1p"
                     /transcript_id="XM_018879447.1"
                     /db_xref="GeneID:30034417"
     CDS             complement(60984..61322)
                     /gene="SMD1"
                     /locus_tag="AWJ20_25"
                     /inference="similar to AA sequence:KEGG_Orthology:K11087"
                     /note="Core Sm protein Sm D1; part of heteroheptameric
                     complex (with Smb1p, Smd2p, Smd3p, Sme1p, Smx3p, and
                     Smx2p) that is part of the spliceosomal U1, U2, U4, and U5
                     snRNPs; relocalizes to the cytosol in response to hypoxia;
                     homolog of human Sm D1; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0005685 - U1 snRNP [Evidence IDA] [PMID 9012791];
                     GO_component: GO:0005685 - U1 snRNP [Evidence IDA] [PMID
                     9630245]; GO_component: GO:0071004 - U2-type
                     prespliceosome [Evidence IDA] [PMID 16618970];
                     GO_component: GO:0046540 - U4/U6 x U5 tri-snRNP complex
                     [Evidence IDA] [PMID 10377396]; GO_component: GO:0046540 -
                     U4/U6 x U5 tri-snRNP complex [Evidence IDA] [PMID
                     10449419]; GO_component: GO:0005682 - U5 snRNP [Evidence
                     IDA] [PMID 11720284]; GO_component: GO:0005682 - U5 snRNP
                     [Evidence IDA] [PMID 11720285]; GO_component: GO:0000243 -
                     commitment complex [Evidence IPI] [PMID 10072386];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     22932476]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 22932476]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0003729 - mRNA binding [Evidence IPI] [PMID 10072386];
                     GO_process: GO:0008380 - RNA splicing [Evidence IEA];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IPI] [PMID 10072386]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IPI] [PMID
                     10377396]; GO_process: GO:0000398 - mRNA splicing, via
                     spliceosome [Evidence IMP] [PMID 8430095]"
                     /codon_start=1
                     /product="Smd1p"
                     /protein_id="XP_018734280.1"
                     /db_xref="GeneID:30034417"
                     /translation="MKLTSESVQIELKNGTVVSGTIVSVSPNMNTTLRGVKMTIKDRD
                     PVALDYINLRGNTIRFYILPESLPLDTLLIDDTPKPKQRSKPEITRGRGRGRGGRGGG
                     RGRGRPGRGF"
     gene            <65268..>66761
                     /gene="MET7"
                     /locus_tag="AWJ20_26"
                     /db_xref="GeneID:30034528"
     mRNA            <65268..>66761
                     /gene="MET7"
                     /locus_tag="AWJ20_26"
                     /product="tetrahydrofolate synthase"
                     /transcript_id="XM_018879551.1"
                     /db_xref="GeneID:30034528"
     CDS             65268..66761
                     /gene="MET7"
                     /locus_tag="AWJ20_26"
                     /inference="similar to AA sequence:KEGG_Orthology:K01930"
                     /note="Folylpolyglutamate synthetase; catalyzes extension
                     of the glutamate chains of the folate coenzymes, required
                     for methionine synthesis and for maintenance of
                     mitochondrial DNA; protein abundance increases in response
                     to DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 10775416]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 10775416]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0016874 - ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004326 -
                     tetrahydrofolylpolyglutamate synthase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004326 -
                     tetrahydrofolylpolyglutamate synthase activity [Evidence
                     IDA] [PMID 10775416]; GO_process: GO:0009058 -
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0009396 - folic acid-containing compound biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006730 -
                     one-carbon metabolic process [Evidence IEA]; GO_process:
                     GO:0006730 - one-carbon metabolic process [Evidence IMP]
                     [PMID 10775416]; GO_process: GO:0046901 -
                     tetrahydrofolylpolyglutamate biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="tetrahydrofolate synthase"
                     /protein_id="XP_018734281.1"
                     /db_xref="GeneID:30034528"
                     /translation="MTSRTYADAIEALNSLQTNFSIIDAIRKSGGKSNKDAIPQMLEW
                     ARRSGYPDPKAFDKLNIIHVTGTKGKGSTCAFVQSILNQYRVESPSIGEHGISKIGLY
                     TSPHLKSVRERIRINGEPIAEEKFVKYFFELWDQLESTSSNEADFPDMIAGVKPVYFR
                     YLTLLSFHIFLHEGVDTAIYEVGIGGEYDSTNIIVSPTATGVSSLGLDHTNILGNTIE
                     EIAWNKSGIFKKGTPALTIPQPEGGDAMKVLKERALEKAGRELTVVPVHPLIANGTAK
                     LGLAGEFQKTNASLAVGLVTEHLRKLNIDSDNLATANSLPPKFLAGLEAASWPGRCQT
                     LKQGTITYSIDGAHTQESITEAGKWYVSRVKDENQSNPPAHRVLLFNQQNRDANALVT
                     TLHTVLSKDNVKFDHVIFTTNVTRKTGYSADLTSLNTSKEAVDELVVQNALSSAWEKI
                     DTTAQRHVFSNIEESVNFIKSLGGETSVLVTGSLILVGGFLAVVEDN"
     gene            complement(<66962..>68458)
                     /gene="TDP1"
                     /locus_tag="AWJ20_27"
                     /db_xref="GeneID:30034639"
     mRNA            complement(<66962..>68458)
                     /gene="TDP1"
                     /locus_tag="AWJ20_27"
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /transcript_id="XM_018879661.1"
                     /db_xref="GeneID:30034639"
     CDS             complement(66962..68458)
                     /gene="TDP1"
                     /locus_tag="AWJ20_27"
                     /inference="similar to AA sequence:KEGG_Orthology:K10862"
                     /note="Tyrosyl-DNA phosphodiesterase I; hydrolyzes 3' and
                     5'-phosphotyrosyl bonds; involved in the repair of DNA
                     lesions created by topoisomerase I and topoisomerase II;
                     mutations in human homolog result in the neurodegenerative
                     disease SCANI; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 12206772]; GO_function: GO:0017005 -
                     3'-tyrosyl-DNA phosphodiesterase activity [Evidence IDA]
                     [PMID 10521354]; GO_function: GO:0070260 - 5'-tyrosyl-DNA
                     phosphodiesterase activity [Evidence IDA] [PMID 16751265];
                     GO_function: GO:0004527 - exonuclease activity [Evidence
                     IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0004518 - nuclease
                     activity [Evidence IEA]; GO_function: GO:0008081 -
                     phosphoric diester hydrolase activity [Evidence IEA];
                     GO_process: GO:0006281 - DNA repair [Evidence IEA,IEA];
                     GO_process: GO:0006281 - DNA repair [Evidence IMP] [PMID
                     10521354]; GO_process: GO:0006281 - DNA repair [Evidence
                     IMP] [PMID 15135727]; GO_process: GO:0006974 - cellular
                     response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0090305 - nucleic acid phosphodiester bond
                     hydrolysis [Evidence IEA]"
                     /codon_start=1
                     /product="tyrosyl-DNA phosphodiesterase 1"
                     /protein_id="XP_018734282.1"
                     /db_xref="GeneID:30034639"
                     /translation="MKRSQESSGDETRQTQKTKTENKAEVRSSPIYLTTIEDLPSEEN
                     VDTVGLRDLIGLEDMVSMFQFNFMFTLPFILEKLHPRARSVVNSYFIYGRKPIGDDHT
                     GDMLRAEREAFGSKQNITIDGETLMNAYATHHTKMMVLFFKTKDGEEEAQVVIHTANL
                     IEFDWSNMTQGVWKSPRLKLKSRGESTNSDSSSVGIKFGNDFLKYLRKYRNKSAKLAA
                     EMISKYDFSPVEAIFVASAPGNYNTNDPEYGQWGIVKLQKEIAKFSKSSENGTESRTG
                     YVVAQVSSIATLGATDSYLGPIVTNALNGRPFFDKVTEKTSPLKLIFPSVEDVADSLE
                     GYVSGSSIHFKRQSAPQLKQLEYMKLLLHRWHALKAGRQRCAPHIKTYTKVINNGQEL
                     EWLLLTSANLSKHAWGTVNKTKANHWIQSWECGVLIHANAFRGKNNSLVPVYKSNNSN
                     VEGQKDKNTICVRMPYDLPLQKYTPRDVIWSANENYTEPDWRGNKWIL"
     gene            <71937..>74573
                     /gene="BOI1"
                     /locus_tag="AWJ20_28"
                     /db_xref="GeneID:30034750"
     mRNA            <71937..>74573
                     /gene="BOI1"
                     /locus_tag="AWJ20_28"
                     /product="Boi1p"
                     /transcript_id="XM_018879768.1"
                     /db_xref="GeneID:30034750"
     CDS             71937..74573
                     /gene="BOI1"
                     /locus_tag="AWJ20_28"
                     /note="Protein implicated in polar growth; functionally
                     redundant with Boi2p; interacts with bud-emergence protein
                     Bem1p; contains an SH3 (src homology 3) domain and a PH
                     (pleckstrin homology) domain; relocalizes from bud neck to
                     cytoplasm upon DNA replication stress; BOI1 has a paralog,
                     BOI2, that arose from the whole genome duplication;
                     GO_component: GO:0005933 - cellular bud [Evidence IDA]
                     [PMID 12097146]; GO_component: GO:0005935 - cellular bud
                     neck [Evidence IDA] [PMID 12097146]; GO_component:
                     GO:0005935 - cellular bud neck [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 22842922]; GO_component: GO:0030427 - site of
                     polarized growth [Evidence IDA] [PMID 12097146];
                     GO_function: GO:0005543 - phospholipid binding [Evidence
                     IDA] [PMID 12097146]; GO_process: GO:0007118 - budding
                     cell apical bud growth [Evidence IGI] [PMID 17417630];
                     GO_process: GO:0007109 - cytokinesis, completion of
                     separation [Evidence IGI] [PMID 16615892]"
                     /codon_start=1
                     /product="Boi1p"
                     /protein_id="XP_018734283.1"
                     /db_xref="GeneID:30034750"
                     /translation="MTGLFPKVFTTELIVTNEPSGGNRTSEIRHKVLSGSSVSGGSSG
                     VGSTAGPSVHDTISDIDEAISEFQNRGIGGVTAGISPAMSSPGQGSGPRSPLVHNSHA
                     NGEFNGNGSNSHMSNGGPNHQQYADNNAIGSNDGGLPSLNDIPNWTSYDISQYFAYRG
                     YEPDVCEQFIRHKITGSILLELDLAYLKEIDIASFGTRFEISKDIKHLNSLVSAQMTG
                     EGASIAAATAAIKRKSKAKSTHSRDRTASSSKGLMLPPQTSPKKNPINDRTSPPVNPR
                     TSSLRSSISTTNETTFSAIGSPYHAKNRSNDSDVVRHPSFNPNWTHPIKTSADLDSPQ
                     TPEIVNDNSAHFTSNIGLLSPNSLNEYNETVPVPRSPQSQVPAGRRRSYTIDALTSRF
                     DSSPLQPATAPTNTQQHIRNPSGDTLRDKAKENFYQRGHARSTSSLGLQARNDDITKS
                     ANEARKSHRRHSSIMSFMTTTQNLASTLTSPTESQVEQSNDLNAYSSSSREDIGMESE
                     SGASSVGISSSASGNNSTSSTAKKYLDLLPGRGNNNNNNSSANNNSATKRIGTDPIQS
                     VTEAPPPSPKRSATFTKPKLRSTPSQPNLKKISKQQTSAFMEGIRQITADEAAKTASV
                     SGWLHKRGGVGVGTWKSRYFTLHGTRLSYFTSQKDTKERGLIDITAHRVLPARESEDK
                     LISIYAASVGAGRHCFKLVPPAPGFKKGVTFTAPKVHYFAVDTKEEMRMWMASLMKAT
                     IDRDDSVPVISSCATPTVPLPRAQELFAEARARDEDLRARMIAGGLASNPSSNAISNK
                     ARANNSSSTNETYPTTPDSPTGSSLQSSRTVSSTNSSSLKVSSPSSFSPVAAFGEYQP
                     SDIRHLTTKTAGLQIVTNLEDS"
     gene            complement(<74755..>77142)
                     /gene="CDC27"
                     /locus_tag="AWJ20_29"
                     /db_xref="GeneID:30034861"
     mRNA            complement(<74755..>77142)
                     /gene="CDC27"
                     /locus_tag="AWJ20_29"
                     /product="anaphase promoting complex subunit CDC27"
                     /transcript_id="XM_018879875.1"
                     /db_xref="GeneID:30034861"
     CDS             complement(74755..77142)
                     /gene="CDC27"
                     /locus_tag="AWJ20_29"
                     /inference="similar to AA sequence:KEGG_Orthology:K03350"
                     /note="Subunit of the Anaphase-Promoting Complex/Cyclosome
                     (APC/C); APC/C is a ubiquitin-protein ligase required for
                     degradation of anaphase inhibitors, including mitotic
                     cyclins, during the metaphase/anaphase transition;
                     GO_component: GO:0005680 - anaphase-promoting complex
                     [Evidence IDA] [PMID 9469814]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence IMP]
                     [PMID 16481473]; GO_process: GO:0031145 -
                     anaphase-promoting complex-dependent proteasomal
                     ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 16481473]; GO_process: GO:0031145 -
                     anaphase-promoting complex-dependent proteasomal
                     ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 8895471]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0051301 - cell division
                     [Evidence IEA]; GO_process: GO:0007067 - mitotic nuclear
                     division [Evidence IEA]; GO_process: GO:0016567 - protein
                     ubiquitination [Evidence IEA]; GO_process: GO:0016567 -
                     protein ubiquitination [Evidence IDA,IMP] [PMID 16481473]"
                     /codon_start=1
                     /product="anaphase promoting complex subunit CDC27"
                     /protein_id="XP_018734284.1"
                     /db_xref="GeneID:30034861"
                     /translation="MNGSMNSFHTTNNGSADNGRGPRPTSSTADRDGYIERLLTHYVW
                     EALDLDMLDSAEFTMEKLLALDPENGSYKHLMALILYRQGRYKAAANIANTSSNHTGC
                     VYIYSRCCLKLKMYGKGIEALEKTKHNWASVAKNYTDNATNERRVIPDQAALNALLGK
                     LYQLQGDKVDALKAYGSSVRANPFLWEPVEALCKLGIKLRVSNAFRVEHLNDALMSSS
                     SAGSGGVNTTGNDNANLNNGNISNGLSNPANTSINDPFTTPVGNGNQGTSSIPANPFK
                     FGQQFLKNSMLNKANEETMSAPVTSKQPAANAPATTSDSSYSTPSDTRTSRPNGLPLA
                     PQKRSSRNVTAGALANSNPEAKTGLPFPRRSARMAQTAQPSTINTTVTTNQKRNLMTP
                     LSRAGPQGSTTASSTSITSNAASTSNLSTTSVVPGAHHATRALAQPQVASTTVAAALK
                     RSRLKPDRESLAKRDAQLYIISLYRQITSAFILCSRYECRQAIALFDQLPEQQKNTPW
                     VLAKLGRCYFEMVDYKEAEKVFIKLRKVDRCRIQDMEYYSTLLWHLRKEVELSLLAHE
                     LMEIERNSPQAWCTLGNSFSLKRETSQAQKCFKRAINIDPDSPYAYTLLAHEQVATEA
                     YESAQDSFRLAIKADNRHYNAWYGLGMVFMRLDNFDLAELHFSKAAMINPSNVVLICC
                     IGMVLEKKGRFAEALEQYKRACEIQSNSALARYKKARVLIQLQLYNAALVEFEHLQKL
                     APDEASVHFLLGQLYKLLDNRDLAIKHFTIALNLDPKGSGLIKDAIEGLNVFNTS"
     gene            <78732..>80636
                     /gene="TMN3"
                     /locus_tag="AWJ20_30"
                     /db_xref="GeneID:30034973"
     mRNA            <78732..>80636
                     /gene="TMN3"
                     /locus_tag="AWJ20_30"
                     /product="Tmn3p"
                     /transcript_id="XM_018879986.1"
                     /db_xref="GeneID:30034973"
     CDS             78732..80636
                     /gene="TMN3"
                     /locus_tag="AWJ20_30"
                     /inference="similar to AA sequence:KEGG_Orthology:K17086"
                     /note="Protein with a role in cellular adhesion and
                     filamentous growth; similar to Emp70p and Tmn2p; member of
                     Transmembrane Nine family with 9 transmembrane segments;
                     localizes to Golgi; induced by 8-methoxypsoralen plus UVA
                     irradiation; GO_component: GO:0030137 - COPI-coated
                     vesicle [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006878 -
                     cellular copper ion homeostasis [Evidence IGI] [PMID
                     20681974]; GO_process: GO:0001403 - invasive growth in
                     response to glucose limitation [Evidence IMP] [PMID
                     18178563]; GO_process: GO:0007124 - pseudohyphal growth
                     [Evidence IGI] [PMID 18178563]; GO_process: GO:0007034 -
                     vacuolar transport [Evidence IGI] [PMID 20526336]"
                     /codon_start=1
                     /product="Tmn3p"
                     /protein_id="XP_018734285.1"
                     /db_xref="GeneID:30034973"
                     /translation="MVMVCEGFYIPGWSIKSYKDGEKVPLFVNKVTSDTTQLPYAYYD
                     LPFVCKPSKDAERVPLNLGEVLLGDRIWGSDYQIHQGKQVDCAELCTAKVDKAALERA
                     HELVSSNYLVEWIVDNLPGATAFISVDRSKRYYASGFPLGVVDETTGKTYLNNHVSII
                     LRYRESSRDKGRNVIVGFEVYPKSVSTDSKKCPGNNDKFQPYLIDPEKENDEIRFTYT
                     VLWREDKTVEWADRWSLYFSYLTHSSKAPKVNSLHWLAIVNSLVIASLLTILVGVVLV
                     RTLSRDIQSYKKISSKQGDDDLVGELDKDMLEEESGWKLVYADVFRPPVLSSVLSSLI
                     GSGIQIFVMALATIGFACFGVLNPSYRGGLLSYALFIFAFAGGFAGFVTARINKYMGN
                     EYHWSRSVWLTAVLAPASVLIIVLTLNLFVWSSASSSALPFGTIVALFSIWLLISCPL
                     VVVGAIIGNKRQASPPPTRISAIPRQIPNNAGYNLVRSTPFAVLAGGLLPFAVIFVEL
                     VTIFQSLWLEKSGYYYMYGFFGVVFIVLVLTVVEMSILTTYILLNSEDYRWWWRSFLV
                     GTGSAWWVFLYSIYYYFTKLNVDGFISALLFFGYTLLGCLAYGLVTGAIGFLSSYVFV
                     FRIYNAIKAD"
     gene            <81188..>81269
                     /locus_tag="AWJ20_31"
                     /db_xref="GeneID:30035084"
     tRNA            <81188..>81269
                     /locus_tag="AWJ20_31"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30035084"
     gene            complement(<87056..>87262)
                     /gene="FDH1"
                     /locus_tag="AWJ20_32"
                     /db_xref="GeneID:30035195"
     mRNA            complement(<87056..>87262)
                     /gene="FDH1"
                     /locus_tag="AWJ20_32"
                     /product="formate dehydrogenase (NAD+)"
                     /transcript_id="XM_018880206.1"
                     /db_xref="GeneID:30035195"
     CDS             complement(87056..87262)
                     /gene="FDH1"
                     /locus_tag="AWJ20_32"
                     /inference="similar to AA sequence:KEGG_Orthology:K00122"
                     /note="NAD(+)-dependent formate dehydrogenase; may protect
                     cells from exogenous formate; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 11921099]; GO_function:
                     GO:0051287 - NAD binding [Evidence IEA]; GO_function:
                     GO:0048037 - cofactor binding [Evidence IEA]; GO_function:
                     GO:0008863 - formate dehydrogenase (NAD+) activity
                     [Evidence IEA]; GO_function: GO:0008863 - formate
                     dehydrogenase (NAD+) activity [Evidence IGI,ISS] [PMID
                     11921099]; GO_function: GO:0008863 - formate dehydrogenase
                     (NAD+) activity [Evidence IDA] [PMID 21246355];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]; GO_function: GO:0016616 - oxidoreductase
                     activity, acting on the CH-OH group of donors, NAD or NADP
                     as acceptor [Evidence IEA]; GO_process: GO:0042183 -
                     formate catabolic process [Evidence IGI] [PMID 11921099];
                     GO_process: GO:0042183 - formate catabolic process
                     [Evidence IGI] [PMID 19564482]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="formate dehydrogenase (NAD+)"
                     /protein_id="XP_018734286.1"
                     /db_xref="GeneID:30035195"
                     /translation="MFNKYGAGNAMTPHISGTSLDAQARYALGTKNILQSYLSGKFDY
                     RPEDVIVIDGHYGTRSYGDDKKLK"
     gene            complement(<87345..>88211)
                     /gene="FDH1"
                     /locus_tag="AWJ20_33"
                     /db_xref="GeneID:30035306"
     mRNA            complement(<87345..>88211)
                     /gene="FDH1"
                     /locus_tag="AWJ20_33"
                     /product="formate dehydrogenase (NAD+)"
                     /transcript_id="XM_018880307.1"
                     /db_xref="GeneID:30035306"
     CDS             complement(87345..88211)
                     /gene="FDH1"
                     /locus_tag="AWJ20_33"
                     /inference="similar to AA sequence:KEGG_Orthology:K00122"
                     /note="NAD(+)-dependent formate dehydrogenase; may protect
                     cells from exogenous formate; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 11921099]; GO_function:
                     GO:0051287 - NAD binding [Evidence IEA]; GO_function:
                     GO:0048037 - cofactor binding [Evidence IEA]; GO_function:
                     GO:0008863 - formate dehydrogenase (NAD+) activity
                     [Evidence IEA]; GO_function: GO:0008863 - formate
                     dehydrogenase (NAD+) activity [Evidence IGI,ISS] [PMID
                     11921099]; GO_function: GO:0008863 - formate dehydrogenase
                     (NAD+) activity [Evidence IDA] [PMID 21246355];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]; GO_function: GO:0016616 - oxidoreductase
                     activity, acting on the CH-OH group of donors, NAD or NADP
                     as acceptor [Evidence IEA]; GO_process: GO:0042183 -
                     formate catabolic process [Evidence IGI] [PMID 11921099];
                     GO_process: GO:0042183 - formate catabolic process
                     [Evidence IGI] [PMID 19564482]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="formate dehydrogenase (NAD+)"
                     /protein_id="XP_018734287.1"
                     /db_xref="GeneID:30035306"
                     /translation="MKVLLVLYSAGQHAQDEPKLLGCTENELGLRKWLEAQGHELVTT
                     ADKDGENSELDKHIVDAEIVITTPFHPGYITRERINKAKNLKICITAGIGSDHVDLAA
                     ANERKIAVLEVTGSNVQSVAEHVLMTMLVLVRNFVPAHEQYVSGGWDVAAVAKDSYDL
                     EGKVIGTVGVGRIGTRVLQRVKPFNPKEMLYFDYQPLAPELEKEIGARRVDKLEDMLA
                     QCDVVTINCPLHESTKGLFNKELISKMKKGAWLVNTARGAIVVAQDVADALRSGQLRG
                     YGGDTSFPQRKY"
     gene            <88842..>90113
                     /gene="DSD1"
                     /locus_tag="AWJ20_34"
                     /db_xref="GeneID:30035417"
     mRNA            <88842..>90113
                     /gene="DSD1"
                     /locus_tag="AWJ20_34"
                     /product="D-serine ammonia-lyase DSD1"
                     /transcript_id="XM_018880410.1"
                     /db_xref="GeneID:30035417"
     CDS             88842..90113
                     /gene="DSD1"
                     /locus_tag="AWJ20_34"
                     /note="D-serine dehydratase (aka D-serine ammonia-lyase);
                     converts D-serine to pyruvate and ammonia by a reaction
                     dependent on pyridoxal 5'-phosphate and zinc; may play a
                     role in D-serine detoxification; L-serine is not a
                     substrate; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0008721 - D-serine
                     ammonia-lyase activity [Evidence IEA]; GO_function:
                     GO:0008721 - D-serine ammonia-lyase activity [Evidence
                     IDA] [PMID 17869212]; GO_function: GO:0008721 - D-serine
                     ammonia-lyase activity [Evidence IDA] [PMID 17937657];
                     GO_function: GO:0016829 - lyase activity [Evidence IEA];
                     GO_process: GO:0070178 - D-serine metabolic process
                     [Evidence IMP] [PMID 17937657]"
                     /codon_start=1
                     /product="D-serine ammonia-lyase DSD1"
                     /protein_id="XP_018734288.1"
                     /db_xref="GeneID:30035417"
                     /translation="MSKQFRNFYPQVDVEALRQEYIGKNVLDLPTPSFIVNKDTIERN
                     CLHMIQGAKNIKASFRPHLKTHKTLEITKFQLGDYSTKVVVSTLREAWSLIPFYEQGR
                     VRDVLYGLPIVKSKIPELDDLSTYVDTLRILVDNIDQLKLLQEYGREKPWHIMIKVDM
                     GTSRAGLHYQSEEFKQLVQASVDEHSDVVTLDGFYCHAGHSYSSHSSKEAEDYLYDEI
                     VAGNVAAGYAKSIVPSGKYLVSVGSTPTGHASAEIALTKILPVSDNIDEIELHAGNYA
                     LCDLQQWATGCISEDNIACRVLVEVASTYPGRGKSELGEVLINAGVIGLAREPGQLPG
                     FGLVSSKPYDNWYVDRVSQEHGILTPFTESTVASIPKPEQIAKEFPPLGTKLLVIPQH
                     ACIASNSYQWYFITDDEGKMVVDVWVPWRGW"
     gene            complement(<90182..>92092)
                     /gene="TAF8"
                     /locus_tag="AWJ20_35"
                     /db_xref="GeneID:30035528"
     mRNA            complement(<90182..>92092)
                     /gene="TAF8"
                     /locus_tag="AWJ20_35"
                     /product="Taf8p"
                     /transcript_id="XM_018880521.1"
                     /db_xref="GeneID:30035528"
     CDS             complement(90182..92092)
                     /gene="TAF8"
                     /locus_tag="AWJ20_35"
                     /inference="similar to AA sequence:KEGG_Orthology:K14649"
                     /note="TFIID subunit (65 kDa); involved in RNA polymerase
                     II transcription initiation; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005669 - transcription factor TFIID complex [Evidence
                     IDA] [PMID 10788514]; GO_component: GO:0005669 -
                     transcription factor TFIID complex [Evidence IDA] [PMID
                     15448131]; GO_function: GO:0001075 - RNA polymerase II
                     core promoter sequence-specific DNA binding transcription
                     factor activity involved in preinitiation complex assembly
                     [Evidence IC] [PMID 15448131]; GO_process: GO:0051123 -
                     RNA polymerase II transcriptional preinitiation complex
                     assembly [Evidence IC] [PMID 10788514]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006366 - transcription
                     from RNA polymerase II promoter [Evidence IDA] [PMID
                     12138208]; GO_process: GO:0006366 - transcription from RNA
                     polymerase II promoter [Evidence IDA] [PMID 15448131];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Taf8p"
                     /protein_id="XP_018734289.1"
                     /db_xref="GeneID:30035528"
                     /translation="MTELDKKDLPKHESNNEGEGELKESPADSPRDDSIVNGNREGSK
                     VNIDEENRSLDAHTNGKTHEKKNSVASSRTSIEVEEEEEEEDDDDDDDDDDDDEGDTE
                     GEAEPTSVKSELPAKSKISASPGPKRLGRREKYLLEVNPQHAPTYFGTLETIFRRALA
                     SILASRGISTNAHAFEFLSLLAEEYMDDLFSKLFKFSQIQRRVQPSVSDLKLTMEHFG
                     IRITDLERERQLKSRYIDAFNNLKLDPEPEQLVPEAEAFFQSPISDLRHLVPSKKKAG
                     AYIPSWMPPLPPDHTFMSTPQYSRNITEPRELREKLVEEGRLAEAALRRLVGMEIDNV
                     GGTEPDNNNGIVHIEEDEEEIANELDKREINKGPISLAGSELKSSESNSQGDSDSDTD
                     GDFEDLDLSQTDKETVDISLKKEDEAMEISTHESGEPVKQEDKDIAQVNEKDEDGDVK
                     IEENGSLKSVSELTQDNEESEASPSVAKSVHFADANGHVKTEEAAQPVVQKPAKSFSL
                     KITLGSKKTTTTIRPEVTTSELISLESGQKDVLSYASERLKIIERRKRKEESKKRRLP
                     DDPSRETIQETLPKEESLPSDGDIVTKATSSTTLDDELRKVLASVSKRNKRSTSAIPN
                     QELVMWDSNRYI"
     gene            complement(<92508..>94247)
                     /gene="DLD1"
                     /locus_tag="AWJ20_36"
                     /db_xref="GeneID:30035639"
     mRNA            complement(<92508..>94247)
                     /gene="DLD1"
                     /locus_tag="AWJ20_36"
                     /product="Dld1p"
                     /transcript_id="XM_018880627.1"
                     /db_xref="GeneID:30035639"
     CDS             complement(92508..94247)
                     /gene="DLD1"
                     /locus_tag="AWJ20_36"
                     /inference="similar to AA sequence:KEGG_Orthology:K00102"
                     /note="D-lactate dehydrogenase; oxidizes D-lactate to
                     pyruvate, transcription is heme-dependent, repressed by
                     glucose, and derepressed in ethanol or lactate; located in
                     the mitochondrial inner membrane; GO_component: GO:0016020
                     - membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IDA] [PMID 9525904]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 11502169];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004458 - D-lactate
                     dehydrogenase (cytochrome) activity [Evidence IEA];
                     GO_function: GO:0004458 - D-lactate dehydrogenase
                     (cytochrome) activity [Evidence IMP,ISS] [PMID 8492799];
                     GO_function: GO:0008762 - UDP-N-acetylmuramate
                     dehydrogenase activity [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016614 - oxidoreductase activity, acting on CH-OH
                     group of donors [Evidence IEA]; GO_process: GO:0009060 -
                     aerobic respiration [Evidence IMP] [PMID 8492799];
                     GO_process: GO:0044262 - cellular carbohydrate metabolic
                     process [Evidence IMP] [PMID 8492799]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Dld1p"
                     /protein_id="XP_018734290.1"
                     /db_xref="GeneID:30035639"
                     /translation="MGSIIRTRQLETLLRVRLNLTRPLSRSVSSSVSKRSPNPPSGGA
                     KPPKPQSNAESNRQSSKSNGGILLTLAVSGIVGAGSFFAAKSLYQSEQRVSSIEKKWD
                     EPKYGGKEEFHRALPELKAILGEDGVSIDDEDLKAHGYSDWSTYNIETNPIAIAYPKS
                     TEEVSEIAKVCHKYKLPMIGFSGGSSLEGNFCAPYGGVCIDFVHMNKIVEIRPQDMDV
                     TVQPAVGWMALNEELAKEGHNLFFAVDPGPTAKIGGMVGTSCSGTNCVRYGPMRNHIV
                     NLTVVLADGTIIKTKRRPMKSSAGYNLNHLFCGSEGTLGLVTEITLKLHTVPEQTSVA
                     VCAFPTVQDATATATDIIRAGIPVHAIELMDDVQMMCVNRAGYTSRKWDEKPTVMFKF
                     SGSKAYVNEQIQQAKAIAKLHQGVRFEFANGKEEQHQLWSARKEALWSAMAVGPPNGK
                     VYSTDVAVPLSRLADLVMNTKKDLVESGLFGACLGHVGDGNFHACIIYDEKDYEKARK
                     VATDIVHKGLELEGTCTGEHGIGAGKVHYLVEELGPDAVQLMRTIKLALDPNELLNPG
                     KIFTKEALEAESH"
     gene            complement(<94768..>95985)
                     /gene="DSK2"
                     /locus_tag="AWJ20_37"
                     /db_xref="GeneID:30035749"
     mRNA            complement(<94768..>95985)
                     /gene="DSK2"
                     /locus_tag="AWJ20_37"
                     /product="Dsk2p"
                     /transcript_id="XM_018880727.1"
                     /db_xref="GeneID:30035749"
     CDS             complement(94768..95985)
                     /gene="DSK2"
                     /locus_tag="AWJ20_37"
                     /inference="similar to AA sequence:KEGG_Orthology:K04523"
                     /note="Nuclear-enriched ubiquitin-like
                     polyubiquitin-binding protein; required for spindle pole
                     body (SPB) duplication and for transit through the G2/M
                     phase of the cell cycle; involved in proteolysis;
                     interacts with the proteasome; protein abundance increases
                     in response to DNA replication stress; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IC] [PMID 8070654];
                     GO_function: GO:0030674 - protein binding, bridging
                     [Evidence IMP,IPI] [PMID 11805328]; GO_process: GO:0030433
                     - ER-associated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 15167887]; GO_process:
                     GO:0030474 - spindle pole body duplication [Evidence IGI]
                     [PMID 8070654]"
                     /codon_start=1
                     /product="Dsk2p"
                     /protein_id="XP_018734291.1"
                     /db_xref="GeneID:30035749"
                     /translation="MSDTAGSSTENIDVVIKSSSDKKYTLSLPISTRIEELKAQLAQQ
                     SDIPADRQRLIFAGRVLKDNETLEFYKIKSGQTIHLVKGAAPPGSTSGTASGASTTGA
                     SATGSSPSSNSSNSTASQVPGNIAAGAGSGNLLADLTGARYAGLAQLPSASMFGPDGG
                     MGAGANSEQLLNLMEEPGFAQHMQQALQNPAIVDLMINSNPQLRQMGPQFRQMLQSPE
                     FVQMMSNPQTIRTMMQMERMFGGAGAGAGGAGANSFPAPGSTDNNGSTTTDSTASSDT
                     SANAGTGAGANPFGGLFPNGQTPDVSANPFAALLNPQRHANAAAAAGGADNASTNQFN
                     QFNPALLASLLGGNAPAPEPQDDRPPEERYESQLRQLNELGFFDFDRNVRALRRSGGN
                     VQGAVEALLDGQV"
     gene            complement(<96526..>96597)
                     /locus_tag="AWJ20_38"
                     /db_xref="GeneID:30035860"
     tRNA            complement(<96526..>96597)
                     /locus_tag="AWJ20_38"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:30035860"
     gene            complement(<96976..>100074)
                     /gene="MAK21"
                     /locus_tag="AWJ20_39"
                     /db_xref="GeneID:30035971"
     mRNA            complement(<96976..>100074)
                     /gene="MAK21"
                     /locus_tag="AWJ20_39"
                     /product="Mak21p"
                     /transcript_id="XM_018880938.1"
                     /db_xref="GeneID:30035971"
     CDS             complement(96976..100074)
                     /gene="MAK21"
                     /locus_tag="AWJ20_39"
                     /inference="similar to AA sequence:KEGG_Orthology:K14832"
                     /note="Constituent of 66S pre-ribosomal particles;
                     required for large (60S) ribosomal subunit biogenesis;
                     acts as part of a Mak21p-Noc2p-Rrp5p module that
                     associates with nascent pre-rRNA during transcription and
                     has a role in bigenesis of the large ribosomal subunit;
                     involved in nuclear export of pre-ribosomes; required for
                     maintenance of dsRNA virus; homolog of human CAATT-binding
                     protein; GO_component: GO:0030690 - Noc1p-Noc2p complex
                     [Evidence IPI] [PMID 11371346]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     23209026]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 23212245];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_process: GO:0000027 - ribosomal large
                     subunit assembly [Evidence IMP] [PMID 9786894];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IMP] [PMID 23209026]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Mak21p"
                     /protein_id="XP_018734292.1"
                     /db_xref="GeneID:30035971"
                     /translation="MSAEAPVIALDKLADKVKKISAGKTNDRPKKKDSKDKRAKKDTK
                     DQTKKSENQKPQNEESELNDSLLKEVEALGGSKADLDLINGLDDSGSDSEIEVTVASK
                     PDSKLNNDLSKFMSELGLPSEPEVVEDEETVVNVSSKSTEPTDNAETTPKEKKNKTKE
                     EEKQKKREEKQKKKEEKKKKEEKEKAKAKEAAVSQTRTEKAAVPAPQSILEKKSTNNS
                     RGVISNEIINHAKYIHPGQLVLEPRTEWYSHDLEPPAEESTLDQDQINVLFSKAKALL
                     QKENDIYVHDNIKSTSQKQFLSQLLTAGTLSDKISALTLLIQESPIHSVKYFDTMIGL
                     CRKKSRGSALQAVAALKDIFISGVLPNRKLKWFKNQPLTASTPVSWLIIWAFEDWLKQ
                     YFFTLLQALETLSHDPVVFIRSNAVLHIIDLLKAKPEQEVNLLRLGVNKLGDSDRKVA
                     SRVSYLLLQLEQAHPAMKGIVVESISELVFRTGTDYHARYYSVITLNQTILAHKDTEV
                     ANNLIKIYLSLFERLLAEWDRDSGRIKPEEPAKKVKKPRWKNKGNKGKHGGERQEAKT
                     TEAVKEEENAKITSAILTGLNRAYPFSALPKDVFDTHIDTLYRVTHSANFNTSVQALM
                     LIFQISKSEQRLTDRYYRTLYESLLDPRLATSSKLRLYLNLLFKSLREDTNTARIKAF
                     AKRLLQMSSSWLSIGVVAAVIFLVNELFKLRDIKDIISEETKESEKIYDGRARDPLYS
                     NSENSKLWEIIPLSNHFHPTVVVYALGLLNNDPSLAKPDLDLHSFSHFLDRFVYKNPR
                     QKTTSKGGSIMQPLAGADPNGFLGIGGSSKSAVNSIDWKNTNLEDVDASERFFHQYFA
                     NRREKAAKSEKIEGELSDNEDEVWDALVNSRPDIEGEDAEDEDLSGFSDEDLSDGDLS
                     DMSIDDEDLDEEDLEDDEKSADEDDAEGEDSDAEPLTLDDFDDVDGLIGSDEEVDEND
                     SEEEEEEEEEEEDKQVGSKKRALERPEGKKSKKAKLKDLPVFASVDDYAQYLDSSDED
                     YS"
     gene            complement(<100553..>103243)
                     /gene="MBP1"
                     /locus_tag="AWJ20_40"
                     /db_xref="GeneID:30036083"
     mRNA            complement(<100553..>103243)
                     /gene="MBP1"
                     /locus_tag="AWJ20_40"
                     /product="transcription factor MBP1"
                     /transcript_id="XM_018881045.1"
                     /db_xref="GeneID:30036083"
     CDS             complement(100553..103243)
                     /gene="MBP1"
                     /locus_tag="AWJ20_40"
                     /inference="similar to AA sequence:KEGG_Orthology:K06647"
                     /codon_start=1
                     /product="transcription factor MBP1"
                     /protein_id="XP_018734293.1"
                     /db_xref="GeneID:30036083"
                     /translation="MKRQSDGWVNATHILKVANFDKPQRTRILEREVQRGTHEKIQGG
                     YGKYQGTWVPLERARAVAEQYKVLEILEPLFAYSPSDTDPTPFAPRHTWKSRSTNGAA
                     GRGGGVAGTPSGRADFTPITARRGASRQSSSASASNIADAGIEDTSLVDNGLKRPYRV
                     LSSGRGGANNGGDGQGAVEGNMLAPPVKKRRGRPPSSSSASLAKRSDSGPRKFHYGIP
                     PSTPKQNIISSKSVNSARYDGNNETLSPESSSISSRSSSPSDFMSESDIDAALTNGVD
                     TPSARNAILASKRRTPSMITDSPQFNYNGYEQRQYTIPDRYQDSPQQSMSGAGNHSML
                     HSSIQPHHQNLQHQQAEHQRQMQQQHPQQGHQRNISTASTSSEMLSTMYSNRLLDYFT
                     SIDEAEIPQFLINPPPEFKINQVIDDEGHTAFHWACSMGDLKIIEVLLQAGANISATN
                     FAEQTPLIRSILFTNNYDRRTFPKVVDLLRDTILYVDSHKQTVLHHIASTTSSRSKLS
                     STRYYTEIILAKLLEIKSLQVVTDFVNLQDENGDTALHIAARNGARKCVKVLFHYNAR
                     ADIVNNNGRTTQEYISEYEAQRQQLLKQADGLVQVKSNTLPGQISSNGQAAVNGYGQS
                     NGTPSNKYMLGKPNSNRELNAAPSQFDSNYRDINGSGSGEANGNANGTVYPAIGNPHV
                     SEVAISATQRVAPSIIEGLEELALAYDSELQEKDSDIEQVRHLLESMKREITETENAI
                     EEIGELPGDEQVVQARLQQSNELVNQRAMHLRKLLERTQSRDLAMLVQAEEDRAGAEL
                     QTREPTLNGTATTAPSEVDPKEEVLSLASTLADLQKRRGKLVDEIVELCASAGAGEKM
                     NDYRRLVSLSCGVKVEEIDELLDGIAQALLADGGGSDGDD"
     gene            complement(<106800..>108671)
                     /gene="EMP70"
                     /locus_tag="AWJ20_41"
                     /db_xref="GeneID:30036194"
     mRNA            complement(<106800..>108671)
                     /gene="EMP70"
                     /locus_tag="AWJ20_41"
                     /product="Emp70p"
                     /transcript_id="XM_018881154.1"
                     /db_xref="GeneID:30036194"
     CDS             complement(106800..108671)
                     /gene="EMP70"
                     /locus_tag="AWJ20_41"
                     /inference="similar to AA sequence:KEGG_Orthology:K17086"
                     /note="Protein with a role in cellular adhesion and
                     filamentous growth; also endosome-to-vacuole sorting;
                     similar to Tmn3p; member of Transmembrane Nine family of
                     proteins with 9 transmembrane segments; EMP70 has a
                     paralog, TMN2, that arose from the whole genome
                     duplication; GO_component: GO:0005768 - endosome [Evidence
                     IEA]; GO_component: GO:0005768 - endosome [Evidence IDA]
                     [PMID 8314797]; GO_component: GO:0010008 - endosome
                     membrane [Evidence IEA]; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     20681974]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006878 - cellular copper
                     ion homeostasis [Evidence IGI,IMP] [PMID 20681974];
                     GO_process: GO:0016197 - endosomal transport [Evidence
                     IMP] [PMID 20526336]; GO_process: GO:0001403 - invasive
                     growth in response to glucose limitation [Evidence IMP]
                     [PMID 18178563]; GO_process: GO:0007124 - pseudohyphal
                     growth [Evidence IGI] [PMID 18178563]; GO_process:
                     GO:0007034 - vacuolar transport [Evidence IGI] [PMID
                     20526336]"
                     /codon_start=1
                     /product="Emp70p"
                     /protein_id="XP_018734294.1"
                     /db_xref="GeneID:30036194"
                     /translation="MLLASSGVHGFYLPGVAPTDYEKDERVPLFVNSMTPSNFYGSAN
                     GLTSVVPYDYYFRAFHFCQPEGGPKRQSESLGSILFGDRIFNSPFELYMLKNETCKTL
                     CTAKYPFRDTLFVIRKIWSEYNFNWLIDGLPAAHEVQDESTGTSFYSAGFPLGSANYE
                     KEEFFIHNHYDIKIEYHQALSGKYRVVGVTVEPASRENKPDEKGNVFCKVDDKPFMLH
                     ETESTDTDTEVPYTYSVTWIPSSTSWATRWDKYLHVYDANIHWFSLLNSAIIVVFLTM
                     IVSGILLRAIRKDIARYNEIDLSEDIQEDSGWKLVHGDVFRPPKQKMLLSVFLGSGSQ
                     LLAMTLVTLVFALFGFISPSNRGSLSTVMILFYTFFGIIGGYVSARAYKTFGGESWKL
                     NLILTPVVVPGIVFVAFILLNFLLIFAKSSGAVPIGTMIALIAMWFIISAPLSVVGGF
                     LGTKREAYEAPVRTNQIPRQIPTQPTYLRPVPSILLAGILPFCAIFVELYFILSSIWF
                     HKIYYMFGFLFLCFTIMVVTSSTVTVLMIYFTLCAENYNWQWRSFILSGSASIYIFLH
                     SIIYLVSKLSLGGFISNGLYLGYSLLISFVFFILTGTVGFIASFFFVRKIYSSIKID"
     gene            <109594..>111672
                     /gene="TRS85"
                     /locus_tag="AWJ20_42"
                     /db_xref="GeneID:30036305"
     mRNA            <109594..>111672
                     /gene="TRS85"
                     /locus_tag="AWJ20_42"
                     /product="Trs85p"
                     /transcript_id="XM_018881260.1"
                     /db_xref="GeneID:30036305"
     CDS             109594..111672
                     /gene="TRS85"
                     /locus_tag="AWJ20_42"
                     /note="Component of transport protein particle (TRAPP)
                     complex III; TRAPPIII is a multimeric guanine
                     nucleotide-exchange factor for the GTPase Ypt1p,
                     regulating endosome-Golgi traffic and required for
                     membrane expansion during autophagy and the CVT pathway;
                     directs Ypt1p to the PAS; late post-replication meiotic
                     role; GO_component: GO:0005794 - Golgi apparatus [Evidence
                     IDA] [PMID 23986483]; GO_component: GO:1990072 - TRAPPIII
                     protein complex [Evidence IDA] [PMID 20375281];
                     GO_component: GO:0031410 - cytoplasmic vesicle [Evidence
                     IDA] [PMID 23129774]; GO_component: GO:0000407 -
                     pre-autophagosomal structure [Evidence IEA]; GO_component:
                     GO:0000407 - pre-autophagosomal structure [Evidence IDA]
                     [PMID 20375281]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0032258 -
                     CVT pathway [Evidence IMP] [PMID 16874038]; GO_process:
                     GO:0032258 - CVT pathway [Evidence IMP] [PMID 20375281];
                     GO_process: GO:0006888 - ER to Golgi vesicle-mediated
                     transport [Evidence IGI] [PMID 10727015]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IMP] [PMID 11239471]; GO_process: GO:0000045 -
                     autophagic vacuole assembly [Evidence IMP] [PMID
                     23129774]; GO_process: GO:0006914 - autophagy [Evidence
                     IEA]; GO_process: GO:0016236 - macroautophagy [Evidence
                     IMP] [PMID 16079147]; GO_process: GO:0016236 -
                     macroautophagy [Evidence IMP] [PMID 16874038]; GO_process:
                     GO:0016236 - macroautophagy [Evidence IMP] [PMID
                     20375281]; GO_process: GO:0007126 - meiotic nuclear
                     division [Evidence IEA]; GO_process: GO:0007126 - meiotic
                     nuclear division [Evidence IMP] [PMID 8619313];
                     GO_process: GO:0030242 - peroxisome degradation [Evidence
                     IMP] [PMID 16079147]; GO_process: GO:0030242 - peroxisome
                     degradation [Evidence IMP] [PMID 16874038]; GO_process:
                     GO:0034727 - piecemeal microautophagy of nucleus [Evidence
                     IMP] [PMID 18701704]; GO_process: GO:0034497 - protein
                     localization to pre-autophagosomal structure [Evidence
                     IMP] [PMID 20375281]; GO_process: GO:0034497 - protein
                     localization to pre-autophagosomal structure [Evidence
                     IMP] [PMID 23129774]; GO_process: GO:0030435 - sporulation
                     resulting in formation of a cellular spore [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0016050 - vesicle organization [Evidence
                     IMP] [PMID 16079147]"
                     /codon_start=1
                     /product="Trs85p"
                     /protein_id="XP_018734295.1"
                     /db_xref="GeneID:30036305"
                     /translation="MDQETSTSPSEGAQSIPLACKDIVSKAFSPNVSISVSSDVNDVA
                     RDMGLDSFVNLLRPFGDRISGRITVCDSQAASVSFDDFAIRFSVGTGSDVTGSNGTNV
                     ADVTQETESTGTTSPTGASTSVATGSGITTPAHQLPQLFNNDELESYLANRLQSFADK
                     GVKLTPQLSQELYLDFFKRILTPLSSIPPFETFNHPVTGVIAVSSRNEQPIETLSLLY
                     NRSHDPQLVHDYINKDYLRYYVLVHDETTGDLDKSIALFEKMKRNFGLHCHMIRINRD
                     TTSVDEASIMKLDQPEWQSLQQLQSANTGQESQLDTSHYIHKEDYESLQQFVREMVVQ
                     SVLPFMERCIATWNDQVASSRRGITGRFFSASKKYFSSSTRATSSILSTASGSSPFYF
                     SLGGSGASTPASRSPTPPTRTISSPNYPASSSKFSYNYLTPEAQIRKLADFAFMLRDY
                     KFAYTTYDLLKRDYHNDKAWSYLAGCEEMAAISYLMTAESLPPKQRVDIIDSLLDSST
                     YSYISRCSLPSYALRSILISSELLCTLNTPSAASDGATKWVLKALNERLVGRLGYAML
                     MERISGAYSAYDSVADRFVNPPGLAKGTPINASSVSLIQGAPDRSSTPASITSTNSNT
                     SKIIASSTVRTSRTRKAAFWQLLAAREWNDANVKEKSIYCIDQANSLIYNELDWAHRP
                     TGLLHRLQES"
     gene            complement(<112903..>115359)
                     /gene="FOL1"
                     /locus_tag="AWJ20_43"
                     /db_xref="GeneID:30036416"
     mRNA            complement(<112903..>115359)
                     /gene="FOL1"
                     /locus_tag="AWJ20_43"
                     /product="trifunctional dihydropteroate
                     synthetase/dihydrohydroxymethylpterin
                     pyrophosphokinase/dihydroneopterin aldolase FOL1"
                     /transcript_id="XM_018881367.1"
                     /db_xref="GeneID:30036416"
     CDS             complement(112903..115359)
                     /gene="FOL1"
                     /locus_tag="AWJ20_43"
                     /inference="similar to AA sequence:KEGG_Orthology:K13939"
                     /note="Multifunctional enzyme of the folic acid
                     biosynthesis pathway; has dihydropteroate synthetase,
                     dihydro-6-hydroxymethylpterin pyrophosphokinase, and
                     dihydroneopterin aldolase activities; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 8813764];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005740 - mitochondrial envelope
                     [Evidence IDA] [PMID 15169867]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003848 -
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     diphosphokinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0003848 -
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     diphosphokinase activity [Evidence IDA] [PMID 15169867];
                     GO_function: GO:0003848 -
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     diphosphokinase activity [Evidence ISS] [PMID 9234673];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]; GO_function: GO:0004150 - dihydroneopterin aldolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004150 -
                     dihydroneopterin aldolase activity [Evidence ISS] [PMID
                     11752249]; GO_function: GO:0004150 - dihydroneopterin
                     aldolase activity [Evidence IDA] [PMID 15169867];
                     GO_function: GO:0004156 - dihydropteroate synthase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004156 -
                     dihydropteroate synthase activity [Evidence IMP] [PMID
                     11731153]; GO_function: GO:0004156 - dihydropteroate
                     synthase activity [Evidence IDA] [PMID 15169867];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0016829 - lyase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0044237 - cellular
                     metabolic process [Evidence IEA]; GO_process: GO:0046656 -
                     folic acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0009396 - folic acid-containing compound
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006760 - folic acid-containing compound metabolic
                     process [Evidence IEA]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]; GO_process: GO:0016310 -
                     phosphorylation [Evidence IEA]; GO_process: GO:0042558 -
                     pteridine-containing compound metabolic process [Evidence
                     IEA]; GO_process: GO:0046654 - tetrahydrofolate
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0046654 - tetrahydrofolate biosynthetic process
                     [Evidence IMP] [PMID 11731153]; GO_process: GO:0046654 -
                     tetrahydrofolate biosynthetic process [Evidence IMP] [PMID
                     15169867]"
                     /codon_start=1
                     /product="trifunctional dihydropteroate
                     synthetase/dihydrohydroxymethylpterin
                     pyrophosphokinase/dihydroneopterin aldolase FOL1"
                     /protein_id="XP_018734296.1"
                     /db_xref="GeneID:30036416"
                     /translation="MKTHNPSQKDLVFVRELFIKAITGVDAWHRPQPQPVLVSIWLHT
                     DVAEAGSTDHLTYSLNYDVISRNVTRNIESGKFRSLEQIASNVAEVVLADSTGGQWAT
                     IHVKKPRALLRAESSEIIISRRKVSTADGGYKIVTTPGTTDVVKIHKLQLVTIIGVNT
                     IERLHRQNVILDLTLYKPTLEGSHTSTANAVAADADSTVASLSQDNNGTGSAPTPTAT
                     FNKHYDFRQVVDTVSNHVEDSSYKTVEAFVTSVAKVICKTCGVEKATVRAEKPSAITF
                     AEAAGVEITRTRDSFTDDEPEPLESDNIAGTNASSVAASAAGTTTPRSIPASGTATPL
                     FPQSGTETLSVADAIHNVYLAFGSNEGDPIANIEQSRHELAKRNINVIATSSLYLSEP
                     MFVADQNKFYNGVFHCQTKLAPLDLLDSIKDIESNALGRVKLMDNGPRTIDLDILLYD
                     DLVMNHPRLNIPHIGMLSRSFVLQPLVELVPSDALHPLTAETYRAHLDQIPSTSDVQS
                     SSQLVTCIPLPHSAGNLEYDPVNHTRSTDIMAIINVTPDSFSDGGKVNLDNIVETACT
                     FVKQGAKILDVGGMSTNPKSVDPGSAEELSRIVPAIKALRACPDLAHIPISIDTYRSE
                     VAEAALEAGANIINDISAGVLDPVILEVAVKYKCPIILNHTRGSPQEMTKLAHYSIPD
                     SQVKDDSDEAVVEIVGRELEDRVNDCVSAGLARWQIILDPGLGFAKNINHNLAIIRNL
                     ELLRSREAFTGLVWLLGPSRKRFIGTITGRQEAADRILGTAATVTSLIAGGSDIVRVH
                     DVPEMADVVKMADAIHRNVY"
     gene            <118444..>120015
                     /locus_tag="AWJ20_44"
                     /db_xref="GeneID:30036527"
     mRNA            <118444..>120015
                     /locus_tag="AWJ20_44"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881465.1"
                     /db_xref="GeneID:30036527"
     CDS             118444..120015
                     /locus_tag="AWJ20_44"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734297.1"
                     /db_xref="GeneID:30036527"
                     /translation="MPNLSTPASRHTPILTPKVMAITVVMAMAIFGLLINRHSTMTAA
                     QIPVLMPMSAVITSPGRNISIPARPAAFGPMFPSKIKGDQPDNDNGDNEGSGDHGGDG
                     DSELGGFTGSLSVVHSFACGSGQEGQGQYDEDYEDLREKIALVQRGGCGFYEKVLTLQ
                     SWGAVAVIVGDNFYHRGLVTMYTRDEFDSAQIPSAFVSRESYDTLSGLDTITITRLPD
                     SAPMMNTVVFLMVSPLCSLSIIYGILLFHRRYRLMKERAPKSLVDSLPTRIWQSYNAT
                     DEEDDDETSHLIANTHANGNTDEDSAVSSTALSPKSSKGAYDNDMTTNVSNVNSGSLL
                     LAPKKQSSPLSLMISRRASITPPATLGRPEKIWVSSGECIICLEDYVAGTSKVMRLPC
                     NHEFHADCISKWLIYRKKTCPICKHDVTKPPRSATTISTTITGTGSQPGSIDSHSEHD
                     NSIDWNSPPHSNHGNRSTNDNDIPDLSHISTPSPPPRRPNTTTATSDTSLSNETTETT
                     PLKGNINSKPTELLP"
     gene            <122886..>123890
                     /gene="YAP3"
                     /locus_tag="AWJ20_45"
                     /db_xref="GeneID:30036638"
     mRNA            <122886..>123890
                     /gene="YAP3"
                     /locus_tag="AWJ20_45"
                     /product="Yap3p"
                     /transcript_id="XM_018881575.1"
                     /db_xref="GeneID:30036638"
     CDS             122886..123890
                     /gene="YAP3"
                     /locus_tag="AWJ20_45"
                     /note="Basic leucine zipper (bZIP) transcription factor;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IPI] [PMID
                     9372930]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IEA]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     19111667]; GO_function: GO:0003700 - sequence-specific DNA
                     binding transcription factor activity [Evidence IEA];
                     GO_function: GO:0003700 - sequence-specific DNA binding
                     transcription factor activity [Evidence IDA] [PMID
                     9372930]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 9372930]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA,IEA];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Yap3p"
                     /protein_id="XP_018734298.1"
                     /db_xref="GeneID:30036638"
                     /translation="MSAFYYDQTALQAPYQKPPAPLPSATEFTLPHDPADPANLDWVE
                     CDKILSSSHGNPGVGSPNDPSPSHSLHSLNNNSSNAQFFINPLMPSPESSESGQSTIA
                     PIGNGSYSSALKPEDEIMNGTSGGMHLTGAPVDDSEVKRKAQNRAAQRAFRERKEQRV
                     RELEIKLAESEEVVKKLTQENQKLTQENTVLKTENQVLRNSHHSNLQTAGSNGPPAPQ
                     QATFPSHQFYASLLEGHEDGSSNDPGSPGTGEVQPSYIVYERNHGETMLGAGTVWQML
                     MEDPVMSAEDVDISFVVQYIKDKAVCDGYGPVYPLREVHEGIRLAKAEKAKSEKAKIL
                     "
     gene            complement(<124269..>126014)
                     /gene="TPO1"
                     /locus_tag="AWJ20_46"
                     /db_xref="GeneID:30036749"
     mRNA            complement(<124269..>126014)
                     /gene="TPO1"
                     /locus_tag="AWJ20_46"
                     /product="Tpo1p"
                     /transcript_id="XM_018881681.1"
                     /db_xref="GeneID:30036749"
     CDS             complement(124269..126014)
                     /gene="TPO1"
                     /locus_tag="AWJ20_46"
                     /inference="similar to AA sequence:KEGG_Orthology:K08157"
                     /note="Polyamine transporter of the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; recognizes spermine, putrescine, and
                     spermidine; catalyzes uptake of polyamines at alkaline pH
                     and excretion at acidic pH; during oxidative stress
                     exports spermine, spermidine from the cell, which controls
                     timing of expression of stress-responsive genes;
                     phosphorylation enhances activity and sorting to the
                     plasma membrane; GO_component: GO:0033101 - cellular bud
                     membrane [Evidence IDA] [PMID 13679573]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IMP]
                     [PMID 11171066]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 12562762]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA,IMP] [PMID
                     15637075]; GO_function: GO:0015297 - antiporter activity
                     [Evidence IEA]; GO_function: GO:0015606 - spermidine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11171066]; GO_function: GO:0015606 - spermidine
                     transmembrane transporter activity [Evidence IDA,IMP]
                     [PMID 15637075]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11171066]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IDA,IMP]
                     [PMID 15637075]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     9920864]; GO_process: GO:1902047 - polyamine transmembrane
                     transport [Evidence IMP] [PMID 24136413]; GO_process:
                     GO:0015847 - putrescine transport [Evidence IMP] [PMID
                     9920864]; GO_process: GO:0015848 - spermidine transport
                     [Evidence IMP] [PMID 11171066]; GO_process: GO:0015848 -
                     spermidine transport [Evidence IDA,IMP] [PMID 15637075];
                     GO_process: GO:0015848 - spermidine transport [Evidence
                     IMP] [PMID 9920864]; GO_process: GO:0000296 - spermine
                     transport [Evidence IMP] [PMID 11171066]; GO_process:
                     GO:0000296 - spermine transport [Evidence IDA,IMP] [PMID
                     15637075]; GO_process: GO:0000296 - spermine transport
                     [Evidence IMP] [PMID 9920864]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tpo1p"
                     /protein_id="XP_018734299.1"
                     /db_xref="GeneID:30036749"
                     /translation="MSETSHSAPPSTESAGFEKGFDKEQGEFEPKPMAEDSDIENSGA
                     AAPQKFYGGDRDVESQRRLSRTSTNISEEANVETDYIARVLTGGSRRSNRPTPNMGGG
                     KDYPPLLNYDKDLYKVEFDGPDDPMHPHNWPLKKKLPICAALGFTTFTVAWGSAIFAS
                     AVEVVAAKYHVSVTVGILCVSLYVMGFASGPILWAPLSEVYGRKIPSVISIFGFMLFS
                     FAAATSKDFQTLILCRFFGGFFGAAPLAVVAAAFADMFGNEMRGTAISIFSLMVFCGP
                     LLAPVVGGFIVNSYLGWRWTEYITGIMAAVALLSCVFLYEETYHPMILVQKAKLIRKA
                     TGNQLVYAPHEQVEIDMAELVTKNLTRPIVMTVTEPIIFLISLYTAFIYGILYLCLEA
                     YPIIFSGYKMKGGIVELPYLGLLVGCVVGGFVIALFFEPQYNKKLAANNGKPVPEARL
                     PPMIAGGIAFPIGIFWLTWTGNYPESVHWAAPAVSGLFTGFGLICVFLPAINYIVDSY
                     LFFAASALAGNTFMRSSFGAAFPLFAIQMFHNLGINWAGTLIGCLAVVLIPVPVLFYI
                     YGKKLRQKSKFAFDL"
     gene            <129232..>131217
                     /gene="SNF1"
                     /locus_tag="AWJ20_47"
                     /db_xref="GeneID:30036859"
     mRNA            <129232..>131217
                     /gene="SNF1"
                     /locus_tag="AWJ20_47"
                     /product="AMP-activated serine/threonine-protein kinase
                     catalytic subunit SNF1"
                     /transcript_id="XM_018881788.1"
                     /db_xref="GeneID:30036859"
     CDS             129232..131217
                     /gene="SNF1"
                     /locus_tag="AWJ20_47"
                     /inference="similar to AA sequence:KEGG_Orthology:K12761"
                     /note="AMP-activated serine/threonine protein kinase;
                     found in a complex containing Snf4p and members of the
                     Sip1p/Sip2p/Gal83p family; required for transcription of
                     glucose-repressed genes, thermotolerance, sporulation, and
                     peroxisome biogenesis; involved in regulation of the
                     nucleocytoplasmic shuttling of Hxk2p; regulates
                     filamentous growth in response to starvation; SUMOylation
                     by Mms21p inhibits its function and targets Snf1p for
                     destruction via the Slx5-Slx8 Ubiquitin ligase;
                     GO_component: GO:0031588 - AMP-activated protein kinase
                     complex [Evidence IDA] [PMID 12393914]; GO_component:
                     GO:0031588 - AMP-activated protein kinase complex
                     [Evidence IDA,IPI] [PMID 2481228]; GO_component:
                     GO:0031588 - AMP-activated protein kinase complex
                     [Evidence IPI] [PMID 9121458]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IPI] [PMID 11331606]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 17237508];
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IPI] [PMID 11331606]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005641 - nuclear envelope lumen
                     [Evidence IDA] [PMID 17237508]; GO_component: GO:0031965 -
                     nuclear membrane [Evidence IEA]; GO_component: GO:0005634
                     - nucleus [Evidence IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IPI] [PMID 11331606]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 17237508];
                     GO_function: GO:0004679 - AMP-activated protein kinase
                     activity [Evidence IMP] [PMID 11486005]; GO_function:
                     GO:0004679 - AMP-activated protein kinase activity
                     [Evidence IMP] [PMID 2557546]; GO_function: GO:0004679 -
                     AMP-activated protein kinase activity [Evidence IMP] [PMID
                     7913470]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0016301 - kinase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0004672 - protein
                     kinase activity [Evidence IEA]; GO_function: GO:0004672 -
                     protein kinase activity [Evidence IDA] [PMID 16319894];
                     GO_function: GO:0004674 - protein serine/threonine kinase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004674 -
                     protein serine/threonine kinase activity [Evidence IDA]
                     [PMID 11486005]; GO_function: GO:0004674 - protein
                     serine/threonine kinase activity [Evidence IDA] [PMID
                     2557546]; GO_function: GO:0004674 - protein
                     serine/threonine kinase activity [Evidence IDA] [PMID
                     7913470]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016772 - transferase
                     activity, transferring phosphorus-containing groups
                     [Evidence IEA]; GO_process: GO:0042710 - biofilm formation
                     [Evidence IMP] [PMID 12024013]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0007155 - cell adhesion [Evidence IMP] [PMID 12556493];
                     GO_process: GO:0006995 - cellular response to nitrogen
                     starvation [Evidence IDA] [PMID 12024013]; GO_process:
                     GO:0071940 - fungal-type cell wall assembly [Evidence IMP]
                     [PMID 24486034]; GO_process: GO:0001403 - invasive growth
                     in response to glucose limitation [Evidence IMP] [PMID
                     11095711]; GO_process: GO:0001403 - invasive growth in
                     response to glucose limitation [Evidence IMP] [PMID
                     12556493]; GO_process: GO:0017148 - negative regulation of
                     translation [Evidence IGI,IMP] [PMID 18955495];
                     GO_process: GO:0016310 - phosphorylation [Evidence IEA];
                     GO_process: GO:1900436 - positive regulation of
                     filamentous growth of a population of unicellular
                     organisms in response to starvation [Evidence IMP] [PMID
                     22904036]; GO_process: GO:0045722 - positive regulation of
                     gluconeogenesis [Evidence IMP] [PMID 8628258]; GO_process:
                     GO:0045722 - positive regulation of gluconeogenesis
                     [Evidence IMP] [PMID 8710504]; GO_process: GO:0045722 -
                     positive regulation of gluconeogenesis [Evidence IMP]
                     [PMID 9111319]; GO_process: GO:0006468 - protein
                     phosphorylation [Evidence IEA]; GO_process: GO:0006468 -
                     protein phosphorylation [Evidence IDA] [PMID 11486005];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IDA] [PMID 16319894]; GO_process: GO:0007124 -
                     pseudohyphal growth [Evidence IMP] [PMID 12024013];
                     GO_process: GO:0006109 - regulation of carbohydrate
                     metabolic process [Evidence IGI,IPI] [PMID 12167649];
                     GO_process: GO:0001302 - replicative cell aging [Evidence
                     IGI,IMP] [PMID 10921902]"
                     /codon_start=1
                     /product="AMP-activated serine/threonine-protein kinase
                     catalytic subunit SNF1"
                     /protein_id="XP_018734300.1"
                     /db_xref="GeneID:30036859"
                     /translation="MSVPSAPPPHAGGHGNADVMPSFGHEGGSAGRIGRYQIIKTLGE
                     GSFGKVKLAYHMATHARVALKIINRKTLAKSDMQGRIEREISYLRLLRHPHIIKLYDV
                     IKSKDEIVMVIEFAGNELFDYIVQRGKMREDEARRFFQQIISAVEYCHRHKIVHRDLK
                     PENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWS
                     CGVILYVMLCGRLPFDDEFIPVLFKKISGGVYTIPNFLSPGAKHLLQRMLVVNPLNRI
                     TVQEIIEDPWFKVGIASYLLPPVEQDDGNEDHKEGNDSKTATEKVDDGIVASLGKTMG
                     YDKEQVYEALKSSDDNGSEIRDAYYLLKDNHQASGDIHFKKDDIDRYLSEHPEDADDL
                     KQPFSRTSTPVLAATASSPGTPVSSSGKPYGRGNPPTLTFDKRFQGGVAIDSNSLTTP
                     HTTIAILPTSLPAYHRANMIAEGIQPSKKLNPISTKKSKTRWHFGIRSRSYPLDVMGE
                     IYRALRNLGAEWAKPVDDDLWTIHVRWKCGLPLKQSLSNSCSGITTSGESTPQTTAVN
                     SGDVTPTEANNNTDTSVTPRETPKTELMKMRIQLYQLEQNNYLVDFKFDGWENPDGTA
                     HPKGAAAPIPEFDSFSAYPFLHLATKLIMELAVNSQA"
     gene            complement(<131400..>132899)
                     /locus_tag="AWJ20_48"
                     /db_xref="GeneID:30036970"
     mRNA            complement(<131400..>132899)
                     /locus_tag="AWJ20_48"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881894.1"
                     /db_xref="GeneID:30036970"
     CDS             complement(131400..132899)
                     /locus_tag="AWJ20_48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734301.1"
                     /db_xref="GeneID:30036970"
                     /translation="MKFIADEETKLYVGDAFSLLGILASYDKLEGLNPYQVRFADFVD
                     DATMLRIIRASGGAWSINLSKYSSPASKAYLLGPEAGSAGIGGTIASWIGGGLGELGG
                     LIWRRGSTGTEEHVSGTDETSPSALDEDLPHPTMSLLLPVYEFIQANKVFRRLLVETP
                     ASDNRSGSISGKDNVGAANSTSSSSARNKSPPPFVLFISLCSYLLQNQHKTLRAASYA
                     RLSLLILRIFAEDSAIVSKQLVSEELQTHISLCRLRNPALPLVTGKTTLLNGIMDSLL
                     GCIRFNMKRTIDYDMYNLTLTVLFQVIASLRSTKTRTTYHWSEVWKSIISLIKFLNTH
                     PPSGGSGSSKQAQEASETADLAVLIIAALLIHGENILPDNHEHDDLFYRVVESTDEFS
                     KLKRLYSLEKSPSMAVITATTSHYASLLEPAKTKSLSPEQVAQTIKQGYQSLSLFQYA
                     SESSNEPTKKTLLYDSLPTYKESEQRLFLKKITRTAINDTQLLYQSANF"
     gene            <135364..>136401
                     /gene="HST3"
                     /locus_tag="AWJ20_49"
                     /db_xref="GeneID:30037081"
     mRNA            <135364..>136401
                     /gene="HST3"
                     /locus_tag="AWJ20_49"
                     /product="Hst3p"
                     /transcript_id="XM_018882002.1"
                     /db_xref="GeneID:30037081"
     CDS             135364..136401
                     /gene="HST3"
                     /locus_tag="AWJ20_49"
                     /inference="similar to AA sequence:KEGG_Orthology:K11121"
                     /note="Member of the Sir2 family of NAD(+)-dependent
                     protein deacetylases; involved along with Hst4p in
                     telomeric silencing, cell cycle progression, radiation
                     resistance, genomic stability and short-chain fatty acid
                     metabolism; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence IC]
                     [PMID 12242223]; GO_function: GO:0003677 - DNA binding
                     [Evidence ISS] [PMID 7498786]; GO_function: GO:0070403 -
                     NAD+ binding [Evidence IEA]; GO_function: GO:0004407 -
                     histone deacetylase activity [Evidence IMP] [PMID
                     16815704]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_process: GO:0006348 - chromatin
                     silencing at telomere [Evidence IGI] [PMID 7498786];
                     GO_process: GO:0016575 - histone deacetylation [Evidence
                     IMP] [PMID 16815704]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0046459 - short-chain fatty acid metabolic
                     process [Evidence IMP] [PMID 12618394]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Hst3p"
                     /protein_id="XP_018734302.1"
                     /db_xref="GeneID:30037081"
                     /translation="MASLRRRILAARSTPTHWFIRHLKERGKLLRCYTQNIDGLEEQE
                     GLLIGGLGYGLETIPIQAAEVVQLHGDINSLKCMSCSTKYSWTPDTEEQLNRGEAPIC
                     PNCNQIQEERTSAGKRFTGVGCLRPNIVLYGEEHADGYSIGDCTVKDIKSKPDFLIIS
                     GTSLKVVGIRKLVRCMAKAVKEKGGLVILVNMTELGQSMWNDLIDYYIEGQSDAWVAD
                     LKIQVPDFFQTQTKITGMSVKKGVPGMVGKLPSFNMPSPPSTPKKVKRPADSSWTSMT
                     PSKHTRMASSSPSKPRTPSTPRVLRTPRTKRIQQGNLSFEVMLQPENRTPLATLSVNR
                     QTARSPTRAGK"
     gene            <137523..>138677
                     /gene="JLP1"
                     /locus_tag="AWJ20_50"
                     /db_xref="GeneID:30037193"
     mRNA            <137523..>138677
                     /gene="JLP1"
                     /locus_tag="AWJ20_50"
                     /product="Jlp1p"
                     /transcript_id="XM_018882110.1"
                     /db_xref="GeneID:30037193"
     CDS             137523..138677
                     /gene="JLP1"
                     /locus_tag="AWJ20_50"
                     /note="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase; involved in sulfonate catabolism for use as a
                     sulfur source; contains sequence that resembles a J domain
                     (typified by the E. coli DnaJ protein); induced by sulphur
                     starvation; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0051213 - dioxygenase
                     activity [Evidence IEA]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0000907 - sulfonate dioxygenase activity [Evidence IDA]
                     [PMID 10482536]; GO_process: GO:0046306 - alkanesulfonate
                     catabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0044273 - sulfur compound catabolic process
                     [Evidence IMP] [PMID 10482536]"
                     /codon_start=1
                     /product="Jlp1p"
                     /protein_id="XP_018734303.1"
                     /db_xref="GeneID:30037193"
                     /translation="MAPPTTAPVYQLTDKALSPKEIIKGPSTYANTINEGPSVLKNWS
                     GPLKVSGALDTAYKFKEITPAIGREYPDLQLKDVLENEEQLRDLAITISRRGVVFFRN
                     QDITIAQQKKLADQLGKLAGKPETSGLHIHPVAPAGGFLKEGSDEIDEEVSIITSKIN
                     NDVYNNARIAFRKSSEKYHTDVNFEPVPADYTTLRIIETPDHGGDTLWASGYSLYDKL
                     SPSLRAYLETLVGTYSQPTFKDSTKGEHGIYSAKRGAPENFGDELIAKHPVVRTNPVT
                     GWKSIFSLGTHFTSFDGLTEDESTLLKTYIHNLLVSSHDIQVRFKWNKNDMAIWDNRS
                     VFHTATNDYPIGAGTVVRTGVRTVSVGERPFFSEKSKSREEDLYENKLLV"
     gene            <138819..>139469
                     /locus_tag="AWJ20_51"
                     /db_xref="GeneID:30037304"
     mRNA            <138819..>139469
                     /locus_tag="AWJ20_51"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882219.1"
                     /db_xref="GeneID:30037304"
     CDS             138819..139469
                     /locus_tag="AWJ20_51"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734304.1"
                     /db_xref="GeneID:30037304"
                     /translation="MSQESDEAKIVHLYKSARALALSPISQAIQLRCFQTSSSKSINL
                     PENAYHQQACPQCCIPWVPGLTVKIRIKLGNSMRTSGGLSKRARKRRQLLLQKKFSNS
                     PPQLERKRALVYDCLVCDNRLVSDLSNKITVRDTGSAENISSVRDIKMELANNTSPLE
                     VVASSALETNSISSAKKRAKERKSKSSLKSLLAKNRDKASTSSTTKLGLSDFFKPG"
     gene            complement(<151135..>154011)
                     /locus_tag="AWJ20_52"
                     /db_xref="GeneID:30037415"
     mRNA            complement(<151135..>154011)
                     /locus_tag="AWJ20_52"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882327.1"
                     /db_xref="GeneID:30037415"
     CDS             complement(151135..154011)
                     /locus_tag="AWJ20_52"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734305.1"
                     /db_xref="GeneID:30037415"
                     /translation="MTVPCTNPAECSGKSIIVTTLPVVPTSTGMGATGYTTMTVSCTN
                     PAECFGSSAIVTTLAVPQSTGATEYATVTLSCTNPSECSGKSVMVTTLPIVPASTEMG
                     ATGYTTMTVSCTNPAECSGNSVMVTTIPASQAANPIESGSTGYATVTLSCTNPAECSG
                     KSIIVTTLPIVPTPTEMGATAYTTMTISCTNPAECSGKSIMVTTVPVSQSANPVQAGS
                     TGYATVTTLPIVPASTEMGATDYTTMTVSCTNPAECSGHSVKVTTIAVLQSTGPTEYA
                     TVTVSCTNPAECSGKSVMVTTLPIVPTPTEMGATSYTTMTISCTNPAECSGKSIMVTT
                     VPVSQSANPVQAGSTGYATVTVSCTNPAECSGKSIIVTTLPIVPTSAEMGATGYTTMT
                     VSCTNPAECFGSSAIVTTLAVPQSTGATEYATVTVSCTNPAECSGKSVMVTTLPIVPT
                     PTEMGATAYTTMTISCTNPAECSGNSVMVTTIPASQAANPIEAGSTGYATVTVSCTNP
                     AECSGKSIIVTTLPIVPTPTEMGATAYTTMTISCTNPAECSGKSIMVTTVPVSQSANP
                     VQAGSTEYATVTISCTNPAECSGKSIIVTTLPIVPTPTEMGATAYTTMTISCTNPAEC
                     SGKSIMVTTVPVSQSANPVQAGSTGYATVTVSCTNPAECSGKSVMVTTLPIVPVSTER
                     GATGYTTMTVSCTNPAECSGSSVLVTTIAMLPSETQTGVAMSSLTVGQYTSYLTKTVP
                     CENSMKCSGKSYMVTTIALVTSMSAEATEVATKTASLAISTSITTIGISEAPGIFPTG
                     VPYTSYSTMTVPCQHPTKCSGKSYIVTTIPIYGTNVPTTSSSIEPSVETSIVSPAGIP
                     YTSYRTETVPCQHPTKCSGRSYVLTTIPIYGTFIPSISESATVTQSVPYTEFISVQNS
                     PVPGEGTTLLTTVTVPCTAKGCTTQQLVTTVTMVLPTPSYPNGK"
     gene            <163382..>164872
                     /gene="CAJ1"
                     /locus_tag="AWJ20_53"
                     /db_xref="GeneID:30037525"
     mRNA            <163382..>164872
                     /gene="CAJ1"
                     /locus_tag="AWJ20_53"
                     /product="Caj1p"
                     /transcript_id="XM_018882430.1"
                     /db_xref="GeneID:30037525"
     CDS             163382..164872
                     /gene="CAJ1"
                     /locus_tag="AWJ20_53"
                     /inference="similar to AA sequence:KEGG_Orthology:K09527"
                     /note="Nuclear type II J heat shock protein of the E. coli
                     dnaJ family; contains a leucine zipper-like motif, binds
                     to non-native substrates for presentation to Ssa3p, may
                     function during protein translocation, assembly and
                     disassembly; GO_component: GO:0005634 - nucleus [Evidence
                     TAS] [PMID 15170475]; GO_function: GO:0051087 - chaperone
                     binding [Evidence ISS] [PMID 8045411]; GO_process:
                     GO:0006457 - protein folding [Evidence ISS] [PMID
                     8045411]"
                     /codon_start=1
                     /product="Caj1p"
                     /protein_id="XP_018734306.1"
                     /db_xref="GeneID:30037525"
                     /translation="MSQTETATADSAVTFKEQGNVAYKAGNYQEAVELYGKAIEADPT
                     NPVYYGNRSMALMQLKEYQLALNDTLESNSYGPGVAKTLNRLGKLYTTLGRPDEALQA
                     YSSSDPPASGPEVMYAHEMSRNLVQAEQLLHSENPALGIHSLDAAERYLGAGVKIPRK
                     WTLLRGQLYLASGNIDGATSLVMSLLRSDSQDPDALTLRGKVLYQEGDVSKAVAHFTE
                     ALRCDPDNANARKSLKVAKELEKLRTEGNNAFKSGSYAAAKELYTRALQVDPTNKGIN
                     SKLYSNRATVNIKLNLIEEALADSDEALLLDPGFVKVKKTRARVLLQLERYEDAVQEF
                     KSAIEMDSADTSLRQELQNAELELKKSKRKDYYKILGVSKTCTETELKKAYRKQALIY
                     HPDKNPDDHTAQEKFKEVGEAYETLSDPQKRARYDSGVDLQDPSDMFGGMGGMGGMGG
                     MGGMGGMGGMGGMGGIDPEILFQMFGGAGGGGRGGHPGFSFSSGGF"
     gene            complement(<165416..>166933)
                     /gene="YCK2"
                     /locus_tag="AWJ20_54"
                     /db_xref="GeneID:30037583"
     mRNA            complement(<165416..>166933)
                     /gene="YCK2"
                     /locus_tag="AWJ20_54"
                     /product="serine/threonine protein kinase YCK2"
                     /transcript_id="XM_018882484.1"
                     /db_xref="GeneID:30037583"
     CDS             complement(165416..166933)
                     /gene="YCK2"
                     /locus_tag="AWJ20_54"
                     /inference="similar to AA sequence:KEGG_Orthology:K02218"
                     /codon_start=1
                     /product="serine/threonine protein kinase YCK2"
                     /protein_id="XP_018734307.1"
                     /db_xref="GeneID:30037583"
                     /translation="MSSHIQSSNVVGVHYRVGKKIGEGSFGVIFEGTNLLNNQQVAIK
                     FEPRKSDAPQLRDEYRTYKILVGCLGMPNVYYFGQEGLHNILVIDLLGPSLEDLFDWC
                     GRRFTLKTVVMVAKQMISRVQTIHEKNLIYRDIKPDNFLIGKPGTKNANLVYVVDFGM
                     AKQYRDPKTKQHIPYRERKSLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGG
                     LPWQGLKAATNKQKYEKIGEKKQTTQIRDLCEGFPEQLEQYLTYVRNLGFEETPDYDY
                     LRDLFTQALKSTGEVEDGEYDWMKLNGGKGWDSATNKKPNLHGYGHPYPPGHNSSNAN
                     NNANATANNRHSQVHLSSSRLNAAQPPPPPPNAALIRHASKSRRNTRQSTPGQLQQAT
                     TAAQQQLQAQQQALAGQRLSKSGAALGVPANGTGGSIGGSNVAQYQNNSSQILSSNQY
                     AQQGYQSTNQQLQQQSNLGSHQYGHDYQNQQQQQQQQGTEENKGFWAKIGAFCCG"
     gene            complement(<177717..>178733)
                     /locus_tag="AWJ20_55"
                     /db_xref="GeneID:30037594"
     mRNA            complement(<177717..>178733)
                     /locus_tag="AWJ20_55"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882495.1"
                     /db_xref="GeneID:30037594"
     CDS             complement(177717..178733)
                     /locus_tag="AWJ20_55"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734308.1"
                     /db_xref="GeneID:30037594"
                     /translation="MYVLTCQASRAIFIGTVLGLALTVGGIAGLQFYSFRKIQAIQPI
                     PSEWTFQTKLLVQAGVDSEQAQNIEQAAKYYQQAIDVLLGKDKQTDISTKSKQWLTGY
                     ADLLIRFGLVQEMLNHRQEAREALEAGYSMPVGTPHVRSKAAIQLGQYSLESNKFSES
                     EKLFVESLKEVASAPILQYLATGPSPVVLPENIVANDYQMAPLIELGKLYVKQKRYQC
                     AFSSFLASLRALRNAKDVFINQSGSGVPLDLHLQNFDVKCNEAIIMSYISEILWKLGK
                     KQDAVIWGEGSYYESFPRSHGVVECRLCAKMVANNLYIMYRNMGMSEQSETFKNIHES
                     LDFD"
     gene            <181958..>182758
                     /locus_tag="AWJ20_56"
                     /db_xref="GeneID:30037605"
     mRNA            <181958..>182758
                     /locus_tag="AWJ20_56"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882506.1"
                     /db_xref="GeneID:30037605"
     CDS             181958..182758
                     /locus_tag="AWJ20_56"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734309.1"
                     /db_xref="GeneID:30037605"
                     /translation="MMTSHNRTYNRRERTRLFPPNGDGYTSLDQVKWFFKDSPIPRWS
                     DPLEQLIPASEHIDMDKIVLNHDRRPVESSVSEDESSVAQRTRGKPLARPIEDLMRLD
                     GSEKAIPSPPPAKSDSPVSPAKKEVTKRRLSSRASPLKLNGGKNKRGPKSPSKVTPEA
                     VADNSSSSEDDNDDNKGSDDDSEKESVISHEVIKPKKSYLTQGAYYGIMRRGRLSKGV
                     RDNHVFPLPMLDGLKRMNTEKPFQLPWNIYCPSEDGPKAKWRTLKKSK"
     gene            <183394..>188358
                     /locus_tag="AWJ20_57"
                     /db_xref="GeneID:30037616"
     mRNA            <183394..>188358
                     /locus_tag="AWJ20_57"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882516.1"
                     /db_xref="GeneID:30037616"
     CDS             183394..188358
                     /locus_tag="AWJ20_57"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734310.1"
                     /db_xref="GeneID:30037616"
                     /translation="MQKWYVNGVPRIGLFAGPAYIEAGTELTYDYNFDWFKGAVAQFC
                     HCGSDNCRGVIGKKSSSVSTSRSDDSSVPSSRNGTPITGLNGSKKKNQASVKSTVSRI
                     VKKSVHSAKMKRVTSVNGPASSIARAKYAKQGLRGRKTPYTDSRVSIPVKKGLQLKIR
                     LAKATPLAEADPPRRRPGRPRKDTNISVADSESSAQENVRTRTRSSASVTDSETAKNL
                     KKGKKMVIPRTKPTIVFSSSLVTKRRGRPKKNLSPEPVLPKRRGRPRKEESQSITNTD
                     VSTVKRARSKIGTVSNGEAANIDNSENKRRTRRSGLQPLIDIGNEDNNLLSAEALGFL
                     HPPGITATLMKIRNPKRQFKRKRINTENNLQEEDGMDDENSEDDRPSEKIERGLRSRT
                     VPLVGDLEWKRERRTSQRTQSVPSTGTADRMEISDADIEVEEIGASDDNFNEEIGASD
                     DNFNEEIGDSDDNSIDDNQNDANDEFVAQSIDEDDSSSLSELDSKASNFSDYQLSMDE
                     EVVSDNDDSEVIILDQSPAVDGGKEINSGAKQRGSLLVEEKGMGVQNSELNQDNDADD
                     RLDIRDEEEKNQSLEQLSEMKERTHNETPEMHTNGRQQITIDHDNDHDQNVEGNIDES
                     ARIIPKKRGRPPKNRMQSGLPNGDGEAPTQPVRRSTRVVNQPQRFIDMVEAPEPKRKL
                     RNRKIGRPKKNTAVLEFTSLDIGRSRQEQPSHVAMSHSRPETVNNSGDRSNSGSNSGS
                     NSGLDILALAIASTEATSRTPNNVRTIARPSVINRPSHNPVSIGRYYRDDSGSEDDSE
                     DTDGGRAPRSLTASSTPIQIEQRSTSQSSPKTESRGQLRQTHLTEFIGPTANRSRVED
                     ERTGLPAPQEIPKESTETRMTIDEYVSKQALAEKQFIPLDVSSLASRRPYMPVPVPVV
                     DAKDGKQPDGPLIECQVVLPEKLSKELSEHPGSLSSGSSRQAQPSQLPGPPGSTPPNT
                     LVPMTPVPAVTYQVVSSPNGPQMIPQGIPYYSSPMGPPMGVPQMMPQMGPSYPSEMSM
                     PDQQMYPQMGPQMGSQMGPQMGPQMGPQMGPQMGPRMGPQMGTPIGPQMGPHMGPHMG
                     SPMGPPMTAPMGVPMGMPMEQAMGPPMGQPMGQPMGPFVGQPMGQPMGQPVGQPMGPP
                     MGPPMGPPMGPPMGPPMGPMGHPMGQPMGQSMGPYMGQPMGPYYGPSMMPQTGPPVEP
                     MAGHMGPPAGSPSGYPMSMPSNGTQSGPPGTSPSLGAPNSPVDGRRYSSTTRVVSGSP
                     SRNVQPHFPTQIGPNGSSVSYRPDTIPGKSSPSSQLSDGTKVMETSVNTFDNRSENVT
                     TKQDPSQTSSSEEEESSEDENQVASSGHTESTISSSGMPNHVGITSTGNVPANPRMAQ
                     FTPLGRSPITSGSTGNSYHPAAPSASQITPSSTSRNKREENRISETHAPINSAAGLVA
                     EYLAKTPTSTSYKPTESTVIGESTPSGSKRTGVMTGTPAKIAPLTNTQNSNNDEEAQL
                     PPMGTFAPPQSQVQPPKGIQTPTRKYTTSIVNKESYSRSKSPPSVHRRRRSSWRDVVG
                     IDVETVENGHSGQNGTGESLPVEVEDSSSEDLSPSSAQPLDVIPNQGYVTTEGGDKNR
                     TAIPRDEQQEIMNTRKILEPGDDLADTAGRFGTRFRRVPKKDLS"
     gene            <191991..>192554
                     /gene="UPS2"
                     /locus_tag="AWJ20_58"
                     /db_xref="GeneID:30037627"
     mRNA            <191991..>192554
                     /gene="UPS2"
                     /locus_tag="AWJ20_58"
                     /product="Ups2p"
                     /transcript_id="XM_018882527.1"
                     /db_xref="GeneID:30037627"
     CDS             191991..192554
                     /gene="UPS2"
                     /locus_tag="AWJ20_58"
                     /note="Mitochondrial intermembrane space protein; involved
                     in phospholipid metabolism; has role in regulation of
                     phospholipid metabolism by inhibiting conversion of
                     phosphatidylethanolamine to phosphatidylcholine; null
                     mutant has defects in mitochondrial morphology; similar to
                     Ups1p, Ups3p and to human PRELI; UPS2 has a paralog, UPS3,
                     that arose from the whole genome duplication;
                     GO_component: GO:0031314 - extrinsic component of
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     19506038]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IEA];
                     GO_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IDA] [PMID 19506038]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0032048 - cardiolipin metabolic
                     process [Evidence IGI] [PMID 19506038]; GO_process:
                     GO:0042407 - cristae formation [Evidence IGI,IMP] [PMID
                     19221197]; GO_process: GO:2001246 - negative regulation of
                     phosphatidylcholine biosynthetic process [Evidence IMP]
                     [PMID 22403410]; GO_process: GO:0046337 -
                     phosphatidylethanolamine metabolic process [Evidence
                     IGI,IMP] [PMID 19221197]"
                     /codon_start=1
                     /product="Ups2p"
                     /protein_id="XP_018734311.1"
                     /db_xref="GeneID:30037627"
                     /translation="MKIFSTQHTFAYDWEHVSCANWKKYPNEMSTHVVAVDVLRREID
                     STTGVLRTERLITCKQAIPSWVLALVGGTDVSYVREVSEVDPKSRSLTLRSVNLTMNQ
                     LLTVYETVNYTPDPANPKQATLFNQEAQITAYASFRRLCSKIEDWTVDRFGQNAALGK
                     KGFESVLSQVAQKVQDGVFRENLAKSA"
     gene            complement(<193004..>194410)
                     /gene="SLM5"
                     /locus_tag="AWJ20_59"
                     /db_xref="GeneID:30037638"
     mRNA            complement(<193004..>194410)
                     /gene="SLM5"
                     /locus_tag="AWJ20_59"
                     /product="asparagine--tRNA ligase SLM5"
                     /transcript_id="XM_018882538.1"
                     /db_xref="GeneID:30037638"
     CDS             complement(193004..194410)
                     /gene="SLM5"
                     /locus_tag="AWJ20_59"
                     /inference="similar to AA sequence:KEGG_Orthology:K01893"
                     /note="Mitochondrial asparaginyl-tRNA synthetase;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]; GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA]; GO_component: GO:0005739 - mitochondrion [Evidence
                     IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005739 - mitochondrion [Evidence IMP]
                     [PMID 9030748]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004812 -
                     aminoacyl-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004816 - asparagine-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004816 -
                     asparagine-tRNA ligase activity [Evidence IDA] [PMID
                     9030748]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_process:
                     GO:0006421 - asparaginyl-tRNA aminoacylation [Evidence
                     IEA]; GO_process: GO:0006421 - asparaginyl-tRNA
                     aminoacylation [Evidence IDA] [PMID 9030748]; GO_process:
                     GO:0070145 - mitochondrial asparaginyl-tRNA aminoacylation
                     [Evidence IMP] [PMID 9030748]; GO_process: GO:0006418 -
                     tRNA aminoacylation for protein translation [Evidence
                     IEA]; GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="asparagine--tRNA ligase SLM5"
                     /protein_id="XP_018734312.1"
                     /db_xref="GeneID:30037638"
                     /translation="MRTSRAVLASVRTIRSLVESPRLGEDATVNGWVRSVRRMKKVAF
                     ADIGDGTSADTLAVVLTPEQSKQLSTGACVQLSGKLSESPGNQKFELQVAEPVPGKPD
                     PVKVLGPADQSYPLQKKFHTAEYLRTIPSFRWKTLGNSSVLRYRSYAQSRIARYFESA
                     GFTQVSSPIITSSDCEGAGEVFTINSGEPDKNQKQPYFFGDKPAYLSVSSQLHLEVYA
                     AALSRVWNMAPAFRAEKSDTNRHLSEFWMVEAELAFTESLKDVMTVAEQMIRAAVPDS
                     AMAIDIIQSNKQSSSTKQETLKQRWQMLSQPKPWARVTYTEAVELLRKEFPSLKWGDS
                     LSSEQEKHLAAHIIQGPVFVTDYPMHQKPFYMKKNAVSDETKATVACFDLLVPEMGEL
                     IGGSLREDDHQTLLSAMNDNNMNPDDLEWYLDLRKYGSFPHGGYGMGFERLVCFVCGV
                     ENIREAIGFPRWAGSCVC"
     gene            <198315..>200189
                     /gene="PLB1"
                     /locus_tag="AWJ20_60"
                     /db_xref="GeneID:30037650"
     mRNA            <198315..>200189
                     /gene="PLB1"
                     /locus_tag="AWJ20_60"
                     /product="Plb1p"
                     /transcript_id="XM_018882549.1"
                     /db_xref="GeneID:30037650"
     CDS             198315..200189
                     /gene="PLB1"
                     /locus_tag="AWJ20_60"
                     /inference="similar to AA sequence:KEGG_Orthology:K13333"
                     /note="Phospholipase B (lysophospholipase) involved in
                     lipid metabolism; required for efficient acyl chain
                     remodeling of newly synthesized
                     phosphatidylethanolamine-derived phosphatidylcholine;
                     required for deacylation of phosphatidylcholine and
                     phosphatidylethanolamine but not phosphatidylinositol;
                     PLB1 has a paralog, PLB3, that arose from the whole genome
                     duplication; GO_component: GO:0031225 - anchored component
                     of membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0042597 -
                     periplasmic space [Evidence IDA] [PMID 8051052];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 16622836]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 8051052];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0004622 - lysophospholipase activity
                     [Evidence IEA]; GO_function: GO:0004622 -
                     lysophospholipase activity [Evidence IMP] [PMID 8051052];
                     GO_function: GO:0004620 - phospholipase activity [Evidence
                     IEA]; GO_process: GO:0006650 - glycerophospholipid
                     metabolic process [Evidence IMP] [PMID 8051052];
                     GO_process: GO:0016042 - lipid catabolic process [Evidence
                     IEA]; GO_process: GO:0006629 - lipid metabolic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0036151 -
                     phosphatidylcholine acyl-chain remodeling [Evidence IMP]
                     [PMID 23501167]; GO_process: GO:0009395 - phospholipid
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Plb1p"
                     /protein_id="XP_018734313.1"
                     /db_xref="GeneID:30037650"
                     /translation="MHFSHILPLLLAVPALAGSPTGGYTPGQVDCPDGSLVRPADSLN
                     PKEADFVQKRHEVARPALIDWLNRANLSDFSADQFLSNSTIPIAIAFSGGGYRAMLAG
                     AGEFSALDNRTANSTNQHHMGGLVQAATYFAGLSGGNWLLGSIVMNNFTSIPELQGSS
                     DVWDLSHSILNPGGINVFSTASYWDDIADDVKSKKKAGFNTSITDIWGRALSHQFFNL
                     SNGGPALTFDDVVNYDVFQNHEMPFPIVVSDGRAPGTTVISTNSTVFELTPYELGSWD
                     PTIYAFTQIKYLGTQVQNGKPVNGTCIAGFDNAGFTIGTSSTLFNQFILQINSTGVSG
                     VVYDLATDILDDIGKKSDDIAIYDPNPFFKVDTVTNGITTNSVLNLVDGGEDNENIPL
                     VPLIQPERKLDVVFAFDNSADTTYNWPNGSSLVASFQRQFGNESNNTIFPYVPDTNTF
                     INNGYTKRPTFFGCNATNLTSLFNDSQSTQDHFVPPLIIYIANFAHSYFSNTSTFKMS
                     YETDEVAGMIENGYNVVTQQNGTIDSDWPACVGCAIIKRELDRRGQSPTDQCQQCFDK
                     YCWDSAVDNQAVNISGENFAPTLSVANHTSSASVATAGSVFTTSLYVICAVGALFLFA
                     "
     gene            complement(<200384..>201934)
                     /locus_tag="AWJ20_61"
                     /db_xref="GeneID:30037661"
     mRNA            complement(<200384..>201934)
                     /locus_tag="AWJ20_61"
                     /product="17-beta-hydroxysteroid dehydrogenase-like
                     protein"
                     /transcript_id="XM_018882560.1"
                     /db_xref="GeneID:30037661"
     CDS             complement(200384..201934)
                     /locus_tag="AWJ20_61"
                     /note="Putative glycoside hydrolase of the mitochondrial
                     intermembrane space; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IDA] [PMID
                     22984289]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0016798 - hydrolase
                     activity, acting on glycosyl bonds [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0008150 - biological_process [Evidence
                     ND]; GO_process: GO:0005975 - carbohydrate metabolic
                     process [Evidence IEA]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="17-beta-hydroxysteroid dehydrogenase-like
                     protein"
                     /protein_id="XP_018734314.1"
                     /db_xref="GeneID:30037661"
                     /translation="MGLGSLIKDKLSKPGGSLSGSGSPTPAAPASTPGQKPSSRQIFQ
                     NRFNHGPNLGGMFVLERWISGDDLFEGTDKTSELEAVKATVKKHGLDGARAKFENHWT
                     SWLDEGNDWNWLQSKGVTAVRVPIGYWTVDNGKFTRHTPFEEYQAVYQNAWNIFKSHV
                     IKPAAARNIAVLIDLHALPGGANEQDHSGTSSGKAEFWSHSSSVDLATDILKFIASDM
                     KSYDNICGIQIINEAPYANNPKHQQNYYFKALSAIRGANPDIPVVISDGWNTQQFISI
                     IKDHEDKLSGDASSLGLIIDTHVYKCFSDEDKRKPPGQLIQDVDSAIPQTGDVDILVG
                     EYSCVMDEGTWKQLPQGQNRDQIVSDYGRRQVSHFYQRAKAGQYFWTYKFHWGSGGEW
                     GFREMSDKGALPDYSQIPSKSPDVYQNAFNDRLKSSLDEHVNYWKGQDANKDWQNWRY
                     EDGFTIGWHDAQAFDEFNHSEIGRWVAWKKSRLSQHVQQKGSSDLLWVFSHGFDKGVE
                     QFIATRNS"
     gene            complement(<203639..>205672)
                     /gene="VPS1"
                     /locus_tag="AWJ20_62"
                     /db_xref="GeneID:30037672"
     mRNA            complement(<203639..>205672)
                     /gene="VPS1"
                     /locus_tag="AWJ20_62"
                     /product="dynamin-like GTPase VPS1"
                     /transcript_id="XM_018882570.1"
                     /db_xref="GeneID:30037672"
     CDS             complement(203639..205672)
                     /gene="VPS1"
                     /locus_tag="AWJ20_62"
                     /inference="similar to AA sequence:KEGG_Orthology:K17065"
                     /note="Dynamin-like GTPase required for vacuolar sorting;
                     also involved in actin cytoskeleton organization,
                     endocytosis, late Golgi-retention of some proteins,
                     regulation of peroxisome biogenesis; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IDA] [PMID
                     20841380]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA]; GO_component: GO:0005856 - cytoskeleton [Evidence
                     IEA,IEA]; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 15550248]; GO_component:
                     GO:0005874 - microtubule [Evidence IEA]; GO_component:
                     GO:0005741 - mitochondrial outer membrane [Evidence IDA]
                     [PMID 16407407]; GO_component: GO:0005777 - peroxisome
                     [Evidence IDA] [PMID 16520372]; GO_function: GO:0005525 -
                     GTP binding [Evidence IEA,IEA]; GO_function: GO:0003924 -
                     GTPase activity [Evidence IEA]; GO_function: GO:0003924 -
                     GTPase activity [Evidence IDA,ISS] [PMID 8299420];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0006184 - GTP catabolic process
                     [Evidence IEA]; GO_process: GO:0030036 - actin
                     cytoskeleton organization [Evidence IGI,IMP,IPI] [PMID
                     15265985]; GO_process: GO:0007049 - cell cycle [Evidence
                     IEA]; GO_process: GO:0051301 - cell division [Evidence
                     IEA]; GO_process: GO:0006897 - endocytosis [Evidence
                     IGI,IMP] [PMID 20841380]; GO_process: GO:0060988 - lipid
                     tube assembly [Evidence IDA] [PMID 20841380]; GO_process:
                     GO:0007126 - meiotic nuclear division [Evidence IEA];
                     GO_process: GO:0016559 - peroxisome fission [Evidence IMP]
                     [PMID 18445678]; GO_process: GO:0007031 - peroxisome
                     organization [Evidence IDA,IGI,IMP] [PMID 12707309];
                     GO_process: GO:0045053 - protein retention in Golgi
                     apparatus [Evidence IMP] [PMID 8649377]; GO_process:
                     GO:0006623 - protein targeting to vacuole [Evidence IMP]
                     [PMID 8299420]; GO_process: GO:0007034 - vacuolar
                     transport [Evidence IMP] [PMID 8299420]"
                     /codon_start=1
                     /product="dynamin-like GTPase VPS1"
                     /protein_id="XP_018734315.1"
                     /db_xref="GeneID:30037672"
                     /translation="MDQHLISTVNRLQDAFATLGPTTNPIDLPQITVVGSQSSGKSSV
                     LENIVGRDFLPRGTGIVTRRPLVLQLTNVKAGYHKAPEGVTFKDGENADEWGEFLHNP
                     GKKFYDFNEIRNEIVRETDAKTGKNAGISSQPINLRIYSPNVLTLTLVDLPGLTKVPV
                     GDQPKDIERQIKEMVLKFITKPNAIILSVTAANTDLANSDGLKLAREVDPEGARTIGV
                     LTKVDLMDQGTDVVDILAGRVIPLRYGYVPVINRGQKDIETHKSIKNALDFERKFFEE
                     HPSYRAKAQYCGTPFLARKLNMILMHHIKTTLPDIKARIHSTLAKYQLELAQLGEDAS
                     LLGSPSNIILNIITELANEYRTILDGNSQDLSTNELSGGARISFVFHELYSNGVKAVD
                     PFDQVKDVDIRTILYNSSGSSPSLFVATQGFEVIVKQQIKRFEDPSLRCVALVYDELV
                     RIINGILQKPIYRRYPNLKEQLYNTIVVFLKNCVNPTNKLVSDLVSMEASYVNTAHPD
                     FINGHSAMAQVNEKLHPTKMDPKTGKPIITQPSSSASPEPDGSGGFFGSFFASKNKKR
                     LAAMEPPPTVLKASGTLSERETMETDVIKLLISSYFNIVKRTMIDMVPKAIILNLVKH
                     SKEEMQRELLEKLYKSDQLNEMLKESDFTVQRRKECQKMIASLETAAEIVSSV"
     gene            complement(<206199..>208523)
                     /gene="LAS17"
                     /locus_tag="AWJ20_63"
                     /db_xref="GeneID:30037683"
     mRNA            complement(<206199..>208523)
                     /gene="LAS17"
                     /locus_tag="AWJ20_63"
                     /product="Las17p"
                     /transcript_id="XM_018882581.1"
                     /db_xref="GeneID:30037683"
     CDS             complement(206199..208523)
                     /gene="LAS17"
                     /locus_tag="AWJ20_63"
                     /inference="similar to AA sequence:KEGG_Orthology:K05747"
                     /note="Actin assembly factor; C-terminal WCA domain
                     activates Arp2/3 complex-mediated nucleation of branched
                     actin filaments and a polyproline domain which can
                     nucleate actin filaments independent of Arp2/3; mutants
                     are defective in actin cytoskeleton dependent processes
                     such as: endocytosis, bud site selection and cytokinesis;
                     localizes with the Arp2/3 complex to actin cortical
                     patches; homolog of the Wiskott-Aldrich Syndrome protein
                     (WASP), implicated in severe immunodeficiency;
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     IEA]; GO_component: GO:0030479 - actin cortical patch
                     [Evidence IDA] [PMID 10512884]; GO_component: GO:0030479 -
                     actin cortical patch [Evidence IDA] [PMID 9024694];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0043332 - mating projection
                     tip [Evidence IDA] [PMID 19053807]; GO_function:
                     GO:0003779 - actin binding [Evidence IEA]; GO_function:
                     GO:0003779 - actin binding [Evidence IDA] [PMID 10512884];
                     GO_function: GO:0003779 - actin binding [Evidence IDA,IPI]
                     [PMID 23290554]; GO_process: GO:0051666 - actin cortical
                     patch localization [Evidence IGI,IMP] [PMID 18177206];
                     GO_process: GO:0007015 - actin filament organization
                     [Evidence IEA]; GO_process: GO:0007015 - actin filament
                     organization [Evidence IDA] [PMID 9214384]; GO_process:
                     GO:0030041 - actin filament polymerization [Evidence IDA]
                     [PMID 22973053]; GO_process: GO:0045010 - actin nucleation
                     [Evidence IDA] [PMID 23290554]; GO_process: GO:0006897 -
                     endocytosis [Evidence IEA]; GO_process: GO:2000601 -
                     positive regulation of Arp2/3 complex-mediated actin
                     nucleation [Evidence IEA]; GO_process: GO:2000601 -
                     positive regulation of Arp2/3 complex-mediated actin
                     nucleation [Evidence IDA] [PMID 10322115]; GO_process:
                     GO:0032233 - positive regulation of actin filament bundle
                     assembly [Evidence IDA] [PMID 19158382]"
                     /codon_start=1
                     /product="Las17p"
                     /protein_id="XP_018734316.1"
                     /db_xref="GeneID:30037683"
                     /translation="MAILKDADKEKVKRAIPKASNKIVDATVARLYIAYPDANSWTYT
                     GLSGAITLVNDLVGNTFFLKLVDIATHRGVIWDQELYINFKYNQDRSFFHTFELDECL
                     AGLLFEEESEASHFFKRVQNKEKYASKATLNNKNAIALKKTANKIQANTPAPQGPRGD
                     PTGLRRRLYLEGSSGPVYYDSEPPPEWRPLYAELASQGITEEMIAENREFIKEYIRQQ
                     GGPLVGLEPPIPRRSAPSSAATESTSNGSSGISNGRNRSDSSVTVASVGSGTSESSST
                     KATRKAKAPPPPPPPGPPNVPKKATPPSTSAPSASAGPPSVAPISTSVPSGSSASSPS
                     PEPGTPSSATATPTSYKVPPPMPFIGQRVASNPSRPSAPATAPGGVPPPPPPPGSARP
                     VPSLPPRGSVPPPPANANPYGTPPYQQQPPPASPYGQQPTSPYGQPPGTAGRPVPPPP
                     SLPPRGVANNGQAPQFGMPPPPAPGAAGAGQYIPPAPPQRGAVPPPPPPQRGGVPPPP
                     PPSRVQQPPPAAGVPPPPPPPPPGQPELQPPTFNPYQTPPPPQSQPQAVSPPVKIDVK
                     PISSFPPPPRPHNAGTPPVASVAPPASTSQPPAPPPPPPPAAAPPSFNNAAVPPPPPP
                     PPPPTAGVPPPPPPPPAPPGPPPAFGSAAPPPPPPPPPGGAPGAPPPPPPLQADAGGP
                     PAPPLPTGDGGRDALLASIRGAGIGSLRKVDKSQLDRPSVILQEARGETPTPAPSAAP
                     GGNASLADALASALNARKGKVALSDDEDDDEDWD"
     gene            complement(<210307..>211734)
                     /locus_tag="AWJ20_64"
                     /db_xref="GeneID:30037694"
     mRNA            complement(<210307..>211734)
                     /locus_tag="AWJ20_64"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882591.1"
                     /db_xref="GeneID:30037694"
     CDS             complement(210307..211734)
                     /locus_tag="AWJ20_64"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734317.1"
                     /db_xref="GeneID:30037694"
                     /translation="MITPFSFFRRSKRETLSAKPVASLGPCICTRNISSQTGSNSVDL
                     TSPLEPTDSRESSSSLSSSCASSNLDVSSVSQVSYPNEPPCPKGGSEDPIFLPNEVLL
                     QRFSNRKSGLKLSKWKMEQQRLKCRRCSTATTASTNPDNTSSTSGRSSYTAGGVTMSA
                     FAASASASASASATATSTTSRCNTSSTSASVSASSTGNTTLECTTLTGSTGSITVSTQ
                     CPASYKYSSSGSTTAAITENCHDELSDQTHPGVIYVTSERLIFVPKSELIDGYTLDIT
                     SLSCMKAIESTKRVWFFVCYKDNNSIATIPFSSQARCQAFLRLIKNIRFEHMVRQCLP
                     PRYTHYSIPEETNSTMDTDSDSPADSNYTLSSSTPPNDNGSSEFQPDEWWYGDNQLPS
                     YNDSEEALHKYLTNLGLLTETEPLDRTERISRLIALATVPQSVALDDSTSTTTSSSSS
                     NRSNVPRTTQTAAAHEAYHSPYVWF"
     gene            complement(<215475..>216728)
                     /locus_tag="AWJ20_65"
                     /db_xref="GeneID:30037705"
     mRNA            complement(<215475..>216728)
                     /locus_tag="AWJ20_65"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882601.1"
                     /db_xref="GeneID:30037705"
     CDS             complement(215475..216728)
                     /locus_tag="AWJ20_65"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734318.1"
                     /db_xref="GeneID:30037705"
                     /translation="MIRRQSIPLSLLTNNPVSSILNNGMSSENRDGTAGTPAAVGGSG
                     ASRINSILNPKPEYQTSALRYRTSPSQAISGVHATARVQHTPSGGLHGSEFSSPTSSS
                     DLTDSAESEEDSGSFNRGLNRASTAGTVSSLTTHGTNGTNTANRTNMMNRMNSMNNST
                     LSSRSSSSSNSSGISISSITNNNNSTSTSLSTAPAPRPTRAKREEQPGSGAEPQPPEA
                     HTPHPDPLSTRAPSASPPAGKPAGSHRRKSSVFNGNSETGLANYIKVPLKKRTRDQVD
                     DGAGNDDDTESLEYQYQCLDCLDRFSSTSELRQHKKNLHHIQTYKCRKCGELFRSIAD
                     RQTHKNNKHFDTITCTIEGDNFREFKQGSTVSSNRNGAGYFSCPVDYCTFLTRIPGYW
                     YDHVHHVEHHGENPQKRKKRASMAP"
     gene            complement(<217960..>219288)
                     /gene="CAF40"
                     /locus_tag="AWJ20_66"
                     /db_xref="GeneID:30037716"
     mRNA            complement(<217960..>219288)
                     /gene="CAF40"
                     /locus_tag="AWJ20_66"
                     /product="CCR4-NOT core subunit CAF40"
                     /transcript_id="XM_018882612.1"
                     /db_xref="GeneID:30037716"
     CDS             complement(217960..219288)
                     /gene="CAF40"
                     /locus_tag="AWJ20_66"
                     /inference="similar to AA sequence:KEGG_Orthology:K12606"
                     /note="Component of the CCR4-NOT transcriptional complex;
                     evolutionarily conserved; involved in controlling mRNA
                     initiation, elongation, and degradation; binds Cdc39p;
                     GO_component: GO:0030015 - CCR4-NOT core complex [Evidence
                     IPI] [PMID 11733989]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0032968 -
                     positive regulation of transcription elongation from RNA
                     polymerase II promoter [Evidence IDA,IPI] [PMID 21406554];
                     GO_process: GO:0006357 - regulation of transcription from
                     RNA polymerase II promoter [Evidence IPI] [PMID 11733989];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="CCR4-NOT core subunit CAF40"
                     /protein_id="XP_018734319.1"
                     /db_xref="GeneID:30037716"
                     /translation="MYANVARQQGGAEQGPPGPNYAQLPQHQHPQQQPQQPQQQQQQQ
                     QQQQQQLHPQQAQAQAQAQGQAPGPGQPQNHPQSQSQHQQQQQQQQQPQQNPGQPHLM
                     SQGPSQGNLGGGNIGANIGGNGTGLPAGISASALNIINAANSSAGQAGTGLPLPIPTD
                     QGNEERHTSDDDRVFAWILELMHGPNREQALLELGKKREQYDELALILWHSFGVMTCL
                     LQEIISVYPLLSPPQLSSPASNRVCNALALLQCVASHDQTRNLFLNAHIPLFIYPFLN
                     TSSKSRAFEYLRLTSLGVVGALVKNDSPEVISFLLSTEIIPLCLSIMESGTELSKTVA
                     IFIVQKILMDDMGLNYVCQTYERFFAVSVVLSNMVAQLVALPPASSRLLKHVVRCYLR
                     LSDNGRAREALRQILPEPLRDATFSYTLRDDAGTKRCLAQLLVNLSDNYE"
     gene            <227115..>228152
                     /gene="HRR25"
                     /locus_tag="AWJ20_67"
                     /db_xref="GeneID:30037727"
     mRNA            <227115..>228152
                     /gene="HRR25"
                     /locus_tag="AWJ20_67"
                     /product="serine/threonine protein kinase HRR25"
                     /transcript_id="XM_018882623.1"
                     /db_xref="GeneID:30037727"
     CDS             227115..228152
                     /gene="HRR25"
                     /locus_tag="AWJ20_67"
                     /inference="similar to AA sequence:KEGG_Orthology:K14758"
                     /codon_start=1
                     /product="serine/threonine protein kinase HRR25"
                     /protein_id="XP_018734320.1"
                     /db_xref="GeneID:30037727"
                     /translation="MGIGRRGNQVNVIDFGLAKKFRDPRTYMHIPYRENKNLTGTARY
                     ASINTHLGVEQSRRDDLESLAYVLIYFCRGSLPWQGLKAQTKKEKYDRIMEKKMTTST
                     EALTRGLPCEFTIILNYARSLTFDDKPDYLYLHRVVRELFNRQGYQYDYVFDWTIYKH
                     HQQKQAENNGANGSNAKNNNGGTGGAGAGATGGASVTNNGNAAALPSSSQPKLLGGPS
                     QSGQAVNQSSSAQAQAQAQAQAAQAQVQAQAQAQMAQAQAQLQAQAQLQRQQQVLAGN
                     GQGHVSHPSSSNLHNEATGGYYRGYDDSMARYNKSGSPQEQGGQAHPQAKRQDSDPLI
                     DALQLGNQAWL"
     gene            <228875..>230263
                     /gene="NPY1"
                     /locus_tag="AWJ20_68"
                     /db_xref="GeneID:30037738"
     mRNA            <228875..>230263
                     /gene="NPY1"
                     /locus_tag="AWJ20_68"
                     /product="NAD(+) diphosphatase"
                     /transcript_id="XM_018882634.1"
                     /db_xref="GeneID:30037738"
     CDS             228875..230263
                     /gene="NPY1"
                     /locus_tag="AWJ20_68"
                     /inference="similar to AA sequence:KEGG_Orthology:K03426"
                     /note="NADH diphosphatase (pyrophosphatase); hydrolyzes
                     the pyrophosphate linkage in NADH and related nucleotides;
                     localizes to peroxisomes; nudix hydrolase family member;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005777 - peroxisome [Evidence
                     IDA] [PMID 11361135]; GO_function: GO:0000210 - NAD+
                     diphosphatase activity [Evidence IEA]; GO_function:
                     GO:0000210 - NAD+ diphosphatase activity [Evidence IDA]
                     [PMID 11361135]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA,IEA]; GO_process:
                     GO:0006734 - NADH metabolic process [Evidence IDA] [PMID
                     11361135]"
                     /codon_start=1
                     /product="NAD(+) diphosphatase"
                     /protein_id="XP_018734321.1"
                     /db_xref="GeneID:30037738"
                     /translation="MLTAARLRRVYSMVASSSVDIAATGAGAGAGGIPLGPVSRVYGP
                     ETKNFYSGNPLNRISFARDDYEFLDRALKHKGTRFLTLRDLDVSTRKLRPEQIVSAGS
                     GHQIKSELAYLGYEDVKNIVGDPFSKPEKDQIKAWSSKRDAIGIGRVATVFLGIDESA
                     PEATHVNYKHFRGQAYFAVDVTPERVTDSGLKSSVEQLLESKYTSSVSTTGAERSEEI
                     DYEKAEHRNLRFGPRLSTESYALYAQARMYIDWNNRNKFCGGCGSRNMSVNGGTKLVC
                     PSHDDGVELPFCETRGVVTNLSFPRTDTSIIVAVVNRSNDRILLGCGRRFPKGFYSCL
                     AGFLEPAESIEDCVRREVYEESGVTVGRVHVHSTQPWPYPANIMVGCIAEVADDTPEA
                     SKIHLGHDPELLDAQWFTFDEVRKAVHRSKQPGYRFGATNDYPLNVPGPEAIANILID
                     AVVSTSSSLSKI"
     gene            <233185..>235227
                     /gene="MSS4"
                     /locus_tag="AWJ20_69"
                     /db_xref="GeneID:30037749"
     mRNA            <233185..>235227
                     /gene="MSS4"
                     /locus_tag="AWJ20_69"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018882645.1"
                     /db_xref="GeneID:30037749"
     CDS             233185..235227
                     /gene="MSS4"
                     /locus_tag="AWJ20_69"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018734322.1"
                     /db_xref="GeneID:30037749"
                     /translation="MKVSIRSGGCYCVFTPANKLGIKQVVAAPLTQGSVHKVTYGPNY
                     CPSSEGKYYEVSAALLSQRPANTLGIKQVVTAPLTQGPVHKVPRRPVLSDIQRLNSVA
                     KVDVCEQQDRRRSARPFDFPSPLDSSVSVESNETLYEPTSWKHTKAIDIVGEHTTCEE
                     LNNTCSAPIDQDDDKCSKWSFESGNEAAFICHQIQNAWSEVNTEAAWTSLAASWALPD
                     CPIEIDEASPSIDSHCDVTLVESHLKTSSSTLAGPEDSNHSLSVAETTSAKVDDQTPC
                     AIADAPTTEGSCSIDSLDADVVNLSKGLPQSIVSGSLQADPESELLKTAPLAPSSEPI
                     AQTTSDDLVIPVEGFDKSKTSLFLTRVKAKMASFTGIGAPISRSTLMFNGVQTATYAN
                     PPPCSQESLTKANKTYRLDGGAFIKAYSPIVYHYIRTLCGIDYQEFLNSFVLHSDLTK
                     TKSPGKSGSDFLFTPDGKYIIKTIKRKEHKVISNVDFLGDYYNHIKAHPSTQLPFYLG
                     NYTLLADGKKTHFVVMKNLLQKETELIYDLKGSSHGRHAGPRKDNRGRVVFKDLDWID
                     KNEAISMTQEDRDKLMVQVSKDVDLLMRHNIMDYSLLVGLQTDTGTCEQRPVIGMIDT
                     LCPFGWRKRAENLSKSLFLGASAIDVVHPEKYGTRFLNFVQSAVIPGPGRSVSTHC"
     gene            complement(<237728..>238030)
                     /gene="GLO2"
                     /locus_tag="AWJ20_70"
                     /db_xref="GeneID:30037761"
     mRNA            complement(<237728..>238030)
                     /gene="GLO2"
                     /locus_tag="AWJ20_70"
                     /product="hydroxyacylglutathione hydrolase GLO2"
                     /transcript_id="XM_018882655.1"
                     /db_xref="GeneID:30037761"
     CDS             complement(237728..238030)
                     /gene="GLO2"
                     /locus_tag="AWJ20_70"
                     /inference="similar to AA sequence:KEGG_Orthology:K01069"
                     /note="Cytoplasmic glyoxalase II; catalyzes the hydrolysis
                     of S-D-lactoylglutathione into glutathione and D-lactate;
                     GLO2 has a paralog, GLO4, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 9261170]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004416 - hydroxyacylglutathione hydrolase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004416 -
                     hydroxyacylglutathione hydrolase activity [Evidence
                     IDA,IGI,IMP] [PMID 9261170]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0008270
                     - zinc ion binding [Evidence IEA]; GO_process: GO:0006750
                     - glutathione biosynthetic process [Evidence IEA];
                     GO_process: GO:0019243 - methylglyoxal catabolic process
                     to D-lactate [Evidence IDA,IGI,IMP] [PMID 9261170]"
                     /codon_start=1
                     /product="hydroxyacylglutathione hydrolase GLO2"
                     /protein_id="XP_018734323.1"
                     /db_xref="GeneID:30037761"
                     /translation="MVTALVSVLGSLPDDTKVYPGHEYTASNLKFVKTVLNNEAVSKL
                     DKFTAQNEQTTGAFTIGDEKQYNPFMMVDSPVIKKAVGLDDRVDVMHKLRELKNKM"
     gene            <240865..>241452
                     /locus_tag="AWJ20_71"
                     /db_xref="GeneID:30037772"
     mRNA            <240865..>241452
                     /locus_tag="AWJ20_71"
                     /product="glycerophosphoryl diester phosphodiesterase
                     (predicted)"
                     /transcript_id="XM_018882666.1"
                     /db_xref="GeneID:30037772"
     CDS             240865..241452
                     /locus_tag="AWJ20_71"
                     /codon_start=1
                     /product="glycerophosphoryl diester phosphodiesterase
                     (predicted)"
                     /protein_id="XP_018734324.1"
                     /db_xref="GeneID:30037772"
                     /translation="MLDIKRTNEPWVIPKIVEDLKKVNSDLDFWGRRMVLGIWRWDVL
                     ESANSSCPTLPVLHIGFSRSLARKFLAQSQVVGISLNVVSLNVPGGSSLIHEAKQLGK
                     LTYAWTVNQKPAMKWAASMDLDGIITDHPDVYAKFIGDVTEKEIETIYAVKEPSAFYT
                     FSEKMSYRLKFAVMWMWVFYLQVSDFFFPSAKGPF"
     gene            <242359..>244443
                     /gene="SEC63"
                     /locus_tag="AWJ20_72"
                     /db_xref="GeneID:30037783"
     mRNA            <242359..>244443
                     /gene="SEC63"
                     /locus_tag="AWJ20_72"
                     /product="protein-transporting protein SEC63"
                     /transcript_id="XM_018882677.1"
                     /db_xref="GeneID:30037783"
     CDS             242359..244443
                     /gene="SEC63"
                     /locus_tag="AWJ20_72"
                     /inference="similar to AA sequence:KEGG_Orthology:K09540"
                     /codon_start=1
                     /product="protein-transporting protein SEC63"
                     /protein_id="XP_018734325.1"
                     /db_xref="GeneID:30037783"
                     /translation="MSDSRYSYDDNGEVWPYFAATLLGVVLVPMTGLAVVGSGSSSGD
                     QQQQQKVGGTSGKKGDSKTKEKSEFKPRNYKQLSKFRSSRKSLFTAYNGLIAAGWLVM
                     AGLVYIIIQQRILSASDTSKVTFDPYEILGVSYSASEKEIKSVYRKLSVKLHPDKIKA
                     SDLANQTREFFEARYVDITKAYKALTDETVRDNFLKYGHPDGPQQTSHGIALPKFLVE
                     GKGSPIVIALYSSVVGILLPLLVGSWWAGTAIYTKTGIRQTTAGKFFEICAKDQPHFI
                     TYDRILEILAQSEELELIGKANKGKLGALNSKQIKQVLEDYLNRRETNEKDIDVDTQL
                     EIVSVTPLLLDGLLDISSAFKSATLCQRVIEVKRCIVQAVPFKDQSHGEFLQIPGVQL
                     DTKAKDSSSASSSSWEKSLSSTELEAARQIPKLHFLNAYFKVPGESVVPPNAQAHLII
                     KFAVTPLGGSSKPPKPEEFDPVLLEDPVDDDETSKVLREPLHTNDLPPVIPYASAPYF
                     PGVYRPNWYGFIVNEKDNKIIDGPAELTRLSYQNLSLSDKDISSKSADNKLAVATFKI
                     QLTTATPPFPGTFSFKLMLLSSGYFGTDIIESVKMTVENPPAVAETTAQDDEDDISEP
                     EEDSVAGALSQMRGGSVKKRAPTSSSTTTDKNDDDEDESSDDEEDLTDIDTDTEDEED
                     LDDEDSDAKKNK"
     gene            complement(<245468..>246964)
                     /gene="CUE5"
                     /locus_tag="AWJ20_73"
                     /db_xref="GeneID:30037794"
     mRNA            complement(<245468..>246964)
                     /gene="CUE5"
                     /locus_tag="AWJ20_73"
                     /product="Cue5p"
                     /transcript_id="XM_018882688.1"
                     /db_xref="GeneID:30037794"
     CDS             complement(245468..246964)
                     /gene="CUE5"
                     /locus_tag="AWJ20_73"
                     /note="Ubiquitin-binding protein; contains a CUE domain
                     that binds ubiquitin, which may facilitate intramolecular
                     monoubiquitination; green fluorescent protein (GFP)-fusion
                     protein localizes to the cytoplasm in a punctate pattern;
                     CUE5 has a paralog, DON1, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0043130 -
                     ubiquitin binding [Evidence IDA] [PMID 12628920];
                     GO_process: GO:0008150 - biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Cue5p"
                     /protein_id="XP_018734326.1"
                     /db_xref="GeneID:30037794"
                     /translation="MAPKSAKGDKKSQSAAAETDKTAAEETVKSKSAELTAESDTKSK
                     DESTESKDTDADVAGSGGSDSNANAKSDADISSATAATTTTATSTTGATEGDGEGEDG
                     KPPAKPARPMSPHAEAQATLEEAFPGVEKSVIRAVLIASQYKLDPAFNALLAMNDPDF
                     KPEDSFPVETDEPSAARPRGPDPKQLAEDEALARKLAAEYNRSAGSRQPPPPPLRRTS
                     TANSGDYNSSSRVRQSTSSYSGRYDEPRPVENERSFFDDDLPEIKATFEKGFNETKTK
                     VSNWMNNFRKKIDGEGGQPGIFGALGGTGNSPRSSYDNQYSYRRTSNDEYDNRQPPPR
                     PARYNNGNRRVYDRDPDEINDDFQGVTLQDDVDEAAPPKPPRPSGESGRTGSANSTTA
                     TTTVKKTTTSTSTGTKGASEDSSKPPTTRPRAVSALGDDDPEEITKSFAPPPLSAAKL
                     SSGTSGATAKWEPLKAVAPEPESDKDAFFIGDSDEDDDDDEPLATLKK"
     gene            <248059..>249867
                     /gene="MEX67"
                     /locus_tag="AWJ20_74"
                     /db_xref="GeneID:30037805"
     mRNA            <248059..>249867
                     /gene="MEX67"
                     /locus_tag="AWJ20_74"
                     /product="Mex67p"
                     /transcript_id="XM_018882698.1"
                     /db_xref="GeneID:30037805"
     CDS             248059..249867
                     /gene="MEX67"
                     /locus_tag="AWJ20_74"
                     /inference="similar to AA sequence:KEGG_Orthology:K14284"
                     /note="Poly(A)RNA binding protein involved in nuclear mRNA
                     export; component of the nuclear pore; ortholog of human
                     TAP; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 10684247]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0042272 - nuclear RNA export factor
                     complex [Evidence IPI] [PMID 9774696]; GO_component:
                     GO:0005643 - nuclear pore [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0030687 - preribosome, large subunit
                     precursor [Evidence IDA] [PMID 23212245]; GO_function:
                     GO:0003723 - RNA binding [Evidence IDA] [PMID 12524544];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_function: GO:0005515 - protein binding
                     [Evidence IPI] [PMID 12411502]; GO_process: GO:0006406 -
                     mRNA export from nucleus [Evidence IMP] [PMID 10722667];
                     GO_process: GO:0051028 - mRNA transport [Evidence
                     IEA,IEA]; GO_process: GO:0000055 - ribosomal large subunit
                     export from nucleus [Evidence IGI,IMP] [PMID 17434126];
                     GO_process: GO:0000056 - ribosomal small subunit export
                     from nucleus [Evidence IMP] [PMID 22956913]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mex67p"
                     /protein_id="XP_018734327.1"
                     /db_xref="GeneID:30037805"
                     /translation="MSWRGGRGRGNSSNNNYNNGGDFGSRLGGTQSSGFGSGGSSHNN
                     NATVEIRGWEGGTRDDLVAFILRKCSIKLQNVIVNGGVISAGVKQEEAGPLVKWSGVR
                     FAGAPLRITIVESNKPSSASNPPTYGTVEILRNFLQSRYNAQISMLDLQNLKNDVYLQ
                     QNGLFASASTASKMFPALMKIAGELASGQQRMVVESVNLAANELQEVTGVTTLAQAFP
                     DLKNLSLANNNITRLKGLEPWRHKFRLLRELILSGNPVTEQPGYKEEMMKMFPRLIML
                     DGQMIRDESTLDQLKLPLPVKQMFFENPDVQGIATSFLTNFFNAFDHDRAQLAQLYDE
                     TSTFSISVNSSSPRVMPGGGTTAPSQAGWSAYIPLSRNLQKVTTESARINRLAIGPQA
                     ILNAFRRIPPTKHPLMESPDKFAVETWHTNGVRAADDTGIMISIHGEFSEQQTNTVRS
                     FDRTFILIQGPAGNMIVASDIMTVRSWGGSESWKESVLPPPTVPTTVPGVNTPSAGAG
                     GVNGIPPPAPTINPMNPSAPPPIMATGTPPTVNTPPELADLPPPQLAIVQQLMQETRL
                     TPQYSRMLAEQANFDLNQAAVLFQQSRQQLPPSAFL"
     gene            complement(<251796..>253397)
                     /gene="ERG5"
                     /locus_tag="AWJ20_75"
                     /db_xref="GeneID:30037816"
     mRNA            complement(<251796..>253397)
                     /gene="ERG5"
                     /locus_tag="AWJ20_75"
                     /product="C-22 sterol desaturase"
                     /transcript_id="XM_018882709.1"
                     /db_xref="GeneID:30037816"
     CDS             complement(251796..253397)
                     /gene="ERG5"
                     /locus_tag="AWJ20_75"
                     /inference="similar to AA sequence:KEGG_Orthology:K09831"
                     /note="C-22 sterol desaturase; a cytochrome P450 enzyme
                     that catalyzes the formation of the C-22(23) double bond
                     in the sterol side chain in ergosterol biosynthesis; may
                     be a target of azole antifungal drugs; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0000249 - C-22 sterol
                     desaturase activity [Evidence IDA] [PMID 8543054];
                     GO_function: GO:0020037 - heme binding [Evidence IEA];
                     GO_function: GO:0005506 - iron ion binding [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0004497 - monooxygenase activity
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0016705 -
                     oxidoreductase activity, acting on paired donors, with
                     incorporation or reduction of molecular oxygen [Evidence
                     IEA]; GO_process: GO:0006696 - ergosterol biosynthetic
                     process [Evidence IDA] [PMID 8543054]; GO_process:
                     GO:0006696 - ergosterol biosynthetic process [Evidence
                     IMP] [PMID 8635732]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006694 - steroid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008202 - steroid metabolic
                     process [Evidence IEA]; GO_process: GO:0016126 - sterol
                     biosynthetic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="C-22 sterol desaturase"
                     /protein_id="XP_018734328.1"
                     /db_xref="GeneID:30037816"
                     /translation="MSVENASVFTDQLPLDADNLSQSLTSSLIVQAIVWSRSNVWSLV
                     LTVVVGLLIYDQISYIIKKGSIAGPKFKVWPVIGPFLESMNPKFEEYKAKWDSGPLSC
                     VSVFHKFVVIASNRDLARKIFNSPSYVKPCVVDVAIKLLRPTNWVFLDGKAHVDYRRS
                     LNGLFTRQALGVYLPHQETIYDKYFERFVALSKSNKGPLPFMPEFRELNCAVSLRTFC
                     GEYITEEQVKIISDNYYKITAALELVNFPIILPFTKTWYGKKITDMTMDIFAKCAQMA
                     KDHIAQGGDVTCVMDAWVKLMHDSKNSTSDDNDEVKKFLVRDFTNKEISETIFTFLFA
                     SQDASSSATTWLFQIIADRPDVMAKIREEQLRVRDGDVHRRLDVDLVESMEYTRMVVK
                     EALRYRPPVTMVPYVAKKSYPISADYTIPKGAMVIPTLYPALHDPEVYENPDEFIPER
                     WVANSPATNAAKNWLVFGTGPHVCLGQTYVMLNLTAMMGKAALFYDWKHTVTEKSENI
                     RVFATIFPDDDCILEFSKRADPTKL"
     gene            complement(<255830..>256993)
                     /gene="UGA4"
                     /locus_tag="AWJ20_76"
                     /db_xref="GeneID:30037827"
     mRNA            complement(<255830..>256993)
                     /gene="UGA4"
                     /locus_tag="AWJ20_76"
                     /product="Uga4p"
                     /transcript_id="XM_018882720.1"
                     /db_xref="GeneID:30037827"
     CDS             complement(255830..256993)
                     /gene="UGA4"
                     /locus_tag="AWJ20_76"
                     /note="GABA (gamma-aminobutyrate) permease; serves as a
                     GABA transport protein involved in the utilization of GABA
                     as a nitrogen source; catalyzes the transport of
                     putrescine and delta-aminolevulinic acid (ALA); localized
                     to the vacuolar membrane; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     14985124]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005774 - vacuolar membrane
                     [Evidence IEA]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA]; GO_function: GO:0015171 - amino acid
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015495 - gamma-aminobutyric acid:proton
                     symporter activity [Evidence IGI] [PMID 8455553];
                     GO_function: GO:0015489 - putrescine transmembrane
                     transporter activity [Evidence IGI] [PMID 14985124];
                     GO_process: GO:0003333 - amino acid transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA]; GO_process: GO:0015812 -
                     gamma-aminobutyric acid transport [Evidence IGI] [PMID
                     14985124]; GO_process: GO:0015812 - gamma-aminobutyric
                     acid transport [Evidence IEP,IGI] [PMID 8455553];
                     GO_process: GO:0015847 - putrescine transport [Evidence
                     IGI] [PMID 14985124]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IGI] [PMID
                     8455553]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Uga4p"
                     /protein_id="XP_018734329.1"
                     /db_xref="GeneID:30037827"
                     /translation="MFSEAKVFGLDFNVDVSNVRFRAVQWIVSEAILGLCLLINYLHP
                     KYYKYAFRICMGIVILDFLLNVIWLPIGVSQTYGFQSADFVFTNFENETGGASNTWAW
                     MLCFFATAGVQVGFDASAHVAEETKNASVTAAKGLIYSAIACTLMAAPIILIFLFCTP
                     DLDVLFSFDAPQPFVQIYALALGKRAHCVMTALSVLSTLASSIVSIVAASRLVYAIAR
                     DGVLPFSGWISKVSPKTNQPTNAITFIGIVSAILLCSILPSALAFQSLVSISGVPTVS
                     AWGLISFGRFFLSKQTAFKPKLSLGVFSKPFQLISFLWNTYLAGILFSPQEFPVTAQN
                     LNYAPIIMGIVTMFALCAYFIIPEERWLKLKSNVLGIEENSDTDSSQHSSSQS"
     gene            <259206..>260735
                     /locus_tag="AWJ20_77"
                     /db_xref="GeneID:30037838"
     mRNA            <259206..>260735
                     /locus_tag="AWJ20_77"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882731.1"
                     /db_xref="GeneID:30037838"
     CDS             259206..260735
                     /locus_tag="AWJ20_77"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734330.1"
                     /db_xref="GeneID:30037838"
                     /translation="MVDDGMKQDEVLEVIADADSTFSDDLFGIVIKDDVLYKKQVLVQ
                     KALDDIGMTPFHWKLFFLNSFGYASDSLLVVCQSIAQPQVNLEFGRENDRIPGVSTAS
                     AVGLLVGAIFWGVGADIIGRRLAFNSSLFLAAVFVIIAGAMPSYISFTAMVALYSAAT
                     GGNYCLDASNLLEFLPRKKAFLTTILAVAWGFGYTITGLLAWAFMSNYSCLSADNCPR
                     SSNQGWRYLHYTSGGLVLIAAILRVTIIHMPHTPKFLITQNRDEEAVKFLTDIARKYN
                     RTTTITVEQLSSYGAIQDVKEGNKVRRFTKHVRGIFVSRKSTYSYILLLMLWLLIGLG
                     DPLYSYFRPYYLKTRGYQDNTTASNYIVWRNYAISNICGLVGPLLAWPLLDFKYLRRK
                     GTLAVSALATMLFLFGYTQVRTPTQNTALSFCINAVETMFFAALYGVTPELLPTGSRA
                     TGYGIAVALNRVCNIFASIIAGYANVETTAPLFISASMFGALAVVSLLLPFEPAGKYI
                     A"
     gene            <262714..>264360
                     /gene="MID1"
                     /locus_tag="AWJ20_78"
                     /db_xref="GeneID:30037849"
     mRNA            <262714..>264360
                     /gene="MID1"
                     /locus_tag="AWJ20_78"
                     /product="Mid1p"
                     /transcript_id="XM_018882742.1"
                     /db_xref="GeneID:30037849"
     CDS             262714..264360
                     /gene="MID1"
                     /locus_tag="AWJ20_78"
                     /inference="similar to AA sequence:KEGG_Orthology:K08284"
                     /note="N-glycosylated integral membrane protein of the ER
                     and plasma membrane; functions as a stretch-activated
                     Ca2+-permeable cation channel required for Ca2+ influx
                     stimulated by pheromone; interacts with Cch1p; forms an
                     oligomer; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IEA,IEA]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IDA] [PMID 14729456]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 10958666]; GO_function:
                     GO:0005262 - calcium channel activity [Evidence IEA];
                     GO_function: GO:0005262 - calcium channel activity
                     [Evidence IMP] [PMID 10958666]; GO_function: GO:0005262 -
                     calcium channel activity [Evidence IMP] [PMID 9343395];
                     GO_function: GO:0015275 - stretch-activated,
                     cation-selective, calcium channel activity [Evidence IDA]
                     [PMID 10436155]; GO_process: GO:0070588 - calcium ion
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006816 - calcium ion transport [Evidence IEA];
                     GO_process: GO:0006816 - calcium ion transport [Evidence
                     IDA] [PMID 10958666]; GO_process: GO:0006811 - ion
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mid1p"
                     /protein_id="XP_018734331.1"
                     /db_xref="GeneID:30037849"
                     /translation="MKSFTICFLWFLTLIPLICAQWIKQEGLLLPNSFLEVASENGEV
                     DPSEPPDMHLDIYDRADHVLSTSQSSSTVVSSSSVIEQDPVTTTMTIPTSGATPIIDS
                     TPIRFTINPGDVHTYELSGINPSAKALFISLNVCNEPFQSVPFDLPQNKTRLTLFATD
                     TNMTDAPMSQIETELGYASIILRDLQSSTSVIEIAGPKLPSGLKSSSWTYEVIASTKA
                     LQSDFSFTSNLYLVDTDFANALFITNNFTTSNNVPTENISDFGIYVYQFSNSSNAGDI
                     RRLSQSFCAVNTEGALIDQDNAQMSNTTRGYGNTMKGQIFVSGLNKSETYLAFLTKPS
                     ERLVYQAVNFTTKSDTNCQVIFDLDFCSGVAFAVPGNASAFTTETLREFYDDMALNRY
                     GNFSKSLQNIPCNASAETQYSIMRGCDDCANSYKQWLCAITIPRCTDWSNQQSFLFPR
                     PVGQSRNPEINEVIKPGKYKEILPCADLCYSIVQDCSPDFGFFCPKAGRGLEFSYGQR
                     SPNGDISCSYPGAAYIPSTASTGRTISMELILFATLLWIL"
     gene            complement(<264410..>265621)
                     /gene="PUS4"
                     /locus_tag="AWJ20_79"
                     /db_xref="GeneID:30037860"
     mRNA            complement(<264410..>265621)
                     /gene="PUS4"
                     /locus_tag="AWJ20_79"
                     /product="pseudouridine synthase PUS4"
                     /transcript_id="XM_018882753.1"
                     /db_xref="GeneID:30037860"
     CDS             complement(264410..265621)
                     /gene="PUS4"
                     /locus_tag="AWJ20_79"
                     /inference="similar to AA sequence:KEGG_Orthology:K03177"
                     /note="Pseudouridine synthase; catalyzes only the
                     formation of pseudouridine-55 (Psi55), a highly conserved
                     tRNA modification, in mitochondrial and cytoplasmic tRNAs;
                     PUS4 overexpression leads to translational derepression of
                     GCN4 (Gcd- phenotype); GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IMP] [PMID 9358157];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IMP] [PMID
                     9358157]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0016853 - isomerase activity
                     [Evidence IEA]; GO_function: GO:0009982 - pseudouridine
                     synthase activity [Evidence IEA]; GO_function: GO:0009982
                     - pseudouridine synthase activity [Evidence IDA,IGI] [PMID
                     9358157]; GO_process: GO:0009451 - RNA modification
                     [Evidence IEA]; GO_process: GO:0006396 - RNA processing
                     [Evidence IEA]; GO_process: GO:0001522 - pseudouridine
                     synthesis [Evidence IEA]; GO_process: GO:0006400 - tRNA
                     modification [Evidence IDA] [PMID 9358157]; GO_process:
                     GO:0008033 - tRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="pseudouridine synthase PUS4"
                     /protein_id="XP_018734332.1"
                     /db_xref="GeneID:30037860"
                     /translation="MLWIKANLNFLRTVIETRKTVFIAAESRTVNALETTMNGVFAVN
                     KPSGPTSHDIVHKIRDLFNKSSLFEADIKKVTSQYKGGKKSRRQRLPPIKVGHGGTLD
                     PLADGILVIGVGNGTKELPKYLGNCTKVYRATALLGTTTDTYDSEGKVVGRGKTDHIT
                     DEMVATALTKLRGDISQIPPIYSALKMGGKKLYEYARSGQPLPREIEARNVTVHELEL
                     INGGLQWDHKFSAPAIESPEEERKISIEFEEKSLQSKGLAPPPELFYDGTIPENSKPS
                     PILEIRFSVSSGTYIRTLIHDLGLALGCGAHMVTLTRLQQGNWKVGENAFELTDFTQH
                     PDSYWGPPLQYYLHSGPGETLKNLFPKEEPGPATQDQEENETKEDTALTNVKQKNPDH
                     VQGTETENYKR"
     gene            complement(<265857..>266546)
                     /gene="SHR5"
                     /locus_tag="AWJ20_80"
                     /db_xref="GeneID:30037872"
     mRNA            complement(<265857..>266546)
                     /gene="SHR5"
                     /locus_tag="AWJ20_80"
                     /product="Shr5p"
                     /transcript_id="XM_018882765.1"
                     /db_xref="GeneID:30037872"
     CDS             complement(265857..266546)
                     /gene="SHR5"
                     /locus_tag="AWJ20_80"
                     /note="Palmitoyltransferase subunit; this complex adds a
                     palmitoyl lipid moiety to heterolipidated substrates such
                     as Ras1p and Ras2p through a thioester linkage;
                     palmitoylation is required for Ras2p membrane
                     localization; Palmitoyltransferase is composed of Shr5p
                     and Erf2; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IEA]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0031211 - endoplasmic reticulum palmitoyltransferase
                     complex [Evidence IPI] [PMID 12193598]; GO_component:
                     GO:0042406 - extrinsic component of endoplasmic reticulum
                     membrane [Evidence IDA] [PMID 12379641]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0016409 - palmitoyltransferase activity [Evidence IDA]
                     [PMID 12193598]; GO_process: GO:0018345 - protein
                     palmitoylation [Evidence IDA] [PMID 12193598]; GO_process:
                     GO:0018345 - protein palmitoylation [Evidence IMP] [PMID
                     16751107]; GO_process: GO:0006612 - protein targeting to
                     membrane [Evidence IMP] [PMID 7532279]"
                     /codon_start=1
                     /product="Shr5p"
                     /protein_id="XP_018734333.1"
                     /db_xref="GeneID:30037872"
                     /translation="MTEEGDSCSFFNCHEYVVQTSINSVQGRDVLLGGSDLPSSEMTA
                     GSTGDSTVIESMLTDFPNPYVPHNSTAFKQTRIVRIPRIFDTQSYDDQNSCPQFSEYF
                     PGTEPGALTPTFDENGVSHGLSSKSPLESYLTHQEFQTIIKGINERLLRAYYPWTWRN
                     VIGNILSFFTLYMSDYFIKPQIDIDLAGIELFIKTTNESLNDIKIMSLKRSGYLSLDF
                     QIPSQGTSLSS"
     gene            <267532..>270087
                     /gene="MDL2"
                     /locus_tag="AWJ20_81"
                     /db_xref="GeneID:30037883"
     mRNA            <267532..>270087
                     /gene="MDL2"
                     /locus_tag="AWJ20_81"
                     /product="ATP-binding cassette permease MDL2"
                     /transcript_id="XM_018882775.1"
                     /db_xref="GeneID:30037883"
     CDS             267532..270087
                     /gene="MDL2"
                     /locus_tag="AWJ20_81"
                     /note="Mitochondrial inner membrane half-type ABC
                     transporter; required for respiratory growth at high
                     temperature; localizes to vacuole membrane in response to
                     H2O2; similar to human TAP1 and TAP2 implicated in bare
                     lymphocyte syndrome and Wegener-like granulomatosis;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IBA,IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     11251115]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IRD]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IDA] [PMID 23509072];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0016887 - ATPase activity [Evidence IEA];
                     GO_function: GO:0042626 - ATPase activity, coupled to
                     transmembrane movement of substances [Evidence IEA];
                     GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0015421 - oligopeptide-transporting ATPase activity
                     [Evidence IBA]; GO_function: GO:0015421 -
                     oligopeptide-transporting ATPase activity [Evidence ISA]
                     [PMID 11251115]; GO_function: GO:0005215 - transporter
                     activity [Evidence IEA]; GO_process: GO:0006200 - ATP
                     catabolic process [Evidence IEA]; GO_process: GO:0070301 -
                     cellular response to hydrogen peroxide [Evidence IDA]
                     [PMID 23509072]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]; GO_process: GO:0090374 -
                     oligopeptide export from mitochondrion [Evidence ISA]
                     [PMID 11251115]; GO_process: GO:0006857 - oligopeptide
                     transport [Evidence ISA] [PMID 11251115]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IBA,IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="ATP-binding cassette permease MDL2"
                     /protein_id="XP_018734334.1"
                     /db_xref="GeneID:30037883"
                     /translation="MSSRYGEFSSGYGRYRSEEERDTVPILPDARGLNHNSPLAGVHN
                     TTRGVLRSVVQFVAVSKRFIYPSEYFYVVSLGTCCFLAGITHAVIAIQVSQLLGFKTS
                     MLFDTDSTSLSGLSGSVPVYGLLKLLSSLNQPEIGTRISSRMRHGYLTEVLDSPYRRQ
                     STTQYWNTILQSSVDHSIKIQQSLANCIWSGIETLGCLLCLIIFLCFILPEAIIFYLV
                     TSLLAVLTVRFSNERIVFTISSPLTWSMLNGILLLIPSVIKDREEDEVNNGLIILMCV
                     FLSQLSIFQLTEKVLSLKVTVREVDEFIQVLANCSIHQGDTSRQESNSEIVNARIQFV
                     DVTFTFPSASEPSLVNFNLTIESGQCIGLVSDSSAEMLGQSAAILDLISGKYAPDSGQ
                     VLVDGQDPATIRAISRQIATISAYNMDIIDESIYDYVYKGLIGTKYESYDSVGQHRMI
                     MRACKEAGLWHIAKPQSLQSQAANGTILSVAERLKLTIAKSLVSRPKIILLDQPIALV
                     DQYALPFISSILHQISKNKTTVLVPYYGSGLRLTDRVLLLSHGKIIEDGTHSELSKSC
                     AGYQVLTRHWKSKRRSSVNSLNSSPGILVPEILNAPSKTFTQRISDLKSVSFTNLATA
                     TIFCALGVSIVTKIFIGIRITIVSITNDTKYRTAYLISQASFSIAELSIIAGGLIIWC
                     RPAFVLNHSFNSLVNVALFSTVFVCFMVVIIYLNWKLGLITVGYMLLALYNGYLNSKL
                     QAENTNLVIDTYQSKRNQLAESITSRHAFQQFYDNVESEIKRFKRRRSNMKLLYAIML
                     IITFVTLSIGSLYLLYYNVSMSEVIMVFLIAASFGSLLNGVLFPVSPRNMYID"
     gene            <270632..>272203
                     /gene="HNM1"
                     /locus_tag="AWJ20_82"
                     /db_xref="GeneID:30037894"
     mRNA            <270632..>272203
                     /gene="HNM1"
                     /locus_tag="AWJ20_82"
                     /product="Hnm1p"
                     /transcript_id="XM_018882786.1"
                     /db_xref="GeneID:30037894"
     CDS             270632..272203
                     /gene="HNM1"
                     /locus_tag="AWJ20_82"
                     /note="Plasma membrane transporter for choline,
                     ethanolamine, and carnitine; involved in the uptake of
                     nitrogen mustard and the uptake of glycine betaine during
                     hypersaline stress; co-regulated with phospholipid
                     biosynthetic genes and negatively regulated by choline and
                     myo-inositol; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence ISS] [PMID 2203793]; GO_function:
                     GO:1901235 - (R)-carnitine transmembrane transporter
                     activity [Evidence IMP] [PMID 23755272]; GO_function:
                     GO:0015171 - amino acid transmembrane transporter activity
                     [Evidence IEA]; GO_function: GO:0015220 - choline
                     transmembrane transporter activity [Evidence IMP] [PMID
                     2203793]; GO_function: GO:0015220 - choline transmembrane
                     transporter activity [Evidence IGI] [PMID 3514579];
                     GO_function: GO:0034228 - ethanolamine transmembrane
                     transporter activity [Evidence IGI] [PMID 3514579];
                     GO_process: GO:1900749 - (R)-carnitine transport [Evidence
                     IMP] [PMID 23755272]; GO_process: GO:0003333 - amino acid
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006865 - amino acid transport [Evidence IEA,IEA];
                     GO_process: GO:0015871 - choline transport [Evidence IMP]
                     [PMID 2203793]; GO_process: GO:0015871 - choline transport
                     [Evidence IGI] [PMID 3514579]; GO_process: GO:0034229 -
                     ethanolamine transport [Evidence IGI] [PMID 3514579];
                     GO_process: GO:0031460 - glycine betaine transport
                     [Evidence IMP] [PMID 16487344]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Hnm1p"
                     /protein_id="XP_018734335.1"
                     /db_xref="GeneID:30037894"
                     /translation="MEEPGNSKNIVTQYDDALLLEQIGYKQELKRSFSLLTMAGWCFG
                     VTSFWTAIGGSLVDTMNAGGPIALVWGWVIVCAFSLMVALSLAELTSAYPVAGGQYSW
                     VLILSRGTKWGRGLSYATAFVQLAGLFSLGSTALYQFGSFTCGMAVLNSDGETWRPTN
                     WQVVLVCWAICFVCLLINIFMNKMLHHIGNFGLWWTIGGFVVCTVTILAVSKHKQDAS
                     FVFTAYTNNSGWNDNGMAALFLLNAAFAMCCYDAACHMGEEMDNASRDTARAVVLSVV
                     IGFFTGFAFILALLFCLQDFDAVANTVTGVPLLEIFYQATNNSKAGATCLTVIVVVCQ
                     VLASNGMITEGSRSLYAFARDDAFPYQISKYIGTVNSKYDVPIYALIICALFQCAFIA
                     IYFGSSTAFFTVMSIGTVGLYVSYLVPILVVMFRRKHKAVGYYNLGKWGHWVNAPAAL
                     YLIYCSVCFFFPTTLPITGDNMNYTPVAFAICAILGLLSWFLGGRHTYATQTESVIIE
                     GVGNEPVVEIVEQKN"
     gene            <277639..>279300
                     /gene="VBA5"
                     /locus_tag="AWJ20_83"
                     /db_xref="GeneID:30037905"
     mRNA            <277639..>279300
                     /gene="VBA5"
                     /locus_tag="AWJ20_83"
                     /product="Vba5p"
                     /transcript_id="XM_018882797.1"
                     /db_xref="GeneID:30037905"
     CDS             277639..279300
                     /gene="VBA5"
                     /locus_tag="AWJ20_83"
                     /note="Plasma membrane protein of the Major Facilitator
                     Superfamily (MFS); involved in amino acid uptake and drug
                     sensitivity; VBA5 has a paralog, VBA3, that arose from a
                     segmental duplication; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 23047103]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0022857
                     - transmembrane transporter activity [Evidence IEA];
                     GO_process: GO:0006865 - amino acid transport [Evidence
                     IEA]; GO_process: GO:0015809 - arginine transport
                     [Evidence IGI,IMP] [PMID 23047103]; GO_process: GO:0055085
                     - transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Vba5p"
                     /protein_id="XP_018734336.1"
                     /db_xref="GeneID:30037905"
                     /translation="MFTSSIHSKNQSVDISNSKTTEGSDAPVDLFVDLEQVEDSGDGT
                     TSDQQILHGFKLVLCSVSLLLCMFIFALDQTITVTLLETVGNKFNSFGKISWITIGFF
                     LPVAVLSMSWGSISLIFGRKICMLISIVLFEAGSLMCALAPSMNVLIGGRIIAGIGGG
                     GIQTMVFLILTEIVTIEKRGLMISFIGLSFGIASVVAPLIGGALTTHVSWRWCFYINL
                     PIGAAAFFCIALLFNPPKVAGSFKEKIKKVDYIGVLLLAIGLSCLLLPLSFGSSTSPW
                     NSAEVISLFVIGFFGCIAFFIYNFFISKVPLIPRRIAKVAQVVLPCLGLFGCYGALMI
                     GCIFLATFFQVVKGADGMQSGIDILPLILPTILAIIFSGAIVSKKGITKPLAIVGSAL
                     STVGFGLLTLLNENSPSSKRIGYQILAGVGLGLLVQPMTISAQIASPKSNGGVLIATS
                     MVTLFRSLGSILGSSLGQVVLNVVFGNKLNDYGAVVGFTTRDIVNNPGLIAALPEDKI
                     PLAIKAFVEGYRDVMFLGMAFSIIAFLTTPFYTNKRVPIAPKSQD"
     gene            <281146..>283800
                     /gene="YSP2"
                     /locus_tag="AWJ20_84"
                     /db_xref="GeneID:30037916"
     mRNA            <281146..>283800
                     /gene="YSP2"
                     /locus_tag="AWJ20_84"
                     /product="Ysp2p"
                     /transcript_id="XM_018882808.1"
                     /db_xref="GeneID:30037916"
     CDS             281146..283800
                     /gene="YSP2"
                     /locus_tag="AWJ20_84"
                     /note="Protein involved in programmed cell death; mutant
                     shows resistance to cell death induced by amiodarone or
                     intracellular acidification; YSP2 has a paralog, YHR080C,
                     that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     24390141]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 16962064];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006915 - apoptotic process [Evidence
                     IEA]; GO_process: GO:0006915 - apoptotic process [Evidence
                     IMP] [PMID 16962064]"
                     /codon_start=1
                     /product="Ysp2p"
                     /protein_id="XP_018734337.1"
                     /db_xref="GeneID:30037916"
                     /translation="MTDSESSSYHHQARGVPFKPSEHEHRRGHRDLLKALSDHPKSGS
                     NGNLTRTSSASSKTSEHPSAVESTSNEDGLSHSESFGYHSSKSEDHSHASSASHFLSS
                     VLTVAQNAANSLAGLKNGEHEESSRSYSEADESESVSEASMSHQRGEDGKLSEVKIEP
                     VRSTISTMGKGELSLATLGFSRDSGSQHRAATPSGEGKKSPQLTDSLKPTSPNANEGY
                     VSGGEGEFNLPEFHSNKFKRSVSITRNRSRRNTNKSMEQPPFRAVSSSTVSTESNEDE
                     DSPEDSVTAFPEGADGDHHLTGFAYANQKRNKEFHRLFKSVQPDDYLLDDFNCALSKE
                     ILIQGKMYVSERHVCFNSNILGWVTNLVIAFDEIVTMEKKMTAGLFPNGIVIQTLHAR
                     HSFASFVNRDSVIDFLMSIWKKSSPHQPNRSEAYANGSAVNMSDSESTSSTDKERNRE
                     VDSDDGSFSYGSSGEVISDELDTDDEFGETARDSPSESANKDSSGGKAPAAGNGSGDG
                     AGADSGSGSGSWPVPLEGPETHAPTDLPALDANDKELATETIHAPLGIVANLLFGSDS
                     TWYKKFLTENQKNIKLGEVPPFEADGGNKTRHYEYVKPLSGPVGPKQTKCISTDTIEK
                     WDLENYVVVTTATSTPDVPSGGSFVTKSRTGLCWAPGNSTKIVISYHIEWSAKSWLKG
                     PIEKGALDGQTQYAKDLVAAINNTLKSKSKSKAPGGIAVTHKKPLKKKRREKVKKVKI
                     DVASAPKSSLEKFMNLLTENPVPGVPLPTWALLTIGIILFSAIRWMFFSPSVPTEVEQ
                     ARLMRVEEEYQMWKWFEDRGRVGHPLVHRGEGKFDDGDILRYPIFQPGVSSHVKGKKG
                     SYSEQEVLEAIRITEHRLSILKERLNST"
     gene            complement(<283843..>284679)
                     /locus_tag="AWJ20_85"
                     /db_xref="GeneID:30037927"
     mRNA            complement(<283843..>284679)
                     /locus_tag="AWJ20_85"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882819.1"
                     /db_xref="GeneID:30037927"
     CDS             complement(283843..284679)
                     /locus_tag="AWJ20_85"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734338.1"
                     /db_xref="GeneID:30037927"
                     /translation="MSADSTLYTNALATSDQLNSTKAVGHGTGKDSAFHNRFLTANFI
                     QTAGIYLRLSQTVISRAIVLAQRFYTTTGLRDFPIHDVAAAVLLISSKLVSGHPIKPE
                     QLCYVVQFLSLNGNLVFEHDVQTFSVPQTFDVIDTWKQISPTEMEVLAGLAFDTNVVL
                     PYSLALSYIQVLSLHERAGSDIIKLTWSTINDGIRDSPFLTIVHQPNTIAVTSIILAA
                     TKLNVVVSDQVNWWDMFDVNSEDVGHSMALILEGKEYASYIRNQNSHTIDTNTKQNKI
                     IK"
     gene            <285576..>287024
                     /locus_tag="AWJ20_86"
                     /db_xref="GeneID:30037938"
     mRNA            <285576..>287024
                     /locus_tag="AWJ20_86"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882829.1"
                     /db_xref="GeneID:30037938"
     CDS             285576..287024
                     /locus_tag="AWJ20_86"
                     /inference="similar to AA sequence:KEGG_Orthology:K00773"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734339.1"
                     /db_xref="GeneID:30037938"
                     /translation="MTSDSMASSSFQTIKAASSSTSLARIGALKVRSNSSPVRTPTFL
                     CPTSRGVIPHLSPDNVVKCETTASVGALISVEDFMEKAPQQNSALLKYPGPTRDLFSF
                     PSKFGLALSHRRPVPVPSPQANFDDKVSVMTPEGFKYMTVDMYSEFITKFEPDMVFSI
                     PDIPNLSPGGKPGNNRAQKMLKRTEKWLDELLEQRSKHTTGFEIFAPILPGLAAEFQS
                     NYLQKIKSDARITGISLWNAQAARLSERQAELAKKRDVAKHSGASLDGEAAISTVTSY
                     VKALHEDVSRLAVAYNSGLETPHEVLDLVNSGVDLFVATGINDFTDAGVALDFTFPAS
                     EEHPDFGFNLWDPKYATDMTNFGRANRDTVPNTYYRAYVHHLLNAREMTSWVLLQMHN
                     IAVFNRFFEGIQKSIENGTFEQEREKFVKVYGTSEEVQVFRDLYKKKDSVPTVRGYHI
                     SYESEVIRRGEGSTQRLNDPPFKKYKEDASQN"
     gene            <287209..>287326
                     /locus_tag="AWJ20_87"
                     /db_xref="GeneID:30037949"
     tRNA            <287209..>287326
                     /locus_tag="AWJ20_87"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:30037949"
     gene            complement(<290253..>291464)
                     /gene="ERG13"
                     /locus_tag="AWJ20_88"
                     /db_xref="GeneID:30037960"
     mRNA            complement(<290253..>291464)
                     /gene="ERG13"
                     /locus_tag="AWJ20_88"
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /transcript_id="XM_018882849.1"
                     /db_xref="GeneID:30037960"
     CDS             complement(290253..291464)
                     /gene="ERG13"
                     /locus_tag="AWJ20_88"
                     /inference="similar to AA sequence:KEGG_Orthology:K01641"
                     /note="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase;
                     catalyzes the formation of HMG-CoA from acetyl-CoA and
                     acetoacetyl-CoA; involved in the second step in mevalonate
                     biosynthesis; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0004421 -
                     hydroxymethylglutaryl-CoA synthase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004421 -
                     hydroxymethylglutaryl-CoA synthase activity [Evidence IMP]
                     [PMID 6148937]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0006696 -
                     ergosterol biosynthetic process [Evidence IMP] [PMID
                     6148937]; GO_process: GO:0008299 - isoprenoid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0006694 -
                     steroid biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008202 - steroid metabolic process [Evidence IEA];
                     GO_process: GO:0016126 - sterol biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /protein_id="XP_018734340.1"
                     /db_xref="GeneID:30037960"
                     /translation="MAFVDDREDIYSFALTAVSKLLKKNNIDPASIGRLEVGTETLLD
                     KSKSVKSVLMQLFGDNADIEGVDTINACYGGTNALFNAINWVESSSWDGRNAIVVAGD
                     IAIYSKGAARPTGGAGVVALLIGPDAPLVFDPVHGSYMQHAYDFYKPDLTSEYPVVDG
                     HFSLTCYTRALDQAYKSYNKKAEKRHLFTASEEKQGIKRFDYSVFHVPTCKLVSKCYG
                     RLHYNDYLENPAAFADAEIPAEVKSVDYEASLTDKVVEKTFLNIAKDASKTRLAPSLI
                     GPTNTGNMYTASVYSSLASLLTFVPADELAGKRVSLFSYGSGLASSFYSLVIKGDIAP
                     LVKNLEFKKLLDDRTTVTPTEYEAALALREKAHLQKSFKPTGSVDALREGTYYLTEVD
                     DKFRRSYAVKN"
     gene            <295364..>296728
                     /gene="LDB17"
                     /locus_tag="AWJ20_89"
                     /db_xref="GeneID:30037971"
     mRNA            <295364..>296728
                     /gene="LDB17"
                     /locus_tag="AWJ20_89"
                     /product="Ldb17p"
                     /transcript_id="XM_018882859.1"
                     /db_xref="GeneID:30037971"
     CDS             295364..296728
                     /gene="LDB17"
                     /locus_tag="AWJ20_89"
                     /note="Protein involved in the regulation of endocytosis;
                     transiently recruited to actin cortical patches in a
                     SLA1-dependent manner after late coat component assembly;
                     GFP-fusion protein localizes to the periphery, cytoplasm,
                     bud, and bud neck; GO_component: GO:0030479 - actin
                     cortical patch [Evidence IDA] [PMID 19506040];
                     GO_component: GO:0005933 - cellular bud [Evidence IEA];
                     GO_component: GO:0005933 - cellular bud [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005935 - cellular bud
                     neck [Evidence IEA]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006897 - endocytosis [Evidence IMP]
                     [PMID 19506040]"
                     /codon_start=1
                     /product="Ldb17p"
                     /protein_id="XP_018734341.1"
                     /db_xref="GeneID:30037971"
                     /translation="MLVLGLEDLSVPWRILIGAVLLVDGRLHKSTLEMLQEEAAISLI
                     VETLWQDRFSNIRLQRIFLELLYEMCRIQKIPIRELQKISKEFLEFLFSVVENKAGYD
                     TTDPYNMAAMKVILALNEQYMIAVLSGHSPDESDEEEQEENANQESISLRNKTFDILK
                     KDGDMYRAFGENMVFIFNRGADKCIQLMMLKLLYLIFTTKETFQYMYLNDLKVVVGVI
                     IRELHDLPFEEEDLRNTYLRILHPLLQNTQIRYEQYKKDELLSLLEVFANPSCANSHA
                     ISENTQRLAYRCLRVDWLGYCSPIISPITSLSEQNTGVSIETRSSSNSEYIDRKQTSS
                     VPLIEMSPVTSISSASSSTTDVTEMPKLRHSSSHNHLLVTHHKRPPRPSPRKLQAMQI
                     RNTSAIEVATLVKTHTPPPPPPRHRNLSLPGSQILEGRPSSTPPPPPRPRMMRIGTPV
                     GPCP"
     gene            complement(<296823..>297761)
                     /locus_tag="AWJ20_90"
                     /db_xref="GeneID:30037983"
     mRNA            complement(<296823..>297761)
                     /locus_tag="AWJ20_90"
                     /product="glyoxylate reductase"
                     /transcript_id="XM_018882871.1"
                     /db_xref="GeneID:30037983"
     CDS             complement(296823..297761)
                     /locus_tag="AWJ20_90"
                     /note="Glyoxylate reductase; acts on glyoxylate and
                     hydroxypyruvate substrates; YPL113C is not an essential
                     gene; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0048037 - cofactor binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0016616 -
                     oxidoreductase activity, acting on the CH-OH group of
                     donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IMP] [PMID 17173333]; GO_process: GO:0008152 -
                     metabolic process [Evidence IMP] [PMID 17173333];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="glyoxylate reductase"
                     /protein_id="XP_018734342.1"
                     /db_xref="GeneID:30037983"
                     /translation="MLITWSGFTSVGGMNTDLVDALPVSLKVIGLPHVGYDHFDWEAI
                     KKRGVIMCNSPGMSDNDVADIGLHLILSTYRSTSLFESTLRSQKNAALARRVVLNFDQ
                     DTGRADPGNEPMDPMKYVHGHRVGERVVTSPAGQRVGIAGFGGIGRALAKRLHVLGMT
                     IHYFKRSQLSQKELKSLEGIPLVRHESFESLAKESDVLVLALPLSSSTRHIVNDKTIG
                     ILPAEARVINVGRGPLVDQAALLRGLKSGKLSGAGLDVFEHEPIIEEELLSRYDVTLL
                     PHIGACTQKAVERALINSLENIKNVVVDGGHGIHPI"
     gene            <300065..>300874
                     /locus_tag="AWJ20_91"
                     /db_xref="GeneID:30037994"
     mRNA            <300065..>300874
                     /locus_tag="AWJ20_91"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882880.1"
                     /db_xref="GeneID:30037994"
     CDS             300065..300874
                     /locus_tag="AWJ20_91"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734343.1"
                     /db_xref="GeneID:30037994"
                     /translation="MSNYLQFTKTLHITKPTLYGEWHNGPALLELIDKFCDNLRILDF
                     TMAGSSSWCAYLPKIPQVTCVRGRSKDISETAAASFAEFRIDDLSNSFTNLQEVSLSG
                     LQVCFNRKADTDPLPLPKLTTLSLNDCSWEYPSQIDDLGSVTDLRVVYSTHHFTHSER
                     LRTFALSPPKTLKSLVIDIKSAYSDDNPTDVAWQPLLKHQCKGLVSLEVRGFNFPGEE
                     FFLALPAALTKLKISCRSGKQLSTSSWLILKQHKRRNQSFSMLLNNELVRL"
     gene            complement(<300953..>303595)
                     /gene="RCY1"
                     /locus_tag="AWJ20_92"
                     /db_xref="GeneID:30038005"
     mRNA            complement(<300953..>303595)
                     /gene="RCY1"
                     /locus_tag="AWJ20_92"
                     /product="Rcy1p"
                     /transcript_id="XM_018882891.1"
                     /db_xref="GeneID:30038005"
     CDS             complement(300953..303595)
                     /gene="RCY1"
                     /locus_tag="AWJ20_92"
                     /inference="similar to AA sequence:KEGG_Orthology:K15071"
                     /note="F-box protein involved in recycling endocytosed
                     proteins; involved in recycling plasma membrane proteins
                     internalized by endocytosis; localized to sites of
                     polarized growth; direct interaction with C-terminal
                     cytoplasmic region of Drs2p plays an important role for
                     Drs2p function in endocytic recycling pathway;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IDA]
                     [PMID 15537705]; GO_component: GO:0051286 - cell tip
                     [Evidence IEA]; GO_component: GO:0005935 - cellular bud
                     neck [Evidence IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005768 -
                     endosome [Evidence IDA] [PMID 15537705]; GO_component:
                     GO:0030427 - site of polarized growth [Evidence IDA] [PMID
                     11287615]; GO_function: GO:0000149 - SNARE binding
                     [Evidence IMP,IPI] [PMID 11287615]; GO_function:
                     GO:0000149 - SNARE binding [Evidence IPI] [PMID 15537705];
                     GO_process: GO:0034498 - early endosome to Golgi transport
                     [Evidence IMP] [PMID 15537705]; GO_process: GO:0032456 -
                     endocytic recycling [Evidence IMP] [PMID 24272750];
                     GO_process: GO:0006897 - endocytosis [Evidence IMP] [PMID
                     10769031]; GO_process: GO:0006897 - endocytosis [Evidence
                     IMP] [PMID 11378903]; GO_process: GO:0006887 - exocytosis
                     [Evidence IEA]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0048278 - vesicle docking
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Rcy1p"
                     /protein_id="XP_018734344.1"
                     /db_xref="GeneID:30038005"
                     /translation="MTSKTFSESRSIPMGTGSFQALVPSRVQKSTLLSGSIFDNSKIV
                     TIIAEYLPVPDLCNLAQVSKICKNAVYAPYLWQQRLENVNVHAGTSSSTNKNSDPLTI
                     FDGFKYNPSDTRSSCLKLYRALGVFYYDLVNNPETSHVFSHAFTDPVDQAKLLGQLKR
                     FSTIDPIQDGYDENISRLNSTIDLFENAALSEFEKGIDESHDADIDSTKLEAVVEHIK
                     KYANVLVTLNGGDSCVQLFIQKHPLIMDQPKIPPLDFLDDSLKLKSQEFQGYLQNICN
                     ILNRDSKTIDMIFSNTIAVMTPLFERVLEENIMETVSTIIDSLLHKSKFAFLAAVPEI
                     YSYILVFEDQLEPGINSGDNFKKMVSTSIDDFYSLYIDNYLEKELERFTEYAESEVSK
                     WSREIQDTEEATESFLWSNVTKEKDKTDFLTSFKKVLLMPVSVISSSSGNGNNNNNNN
                     ASSTYKSENISTTSLPGTVPPSFSSKLTSAPPSRQSMTSSPVPFRTTQTTPIPPSSEL
                     DAMVAVMNSKLESIKTLFSLELAVNIIREGKESIERMGRFVNMGGEGTHAKSQCEAIF
                     IELIHTLGERHVKGGFSKAIQTLNLYDPKQHRKTVTGTEANGEELAAVEPLAIFAELV
                     NIGDLIQQMVHVFFEEELGLRRYVDRNDFLSPSLKAKKKFEQMLDDCVANGLSRGIDV
                     LIDQIDFLFVTVQLGSDYNPIVGLPQNNGFGGGMFGGLGMSGDLGPTTAAQKVVTLLS
                     SHMTLLVGSTEKSVLDVFQQEVGLRFFGSVCKHIKRQVISTDGAINLISDLNYYYSFI
                     LGLKQKELVPYFAALKEVGQLFLIDGGDSKALGATLSDMVRFRGVFKPEELLEFVECR
                     KDWTLVRRDVEKVMYGFGIDCVMM"
     gene            <303972..>306851
                     /gene="SGD1"
                     /locus_tag="AWJ20_93"
                     /db_xref="GeneID:30038016"
     mRNA            <303972..>306851
                     /gene="SGD1"
                     /locus_tag="AWJ20_93"
                     /product="Sgd1p"
                     /transcript_id="XM_018882901.1"
                     /db_xref="GeneID:30038016"
     CDS             303972..306851
                     /gene="SGD1"
                     /locus_tag="AWJ20_93"
                     /inference="similar to AA sequence:KEGG_Orthology:K17583"
                     /note="Essential nuclear protein; required for biogenesis
                     of the small ribosomal subunit; has a possible role in the
                     osmoregulatory glycerol response; putative homolog of
                     human NOM1 which is implicated in acute myeloid leukemia;
                     GO_component: GO:0097078 - FAl1-SGD1 complex [Evidence
                     IPI] [PMID 21576267]; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 11042259]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA,ISS] [PMID 11042259]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0006972 - hyperosmotic response [Evidence IGI] [PMID
                     11042259]; GO_process: GO:0006972 - hyperosmotic response
                     [Evidence IGI] [PMID 12073033]; GO_process: GO:0042274 -
                     ribosomal small subunit biogenesis [Evidence IMP] [PMID
                     19806183]"
                     /codon_start=1
                     /product="Sgd1p"
                     /protein_id="XP_018734345.1"
                     /db_xref="GeneID:30038016"
                     /translation="MSRKRKSADDAEDDYQGIKLPPALLNELSQKGDHDETIHQPSLR
                     RNRVTRATRKENRKLERQKKKNKRSGKPQQEEAPKNAANGAKKFNKKVALPKDDESEG
                     DFDDFDGFKDGSGTDDFDLNEDDFEDLGSEDDSPMSALDTMAALKKMKEKKNSKPLTA
                     ADTMAALKAAKEKKTKVDNQVEKVKSNKISKGEKESEVLEDLKSGGDSMSVEETMAAL
                     KAAKEGKRKPGEVSDHSKKKRKTESKDSKGTSKKASLTKSKPDRVISERDKFLMAQDE
                     EDIDFYAKKLGLKSYKLGGSKQKKSKDELDDGFDDILGGLDFEKFASGSETEDSENEL
                     SDSISLNERDREGERSSDESDDAEDEDDEDEEDEEADEEEEEEQKPKENPYVAPTVSS
                     GKYVPPSKRRLLAQSNDNEAESEELIVLRRQLKGLINRLSESNMGSIINEIEALYQRN
                     PRSHVNSTITTIIIESTSLQGTLLESFLIIHAALVTALYRTMGVEFGAHFVQTLVEEF
                     EKHYKQGGGKEASNLLSLLSEIYTFQLVSCKLMYDFVRLFLQDVNEVNTEFLLKIVRN
                     SGPQLRSDDPSSLKEIIYLLQSAVSKAEPTTINSRTKFLIESITALKNNRQKIANEMS
                     IASTQRMKKFLGTISGLTSEPLQVSLDDIHNINTKGKWWLVGAAYNNNNGSVGNKTTP
                     DVDIDAMNDILDTAEPNWMELAKKQRMNTDVRKAVFVALMTSEDYIDSCDRLQKLRLK
                     SKQEREIPKVILHCCSNEEVYNPFYALVAGKLCGQHSLKKTFQFCLWDFLSELQGDED
                     SSDEEDGLGKLAKRSEANDKDVLRRVSHLAKFYGAIVAKGDMSLDTLKAVDFLTAVTE
                     IKLFLEIFFISFFEIIGKNAEKGTGSQTKKNGFGNAMFGIRRNEKELAQILIKTKDQT
                     VLRGIQYFQKFVTSSSLLPTKEKQKDRVIWGSSTMSDLVEGLLTH"
     gene            complement(<306924..>307952)
                     /gene="CAB4"
                     /locus_tag="AWJ20_94"
                     /db_xref="GeneID:30038027"
     mRNA            complement(<306924..>307952)
                     /gene="CAB4"
                     /locus_tag="AWJ20_94"
                     /product="putative pantetheine-phosphate
                     adenylyltransferase"
                     /transcript_id="XM_018882911.1"
                     /db_xref="GeneID:30038027"
     CDS             complement(306924..307952)
                     /gene="CAB4"
                     /locus_tag="AWJ20_94"
                     /inference="similar to AA sequence:KEGG_Orthology:K02201"
                     /note="Subunit of the CoA-Synthesizing Protein Complex
                     (CoA-SPC); subunits of this complex are: Cab2p, Cab3p,
                     Cab4p, Cab5p, Sis2p and Vhs3p; probable
                     pantetheine-phosphate adenylyltransferase (PPAT); PPAT
                     catalyzes the fourth step in the biosynthesis of coenzyme
                     A from pantothenate; null mutant lethality is complemented
                     by E. coli coaD (encoding PPAT); widely conserved;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14690591]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14690591]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_function:
                     GO:0016779 - nucleotidyltransferase activity [Evidence
                     IEA]; GO_function: GO:0004595 - pantetheine-phosphate
                     adenylyltransferase activity [Evidence IEA]; GO_function:
                     GO:0004595 - pantetheine-phosphate adenylyltransferase
                     activity [Evidence ISS] [PMID 11923312]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]; GO_process: GO:0015937 - coenzyme A biosynthetic
                     process [Evidence IEA]; GO_process: GO:0015937 - coenzyme
                     A biosynthetic process [Evidence ISS] [PMID 11923312];
                     GO_process: GO:0015937 - coenzyme A biosynthetic process
                     [Evidence IGI] [PMID 19266201]"
                     /codon_start=1
                     /product="putative pantetheine-phosphate
                     adenylyltransferase"
                     /protein_id="XP_018734346.1"
                     /db_xref="GeneID:30038027"
                     /translation="MLYCSTVALIQGGPASAIPTKYSEFIGKCLHMTMPNGKLDIMVL
                     KTPPTLVEAERTVRCLYDIARKEAARQGITSHKIDVTVLLDGLDIEVNRNQTWEVVAA
                     SKFELELPKLLRSLVPDNSDIQLLPVVLLGGGINTGVSLGGTPGGLTTPMNKKYQEIE
                     EMEQKKETDAARHGETLYSRTWEYNVIALGGTFDHLHEGHKLLLTMAGYLARECLIVG
                     ITGPELLKNKKYAQAMQSYMERKESVRNFLNYVYPSLDLDIVMINDIYGPTAQVKEID
                     GLVVSKETAAGGDSVNKLRSEKGWPELVIFEVGLISDSDSGDDSDKVSSTQLRKEEIE
                     QREKREKL"
     gene            <311106..>314132
                     /gene="CWC22"
                     /locus_tag="AWJ20_95"
                     /db_xref="GeneID:30038038"
     mRNA            <311106..>314132
                     /gene="CWC22"
                     /locus_tag="AWJ20_95"
                     /product="Cwc22p"
                     /transcript_id="XM_018882921.1"
                     /db_xref="GeneID:30038038"
     CDS             311106..314132
                     /gene="CWC22"
                     /locus_tag="AWJ20_95"
                     /inference="similar to AA sequence:KEGG_Orthology:K13100"
                     /note="Spliceosome-associated protein that is required for
                     pre-mRNA splicing; necessary for Prp2p function at the
                     first catalytic step of splicing; has similarity to S.
                     pombe Cwf22p; CWC22 is an essential protein; GO_component:
                     GO:0071006 - U2-type catalytic step 1 spliceosome
                     [Evidence IDA] [PMID 20956557]; GO_component: GO:0005684 -
                     U2-type spliceosomal complex [Evidence IDA] [PMID
                     11884590]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005681 - spliceosomal complex
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008380 -
                     RNA splicing [Evidence IEA]; GO_process: GO:0006397 - mRNA
                     processing [Evidence IEA]; GO_process: GO:0000398 - mRNA
                     splicing, via spliceosome [Evidence IDA] [PMID 20956557]"
                     /codon_start=1
                     /product="Cwc22p"
                     /protein_id="XP_018734347.1"
                     /db_xref="GeneID:30038038"
                     /translation="MSRADSRILRPYEEPSTDGGLVDSHETGPAKIANGSSSRQLEDE
                     HQNHSRNFNPNDTPERYQNGRGYERKSSDWTRDPGRGRSRSRSRRRTPPRYRRNGLDR
                     KGSPHSRDSRNYSRSPEPQNARNGGRQRRQQETRPKLFDVDGKRKAERERQAMERELQ
                     PEPEPATPLDPAEEYKRLMDLRSGGRYVPPAKLRALQEQIIKSQSSSSKEYQRLEWDK
                     LKKSINGLINKVNVGNIREIIQLIFQENIIRGRGVLCRSIMRAQSLSLAYTPVYASLV
                     AVINSKLPEIGELLVKRLVIQFRRSFKRNDKTMCIASGTFLAHLVNQQVAHEILCLEI
                     MHLLLLHPTDDSVEIAVGFVKEAGLFLSENSSTAFNGVYERLRVILRESNLEKRTQYM
                     IETLFQIIKDQFRDNPSIPKGLDLVEEDDQNIHMVSLDDELKGEETLNVFRFDDKYDE
                     NEESYKQIKKDILGDSDEEEESEEENEAENEQSEDESENEDEVEASVSATQDVASDAG
                     KVVVQDMTNSALISLRRTIYLTVMSTMSIDEVCHKLTRIQVPSGHEIEVVNMLVECCS
                     QEKIYNKIYGGVGSRLCRMGRQWQDLFNRAFEHYYEIIHRYDTNKLRNIATMFGFILA
                     SDSMSWSVFQIIKMSEESSTSSSRIFVKLLFQEIQQEIGINELVKRLKEPYLQQYLVN
                     LMPKGDDLDATRFSINYFTAIGLGAVTEDMREYLKNLPPPPPVTDSRSSSLSRSDSRS
                     RSRSRSRSLSSRSRSRSRSYDSRSRSRSYDSRSRSRSRSRSYDSHSRSRSRSRSISLS
                     RSPPRTRKNRSLSRSSSLSSQGRVRKRARGRSYSRSLSRSMSQSRSDSRSVSRGRALS
                     RSISRGRSYSRSYSRSRSDSRSRSYSRSRRNSTKSYSDSRSRSRSYSRSPARGRRYSR
                     PSSTRRTRSYSDSRSRSDRSRSISRSRSPSHSRSLSRSLSRSRSRSHTPPSLSPPPPK
                     RKAAAKSPPQKRHQSVSPPHDSEPTAKRRAKASDYL"
     gene            <315673..>316830
                     /gene="LPD1"
                     /locus_tag="AWJ20_96"
                     /db_xref="GeneID:30038049"
     mRNA            <315673..>316830
                     /gene="LPD1"
                     /locus_tag="AWJ20_96"
                     /product="dihydrolipoyl dehydrogenase"
                     /transcript_id="XM_018882930.1"
                     /db_xref="GeneID:30038049"
     CDS             315673..316830
                     /gene="LPD1"
                     /locus_tag="AWJ20_96"
                     /inference="similar to AA sequence:KEGG_Orthology:K00382"
                     /note="Dihydrolipoamide dehydrogenase; the lipoamide
                     dehydrogenase component (E3) of the pyruvate dehydrogenase
                     and 2-oxoglutarate dehydrogenase multi-enzyme complexes;
                     LPD1 has a paralog, IRC15, that arose from the whole
                     genome duplication; GO_component: GO:0005960 - glycine
                     cleavage complex [Evidence IMP] [PMID 7498764];
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]; GO_component: GO:0042645 - mitochondrial nucleoid
                     [Evidence IDA] [PMID 10869431]; GO_component: GO:0042645 -
                     mitochondrial nucleoid [Evidence IDA] [PMID 11926067];
                     GO_component: GO:0009353 - mitochondrial oxoglutarate
                     dehydrogenase complex [Evidence IDA] [PMID 2072900];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004148 - dihydrolipoyl
                     dehydrogenase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004148 - dihydrolipoyl dehydrogenase activity
                     [Evidence IDA] [PMID 2821168]; GO_function: GO:0050660 -
                     flavin adenine dinucleotide binding [Evidence IEA];
                     GO_function: GO:0004375 - glycine dehydrogenase
                     (decarboxylating) activity [Evidence IMP] [PMID 7498764];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016668 -
                     oxidoreductase activity, acting on a sulfur group of
                     donors, NAD(P) as acceptor [Evidence IEA]; GO_function:
                     GO:0004591 - oxoglutarate dehydrogenase
                     (succinyl-transferring) activity [Evidence IMP] [PMID
                     3528755]; GO_function: GO:0004738 - pyruvate dehydrogenase
                     activity [Evidence IMP] [PMID 3528755]; GO_process:
                     GO:0006103 - 2-oxoglutarate metabolic process [Evidence
                     IMP] [PMID 3528755]; GO_process: GO:0006564 - L-serine
                     biosynthetic process [Evidence IMP] [PMID 7498764];
                     GO_process: GO:0045454 - cell redox homeostasis [Evidence
                     IEA]; GO_process: GO:0006546 - glycine catabolic process
                     [Evidence IMP] [PMID 7498764]; GO_process: GO:0042743 -
                     hydrogen peroxide metabolic process [Evidence IGI,IMP]
                     [PMID 17110466]; GO_process: GO:0006550 - isoleucine
                     catabolic process [Evidence IMP] [PMID 1479341];
                     GO_process: GO:0006552 - leucine catabolic process
                     [Evidence IMP] [PMID 1479341]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006090 - pyruvate metabolic process
                     [Evidence IMP] [PMID 3528755]; GO_process: GO:0006574 -
                     valine catabolic process [Evidence IMP] [PMID 1479341]"
                     /codon_start=1
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="XP_018734348.1"
                     /db_xref="GeneID:30038049"
                     /translation="MKAKDDAVTGLTKGIEILFKQNKVDYFKGTGSFVNENEIEVEPL
                     DGSEKVNLKAKNIIIATGSEPTPFPGIEVDEKKIVTSTGILSLTEVPKKLAIIGGGII
                     GLEMASVWSRLGSDVTVIEFLNNIGGAGIDGELAKLAQKTLKKQGINFKLGTKVLSGK
                     VEGENVKIEVENAKNGKKEELDADVLLVAIGRRPYTEGLKIENVGVDMDQRGRVVIDQ
                     EYRTKYPHIRVIGDATFGPMLAHKAEEEGIAAVEYIKNGHGHVNYGAIPSVMYTHPEF
                     AWVGQTEEQIKEAGIKYNVGKFPFLANSRAKTNLDTEGIVKIIADKETDRVLGVHIAG
                     PNAGEMIAEAVLAIEYGASSEDIARTCHAHPTLSEAFKEAAMATYDKAIHF"
     gene            complement(<315747..>316049)
                     /locus_tag="AWJ20_97"
                     /db_xref="GeneID:30038060"
     mRNA            complement(<315747..>316049)
                     /locus_tag="AWJ20_97"
                     /product="Multispecies: transposase"
                     /transcript_id="XM_018882940.1"
                     /db_xref="GeneID:30038060"
     CDS             complement(315747..316049)
                     /locus_tag="AWJ20_97"
                     /codon_start=1
                     /product="transposase"
                     /protein_id="XP_018734349.1"
                     /db_xref="GeneID:30038060"
                     /translation="MLFKNSITVTSDPRRDQTEAISRPIIPPPIMANFLGTSVNERIP
                     VEVTIFFSSTSIPGKGVGSEPVAIMMFLAFKLTFSEPSRGSTSISFSLTKLPVPLK"
     gene            complement(<317652..>318515)
                     /gene="RAD51"
                     /locus_tag="AWJ20_98"
                     /db_xref="GeneID:30038071"
     mRNA            complement(<317652..>318515)
                     /gene="RAD51"
                     /locus_tag="AWJ20_98"
                     /product="recombinase RAD51"
                     /transcript_id="XM_018882951.1"
                     /db_xref="GeneID:30038071"
     CDS             complement(317652..318515)
                     /gene="RAD51"
                     /locus_tag="AWJ20_98"
                     /inference="similar to AA sequence:KEGG_Orthology:K04482"
                     /note="Strand exchange protein; forms a helical filament
                     with DNA that searches for homology; involved in the
                     recombinational repair of double-strand breaks in DNA
                     during vegetative growth and meiosis; homolog of Dmc1p and
                     bacterial RecA protein; GO_component: GO:0005694 -
                     chromosome [Evidence IEA,IEA]; GO_component: GO:0000794 -
                     condensed nuclear chromosome [Evidence IDA] [PMID
                     9427283]; GO_component: GO:0000228 - nuclear chromosome
                     [Evidence IDA] [PMID 11459983]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0003677 - DNA
                     binding [Evidence IEA]; GO_function: GO:0008094 -
                     DNA-dependent ATPase activity [Evidence IEA]; GO_function:
                     GO:0008094 - DNA-dependent ATPase activity [Evidence IDA]
                     [PMID 8066464]; GO_function: GO:0003684 - damaged DNA
                     binding [Evidence IEA]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_function: GO:0000150 - recombinase activity
                     [Evidence IDA] [PMID 8066464]; GO_function: GO:0003697 -
                     single-stranded DNA binding [Evidence IDA] [PMID
                     20371520]; GO_process: GO:0006200 - ATP catabolic process
                     [Evidence IEA]; GO_process: GO:0006259 - DNA metabolic
                     process [Evidence IEA]; GO_process: GO:0006310 - DNA
                     recombination [Evidence IEA]; GO_process: GO:0006310 - DNA
                     recombination [Evidence IDA] [PMID 22955832]; GO_process:
                     GO:0006281 - DNA repair [Evidence IEA,IEA]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0045002 - double-strand
                     break repair via single-strand annealing [Evidence IMP]
                     [PMID 8849880]; GO_process: GO:0030491 - heteroduplex
                     formation [Evidence IDA] [PMID 10506208]; GO_process:
                     GO:0000709 - meiotic joint molecule formation [Evidence
                     IMP] [PMID 1581961]; GO_process: GO:0007131 - reciprocal
                     meiotic recombination [Evidence IMP] [PMID 16581767];
                     GO_process: GO:0042148 - strand invasion [Evidence IDA]
                     [PMID 8066464]; GO_process: GO:0042148 - strand invasion
                     [Evidence IDA] [PMID 9271413]; GO_process: GO:0000722 -
                     telomere maintenance via recombination [Evidence IMP]
                     [PMID 11238918]"
                     /codon_start=1
                     /product="recombinase RAD51"
                     /protein_id="XP_018734350.1"
                     /db_xref="GeneID:30038071"
                     /translation="MLTEVKGFSDTKVDKLLTEAAKYVPMGFTTATEFHSRRSELISI
                     TTGSKQLDTLLGGGIETGSVTEVFGEFRTGKSQLCHTLAVTCQLPIDMGGGEGKCLYI
                     DTEGTFRPQRLLSIGERFGLSGTDALDNVAYARAYNADHQFELLNQAAAMMVQTRFAV
                     LIVDSIMALYRTDYSGRGELSARQTHVAKFMRTLQRLADEFGIAVVITNQVVAQVDGM
                     SNPYNPDPKKPIGGNIIAHASTTRLSFKKAKGENRRCTIYDSPCLPESTVEFAICEDG
                     IRDPRDDKNND"
     gene            <326344..>328092
                     /gene="CTS1"
                     /locus_tag="AWJ20_99"
                     /db_xref="GeneID:30038082"
     mRNA            <326344..>328092
                     /gene="CTS1"
                     /locus_tag="AWJ20_99"
                     /product="Cts1p"
                     /transcript_id="XM_018882962.1"
                     /db_xref="GeneID:30038082"
     CDS             326344..328092
                     /gene="CTS1"
                     /locus_tag="AWJ20_99"
                     /inference="similar to AA sequence:KEGG_Orthology:K01183"
                     /note="Endochitinase; required for cell separation after
                     mitosis; transcriptional activation during the G1 phase of
                     the cell cycle is mediated by transcription factor Ace2p;
                     GO_component: GO:0005618 - cell wall [Evidence IEA,IEA];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 11747810]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005576 - extracellular region [Evidence
                     IEA,IEA]; GO_component: GO:0005576 - extracellular region
                     [Evidence IDA] [PMID 19129178]; GO_component: GO:0005576 -
                     extracellular region [Evidence IDA] [PMID 1918080];
                     GO_component: GO:0009277 - fungal-type cell wall [Evidence
                     IDA] [PMID 11747810]; GO_component: GO:0009277 -
                     fungal-type cell wall [Evidence IDA] [PMID 1918080];
                     GO_component: GO:0005635 - nuclear envelope [Evidence IDA]
                     [PMID 11914276]; GO_function: GO:0008061 - chitin binding
                     [Evidence IEA]; GO_function: GO:0004568 - chitinase
                     activity [Evidence IEA,IEA]; GO_function: GO:0008843 -
                     endochitinase activity [Evidence IDA] [PMID 6799506];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016798 - hydrolase activity, acting
                     on glycosyl bonds [Evidence IEA]; GO_function: GO:0004553
                     - hydrolase activity, hydrolyzing O-glycosyl compounds
                     [Evidence IEA]; GO_process: GO:0005975 - carbohydrate
                     metabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0006032 - chitin catabolic process [Evidence IEA,IEA];
                     GO_process: GO:0006032 - chitin catabolic process
                     [Evidence IC] [PMID 3033651]; GO_process: GO:0007109 -
                     cytokinesis, completion of separation [Evidence IMP] [PMID
                     1918080]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0000272 - polysaccharide
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Cts1p"
                     /protein_id="XP_018734351.1"
                     /db_xref="GeneID:30038082"
                     /translation="MLSLKLIASSLALLGNVVSAVDVSTNTNVALYWGQNSAGGANTQ
                     QSLATYCQDASTDIVILSFLNTFFGPGNLPEVNFGPSCGGPNFPGSSLESCPNIGQDI
                     QTCQSLGKTVLLSLGGAIGDYGFTSDSQAADFADTLWNTFGGGSSDTRPFGDAVVDGF
                     DLDIENGDSTGYVAFINELRKDYATDSSKTYYISGAPVCPLSGNDLSSAITGADFDFI
                     FVQFYDNTCGMQAWAPNDANSAFNFDAWNTFITTEADNTNAKIYLGVPGGPTAANSGY
                     EPADTVIQAAQYLQKNYPSFGGVMIWDASQAFNNVNDGVNFAQAVKAGLLEEDVVSST
                     TSASSTAVSTVASLAAETGVIAVAVTSGFHNSSSSSSSAATAAPATVTAYATSEAVVQ
                     ETVVETITSCTGSNVVSCHYVTKTYVTASTSTPSVLYETKVVTYTSNGEVVITTTVCP
                     LTETTAAVPASTASGSSAAAAVLTSVAGAAAPAVTSAPAAGPASETGESVTTSIIYDT
                     ELLTVTVSGQVEETTAVVAVPAPVATSNGTFASNSSAVAPAIEPSVPFAESTGAASAV
                     TVSVFGFLAAGIAMLL"
     gene            <330231..>332741
                     /gene="SEC7"
                     /locus_tag="AWJ20_100"
                     /db_xref="GeneID:30032754"
     mRNA            <330231..>332741
                     /gene="SEC7"
                     /locus_tag="AWJ20_100"
                     /product="Arf family guanine nucleotide exchange factor
                     SEC7"
                     /transcript_id="XM_018877847.1"
                     /db_xref="GeneID:30032754"
     CDS             330231..332741
                     /gene="SEC7"
                     /locus_tag="AWJ20_100"
                     /inference="similar to AA sequence:KEGG_Orthology:K18442"
                     /codon_start=1
                     /product="Arf family guanine nucleotide exchange factor
                     SEC7"
                     /protein_id="XP_018734352.1"
                     /db_xref="GeneID:30032754"
                     /translation="MTPVNNESNEPNESSEPTEPSVQSGSKVNEDPLISDSKTTLAAA
                     NISNVEGTESSAVYQKAEHPTTATDDADAEGVTPEPYSTNSTATDLTGPSDHKMSPSS
                     SLSSIHAEGGTSASKSSGSPAGPQTPVQSINKEIIEGDDDKSTDSSPSVAKSLYQHTA
                     TFVNEDEYASWLGSDGETQQAVRVEYMSLFDFKSKSILSALRILCDKLYMKGESQQLN
                     RVIEAFSQSWVSQNPKHGFYDANVVYTITYALVLLNTDLYAADHSTTKKMSRSVFIQN
                     TLETVRAQRGPLPNSPNLSRRSEDFSSRRISVVSSNHDTLMVQDANVEPLSKEWEFQL
                     EMVLKSFYSSVSKEALQLHIIEHAPFSPLSRIYSPTGHDHTPSILSASQAQNSGASSI
                     FGRMNFGRLRGSKNLEPHQSRIALNDRAAEGFRHDSLASSYSLETSVTNNFGFSRHAV
                     GFAGLLWNSMIKEEDSGAQSTGDDDDFADFSKIEKELADETELELLGAPWAKEGILMY
                     RPYVDPSTGKKPRKKDWTKVFMVVQRGQLKMFKFDMSSSSHGAVNGAVGGGNWMENAQ
                     LVDGFHLCHTMAQELPPPKKSNGFAAVWSLTLPQRGLLVFQAGTPEVAREFVYTCNFW
                     AGRLSKEPFDDPVSNMEYGWTAALDSSSGKSGSALMTTPSTATLRRPGSSAGHRVLPG
                     DRLTIKEWKPTGHNMVVSDLNEEKQLKTLQEYIKRAENDLTEHNALVSKLAQAYTPST
                     TNWSKAHTNWENKSQFLLQQVIRYKIYVEVLDKAIKDRLEKFPVKSETDGDAQDDLTV
                     SDGGLPVKDPSLAVFDKGSPNGEKFSSVTVEAHQVIAA"
     gene            <333438..>334013
                     /gene="PUP3"
                     /locus_tag="AWJ20_101"
                     /db_xref="GeneID:30032765"
     mRNA            <333438..>334013
                     /gene="PUP3"
                     /locus_tag="AWJ20_101"
                     /product="proteasome core particle subunit beta 3"
                     /transcript_id="XM_018877858.1"
                     /db_xref="GeneID:30032765"
     CDS             333438..334013
                     /gene="PUP3"
                     /locus_tag="AWJ20_101"
                     /inference="similar to AA sequence:KEGG_Orthology:K02735"
                     /note="Beta 3 subunit of the 20S proteasome; involved in
                     ubiquitin-dependent catabolism; human homolog is subunit
                     C10; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IC] [PMID 9087403]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IC] [PMID 9087403];
                     GO_component: GO:0000502 - proteasome complex [Evidence
                     IEA]; GO_component: GO:0005839 - proteasome core complex
                     [Evidence IEA]; GO_component: GO:0019774 - proteasome core
                     complex, beta-subunit complex [Evidence IDA] [PMID
                     9087403]; GO_component: GO:0034515 - proteasome storage
                     granule [Evidence IC] [PMID 9087403]; GO_function:
                     GO:0061133 - endopeptidase activator activity [Evidence
                     IGI] [PMID 9207060]; GO_function: GO:0004175 -
                     endopeptidase activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0004298 - threonine-type
                     endopeptidase activity [Evidence IEA,IEA]; GO_process:
                     GO:0010499 - proteasomal ubiquitin-independent protein
                     catabolic process [Evidence IDA] [PMID 19162040];
                     GO_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 11545745]; GO_process: GO:0043161 -
                     proteasome-mediated ubiquitin-dependent protein catabolic
                     process [Evidence IDA] [PMID 19029916]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA]; GO_process:
                     GO:0051603 - proteolysis involved in cellular protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome core particle subunit beta 3"
                     /protein_id="XP_018734353.1"
                     /db_xref="GeneID:30032765"
                     /translation="MAGKDCIAIACDLRLGMQSVGVSSNFEKIFEYDSVYLGLTGLAT
                     DVITLSEEFRMKHNMYKMREERRMEPDTFANLVSSSLYEKRFGPYFVGPIVAGLNSKT
                     GKPFICGFDLIGAIDFAKDFIVAGTATDQLYGMCESLWEPDLEPEDLFETISQALLNA
                     QDRDALSGWGAVVYIITKDKVVKRLLKTRQD"
     gene            <334906..>336996
                     /locus_tag="AWJ20_102"
                     /db_xref="GeneID:30032776"
     mRNA            <334906..>336996
                     /locus_tag="AWJ20_102"
                     /product="hypothetical protein"
                     /transcript_id="XM_018877869.1"
                     /db_xref="GeneID:30032776"
     CDS             334906..336996
                     /locus_tag="AWJ20_102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734354.1"
                     /db_xref="GeneID:30032776"
                     /translation="MKPIRLATTKELHDASTIPSITVEKTNPSEMLSHSKKEVVPMAS
                     RATPTTRTISKISASHANKITESLPKSHKRAISHIISILSQTSLLECQTISFERYKRE
                     IEPHLFQVRYSQHDFDLVLSLYQCGHGEIAYKLQTILAAQWPYSADVKATIVTSLGLL
                     VSQGKPEYAESFLNLLIEKFDEEQYEMFSRSLRLTVSDSDKDDPNVRKIGGLSVDKKS
                     PPIPDSGDSQDIFSTLKNPRRFKYFVANALVKFALELGDPLLAASLLIQFRSDFVYIQ
                     TNSIYNCIRGLLVYDPYLNPFLIRAIYNIYCAYPNDRVLFDSEMKRKLTMNGIRYCKN
                     KYPSFANECFNLAVKLKGDPVPIVAVYKMIMLNLQYNNVTQASNIWKAFSSSLGEFDN
                     HDRLTISALLLRLSKDKKYLPVSVAIASSLQPSYYNLEGITEGLLLTCARSKNVELIE
                     KIYPHLEQPFRRSTLTALLKLHLVLDDSSGVEKLLLEINSRKKTGSSTHHNGGLNEVE
                     LSSIIEELSNHDTSRAETFLERFSTWPSKLLLRSYAAISNRAIEKKEWATYQKYLDLL
                     LDHDDSRDLSDVCCIENIQLKAECSKLSESTSSFHSVQRLHQSLTGPRRKFYKTRERL
                     VGLHIICDTALKLQTRATSIIQWLVLEYLNLGLAHNDIRQHLQMRHGFRILPPDIQQK
                     WLSSLEPHDQQTNL"
     gene            <339086..>343338
                     /gene="TSC11"
                     /locus_tag="AWJ20_103"
                     /db_xref="GeneID:30032787"
     mRNA            join(<339086..339241,339436..>343338)
                     /gene="TSC11"
                     /locus_tag="AWJ20_103"
                     /product="Tsc11p"
                     /transcript_id="XM_018877878.1"
                     /db_xref="GeneID:30032787"
     CDS             join(339086..339241,339436..343338)
                     /gene="TSC11"
                     /locus_tag="AWJ20_103"
                     /note="Subunit of TORC2
                     (Tor2p-Lst8p-Avo1-Avo2-Tsc11p-Bit61p); TORC2 is a
                     membrane-associated complex that regulates actin
                     cytoskeletal dynamics during polarized growth and cell
                     wall integrity; involved in sphingolipid metabolism;
                     contains a RasGEFN domain; GO_component: GO:0031932 -
                     TORC2 complex [Evidence IEA]; GO_component: GO:0031932 -
                     TORC2 complex [Evidence IPI] [PMID 12408816];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005774 - vacuolar membrane
                     [Evidence IEA]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA]; GO_function: GO:0005085 -
                     guanyl-nucleotide exchange factor activity [Evidence IEA];
                     GO_function: GO:0005515 - protein binding [Evidence IPI]
                     [PMID 12631735]; GO_process: GO:0031929 - TOR signaling
                     [Evidence IEA]; GO_process: GO:0031929 - TOR signaling
                     [Evidence IC] [PMID 12408816]; GO_process: GO:0030950 -
                     establishment or maintenance of actin cytoskeleton
                     polarity [Evidence IPI] [PMID 12408816]; GO_process:
                     GO:0030950 - establishment or maintenance of actin
                     cytoskeleton polarity [Evidence IMP] [PMID 15809876];
                     GO_process: GO:0031505 - fungal-type cell wall
                     organization [Evidence IGI,IMP] [PMID 15809876];
                     GO_process: GO:0043087 - regulation of GTPase activity
                     [Evidence IEA]; GO_process: GO:0001558 - regulation of
                     cell growth [Evidence IPI] [PMID 12408816]; GO_process:
                     GO:0030148 - sphingolipid biosynthetic process [Evidence
                     IGI] [PMID 9804843]"
                     /codon_start=1
                     /product="Tsc11p"
                     /protein_id="XP_018734355.1"
                     /db_xref="GeneID:30032787"
                     /translation="MSRVPDSRNEIIGLPHHRSGDDQRNNGSRIDDILAKLEIEEKIK
                     EGAENLLEVFDKRKIKGGDKEEIKKQVESQLDAANAKIQLLQQQLGDLGVGGQVTRDG
                     RRSLETRRSIDDLRPLTRTGASRSTSDINGYGNGNGTSGIGRSDTEIAIPEGIEIGPG
                     SDRSGYRENGRGISASASSTGTKKDSILGVNGDLESEDHADADEDLRSGQESPTWSLE
                     AILHSLDPSQPSEFLVQRSNDLVELLQRHPVLKYDLVMSRVGDKIRVLLLHKKPEVIA
                     SGYRLARNAITDMSSIRDIRSLHIDFMIVRTMTKDSKSQLERLQAVRLVRSFLDVPGG
                     VDEISIGVIRALVAVSEQSDDKLRYIAIETLGEIFIKNPEKVSASGGIRVLLQSIIEG
                     PYELSGSLSMAFAYVLDSPKNRGFLRGGRDLEYLISAMTESQVRGHVNLERLQNGAKV
                     ISSLLRTWSGLFATCIDNFYCLKSLVLCLEVPIPSLRDVLLDIFLSILCIKPLSWSSS
                     FLAGRRLTTFGRIPDLEKELANGGKSFQSSFSQSSGGGGTFAAGDYSSRYIDHYSALL
                     LSILVECNLIESLVQLLRSNDDVANTRKATLLLGEILSMTSRVSPPATLRRIGALPGL
                     LESAMDHKSAFSSASSAAVFQIDKISRNLHKGRQSTITGRTGPVSEVPSLLSSKRKAV
                     RVKMGVQIDDASFKQLIMETQVLNTKTFVKWNWDALSELIQGPLLNPKRLDEAIKTTK
                     FMKRLMSFYRPFKYRFSAIKRTKPNQKYIDVGKSLLLTLLYNPEGVRYLTENKLLRQI
                     AECLAQLDPMSGITSAEPLFSRQRLENTLSHGYFMLLGTLSSDPNGLAMMERWRMFNM
                     FYHLSEIPDREDLIISFIASMDYNLVGHPRIILSKALRTGQLEVRLFATGYLQNLMGT
                     ESETQKWAIELLATQLYDPSIEVCKLAVQILENFCSINENLEHFVKMKPSFDHLGDIG
                     TPLLLRFLSTSRGFQYLKELDYVHNEMDNWVHGQNDAFVLQIEEYLENANNLWIHDKF
                     GLSSTATATGLLARDDGTGVGENKPPRHFFGELTITEEGCHLLQSKGHFDVFAEYIDQ
                     HKFEEEDGEILTKLKGCMWAVAHIGSNPRGVPFLEESGVVENMIKIFESSQLYSLRGT
                     AFFCLGLVSLTYEGVEILDEMGWACVRDIMDEPCGICIPKSLQSSFDESSKVVTDAPV
                     TTYQSPSSSSESLDTTVKESLPQTSETIKNEKTSNSTSQDDETEFPMVYSDPIKRRII
                     TALSNLSNQILANDASKQLVRLEAKYGSRFQSIDLFLDTMKLLETYHYKLPVRRFIFE
                     LFDTTTLMERMARKQKEQQRRARHLSDTTKRE"
     gene            <343924..>345444
                     /gene="NMD3"
                     /locus_tag="AWJ20_104"
                     /db_xref="GeneID:30032798"
     mRNA            <343924..>345444
                     /gene="NMD3"
                     /locus_tag="AWJ20_104"
                     /product="ribosome-binding protein NMD3"
                     /transcript_id="XM_018877889.1"
                     /db_xref="GeneID:30032798"
     CDS             343924..345444
                     /gene="NMD3"
                     /locus_tag="AWJ20_104"
                     /inference="similar to AA sequence:KEGG_Orthology:K07562"
                     /note="Protein involved in nuclear export of the large
                     ribosomal subunit; acts as a Crm1p-dependent adapter
                     protein for export of nascent ribosomal subunits through
                     the nuclear pore complex; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 10022925]; GO_component:
                     GO:0022625 - cytosolic large ribosomal subunit [Evidence
                     IDA] [PMID 10022925]; GO_component: GO:0005654 -
                     nucleoplasm [Evidence IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     23212245]; GO_function: GO:0043023 - ribosomal large
                     subunit binding [Evidence IDA] [PMID 11105761];
                     GO_function: GO:0043023 - ribosomal large subunit binding
                     [Evidence IDA] [PMID 17347149]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0000055 -
                     ribosomal large subunit export from nucleus [Evidence IMP]
                     [PMID 11086007]; GO_process: GO:0000055 - ribosomal large
                     subunit export from nucleus [Evidence IGI] [PMID
                     23212245]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="ribosome-binding protein NMD3"
                     /protein_id="XP_018734356.1"
                     /db_xref="GeneID:30032798"
                     /translation="MKAEGGLAMCNDCISLSVDITEGIQKEAVITFCKNCERLQVPPT
                     HWIFAPRESRELLGACLKRLRGLNKVRLIDAKYVWTEPHSRRTKIKVLVQGEAPQFPG
                     VLIQQGITVNFTETSAQCPDCAKSYTATTWRANIQVRQKVDHKKTFFYLEQLILKNHA
                     HKYTVSIQENKEGLDFFYNQRNHALKMLEFLSGVIPVRVTKSSELISQNIHTSAKSYK
                     FSYSVEIVPICKEDLVVLPKKLAKSLGISNQLTLCYRIGNAVHLIDPTNLQTAELAAG
                     IYWRSPFSSLSTGKNLTEYVVLDIEPVGPANGKFALADVTVARSVDLGSNDTTYYVRT
                     HLGGILHPGDTVMGYHLSNTNFNHALWDEIDQDKTPEVILVKKSYPDKIRSKTRNWKV
                     KRMAKEYNDDTVRATGREKTKNKSNDAFERAQRDYEEFLRELEEDPELRTEVNLYKNV
                     PEVDAQEENGEEGEDDDESEELPGVNLDELKLEDDLSSDLSFSDDNSDEPDDENDS"
     gene            <345783..>347639
                     /gene="MPP10"
                     /locus_tag="AWJ20_105"
                     /db_xref="GeneID:30032809"
     mRNA            <345783..>347639
                     /gene="MPP10"
                     /locus_tag="AWJ20_105"
                     /product="Mpp10p"
                     /transcript_id="XM_018877900.1"
                     /db_xref="GeneID:30032809"
     CDS             345783..347639
                     /gene="MPP10"
                     /locus_tag="AWJ20_105"
                     /inference="similar to AA sequence:KEGG_Orthology:K14559"
                     /note="Component of the SSU processome and 90S
                     preribosome; required for pre-18S rRNA processing,
                     interacts with and controls the stability of Imp3p and
                     Imp4p, essential for viability; similar to human Mpp10p;
                     GO_component: GO:0030686 - 90S preribosome [Evidence IDA]
                     [PMID 12150911]; GO_component: GO:0034457 - Mpp10 complex
                     [Evidence IDA] [PMID 17515605]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA,IEA]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 12068309];
                     GO_component: GO:0032040 - small-subunit processome
                     [Evidence IMP] [PMID 12242301]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0000480 -
                     endonucleolytic cleavage in 5'-ETS of tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 9315638]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 9315638]; GO_process:
                     GO:0000472 - endonucleolytic cleavage to generate mature
                     5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
                     [Evidence IMP] [PMID 9315638]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA,IEA]; GO_process: GO:0042254
                     - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Mpp10p"
                     /protein_id="XP_018734357.1"
                     /db_xref="GeneID:30032809"
                     /translation="MSAGLVELLNRSPQNLLVPSDDLKAAAFKAVKESLDPIASDYSI
                     FDQLHTEGLDAEQIWAQARMVVDGAIEKLLGDVMSRKRKREDDGMSDEELDSELDEDI
                     EQSGDEESDEGFADIRERQDLEDDEDSDLDVKELDGYEEVDEDEEEEEDDDEQTLVGE
                     DGFSGDEDGSEEENEEDKDENVLSKPKSELDEGLFRLADFQQQILALEKDDQEDEEED
                     INYFADAKDQDSESDADMQYDDFFAPAPKILTGSADQEEDEEDEESDYDEDEEFTGLD
                     TEAGSKDIDSAMKNARRELFADDDEEEEEGGPSTEKLSTFEKQQLEIMKQIKQLEEEN
                     VAEKSWAVRGEVKAKDRPLDSLIETDLDFERNAKPVPVITQEVTESLEDMIRRRIKNE
                     QFDDIPRRLPDTLPEFQKAKLVEVQETKSQKSLAELYEDDYVKEHNPDSYKDAESEQL
                     KGAHKEIEDMYTSLSRKLDALCSWNYTPKAPKAAISIVSNVAAISMEEAQPLAMATES
                     MLAPQEVYQPGATSKREVVGANGLPVAKAEMSREERKREKRHQKAKRAKHFKEKEAKE
                     NSKAQKEGSKSNIMDTLKKGNVTVIGKKGEKRDLSGKLVKEKGKVESANLKL"
     gene            complement(<347803..>349416)
                     /locus_tag="AWJ20_106"
                     /db_xref="GeneID:30032820"
     mRNA            complement(<347803..>349416)
                     /locus_tag="AWJ20_106"
                     /product="hypothetical protein"
                     /transcript_id="XM_018877911.1"
                     /db_xref="GeneID:30032820"
     CDS             complement(347803..349416)
                     /locus_tag="AWJ20_106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734358.1"
                     /db_xref="GeneID:30032820"
                     /translation="MSRRQPIAKDNHIGTGYGLDKNRLQARDYRDRTKPQGLGTRPRS
                     RSVSPARKSEPPPYRRERPQNNKASNSFSRETGFKEADLERKWRNDEDNFILKQMKDG
                     SIIRIKDNRAKPIDWFVVCLKYLEPNESSHSDLVDSLLGLNSRQPVENPYDLENLDIK
                     YSDVHEFEFPEPTSVISSLSENELEQLKVQCEEFAKLDENKRNFEFWQSTIVLCTERL
                     WEMGQKVKSRDSRVVEVVSSDIDNLIIGKSATELADLEKRVDTMLQSANISIDRDFWL
                     QISKRLKVDKARAQLLSAYIDSINIRTVLVDKVRERELSRNSAESRELVAKLDALKDH
                     LIKARKDPVQYPELLKRIASVTSDNQISMSKSTHQSAHSPIYPTALDESEFDIPKANE
                     AHFNDEVESNANPELVKPKYYNRVILGYEWNKYNKAHYTSEHPPPKVVQGYKFNIFYP
                     KLTGSATIPSYKIIPDKTKSTSDGASHAGSDTVILLFQSPAPYQNIAFRIVDQPWDRS
                     SHGNSLYKSQFENGVLQLHFKFKKTYYKT"
     gene            <350257..>351528
                     /gene="PDX1"
                     /locus_tag="AWJ20_107"
                     /db_xref="GeneID:30032831"
     mRNA            <350257..>351528
                     /gene="PDX1"
                     /locus_tag="AWJ20_107"
                     /product="Pdx1p"
                     /transcript_id="XM_018877920.1"
                     /db_xref="GeneID:30032831"
     CDS             350257..351528
                     /gene="PDX1"
                     /locus_tag="AWJ20_107"
                     /note="E3-binding protein of the mitochondrial pyruvate
                     dehydrogenase complex; plays a structural role in the
                     complex by binding and positioning Dihydrolipoamide
                     dehydrogenase (E3) to the dihydrolipoamide
                     acetyltransferase (E2) core; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IEA]; GO_component:
                     GO:0005967 - mitochondrial pyruvate dehydrogenase complex
                     [Evidence IDA] [PMID 2007123]; GO_component: GO:0005967 -
                     mitochondrial pyruvate dehydrogenase complex [Evidence
                     IDA,IPI] [PMID 7947791]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0005198 - structural
                     molecule activity [Evidence IDA,IMP] [PMID 2007123];
                     GO_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA]; GO_process:
                     GO:0006086 - acetyl-CoA biosynthetic process from pyruvate
                     [Evidence IDA,IMP] [PMID 2007123]; GO_process: GO:0006086
                     - acetyl-CoA biosynthetic process from pyruvate [Evidence
                     IDA] [PMID 7947791]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="Pdx1p"
                     /protein_id="XP_018734359.1"
                     /db_xref="GeneID:30032831"
                     /translation="MVSFLARRLVTRANLRVGHRAISSSRNLLAASNFGMPAMSPTMT
                     EGGIVEWKFKEGESFSAGDVLLEIETDKAQIDVEAQDDGVLAKIYAEAGEKGIPVGKP
                     IAVIAEPGDDLASLKLPSTEQSEGATETPAAEQSQEESKPTASETSSSSSHASTSSPS
                     SGASANKKQTLLPSVAGILRAKGISSEEALEKIQASGPNGRILKGDALAYIGSISNES
                     VDAISDNIKKLQKLDLSHKLQEPKAKSESSDSEKAPEKAAASPVSSQAAPEPVSAIFS
                     LSDVNLLKSTLDATLSTSISVQNLVEKAIKLALRDTPKLTRARKSILNDPIFDDIVSI
                     SPRGSKAFDYKVSYPTSSARSSSASVDIYDILTSSRKPLRSPTARIASTELLKISVTP
                     NSKVSGSDKKAQVFLDRVGYYLAQGKGDLVL"
     gene            complement(<351670..>352785)
                     /locus_tag="AWJ20_108"
                     /db_xref="GeneID:30032842"
     mRNA            complement(<351670..>352785)
                     /locus_tag="AWJ20_108"
                     /product="hypothetical protein"
                     /transcript_id="XM_018877931.1"
                     /db_xref="GeneID:30032842"
     CDS             complement(351670..352785)
                     /locus_tag="AWJ20_108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734360.1"
                     /db_xref="GeneID:30032842"
                     /translation="MFSSFRTGFSLPLRGTIRVPQPRSFCSLKQDLASRQKNLLPKTF
                     KRNNTQLPKNVNDKNNLTSNDWKSRVPQFPFGKEVAPTLIPKANTPRVTKDFTFRQLV
                     MSLKNAREPELLYTAESHRLYFLTSVALTFVVSYNLFDLVDRSVKSLIEEYKENPEDL
                     SQRDNQIKAVKRGSLIALMASIYATAAFVFATFPTRLVRRIEYLPGNKEYLRLVTHPW
                     FPGKPSPVLTIPLENLSIGKRSKVWTGSGFYGTAHRSSFFFFIFEKDKWFPWIVDRSG
                     WFWGDGRVYDVILGKESIELAEKGLSYDDILRIQQNEASKRKTELRRELGPAWRAKAM
                     GQLMKEDAVKLQGAAKRALNSSVSNHKQLPGEDQEKK"
     gene            <353688..>355778
                     /locus_tag="AWJ20_109"
                     /db_xref="GeneID:30032853"
     mRNA            <353688..>355778
                     /locus_tag="AWJ20_109"
                     /product="hypothetical protein"
                     /transcript_id="XM_018877942.1"
                     /db_xref="GeneID:30032853"
     CDS             353688..355778
                     /locus_tag="AWJ20_109"
                     /inference="similar to AA sequence:KEGG_Orthology:K03380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734361.1"
                     /db_xref="GeneID:30032853"
                     /translation="MPTHIVKESKVDVLIIGAGPAGHMAATWFARTGVNARIIDKRSA
                     SQFVGQADGLQSRTLEIFQSFGFADRAIKESNHMLEICFWQPGEDASKGIERSGRIPD
                     STIGLSRFQQAVIHQGRVEGWMRDSWRKWSDNSLVLERPVQATELVIDTSIPASDIES
                     YPVTVTVEHLKDEQAVAEQFGSKVSNGLFRQFGGDGDKNAKGETEIIHAKYVVGTDGA
                     HSWVRRNLGISMVGESTDYIWGVLDGIPVTDFPDIRCRCAIHSAEHGSIMVIPREHNM
                     IRLYIQLQKTPQASDSSSGRIDRSKITPELILENANKILFPYTIDMVDIKWFTAYQIG
                     QRVATEFQKNGRVFLAGDATHTHSPKAGQGMNISMADTYNLAWKIAHIVKGVADPAIL
                     DTYESERKTIAQNLIDFDAKLSKLFSGRPAVPGIETPGVDLAEFHKVFEKGNEFASGT
                     TVDYDGSILIDKATNELTETKRRYDEDNITTNPLATNCPIGRRLDTAQVVVQSDSKPV
                     ELADVCLSDGRWRVLYFAGDIKSNASLKNFMVKFGEYLEASDNFVKKYTPATASLYSV
                     IDILLVHASSRTACEWNDFPSAFRPRDHKGRMDYLKIYADDTSYHQGHGHAYKKYGID
                     TSFGALLVVRPDGYLAKVEPLNQDGINSIEEFFAKFMIPQKVSLSNHEPIILEREEKE
                     WYGSESYARRIFLE"
     gene            complement(<356023..>356096)
                     /locus_tag="AWJ20_110"
                     /db_xref="GeneID:30032865"
     tRNA            complement(<356023..>356096)
                     /locus_tag="AWJ20_110"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:30032865"
     gene            complement(<356310..>358163)
                     /locus_tag="AWJ20_111"
                     /db_xref="GeneID:30032876"
     mRNA            complement(<356310..>358163)
                     /locus_tag="AWJ20_111"
                     /product="hypothetical protein"
                     /transcript_id="XM_018877964.1"
                     /db_xref="GeneID:30032876"
     CDS             complement(356310..358163)
                     /locus_tag="AWJ20_111"
                     /inference="similar to AA sequence:KEGG_Orthology:K12373"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734362.1"
                     /db_xref="GeneID:30032876"
                     /translation="MKLSLLNSLSIALYAFGTASAVTVNPLPAPRQINWGNTGPKQVA
                     QYLTLSNNGPYNQILHDAFSRCMDNMNLKWTPAATEAPIPSFAPFPTGIPTVADSGSG
                     PVTGAIPNAKRSQVQMNSPMIIGVKLQINDYNADLQYGVDESYNITITQSSQMIEISA
                     VTVWGALNAFKTLQQIIIGGPSNTLIIEQPVTIVDAPLYPHRGIMVDTGRNFVSSKKV
                     LEQIDIMSLSKMNVLHWHLDDSQSWPIQLNTYPQMVRDAYSPSEQFSHSDVANIIAYA
                     KARGVRVIPEVDMPGHADAGWKQVDPNAVACSNSWWSNDVWEFHTAVEPNPGQLDIMY
                     EGTYEIVENVYKELSDMFSDNWFHVGADELQTGCYNFSALTQEYLADGHTYNELLEYW
                     VNRTYPIFSAPKDRRVVMWEDVVLSTPQASNVPTNVVMQSWNNGTGNVKLLAQMGYDV
                     IVSSSDFLYLDCGYGGWVTNDDRYNIQANPDPSGATDSFNYGGNGGSWCAPYKTWQRI
                     YEFDITYGLTDEEATHVIGAEAPLWSEQVDDNVVTIKFWPRAAALAELVWSGNKDANG
                     QNRATEMTQRILNFREWLVALGYSVTPLVPRYCSLHPHACDLNYNQSAVSP"
     gene            <360509..>360611
                     /locus_tag="AWJ20_112"
                     /db_xref="GeneID:30032887"
     tRNA            <360509..>360611
                     /locus_tag="AWJ20_112"
                     /product="tRNA-Val"
                     /db_xref="GeneID:30032887"
     gene            complement(<360954..>362033)
                     /locus_tag="AWJ20_113"
                     /db_xref="GeneID:30032898"
     mRNA            complement(<360954..>362033)
                     /locus_tag="AWJ20_113"
                     /product="hypothetical protein"
                     /transcript_id="XM_018877981.1"
                     /db_xref="GeneID:30032898"
     CDS             complement(360954..362033)
                     /locus_tag="AWJ20_113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734363.1"
                     /db_xref="GeneID:30032898"
                     /translation="MSTLRVRRQNEPHSFRTSKSRRNQHQNSGAIHFQNAATSSSVGG
                     IVGTNGPNQSRTIANFHNSTYHPPANGLTTRGTSRFCISNEYAGIGQWGYGMWRQQST
                     DIYNIERDEEYRENYLKSIREFGYNYLKPSGIRQTMRSLLERAVQGDEDLDISRGHID
                     ISGMADPNEREELELQQEQLEVRGVENEENDRARNVAEEDTTNDVGNERMANMRHAID
                     GEEDDTFRSDQDEDENEEEVDLDADIPDLDAEIPEAVDNSYDDSYDEDEYQEGFMADE
                     EYGDVVTENDVQDADNSASMIMPSDQSAIGPAIALPDEDSFVRPVHPNQDIAHADVSY
                     SSNAGYGLDDGDSELEMDVSNMSFQ"
     gene            complement(<362363..>363877)
                     /gene="COX10"
                     /locus_tag="AWJ20_114"
                     /db_xref="GeneID:30032909"
     mRNA            complement(<362363..>363877)
                     /gene="COX10"
                     /locus_tag="AWJ20_114"
                     /product="Cox10p"
                     /transcript_id="XM_018877990.1"
                     /db_xref="GeneID:30032909"
     CDS             complement(362363..363877)
                     /gene="COX10"
                     /locus_tag="AWJ20_114"
                     /inference="similar to AA sequence:KEGG_Orthology:K02257"
                     /note="Heme A:farnesyltransferase; catalyzes the first
                     step in the conversion of protoheme to the heme A
                     prosthetic group required for cytochrome c oxidase
                     activity; human ortholog is associated with mitochondrial
                     disorders; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0031966 - mitochondrial membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004659 -
                     prenyltransferase activity [Evidence IEA]; GO_function:
                     GO:0008495 - protoheme IX farnesyltransferase activity
                     [Evidence IEA]; GO_function: GO:0008495 - protoheme IX
                     farnesyltransferase activity [Evidence ISS] [PMID
                     8118433]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0048034 - heme O
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006784 - heme a biosynthetic process [Evidence IMP]
                     [PMID 8118433]; GO_process: GO:0006783 - heme biosynthetic
                     process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Cox10p"
                     /protein_id="XP_018734364.1"
                     /db_xref="GeneID:30032909"
                     /translation="MLYRCQSYEKNELIRALSHFSSAARSTTTSKLCRHFSSSRNLLI
                     RSAAARSSSDVLRQDTFFSNIYLSQGHSRNSSSKSASVSSILYPKSDLDLGSVPSSPV
                     NTSESDPSNASSGRAKATVYSSSTRSAIFSRSGSDSNNKTSDELRTASKENSTATDTI
                     PIIPFEVRQLDHSSPRRSKPVTEIPFYAPYLALTKPRLSALVVLSAMSSYALTPYDAT
                     LSQLLFLTIGTALSSGSANAINMAREYEYDAQMTRTRTRPVVRGLLSPGQAFGFAGLS
                     GTLGVASLYFGVNPTVAALGAANIVLYGWTYTSLKRKSIINTWVGAVVGAIPPLMGWA
                     ASSSLTDPGAWALAGLLYAWQFPHFNSLSHNIREEYRRAGYVMAAWTNPSLNARVALK
                     YSVAMFPLCIALSYYNVTDWFYAIDSGILNGWLTYLAFKFWTEQRHIVGPVIEAASSS
                     SAGGSSSYARKLFWGSVLHLPGVLVLAMIHKKGQWDWLWPQEEEEEEDIDADEE"
     gene            complement(<364750..>365847)
                     /locus_tag="AWJ20_115"
                     /db_xref="GeneID:30032920"
     mRNA            complement(<364750..>365847)
                     /locus_tag="AWJ20_115"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878001.1"
                     /db_xref="GeneID:30032920"
     CDS             complement(364750..365847)
                     /locus_tag="AWJ20_115"
                     /inference="similar to AA sequence:KEGG_Orthology:K00252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734365.1"
                     /db_xref="GeneID:30032920"
                     /translation="MRTQLASALQTRHISNARPALSKAKFDWENPLRLDTLLTEDEIA
                     ISQVAHEYCQEKLYPRVLEGYRTEIFDKTLMREMGELGLLGATIDGYGCSGVSSVAYG
                     LIAREVEKVDSGYRSAMSVQSSLVMHPIDVFGTQEQKDRFLPKLATGELIGCFGLTEP
                     NHGSDPASMETTARPHPTKKGVYLLNGAKNWITNSPIADIAIIWAKLNGEIRGFIVER
                     DNVGNGSFATPAIKNKTALRASITGMVQMDDVEVPEENLFPDIKGLKGPFTCLNSARY
                     GISWGAIGALEEALKLARNYALERKQFNKPLASFQLVQKKLAEALTDAAYGLTNCVQV
                     GRLKDQGLATPEMISMIKRRNCDVALKNART"
     gene            complement(<367099..>368109)
                     /gene="INP53"
                     /locus_tag="AWJ20_116"
                     /db_xref="GeneID:30032931"
     mRNA            complement(<367099..>368109)
                     /gene="INP53"
                     /locus_tag="AWJ20_116"
                     /product="phosphatidylinositol-3-/phosphoinositide
                     5-phosphatase INP53"
                     /transcript_id="XM_018878012.1"
                     /db_xref="GeneID:30032931"
     CDS             complement(367099..368109)
                     /gene="INP53"
                     /locus_tag="AWJ20_116"
                     /inference="similar to AA sequence:KEGG_Orthology:K01106"
                     /note="Polyphosphatidylinositol phosphatase;
                     dephosphorylates multiple phosphatidylinositol phosphates;
                     involved in trans Golgi network-to-early endosome pathway;
                     hyperosmotic stress causes translocation to actin patches;
                     contains Sac1 and 5-ptase domains; INP53 has a paralog,
                     INP52, that arose from the whole genome duplication;
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     IDA] [PMID 11094088]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11094088]; GO_component: GO:0016020 -
                     membrane [Evidence IDA] [PMID 9560389]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0043813 -
                     phosphatidylinositol-3,5-bisphosphate 5-phosphatase
                     activity [Evidence IDA] [PMID 10224048]; GO_function:
                     GO:0004438 - phosphatidylinositol-3-phosphatase activity
                     [Evidence IDA] [PMID 10224048]; GO_function: GO:0004439 -
                     phosphatidylinositol-4,5-bisphosphate 5-phosphatase
                     activity [Evidence IEA]; GO_function: GO:0004439 -
                     phosphatidylinositol-4,5-bisphosphate 5-phosphatase
                     activity [Evidence IDA] [PMID 10224048]; GO_function:
                     GO:0004439 - phosphatidylinositol-4,5-bisphosphate
                     5-phosphatase activity [Evidence IMP] [PMID 9438131];
                     GO_function: GO:0043812 - phosphatidylinositol-4-phosphate
                     phosphatase activity [Evidence IDA] [PMID 10224048];
                     GO_function: GO:0042578 - phosphoric ester hydrolase
                     activity [Evidence IEA]; GO_process: GO:0006897 -
                     endocytosis [Evidence IEA]; GO_process: GO:0046856 -
                     phosphatidylinositol dephosphorylation [Evidence IEA];
                     GO_process: GO:0046856 - phosphatidylinositol
                     dephosphorylation [Evidence IDA] [PMID 10224048];
                     GO_process: GO:0046856 - phosphatidylinositol
                     dephosphorylation [Evidence IMP] [PMID 9438131];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="phosphatidylinositol-3-/phosphoinositide
                     5-phosphatase INP53"
                     /protein_id="XP_018734366.1"
                     /db_xref="GeneID:30032931"
                     /translation="MAMAINQGQAEILVFGFQELVELDNTSVTAKSMFHSKRKKEKEG
                     AVVTSSHISHQYKAWQDKLDEFVGSNLSERYRLVHSNNMVGLFTCVFMKESECNRVRD
                     IKSSAIKTGLGGLHGNKGGLAVRMVVDDSSLCFVNCHLAAGQSGVLQRNSDIETILET
                     KFSDASDNTNFTSKGIFVNGGDGTKIMDHEICFFFGDMNYRINRHRQVAIKAIEENAF
                     DQLLEYDQLGLQLKKNPGLRLRAFSEKPITFAPTYKFDVGSDRYDSSDKKRVPAWCDR
                     IFYRGGLKVVPASYYSFSVRASDHRPVTGVYSVQLKTIDPGKRKEVYKDSLLRWKEYL
                     AV"
     gene            complement(<368189..>371158)
                     /locus_tag="AWJ20_117"
                     /db_xref="GeneID:30032942"
     mRNA            complement(<368189..>371158)
                     /locus_tag="AWJ20_117"
                     /product="inositol polyphosphate phosphatase (predicted)"
                     /transcript_id="XM_018878023.1"
                     /db_xref="GeneID:30032942"
     CDS             complement(368189..371158)
                     /locus_tag="AWJ20_117"
                     /codon_start=1
                     /product="inositol polyphosphate phosphatase (predicted)"
                     /protein_id="XP_018734367.1"
                     /db_xref="GeneID:30032942"
                     /translation="MADHSSLPSVNNVKARFEQMAAAEADLAPGRSLKYSLSMPVGSS
                     SARNDAGNIKADAADARSKSVSVVPDNSIQAAAVAAPLPKKLPPGAPPKPARLSSQHK
                     RISSVGVSQSASQSASQPAVLAAAQSGVGLGLVSAPGVPATPSAPSAATPDPSAATEE
                     IQQNTVNRQQSQHARTPSSLLMPPPASTSRTREGSVTPPIPPPPRIRTPVDFEKSPSQ
                     NMTRSPIRTPPTPPLPRSRTPIENLSLAPHSHGHGPAFGLRSPSQPSINTPPMLPPRP
                     SAHHSIAGIETSSQNLPSISHSPASPVAPTTPISGISVSSTPVPPPVPPVPPHSIKQV
                     ASHQHSSLHHLDNPSHPVSQPVPETNNSSHAAAGVSATVPPTTPYSHINNSLQQFHIN
                     GGNDPSASYPNIALQQTNFTPPILPPRPVRSVSPQTALGQSPSLSESFSATTTLHPPA
                     LSVATTPSTPAMNPSLPPANLFPPPPQTQITQHLPTPIVPAASAVPTPSTAPAPTSTP
                     ISDSDNETELYSNPNTSNTSLAAGSEYAYYSFPDSSQASRRPPIFEGVLHSIQLSSKK
                     EEGKKTISTFGKHACVSGGSTTCIYDTQTGGQIWSLSHSEVRITSIGYKSDDGHTFWL
                     GTKDGQIWEISLTDIPGTIPNKRANTHLNSIILIYKNEQTNEMWTLSEDGKLCVWSEC
                     DLFKTPKTFRVTPNFKAVGVAGSTLWVGRNRQIFVYQPSSQANVPFLLTARPIQASAP
                     VTPAAGGLQPSPSSASLSSMNGYKPPPANGTTASSNSNNLIGDFTCAANVGSIPDHMF
                     FGHDNGCISVYSVSQLAFIDAVSVSMNKISSMCGVGDNLWIGLKTGTILVCDAKTTPW
                     TVRKEWKAHDTAVASIACFDDLDISQVEGMLPVISTSLAETSVALWDGLLKHDWIGKF
                     TGPLASGGWGSAPDPGCAPLRGAAGTVDERNDSSAARGAAGSGAEPQPPEAESPLRST
                     NRSRNGFTGARSRVQCS"
     gene            complement(<372419..>373186)
                     /gene="SSO2"
                     /locus_tag="AWJ20_118"
                     /db_xref="GeneID:30032953"
     mRNA            complement(<372419..>373186)
                     /gene="SSO2"
                     /locus_tag="AWJ20_118"
                     /product="Sso2p"
                     /transcript_id="XM_018878034.1"
                     /db_xref="GeneID:30032953"
     CDS             complement(372419..373186)
                     /gene="SSO2"
                     /locus_tag="AWJ20_118"
                     /inference="similar to AA sequence:KEGG_Orthology:K08486"
                     /note="Plasma membrane t-SNARE; involved in fusion of
                     secretory vesicles at the plasma membrane; syntaxin
                     homolog that is functionally redundant with Sso1p; SSO2
                     has a paralog, SSO1, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 16622836]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA] [PMID
                     17507646]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 19502581]; GO_component: GO:0005628 -
                     prospore membrane [Evidence IDA] [PMID 19502581];
                     GO_function: GO:0005484 - SNAP receptor activity [Evidence
                     IEA]; GO_function: GO:0005484 - SNAP receptor activity
                     [Evidence IPI] [PMID 7954793]; GO_function: GO:0070300 -
                     phosphatidic acid binding [Evidence IDA] [PMID 19502581];
                     GO_process: GO:0006893 - Golgi to plasma membrane
                     transport [Evidence TAS] [PMID 10047442]; GO_process:
                     GO:0031321 - ascospore-type prospore assembly [Evidence
                     IGI] [PMID 19502581]; GO_process: GO:0006886 -
                     intracellular protein transport [Evidence IEA];
                     GO_process: GO:0006906 - vesicle fusion [Evidence TAS]
                     [PMID 10047442]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Sso2p"
                     /protein_id="XP_018734368.1"
                     /db_xref="GeneID:30032953"
                     /translation="MIAFFGELDDIKRNLVQYDDNVDRIEALHKRSLAEVGGEHEDYI
                     QGQIESLTQDTQALADTLKARIKTLQAKSTRDSTKKTQAENVKRQFLSSIQKYQTTEA
                     RFRQKYREAAERQFRIVRPDATDAEVKEAIEDSAGVQIFSQALMNSNRRGQARTALTE
                     VQTRHREIQKIEQTMAELAQLFRDMEVLVAEQEEPIRHIDEQAATVQTDIEQGVSHTQ
                     KAIFSARAARKKKWWCLGIVLIIVIILAVVLGVKLSN"
     gene            <381201..>382856
                     /gene="PGI1"
                     /locus_tag="AWJ20_119"
                     /db_xref="GeneID:30032964"
     mRNA            <381201..>382856
                     /gene="PGI1"
                     /locus_tag="AWJ20_119"
                     /product="glucose-6-phosphate isomerase"
                     /transcript_id="XM_018878045.1"
                     /db_xref="GeneID:30032964"
     CDS             381201..382856
                     /gene="PGI1"
                     /locus_tag="AWJ20_119"
                     /inference="similar to AA sequence:KEGG_Orthology:K01810"
                     /note="Glycolytic enzyme phosphoglucose isomerase;
                     catalyzes the interconversion of glucose-6-phosphate and
                     fructose-6-phosphate; required for cell cycle progression
                     and completion of the gluconeogenic events of sporulation;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16962558]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 16622836];
                     GO_function: GO:0004347 - glucose-6-phosphate isomerase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004347 -
                     glucose-6-phosphate isomerase activity [Evidence IMP]
                     [PMID 3007940]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA]; GO_process: GO:0006094 -
                     gluconeogenesis [Evidence IEA,IEA]; GO_process: GO:0006094
                     - gluconeogenesis [Evidence IMP] [PMID 3020369];
                     GO_process: GO:0006096 - glycolytic process [Evidence
                     IEA,IEA,IEA]; GO_process: GO:0006096 - glycolytic process
                     [Evidence IMP] [PMID 3007940]; GO_process: GO:0006098 -
                     pentose-phosphate shunt [Evidence IMP] [PMID 7901008]"
                     /codon_start=1
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="XP_018734369.1"
                     /db_xref="GeneID:30032964"
                     /translation="MASATFSQASDLPAWKTLQNLYDTEGKSLSVKEQFSKDPERFSK
                     FSHTFTNFDGSKILFDFSKNIINDEILASLIKLAKEANVEGLREAFFKGDKINFTEDR
                     AVYHIALRNQAGKPMLVDGKDVTPEVNSVLAHIKEFTEQVRSGEWKGYTGKAITDIVN
                     IGIGGSDLGPVMVTEALKSYSKRDLDVHFVSNIDGTHIAEILRKVNPETTLFLIASKT
                     FTTAETTTNANSAKKWFLETAKDKTHIARHFVALSTNAEEVSKFGIDTANMFGFENWV
                     GGRYSVWSSIGLSVALYIGYDNFVQFLKGAEALDKHFTETPLEQNIPVLGGLLSVWYN
                     NFFGAQTHLVAPFDQYLHRFPAYLQQLSMESNGKSVTRSNEFVKYSTGSILFGEPATN
                     SQHSFFQLVHQGTKLIPTDFILAAKSHNPIENNLHQRMLASNFFAQAEALMVGKPQEV
                     VKAEGAPDSLVPHKIFLGNRPTTSILAQEITPAALGALIAYYEHLTFTEGAVWNINSF
                     DQWGVELGKVLAKAIGKELDNNEPVTDHDASTNALINQFKKWA"
     gene            <384229..>384924
                     /locus_tag="AWJ20_120"
                     /db_xref="GeneID:30032976"
     mRNA            <384229..>384924
                     /locus_tag="AWJ20_120"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878057.1"
                     /db_xref="GeneID:30032976"
     CDS             384229..384924
                     /locus_tag="AWJ20_120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734370.1"
                     /db_xref="GeneID:30032976"
                     /translation="MINSVLPKQILSNDITLNVLPDSHPHIPAVVGRVPYATTVKLLQ
                     FLVTTLLIPPSSKLMILSARTDSHPSIFRYSYYRAHDTAKEPQKDEQHSRPTTTDPDQ
                     EAGHHGHHHHRLTQSQAVKSRLSSGLPPRFIVYWRTVSPEDYEMKTRTSSSSKDEDTT
                     EYFPYSWSSSLTKEVDALKIARSLGILPHEYPVLTGIFEFDFDDTCTSIITHTITDLE
                     YLTKPTSECVNPA"
     gene            complement(<385276..>387441)
                     /gene="KSP1"
                     /locus_tag="AWJ20_121"
                     /db_xref="GeneID:30032987"
     mRNA            complement(<385276..>387441)
                     /gene="KSP1"
                     /locus_tag="AWJ20_121"
                     /product="putative serine/threonine protein kinase KSP1"
                     /transcript_id="XM_018878068.1"
                     /db_xref="GeneID:30032987"
     CDS             complement(385276..387441)
                     /gene="KSP1"
                     /locus_tag="AWJ20_121"
                     /codon_start=1
                     /product="putative serine/threonine protein kinase KSP1"
                     /protein_id="XP_018734371.1"
                     /db_xref="GeneID:30032987"
                     /translation="MPAITEKPPTQSQTSASPSKSLLNGRYQIIADINKGSYGVVSLA
                     KDIGGDGSLVAIKCITKSSNCAVYEEALYEVEMHKRLGNHPNIVQLIDFFDENSKAYL
                     VLEYCAPGDLYEAIKAGRGPREQNCVLDFMLQLIDSVEYCHSKGVYHRDIKPENILIG
                     NDGSVKLADWGLATCTKINGEFGIGSERYMAPELFDQANTKEYDAEKADIWALGICLL
                     NILFGRNPFTVASQKDKLFLDFATAREALFDIFPSLSEDVFAALRHCLTMDPDNRSLS
                     KLRKELLAVRMWTTDEYYEDEDVYDDDEFGLNLNDNEINEYEQQSNNEKTTKNNDDFE
                     DNDDTVVGGFVKASSGALATVHGGSISAANGEHEPFATKTPGPHHAPSPLAIFQESLA
                     VPQDFISTTTNRQPFRTPTGLVNHSPLRQDLDWNRTMQFTPPTRENGFFPNSKVKTPS
                     NLSFVLSARGGNGSGFPMQSVGEDDESGLLESSTSSASRSRRGSDGSTNSIIDDEHHE
                     DVFAMDGELSGSFNKLSLNSGHNNSNIINGGARAVPTSNERAGSGSDSSISSVPSLVK
                     STTLEEASLPSQRFTFNGASASFTPSNMTIPKMIVQGASPERRKTAFLASSAPPVRDF
                     LNLGKSWSDIDFEDDDDADFVEDDFYYNKLRNAVPAGTGTVTSVSGSNSQRLDDAMAS
                     KETSAVSIKPMATKSRLPAIAGKSHPTPGQSWVYPHWVE"
     gene            <392838..>393656
                     /locus_tag="AWJ20_122"
                     /db_xref="GeneID:30032998"
     mRNA            <392838..>393656
                     /locus_tag="AWJ20_122"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878079.1"
                     /db_xref="GeneID:30032998"
     CDS             392838..393656
                     /locus_tag="AWJ20_122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734372.1"
                     /db_xref="GeneID:30032998"
                     /translation="MPCPIVILSKVIGTVSLGVLAGASTTNSLVSLPSILTNSSLQTE
                     VDVQQQDTILTSLYQTTVSKVILPLSTVAFGSLVSAYILAPRSGQHPYLIYSALSVPI
                     VAGLNYFYGPGISFNTLLNNFCGSLSVGKCDRTSSTKPSQETGSPAVASGADLTETKS
                     ASSTSAVSKSSEDTSSSDEPSLLDNSVYAHLDHPDKGGSDIELSSASSNIATPEDQSE
                     DELAGQPVSSTTTAGTNYPASALSSNLSKLSFYSSIVFQLAFLISTIGIYGDLS"
     gene            <395872..>398796
                     /locus_tag="AWJ20_123"
                     /db_xref="GeneID:30033009"
     mRNA            <395872..>398796
                     /locus_tag="AWJ20_123"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878090.1"
                     /db_xref="GeneID:30033009"
     CDS             395872..398796
                     /locus_tag="AWJ20_123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734373.1"
                     /db_xref="GeneID:30033009"
                     /translation="MGNLQVSSGQYVQAAKSFASAVIFGLGGSVENDGRHLGVGTLND
                     LKSNSPINRRAISSIPDLVHAIDQSLRGSPVSANACSSHSPLLLSPQQALQARYKLFP
                     PDGQLPLVSQCQNNQNTNPQIPVDSLPSNYIQRYNNMGREDDPRQTSASIEAIVSNAL
                     LNLSKIFQDGINSGAPDKVVYLNGRVPSTYDILSLYLLSLSLNASASTANNVGILLLA
                     SVTQSPMSSNLPCQNCERRTRDLALDYYLFGLSLDQKHPHLHTNLGSLLREQGKLNEA
                     VQMYQKAIQCDPHFNIALANLAGCLKDQGQIDKAIIYYARAVQENPDFVEALVGLASC
                     YGSVCNWTDRGGCGWEQMSVDIEGNLVSGQIEGWVTRVIKVAENQVDEVRRWGIGAID
                     FIDSVEGGNLFKTIERTVRISDPNERVKFRQLINSWRGCYEEGTNLLSLIEKTIRAVQ
                     RQWYLDRRQGVKPPVPDYTYARPHIPSVLPIPLAPSILPFHSFTLPLNSFYVRQISEK
                     AASRVSMTVLSQNWLPKHVYPPPASPKNGVLKVAYISSDFANHPLAHLMQNVFGMHDR
                     TKVHAYCYATSPSDSSQYRQEIEKGAYVFRDVSSWSTQKIVEQLVSDGIHISVNLNGF
                     TKGGRNEIFATRPCPVQISLMGFAGPMGADWCDYVLGDITAMNGVPQYSNLSNNDSRL
                     KLIQPPDENMSSYWPYRKEKVIYMPRTLFCCDHRQSAPDSNKVRIESGQPLHTWEADV
                     ELRQRLRKQLFPNLPEGAFLMGNFNQLYKIDPTIFVTWLRILQRLPHAYLWLLEFPKN
                     GRTNLYTYAYKWTGSRDILSRIIFTPVAEKNEHIIRSRVCDLFLDTPECNAHTTAADV
                     SWGGTPIITYPRHSYKLCSRIGASIVYGALPADYRGRQIGQRLVVHSEAEYEDRVVEF
                     GSTLEGLRELNEIRTVLFNEREKDGNGLFNTKKWVESVEKGFQRAWEDWVQGKHENIF
                     ID"
     gene            <401484..>404087
                     /gene="ZAP1"
                     /locus_tag="AWJ20_124"
                     /db_xref="GeneID:30033020"
     mRNA            <401484..>404087
                     /gene="ZAP1"
                     /locus_tag="AWJ20_124"
                     /product="Zap1p"
                     /transcript_id="XM_018878101.1"
                     /db_xref="GeneID:30033020"
     CDS             401484..404087
                     /gene="ZAP1"
                     /locus_tag="AWJ20_124"
                     /note="Zinc-regulated transcription factor; binds to
                     zinc-responsive promoters to induce transcription of
                     certain genes in presence of zinc, represses other genes
                     in low zinc; regulates its own transcription; contains
                     seven zinc-finger domains; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 10899124]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA]; GO_function:
                     GO:0000977 - RNA polymerase II regulatory region
                     sequence-specific DNA binding [Evidence IMP] [PMID
                     12549926]; GO_function: GO:0000977 - RNA polymerase II
                     regulatory region sequence-specific DNA binding [Evidence
                     IDA,IMP] [PMID 9786867]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA,IEA]; GO_function: GO:0003676 -
                     nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000981 - sequence-specific DNA binding RNA polymerase
                     II transcription factor activity [Evidence IDA] [PMID
                     22128164]; GO_function: GO:0008270 - zinc ion binding
                     [Evidence IDA] [PMID 14517251]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IDA,IMP] [PMID 16720702];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 22128164]; GO_process: GO:0034225 - regulation
                     of transcription from RNA polymerase II promoter in
                     response to zinc ion starvation [Evidence IMP] [PMID
                     9271382]; GO_process: GO:0034225 - regulation of
                     transcription from RNA polymerase II promoter in response
                     to zinc ion starvation [Evidence IMP] [PMID 9786867];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Zap1p"
                     /protein_id="XP_018734374.1"
                     /db_xref="GeneID:30033020"
                     /translation="MLEAFVADDIYNWISPMMEKQAKNGAGNGPLARSASSPPTSVNG
                     FGRPPARNVDREGSEPPHHFYPKLLESSTPLSEPETVDSETADSSSTTPNCVECEHES
                     KPNLNSQHLSDRDLNKVDEANSVTKPNLKPDLTSTEQIPLSLQTAAASANVGTLPTEV
                     QADGSCEECQVAMKDHLLQIYDPFLDYCAECQEAEEEHQLNNRDCAVAAQPDCEECID
                     VEHKPPPTDSNSMINFDILPSQKRISKKAFLENQIQPKYSNSRHEKMAMTVRTENMDL
                     NMGINGGMNMGEGSLDPSLNIQTGNGLKRRASSFERSSEDHQRRKLESLSQLYNQQQN
                     ITRQYYLMLRQAQQQYNNSQGNKNQLDGTMPNKPLPSDLDQSHVQNNVGTSHSHIQHE
                     HGHDHSHDHTHEHSHEHGNGHSCSHCHSSGNGHHDPQHQQVSPRSLYCHWNGHEGEAQ
                     FNSELALQAHLRHHIYPQAESMSDQLECQWDSCDVSLKFVDELLEHIRTDHYNNYSQP
                     HTDCLYDGTHIHPKANDVTISQTSSQVYPSTQTQGYKCQWSNCQYIANTSDQLGVHVL
                     SDHINNNIPKPSQMTTEPTREDMNNFMKNNDMFQCQYQACDFQSLNFDDFTSHIKSDH
                     LSATAPLDSFATNDMVTHSLDPSLGIPQPNNIVGTTKPVNVTTTGTNNNTVKVKTEHD
                     ETTSTKTCKWVLENGQLCSCECKNTEELSNHIIEAHVGLRKTEYVCSWQGCDRNHRPF
                     QQRQKMVRHLQVHTNHRPYKCHICNSTFGEESVLKQHLRVHSGERPFECKICHKRFAA
                     SAALSVHLRIHTGEKPLKCKYPGCEKRFSESSNLNKHLKTHFSGSPCICPICSESFQD
                     PDHLFKHFKTH"
     gene            complement(<404377..>405324)
                     /gene="PEP8"
                     /locus_tag="AWJ20_125"
                     /db_xref="GeneID:30033031"
     mRNA            complement(<404377..>405324)
                     /gene="PEP8"
                     /locus_tag="AWJ20_125"
                     /product="retromer subunit PEP8"
                     /transcript_id="XM_018878112.1"
                     /db_xref="GeneID:30033031"
     CDS             complement(404377..405324)
                     /gene="PEP8"
                     /locus_tag="AWJ20_125"
                     /inference="similar to AA sequence:KEGG_Orthology:K18466"
                     /note="Vacuolar protein component of the retromer; forms
                     part of the multimeric membrane-associated retromer
                     complex involved in vacuolar protein sorting along with
                     Vps35p, Vps29p, Vps17p, and Vps5p; essential for
                     endosome-to-Golgi retrograde protein transport; interacts
                     with Ypt7p; protein abundance increases in response to DNA
                     replication stress; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005768 -
                     endosome [Evidence IPI] [PMID 9700157]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 22842922]; GO_component: GO:0030904 - retromer
                     complex [Evidence IEA]; GO_component: GO:0030904 -
                     retromer complex [Evidence IMP,IPI] [PMID 9700157];
                     GO_component: GO:0030906 - retromer complex, inner shell
                     [Evidence IMP] [PMID 9700157]; GO_function: GO:0008565 -
                     protein transporter activity [Evidence IMP,IPI] [PMID
                     9700157]; GO_process: GO:0045053 - protein retention in
                     Golgi apparatus [Evidence IMP] [PMID 8649377]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA]; GO_process:
                     GO:0042147 - retrograde transport, endosome to Golgi
                     [Evidence IPI] [PMID 9700157]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0007034 -
                     vacuolar transport [Evidence IEA]"
                     /codon_start=1
                     /product="retromer subunit PEP8"
                     /protein_id="XP_018734375.1"
                     /db_xref="GeneID:30033031"
                     /translation="MASFFKSQLDIEIRLDGEDTRTHVEIKQSNGQKAIAGTGNPSSA
                     NALARRRSVPLYMDGESVKGSVTIRPRDGKRLEHMGIKVQFVGSIEQSSDRGQHDDFL
                     SLAQELAAPAELRHPETYDFEFKNVEKQFESYNGINVKLRYYVKVTVFRRMADIVREK
                     DLWVYNYKVPPEGISSIKMDVGIEDCLHIEFEYSKSRYHLKDVIVGRIYFLLVRLKIK
                     HMELSIIRRETVGVAPNQYNESDTLVRFEIMDGAPVRGETIPIRLFLGGFDLTPTFRD
                     VNKKFSIRTFLSLVLIDEDSRRYFKQSEIILYRNPQDET"
     gene            complement(<405811..>407652)
                     /locus_tag="AWJ20_126"
                     /db_xref="GeneID:30033042"
     mRNA            complement(<405811..>407652)
                     /locus_tag="AWJ20_126"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878123.1"
                     /db_xref="GeneID:30033042"
     CDS             complement(405811..407652)
                     /locus_tag="AWJ20_126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734376.1"
                     /db_xref="GeneID:30033042"
                     /translation="MSKAANRLNGSIGPPSRNGSESPVSLPPMLSPTLPAWAEEMIPQ
                     RMLSPTLPPEFDDLGSFRSDSTGSSDKKKPSSAATASDRPVILQPVPKRAVAPLISEG
                     NGDHILSNGKDSTINGKKRRPSFIVTLKVDTKERERDRDRDGELSDKSNSESAKNREK
                     VNDRRIGEKTDRSKDRTVTKDGEIRAKERPEKGVASTKLNEKSKRPPVKDGRDSEGEL
                     SSKKPSSTNPNSSSKKTIGLGIIEHKSSQNGSSTSNNANTNATTNNTKPSTKRPKINR
                     SYSSSSEDEGPLAESAKRKKISKNQNQNQNQNHNSQTQLPSVKATKQKSEQKDSGAGL
                     TNPASSPISKISSQSAISEEKREKYYRLLRSKMHNWIELAREKKHEADSAMEKKQYSL
                     AAVISVDSLLAFIVGFDYEDRADQMVRRDANRSSWSTLIPFIGRLIINFEQNKIHQLV
                     GLLYQIRALVHMRIASACHSVIQKKTKQLPDTGSSASRAGSGPGSGSDDVDVNKLNQE
                     IVHLTTKYMACHDSSMQDFKLGLTQLSLDDVEKDYPKTWTNRHASPKPSSKHEGGYRP
                     LEDPYYLPMHCFSTLQEAAAFGYKLTKEWADSNNIKCDSWALVKGLC"
     gene            complement(<408233..>409825)
                     /locus_tag="AWJ20_127"
                     /db_xref="GeneID:30033053"
     mRNA            complement(<408233..>409825)
                     /locus_tag="AWJ20_127"
                     /product="cystathionine gamma-synthase"
                     /transcript_id="XM_018878134.1"
                     /db_xref="GeneID:30033053"
     CDS             complement(408233..409825)
                     /locus_tag="AWJ20_127"
                     /inference="similar to AA sequence:KEGG_Orthology:K01739"
                     /note="hypothetical protein with similarity to Str2p;
                     Str2p is a cystathionine gamma-synthase important in
                     sulfur metabolism; YLL058W is not an essential gene;
                     GO_component: GO:0005575 - cellular_component [Evidence
                     ND]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0003962 - cystathionine
                     gamma-synthase activity [Evidence IEA]; GO_function:
                     GO:0003962 - cystathionine gamma-synthase activity
                     [Evidence ISS] [PMID 10821189]; GO_function: GO:0030170 -
                     pyridoxal phosphate binding [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0009086 -
                     methionine biosynthetic process [Evidence IEA];
                     GO_process: GO:0006790 - sulfur compound metabolic process
                     [Evidence ISS] [PMID 10821189]"
                     /codon_start=1
                     /product="cystathionine gamma-synthase"
                     /protein_id="XP_018734377.1"
                     /db_xref="GeneID:30033053"
                     /translation="MSVPDGIGDPIPPNEIHPVSFRLPTWRVVEGLMEDEPWVTSKLR
                     TGYPRFSIHPKVQLLAADIISRFGDPGDKCLLFPFYDAAVRCKEFIERHSELPNVKVR
                     VSGFTTTDKSDKKKQNDPSAPLATLTIFATFMPESEFAVGKLYLRVSGEAIGSRLGAY
                     LCQCPRLEPTGSHTSSRELYATDSKSVLKKRIASLINDTASLSKVPTPKAVEEDVFLF
                     PSGLTAIFNAHRAVLQAIGEYKSVCYGFAFTDTIKLLAKVGPGSHFYGNGEAEDLDSL
                     TKLLESGERITALFCEVPTNPLLKTPDLLAIRKLADKYNFAVVVDDTLANYVNLNLFP
                     YADIVCCSLTKIFNGACDALGGSLVLNPDSKYYNQLKQASTKFVDFLWYQDADVLEKN
                     SRDVVERAYKSNTNSQAVVDLLNKSPVIDTVYYPSNSPTRKHYEELMVEKGGYGSLFS
                     ILFKDPINAQRFYDALDIDKGPSLGTNFTLCCPFPMLAHYSELDYVSTFGVDRNLIRV
                     SIGLEPTADLVAKFDRALAACN"
     gene            <410363..>411307
                     /locus_tag="AWJ20_128"
                     /db_xref="GeneID:30033064"
     mRNA            <410363..>411307
                     /locus_tag="AWJ20_128"
                     /product="formamidase"
                     /transcript_id="XM_018878145.1"
                     /db_xref="GeneID:30033064"
     CDS             410363..411307
                     /locus_tag="AWJ20_128"
                     /codon_start=1
                     /product="formamidase"
                     /protein_id="XP_018734378.1"
                     /db_xref="GeneID:30033064"
                     /translation="MTGELDQSFHVHSGQSHLKWSKDIKPVLRVKSGEVVTFDANDSS
                     NNQIHKDSTLETLYFDLAICDPVYGPVYIEGAEPGDTLEVELMKLDPADWGWTAIFPD
                     FGLLADEFPDTQLKIWKFAKGSKTAEFKKGIEVPIRPFLGEVGVAPPEGEHSTIPPLD
                     TGGNIDCRHVVEGTKLYLPVKVAGALFSCGDGHAAQGDGEVCGTAIETPMTATLRFTV
                     HKDKPWVTSPHYLTKPITTTVPDKGTYSILGIDSDLREAARKAIRSMIVYLTTTHSLT
                     KVEAYMLCSVAVDLKIAEAVDMPNYAVAATLPLNIFTE"
     gene            complement(<411573..>413339)
                     /locus_tag="AWJ20_129"
                     /db_xref="GeneID:30033075"
     mRNA            complement(<411573..>413339)
                     /locus_tag="AWJ20_129"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878156.1"
                     /db_xref="GeneID:30033075"
     CDS             complement(411573..413339)
                     /locus_tag="AWJ20_129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734379.1"
                     /db_xref="GeneID:30033075"
                     /translation="MKVKSLHYIPMLPKADDKMIRKPAPLLTNNVLIRAMYNAVGKQP
                     TADEIPDLRNSWAKIPANKQTVNLLGESLFWDTYLIMMASYGVEVVEALFQQRDAVVE
                     LCATPYYFGLVFDNSIIPSSPRWIVGAADNLLILALYLVSQISIHTQAIFKSQKYRLL
                     LSCIIFGPFMLFEGWNFIQYESKRLELGLGLLFFTVGYPIISLIFVAFCFIIYSSAFL
                     LVGGPSKMRTPFGSSEVGSATTLHDAIFKLCKAAVSDNGGHSFIKETMVIKAPSVTWV
                     ENPKNLNLLDSSMAILESTQASGISSSTSSSSSNSIYAQQHLGSKYISWLMRQPNYST
                     LSYIGSMLIFIIKLVKKIQLFLIYISQFLRRSARNSDKTSTRPDLQSGHVPFILEELE
                     ENESDEEEYNDHLDKNDAVDPETSDIDGWETESESESNDSAGPIDNGTFQEDFQELLL
                     SGPDSLQTLLSAESPRRDILQKHLFNNSGRPLTRSQYTRLLENDRQESLKLIQNRWHD
                     HNTSSLQNASDFDNDNEDGPDLPSSNLCVICISAPRQVVLFPCGCLLMCEPCRETLAS
                     QLFSGCVNCRRKVESYSHVVAE"
     gene            complement(<414933..>416363)
                     /locus_tag="AWJ20_130"
                     /db_xref="GeneID:30033087"
     mRNA            complement(<414933..>416363)
                     /locus_tag="AWJ20_130"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878168.1"
                     /db_xref="GeneID:30033087"
     CDS             complement(414933..416363)
                     /locus_tag="AWJ20_130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734380.1"
                     /db_xref="GeneID:30033087"
                     /translation="MSFPNFKYTPLAKEQTQLPSPTPHSPYISEAKVSFDNDLECPLQ
                     PGIQPVSRTPLWVSVKRFIKRFILFSLLSLLSLLTLTAVFNPSYTNPPDFKMLDEKVF
                     ITANIINGDLIRGRWGDSVVELIDLLGPQNVFLSIYGGPTDALKELEPRIKCDHSLVS
                     EQDSPIHLESLPHIIVPGTNDTRVKRTEYLANVRNKALEPLNTLATKFDKILFMNDII
                     FNPHDAARLLFSTNVVDGKTDYRAACSVDFVNAFKFYDTFATRDFEGNSMGLPFFPWF
                     ANIGSAQSRRDVLNSKEAVRVRSCWGGMIAFEAKWFQSSNNNDNNDTSASDKVTTGTN
                     RQLVRFRAEHEATWDASECCLINADLEAAAGANNGGIYMNPYVRVAYDEKNFKWLAFT
                     RRFERLYSLIHDILNRMVSLPHKNPRYQEEPGQVIIESEYNFTQHQYQPRARVAGIGG
                     YCGSRMLQVMKTHPKQGERMWESVKL"
     gene            <420374..>421774
                     /gene="MEP2"
                     /locus_tag="AWJ20_131"
                     /db_xref="GeneID:30033098"
     mRNA            <420374..>421774
                     /gene="MEP2"
                     /locus_tag="AWJ20_131"
                     /product="ammonium permease MEP2"
                     /transcript_id="XM_018878179.1"
                     /db_xref="GeneID:30033098"
     CDS             420374..421774
                     /gene="MEP2"
                     /locus_tag="AWJ20_131"
                     /inference="similar to AA sequence:KEGG_Orthology:K03320"
                     /note="Ammonium permease involved in regulation of
                     pseudohyphal growth; belongs to a ubiquitous family of
                     cytoplasmic membrane proteins that transport only ammonium
                     (NH4+); expression is under the nitrogen catabolite
                     repression regulation; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 11069679]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA] [PMID
                     24124599]; GO_function: GO:0008519 - ammonium
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0008519 - ammonium transmembrane
                     transporter activity [Evidence IDA,IMP] [PMID 9234685];
                     GO_process: GO:0072488 - ammonium transmembrane transport
                     [Evidence IEA]; GO_process: GO:0015696 - ammonium
                     transport [Evidence IEA,IEA]; GO_process: GO:0015696 -
                     ammonium transport [Evidence IMP] [PMID 9234685];
                     GO_process: GO:0019740 - nitrogen utilization [Evidence
                     IMP] [PMID 9234685]; GO_process: GO:0007124 - pseudohyphal
                     growth [Evidence IMP] [PMID 9482721]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="ammonium permease MEP2"
                     /protein_id="XP_018734381.1"
                     /db_xref="GeneID:30033098"
                     /translation="MGNTGGDSLTEDINTQYNLANMVWIMTATALVWIMIPGVGLLYS
                     GLSRKHHGLSLIWMALMAVSVVSLQWFFWGYSLAFSHEAGKFIGALDNFGMMNVLAAP
                     SVGSTAIPDILYSFYQLVFAATTAMIMVGGAHERARLGPMMVMLFIWMTVVYCPIACW
                     TWNPSGWLAKLGGLDFAGGGPVHMTSGAGALAYALVCGKRHDPLADDKVKTYRPHSVL
                     SVVLGTVFLWFGWLGFNGGSSGNATIRGFYAANSTNLAAASGAMTWLMIDYFRKGRKW
                     SVVAICTGAIAGLVGITPAAGFVPCWSAVPIGVITAAVCNFAFDLKKVLHIDDGLDVF
                     ALHGVGGLMGSILTGFFAADYIAALDGATQIPGGWLNHNYRQLGLQLAGATATLGYSF
                     TVSTVILVALKYIPGFHLRLSVEEELLGTDVCQIGETYFQDSDEPVYTDGVSPGVMSG
                     AQTPVPRTEKTADESV"
     gene            complement(<422094..>424100)
                     /gene="AMO2"
                     /locus_tag="AWJ20_132"
                     /db_xref="GeneID:30033109"
     mRNA            complement(<422094..>424100)
                     /gene="AMO2"
                     /locus_tag="AWJ20_132"
                     /product="putative peroxisomal copper amine oxidase"
                     /transcript_id="XM_018878190.1"
                     /db_xref="GeneID:30033109"
     CDS             complement(422094..424100)
                     /gene="AMO2"
                     /locus_tag="AWJ20_132"
                     /inference="similar to AA sequence:KEGG_Orthology:K00276"
                     /note="one of two likely peroxisomal copper amine oxidase
                     genes; similar to A.niger AO-I; allele of CaO19.10662"
                     /codon_start=1
                     /product="putative peroxisomal copper amine oxidase"
                     /protein_id="XP_018734382.1"
                     /db_xref="GeneID:30033109"
                     /translation="MSHPLDQLTADEINRAVKLIKSRYSGKLLHFKNVETEEPPKALL
                     VPYLEAEKAGRPIAPPPRIAYNIYYVLDDKKAEEAWIDLGTNTIIKTAVIPKPHHPPM
                     DMIECMEMEKELFKSAEVLEAFKACGIEGDALNTISTDGWMYGADEEGAVARQMMFLI
                     YSRNPKTNHVESNIYAFPIPFVPIFDLLEKKLIRIDWVATGGDNDDLDGFNYNTRTAG
                     RNVLDQCAAHDYHPDLVPSLRTDLKAYNVIQPDGPSFTVEGNLVKWQKWRFRVGFTPR
                     EGMVLHDIDYDGRHTFYRLAMSEMAVPYGDPRPPLHRKMAFDFGDVGGGKCANQLNLG
                     CDCLGVIKYFDGNLVTPSGDVDARKSVICMHEQDDGILWKHTNYRTEEPAVVRRRILV
                     IQTILTVANYEYIFAWHLDQAANIQLEIRATGIVSTQAIDFGKRSKFGTVVSPGVLAT
                     SHQHIFNLRIDPAIDGYKNSISVQETEIIPWNHLNPRGTGFVNNKYYLEQAGYLDAKI
                     ENNRYLKIVNENKINPISGNPVGYKLSAAATALLMAPPGTVARSRAAFATHHFWVSKY
                     KDSELYAGGIWTNQSFKEFCGVQNAVDRKEPVRNEDVVLWHSFGLTHHPRVEDFPVMP
                     AEMLKISLHPNDFFVGNPALDVPPSTQQFNRSVEVMQTRSCHRM"
     gene            complement(<425344..>426708)
                     /gene="MNN10"
                     /locus_tag="AWJ20_133"
                     /db_xref="GeneID:30033120"
     mRNA            complement(<425344..>426708)
                     /gene="MNN10"
                     /locus_tag="AWJ20_133"
                     /product="Mnn10p"
                     /transcript_id="XM_018878201.1"
                     /db_xref="GeneID:30033120"
     CDS             complement(425344..426708)
                     /gene="MNN10"
                     /locus_tag="AWJ20_133"
                     /inference="similar to AA sequence:KEGG_Orthology:K05531"
                     /note="Subunit of a Golgi mannosyltransferase complex;
                     complex mediates elongation of the polysaccharide mannan
                     backbone; membrane protein of the mannosyltransferase
                     family; other members of the complex are Anp1p, Mnn9p,
                     Mnn11p, and Hoc1p; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence IEA,IEA]; GO_component: GO:0000136 -
                     alpha-1,6-mannosyltransferase complex [Evidence IDA] [PMID
                     10037752]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0000009 -
                     alpha-1,6-mannosyltransferase activity [Evidence IDA]
                     [PMID 10037752]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016757 -
                     transferase activity, transferring glycosyl groups
                     [Evidence IEA]; GO_function: GO:0016758 - transferase
                     activity, transferring hexosyl groups [Evidence IEA];
                     GO_process: GO:0000917 - barrier septum assembly [Evidence
                     IMP] [PMID 16034811]; GO_process: GO:0000032 - cell wall
                     mannoprotein biosynthetic process [Evidence IMP] [PMID
                     10037752]; GO_process: GO:0006487 - protein N-linked
                     glycosylation [Evidence IMP] [PMID 23210626]; GO_process:
                     GO:0006487 - protein N-linked glycosylation [Evidence IMP]
                     [PMID 8991513]"
                     /codon_start=1
                     /product="Mnn10p"
                     /protein_id="XP_018734383.1"
                     /db_xref="GeneID:30033120"
                     /translation="MRLSQTVFLACSAAAILATIWYMAAFNSIDGVKWPASPNRKAPP
                     KTDTPVLSDTEKQLERLMEAIHQKNEELGIKESLVKEKEEALAEMEHQRKVEIAAQEA
                     KAKKEEEEKAERKKKMKELADEIKKKQKEEEEKKKKQREDEEKERKRLSDAFWLIRER
                     LAKEEAGLLRPVEVPQELRDKYTDDNNKLVPNSKQVLLLSAFNNSAESSDNMTRKVMI
                     NRDEYCKYHGYTHLFINTTRYIKQDQNQRSPRWWKIPAIKEAFKKHPEAEWIWYADYD
                     IMITNEMVDLAQHLLNPYILAERITYGSPVNSLGDQLDGLRVPPRDHFDVNKVDIIFS
                     QDFFGINTASFFIRRSVFTEFLLDIWDDPFFMDKEWLREEQDAFVFLYQHYKVVFEHT
                     AIVPQRGINSYHKYKTETGSWQKDDLALNFAVPSEDEKRSTKELFDTYFIIRKKVPEE
                     FQIN"
     gene            complement(<429548..>430714)
                     /gene="HOC1"
                     /locus_tag="AWJ20_134"
                     /db_xref="GeneID:30033131"
     mRNA            complement(<429548..>430714)
                     /gene="HOC1"
                     /locus_tag="AWJ20_134"
                     /product="Hoc1p"
                     /transcript_id="XM_018878212.1"
                     /db_xref="GeneID:30033131"
     CDS             complement(429548..430714)
                     /gene="HOC1"
                     /locus_tag="AWJ20_134"
                     /inference="similar to AA sequence:KEGG_Orthology:K05528"
                     /note="Alpha-1,6-mannosyltransferase; involved in cell
                     wall mannan biosynthesis; subunit of a Golgi-localized
                     complex that also contains Anp1p, Mnn9p, Mnn11p, and
                     Mnn10p; identified as a suppressor of a cell lysis
                     sensitive pkc1-371 allele; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IEA,IEA]; GO_component:
                     GO:0000136 - alpha-1,6-mannosyltransferase complex
                     [Evidence IDA] [PMID 10037752]; GO_component: GO:0000136 -
                     alpha-1,6-mannosyltransferase complex [Evidence IPI] [PMID
                     9430634]; GO_component: GO:0000136 -
                     alpha-1,6-mannosyltransferase complex [Evidence IDA] [PMID
                     9434768]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0000009 -
                     alpha-1,6-mannosyltransferase activity [Evidence IDA]
                     [PMID 10037752]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016757 -
                     transferase activity, transferring glycosyl groups
                     [Evidence IEA]; GO_function: GO:0016757 - transferase
                     activity, transferring glycosyl groups [Evidence ISS]
                     [PMID 9653120]; GO_process: GO:0000032 - cell wall
                     mannoprotein biosynthetic process [Evidence TAS] [PMID
                     10037752]; GO_process: GO:0006080 - substituted mannan
                     metabolic process [Evidence TAS] [PMID 10037752]"
                     /codon_start=1
                     /product="Hoc1p"
                     /protein_id="XP_018734384.1"
                     /db_xref="GeneID:30033131"
                     /translation="MLTFRRSVVVAATVLLLFFVFFSDPKSISAKDLLHDVELEQKLQ
                     KNRQETESAIRELQASTSRADDAQERKIELLEAQRKNLEKQLQQLRRLPPDAGVRTQL
                     AFQFPYDTLNKFPAYIWQTWKQDFDDPNFDERFKYHVRSWDEKNNGFVHEVMSDQTAR
                     TLIRYLYMNIPQVIEAYEAMPENILRADFFRYLILLARGGTYSDVDTEALQPIPNWIP
                     DRIDPMKLGLIIGIEADPDRPDWDEWYARRIQFCQWTIQSKPGHPVLREIVAKITETT
                     LQKKKENRLQLPSTKDRGSEVMDWTGPGVWTDSVFGYFNDPVKSGLYYPVTWSNFTGM
                     DQPKAVSDVLVLPITSFSPGIETMGAGGDNDPLAFVKHHFEGSWKPEDERMNSN"
     gene            complement(<431722..>432381)
                     /gene="MOG1"
                     /locus_tag="AWJ20_135"
                     /db_xref="GeneID:30033142"
     mRNA            complement(<431722..>432381)
                     /gene="MOG1"
                     /locus_tag="AWJ20_135"
                     /product="Mog1p"
                     /transcript_id="XM_018878222.1"
                     /db_xref="GeneID:30033142"
     CDS             complement(431722..432381)
                     /gene="MOG1"
                     /locus_tag="AWJ20_135"
                     /note="Conserved nuclear protein that interacts with
                     GTP-Gsp1p; stimulates nucleotide release from Gsp1p;
                     involved in nuclear protein import; nucleotide release is
                     inhibited by Yrb1p; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 9860978]; GO_function: GO:0008536 -
                     Ran GTPase binding [Evidence IPI] [PMID 11509570];
                     GO_process: GO:0051028 - mRNA transport [Evidence IEA];
                     GO_process: GO:0006606 - protein import into nucleus
                     [Evidence IMP] [PMID 9860978]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mog1p"
                     /protein_id="XP_018734385.1"
                     /db_xref="GeneID:30033142"
                     /translation="MTAVDLEKQELYGGALTSSVPVNFKDASFFRQVPDTQEVFVSDD
                     NEYLNHSMVFDIMEMVEGCKSTKDAAVIHLNEISSLNGVDGRCKILSIDETTVSNGDV
                     SDDEAIILTAVEPSRKWGRTEPSNGVLLLVLGLIRITKVTADILISYNVPITDPDQLK
                     DLQELVYKSNTEGHSPSSQSVLSDTTTPATSILDTINVARSRVGGAMASFVVNDWSLF
                     G"
     gene            <433916..>436552
                     /gene="URB2"
                     /locus_tag="AWJ20_136"
                     /db_xref="GeneID:30033153"
     mRNA            <433916..>436552
                     /gene="URB2"
                     /locus_tag="AWJ20_136"
                     /product="putative nucleolar protein URB2p"
                     /transcript_id="XM_018878233.1"
                     /db_xref="GeneID:30033153"
     CDS             433916..436552
                     /gene="URB2"
                     /locus_tag="AWJ20_136"
                     /inference="similar to AA sequence:KEGG_Orthology:K14862"
                     /note="similar to S. cerevisiae URB2 (YJR041C) essential
                     nucleolar protein (Unhealthy Ribosome Biogenesis); allele
                     of CaO19.5884"
                     /codon_start=1
                     /product="putative nucleolar protein URB2p"
                     /protein_id="XP_018734386.1"
                     /db_xref="GeneID:30033153"
                     /translation="MSLKTAEEVTRFLRSKNESLPKLLEVAFSLRNGDLPVYLPQKDV
                     VLLDWLLEKLSANNGTAWRLESGSWVLYKSIWEGLQQNNKTEARSRAFKNHNFASILV
                     NSLRDIAESPSSIISVFPSLSDSLGSVLSATRDGHNVVILTRSGPQGGEVNTISQQLI
                     LEYMNCVLACTKSEEIEILSPFSKELLRTLDQVLVRGLKFSSKSSNSNGVSIFSRIII
                     LLSTISDQSIIYFIHKLLASLFSSDSSELPSIKSSISEAIKLLETRHQSSDILTIGLG
                     KLYNAMLSAPNGKMLSNKYFDELITEHPLSSTVLLQTALDRNIKIEQSTIRKILDKQL
                     LDTSNTDWTIVKFVLEIDGQVVLQSEVSTKLFESINTAESNDSLEAIAALLVKSYSQP
                     RDMPDFFVKWRTTLIEQSPTWRSEQVVKQVTSNLTGLSVHQISSLINGFLEGPSGSEL
                     PVKKSKKRKLEKSIDESVMPLAVLVNSLSPEKVPRVKESLMKILDTESLDISKVKYLI
                     MSLSPDFVSSAMVSTEFSKHNWLDYFSSVFRVAEIHQVKEFSKVVNDLFEFLKRNKNK
                     QVPTFLSEITSRWLFLVNQSFDESHITQLVELYLDNSANLLGLASNPYLYEQPRIINT
                     LILAVSRDLESKAPRLQAVLPALVLFPIDVFTKGHRQDLLDSLLTLDKELDIEDCIAL
                     RKCLRLLLARPTFSSKIEKDYDVIINLFSSSAKSTELEAVTSDICTSVIGHHISNTNE
                     SSKEFISSLVAKVQKKTKKLSKKASLETWVLKFGCIVLTTAGLNEEFQTEFFNSIKQY
                     LAAYEDSEDMASVLEYLLPVVRMTPEPFHEFRDTFGEILTASIGTRRVFMNCFKIMCL
                     IVNGISDLRSLTAVYIVIGKFL"
     gene            <441333..>442730
                     /gene="MIT1"
                     /locus_tag="AWJ20_137"
                     /db_xref="GeneID:30033164"
     mRNA            <441333..>442730
                     /gene="MIT1"
                     /locus_tag="AWJ20_137"
                     /product="Mit1p"
                     /transcript_id="XM_018878244.1"
                     /db_xref="GeneID:30033164"
     CDS             441333..442730
                     /gene="MIT1"
                     /locus_tag="AWJ20_137"
                     /note="Transcriptional regulator of pseudohyphal growth;
                     protein with sequence similarity to S. pombe gti1+
                     (gluconate transport inducer 1) and C. albicans Wor1;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Mit1p"
                     /protein_id="XP_018734387.1"
                     /db_xref="GeneID:30033164"
                     /translation="MMQSYYGHVRTQQDAILLFEACRQGLIPRIRRRLSERERFQITS
                     GCVYIWDEQEAGMRRWTDGKSWSASRVSGAFLTYREMDGSRRPSSPDGKQSDSADGSP
                     QGSSPQMKKRTKFWDNDVSVSSSTPASSSASDSGSGNGSEEGYRYKPNGLYKQSFSIT
                     TSSNLKLHLISYYRKEDIISGKLVQPTSDPRIKDLPIPLNLYPDTSPGVSLIPAITNA
                     PLVGRHQMPTADGIKDPMGILVKNESFPQNGNNHNGLQKTGGFGELTGSPTPQYSNFA
                     SSTSTMPPSPSGVPPNTMVVHNGPEAQYYQQATPPAGPYILHPQQQPLTYHNPSQPPH
                     VQVLSPPDQQPQPQPQPQSQQQGPQLPLPPPPPQQQPQQSQQQQLPQIQIHQQQQQMS
                     QRLPGPPQPPAGHPPPSTSPRPMLPLGSPFNGTQPVLNTSSLTRSDMPHGLGPAAQFA
                     EDRRVINILDKALII"
     gene            <445023..>446948
                     /gene="rad4"
                     /locus_tag="AWJ20_138"
                     /db_xref="GeneID:30033175"
     mRNA            <445023..>446948
                     /gene="rad4"
                     /locus_tag="AWJ20_138"
                     /product="BRCT domain protein Rad4"
                     /transcript_id="XM_018878254.1"
                     /db_xref="GeneID:30033175"
     CDS             445023..446948
                     /gene="rad4"
                     /locus_tag="AWJ20_138"
                     /codon_start=1
                     /product="BRCT domain protein Rad4"
                     /protein_id="XP_018734388.1"
                     /db_xref="GeneID:30033175"
                     /translation="MSFLRPEGIPQIFEKWRSGLDIDIEQELEAAKLPVFDGYKICAT
                     NINIDPDRKILIDLITTHGGEYMPDLTKSVTQLISPVPTGKKYTFAKKWDIWVVSPLW
                     VTMSVERGAALNEKFFSLDLPADKIGKGACSFDLHRQRERITKAREVAAVTEVDRTMS
                     EISAPVKRKKSMASTAWNSILSDLGNHVVKKEIDVDRDQAAWEMNRRNAPNESEGYDH
                     DNQDDNNSLNRRRRYEYENGDEHLIDKRNRLDIDTVNPANALFLNHCFMFVGFNDKQL
                     KRLQSIITSHRGRLAEGEHRPTLIIVNSELPVAKYHELQLEREYTSVPIYTEWALERS
                     LHKKKLSLDIWGQYVVHRDIPGFSGLNISLSGYAGVELLHLERLVNLLGGLYQSVFTA
                     SGDLLVSTPRSSKFKYALIWKVPIVNHLWIWGCASKGTILPLDCKEWVIDGKETEVRF
                     LPRNKTAVVDTTVTADSRAPQAVSVAPVIPVQEKNRAESETEQSEESETMAPVSHSET
                     SSLSELLQLARSDTDGLPVRDESHRPQKRSRDRRIVGRATESASANEVMKPATLVEVQ
                     PVEEQAHPSTQVSYLDIETQDERKKLLEALGESESAAEELRSVPDEMGPAVDLLHKRP
                     RRNRNSTTPGRRLRANS"
     gene            complement(<447292..>448296)
                     /gene="RIT1"
                     /locus_tag="AWJ20_139"
                     /db_xref="GeneID:30033186"
     mRNA            complement(<447292..>448296)
                     /gene="RIT1"
                     /locus_tag="AWJ20_139"
                     /product="Rit1p"
                     /transcript_id="XM_018878265.1"
                     /db_xref="GeneID:30033186"
     CDS             complement(447292..448296)
                     /gene="RIT1"
                     /locus_tag="AWJ20_139"
                     /inference="similar to AA sequence:KEGG_Orthology:K15463"
                     /note="2'-O-ribosyl phosphate transferase; modifies the
                     initiator methionine tRNA at position 64 to distinguish it
                     from elongator methionine tRNA; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016763 - transferase activity, transferring pentosyl
                     groups [Evidence IEA]; GO_function: GO:0016763 -
                     transferase activity, transferring pentosyl groups
                     [Evidence IDA,IGI,IMP] [PMID 7954819]; GO_process:
                     GO:0019988 - charged-tRNA amino acid modification
                     [Evidence IGI,IMP] [PMID 7954819]; GO_process: GO:0008033
                     - tRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="Rit1p"
                     /protein_id="XP_018734389.1"
                     /db_xref="GeneID:30033186"
                     /translation="MPDALSKTIPIWCSVLNYLALGGDVMFFTPPNTVSASEHDQIRS
                     RVIGWAELAVNNGIDVEMLKTKITKPLRPLWITPDAYLPDEVPEFDEFYPLILCTASR
                     MVQDGTEHRQGYTYVQGAADDHEEWAQLLTPELLWFNRDSLGDSKHTDSELHEMIENL
                     AEQSSRLGAGQNKDTSEITLIKPTNISIASRSGCDVEDFVKFDLIIDLSEKSMSADDD
                     NRKSGYRKLTYPLAAGKKGSKELRTILPDLVAVVSNESLFKGKILVICDTGTDFSVGV
                     ALVIVCLFYSLSYDCLDSRTTAFLDKTEIRKRLVHIISEHKCNPSRNTLNAVNAYLMG
                     "
     gene            complement(<448499..>448852)
                     /gene="RIT1"
                     /locus_tag="AWJ20_140"
                     /db_xref="GeneID:30033198"
     mRNA            complement(<448499..>448852)
                     /gene="RIT1"
                     /locus_tag="AWJ20_140"
                     /product="Rit1p"
                     /transcript_id="XM_018878276.1"
                     /db_xref="GeneID:30033198"
     CDS             complement(448499..448852)
                     /gene="RIT1"
                     /locus_tag="AWJ20_140"
                     /inference="similar to AA sequence:KEGG_Orthology:K15463"
                     /note="2'-O-ribosyl phosphate transferase; modifies the
                     initiator methionine tRNA at position 64 to distinguish it
                     from elongator methionine tRNA; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016763 - transferase activity, transferring pentosyl
                     groups [Evidence IEA]; GO_function: GO:0016763 -
                     transferase activity, transferring pentosyl groups
                     [Evidence IDA,IGI,IMP] [PMID 7954819]; GO_process:
                     GO:0019988 - charged-tRNA amino acid modification
                     [Evidence IGI,IMP] [PMID 7954819]; GO_process: GO:0008033
                     - tRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="Rit1p"
                     /protein_id="XP_018734390.1"
                     /db_xref="GeneID:30033198"
                     /translation="MNSNSDIDFVNGNFKESLDSLVNSSFGELSKSIRKDSRSVRNRI
                     QSILQDSNYVQLVAASYNLPLVANERCGRWYIPPEKIKESVYFKSTDGHTGQWGFSTR
                     RLNTHILDLILANNG"
     gene            <450374..>451582
                     /gene="FPR4"
                     /locus_tag="AWJ20_141"
                     /db_xref="GeneID:30033209"
     mRNA            <450374..>451582
                     /gene="FPR4"
                     /locus_tag="AWJ20_141"
                     /product="peptidylprolyl isomerase FPR4"
                     /transcript_id="XM_018878287.1"
                     /db_xref="GeneID:30033209"
     CDS             450374..451582
                     /gene="FPR4"
                     /locus_tag="AWJ20_141"
                     /inference="similar to AA sequence:KEGG_Orthology:K14826"
                     /note="Peptidyl-prolyl cis-trans isomerase (PPIase);
                     nuclear proline isomerase; affects expression of multiple
                     genes via its role in nucleosome assembly; catalyzes
                     isomerization of proline residues in histones H3 and H4,
                     which affects lysine methylation of those histones; PPIase
                     domain acts as a transcriptional repressor when tethered
                     to DNA by lexA, and repressor activity is dependent on
                     PPIase activity; FPR4 has a paralog, FPR3, that arose from
                     the whole genome duplication; GO_component: GO:0000785 -
                     chromatin [Evidence IDA] [PMID 14981505]; GO_component:
                     GO:0000785 - chromatin [Evidence IDA] [PMID 16959570];
                     GO_component: GO:0016020 - membrane [Evidence IBA];
                     GO_component: GO:0005730 - nucleolus [Evidence IBA,IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14981505]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 9371805]; GO_function: GO:0005528 -
                     FK506 binding [Evidence IBA,IEA]; GO_function: GO:0016853
                     - isomerase activity [Evidence IEA]; GO_function:
                     GO:0005527 - macrolide binding [Evidence IDA] [PMID
                     9371805]; GO_function: GO:0003755 - peptidyl-prolyl
                     cis-trans isomerase activity [Evidence IEA,IEA,IEA];
                     GO_function: GO:0003755 - peptidyl-prolyl cis-trans
                     isomerase activity [Evidence IDA] [PMID 14981505];
                     GO_function: GO:0003755 - peptidyl-prolyl cis-trans
                     isomerase activity [Evidence IDA] [PMID 16959570];
                     GO_process: GO:0000412 - histone peptidyl-prolyl
                     isomerization [Evidence IEA]; GO_process: GO:0000412 -
                     histone peptidyl-prolyl isomerization [Evidence IDA] [PMID
                     16959570]; GO_process: GO:0000415 - negative regulation of
                     histone H3-K36 methylation [Evidence IMP] [PMID 16959570];
                     GO_process: GO:0006334 - nucleosome assembly [Evidence
                     IDA] [PMID 16846601]; GO_process: GO:0006334 - nucleosome
                     assembly [Evidence IDA] [PMID 24297734]; GO_process:
                     GO:0018208 - peptidyl-proline modification [Evidence
                     IBA,IEA]; GO_process: GO:0006457 - protein folding
                     [Evidence IEA,IEA]; GO_process: GO:0034401 - regulation of
                     transcription by chromatin organization [Evidence IMP]
                     [PMID 16959570]"
                     /codon_start=1
                     /product="peptidylprolyl isomerase FPR4"
                     /protein_id="XP_018734391.1"
                     /db_xref="GeneID:30033209"
                     /translation="MSAYNLLPLASFSLELIPGLPTPPIDDEFNVSVRLTMAAIDPND
                     AVDDEKTPSTLKIIKRVIEDYDDYDDDLLAASSDEDEDDEEEEEEEEEEEEKASKKSK
                     KSEDEDEDEEMDDDEDDEDEDDDEDVETSETVICTLSPSSQFQQTLDLVITAGEEVLF
                     VVEGSYPIHLTGNYVEHPYDDESDDYEESDDDEDLDDDELDYDLTPDEDEIDEDKIRE
                     LVDSEEEEEEEEEEKPAPKSKKEAKKENKKRAAEAEEEEAAAKKQKKADGKKVAFSKE
                     LEQGPTGSAAASKKPSTKKLEGGVVAEDRVVGEGPTAKSGQTVGIRYIGKLADGKVFD
                     SNTKGKPFTFKLGAGDVIKGMDIGVTGMAVKGERRVVIPAALAYGKKKLPGIPANSEL
                     TFDIKVVKIK"
     gene            complement(<451808..>453898)
                     /gene="SEC1"
                     /locus_tag="AWJ20_142"
                     /db_xref="GeneID:30033220"
     mRNA            complement(<451808..>453898)
                     /gene="SEC1"
                     /locus_tag="AWJ20_142"
                     /product="Sec1p"
                     /transcript_id="XM_018878298.1"
                     /db_xref="GeneID:30033220"
     CDS             complement(451808..453898)
                     /gene="SEC1"
                     /locus_tag="AWJ20_142"
                     /inference="similar to AA sequence:KEGG_Orthology:K15292"
                     /note="Sm-like protein involved in docking and fusion of
                     exocytic vesicles; binds to assembled SNARE complexes at
                     the membrane and stimulates membrane fusion; localization
                     to sites of secretion (bud neck and bud tip) is dependent
                     on SNARE function; interacts directly with essential
                     exocyst subunit Sec6p; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 10427089]; GO_component:
                     GO:0005935 - cellular bud neck [Evidence IDA] [PMID
                     11038189]; GO_component: GO:0005934 - cellular bud tip
                     [Evidence IDA] [PMID 10427089]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 11038189];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 15466482]; GO_function: GO:0000149 - SNARE binding
                     [Evidence IDA] [PMID 10427089]; GO_process: GO:0006887 -
                     exocytosis [Evidence IMP,IPI] [PMID 10427089]; GO_process:
                     GO:0031340 - positive regulation of vesicle fusion
                     [Evidence IDA] [PMID 15466482]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0006904 - vesicle
                     docking involved in exocytosis [Evidence IEA]; GO_process:
                     GO:0006904 - vesicle docking involved in exocytosis
                     [Evidence IPI] [PMID 10427089]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="Sec1p"
                     /protein_id="XP_018734392.1"
                     /db_xref="GeneID:30033220"
                     /translation="MLFDCSVKSNPITTAEANEIIEIFGLLDSVNPASRYKAVILDRE
                     TKKNFDRVIEVHEILDRNASSVQILDEKRQSESYLEAVYFIKPTAYNIECIAADFTRA
                     PTRYACAHIFVTSNISDELLVKLKNSATGRYLKRLEIVHIDFWTLESQVFTLDDPFAI
                     EQYYSSQCHDLVTKLVKKVASQLVGVCVMLDEYPIIRFYKPTSAIHEAHVLPFMIADE
                     FQKQMDDYLRNNPNFKGVSEQRGRSVFLILDRSIDPFAPFLHEFTFQAMAYDLLPVKD
                     GLKVEYFVDGKTGKEKVEGVISEKDPDWVGLRHLHMQEVIEKLTEKMDRLKTDNPHFA
                     ASQIGNGNSGGNTTVSDLQDMVASLPAFMETKDRFALNLHMASECMEILQRKGLSDIA
                     DVEQTVTLGVGADGIKPKNLADEFIALIADPNLGKAEKVRLVMLYSLHRGGLIEADYK
                     KLMHHSGLDDTDIDVIRNMTVFGHPTFKTTLGKLKQSKLPKSYFSHSTEDVYSVSRFV
                     PGVKNVVASAIERTLSADEFPYTKYEPTEGHDEMEVQASLRNPRQRAVWAKTTATSLN
                     KQRVFVYMAGGFTQSEARSIYELNKKYPKEIIIGGDQVITPNNFLRILSRLSVSRKQL
                     NLPCDQPKQQVPQHLFESDRQNRPSANQATPASTPAGQQASRPSSSKASSSTTQPERP
                     PIKEKKSRFGKFFK"
     gene            complement(<454917..>456149)
                     /gene="PAF1"
                     /locus_tag="AWJ20_143"
                     /db_xref="GeneID:30033231"
     mRNA            complement(<454917..>456149)
                     /gene="PAF1"
                     /locus_tag="AWJ20_143"
                     /product="Paf1p"
                     /transcript_id="XM_018878308.1"
                     /db_xref="GeneID:30033231"
     CDS             complement(454917..456149)
                     /gene="PAF1"
                     /locus_tag="AWJ20_143"
                     /inference="similar to AA sequence:KEGG_Orthology:K15174"
                     /note="Component of the Paf1p complex involved in
                     transcription elongation; binds to and modulates the
                     activity of RNA polymerases I and II; required for
                     expression of a subset of genes, including cell
                     cycle-regulated genes; involved in SER3 repression by
                     helping to maintain SRG1 transcription-dependent
                     nucleosome occupancy; homolog of human PD2/hPAF1;
                     GO_component: GO:0016593 - Cdc73/Paf1 complex [Evidence
                     IPI] [PMID 11884586]; GO_component: GO:0016593 -
                     Cdc73/Paf1 complex [Evidence IPI] [PMID 11927560];
                     GO_component: GO:0016593 - Cdc73/Paf1 complex [Evidence
                     IPI] [PMID 9032243]; GO_component: GO:0005654 -
                     nucleoplasm [Evidence IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 15149594]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 15643076]; GO_component:
                     GO:0035327 - transcriptionally active chromatin [Evidence
                     IDA] [PMID 11983171]; GO_function: GO:1990269 - RNA
                     polymerase II C-terminal domain phosphoserine binding
                     [Evidence IDA] [PMID 22796944]; GO_function: GO:0000993 -
                     RNA polymerase II core binding [Evidence IPI] [PMID
                     16581788]; GO_function: GO:0000983 - RNA polymerase II
                     core promoter sequence-specific DNA binding transcription
                     factor activity [Evidence IDA] [PMID 16581788];
                     GO_function: GO:0001076 - RNA polymerase II transcription
                     factor binding transcription factor activity [Evidence
                     IPI] [PMID 11927560]; GO_function: GO:0001076 - RNA
                     polymerase II transcription factor binding transcription
                     factor activity [Evidence IPI] [PMID 16581788];
                     GO_function: GO:0001089 - TFIIF-class binding
                     transcription factor activity [Evidence IMP,IPI] [PMID
                     9032243]; GO_function: GO:0003682 - chromatin binding
                     [Evidence IDA] [PMID 11983171]; GO_process: GO:0006353 -
                     DNA-templated transcription, termination [Evidence IMP]
                     [PMID 23109428]; GO_process: GO:0000183 - chromatin
                     silencing at rDNA [Evidence IMP] [PMID 16582434];
                     GO_process: GO:0070911 - global genome nucleotide-excision
                     repair [Evidence IMP] [PMID 21737840]; GO_process:
                     GO:0031124 - mRNA 3'-end processing [Evidence IMP] [PMID
                     15149594]; GO_process: GO:0045910 - negative regulation of
                     DNA recombination [Evidence IMP] [PMID 9891041];
                     GO_process: GO:0000122 - negative regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 15180994]; GO_process: GO:2001255 - positive
                     regulation of histone H3-K36 trimethylation [Evidence IMP]
                     [PMID 17948059]; GO_process: GO:2001165 - positive
                     regulation of phosphorylation of RNA polymerase II
                     C-terminal domain serine 2 residues [Evidence IMP] [PMID
                     18469135]; GO_process: GO:2001209 - positive regulation of
                     transcription elongation from RNA polymerase I promoter
                     [Evidence IDA] [PMID 20299458]; GO_process: GO:0032968 -
                     positive regulation of transcription elongation from RNA
                     polymerase II promoter [Evidence IMP] [PMID 14710186];
                     GO_process: GO:0006364 - rRNA processing [Evidence IMP]
                     [PMID 20299458]; GO_process: GO:0031938 - regulation of
                     chromatin silencing at telomere [Evidence IMP] [PMID
                     12667454]; GO_process: GO:0031938 - regulation of
                     chromatin silencing at telomere [Evidence IMP] [PMID
                     18194564]; GO_process: GO:2001173 - regulation of histone
                     H2B conserved C-terminal lysine ubiquitination [Evidence
                     IDA] [PMID 19531475]; GO_process: GO:2001166 - regulation
                     of histone H2B ubiquitination [Evidence IMP] [PMID
                     12876294]; GO_process: GO:0051569 - regulation of histone
                     H3-K4 methylation [Evidence IMP] [PMID 12667454];
                     GO_process: GO:0051569 - regulation of histone H3-K4
                     methylation [Evidence IMP] [PMID 12876294]; GO_process:
                     GO:0051569 - regulation of histone H3-K4 methylation
                     [Evidence IMP] [PMID 15180994]; GO_process: GO:2001163 -
                     regulation of phosphorylation of RNA polymerase II
                     C-terminal domain serine 2 residues [Evidence IMP] [PMID
                     15149594]; GO_process: GO:0034401 - regulation of
                     transcription by chromatin organization [Evidence IMP]
                     [PMID 18194564]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 11884586]; GO_process: GO:0000083 - regulation
                     of transcription involved in G1/S transition of mitotic
                     cell cycle [Evidence IMP] [PMID 10219085]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0090262 - regulation of
                     transcription-coupled nucleotide-excision repair [Evidence
                     IGI] [PMID 21737840]; GO_process: GO:0031126 - snoRNA
                     3'-end processing [Evidence IMP] [PMID 16246725];
                     GO_process: GO:0001015 - snoRNA transcription from an RNA
                     polymerase II promoter [Evidence IDA,IMP] [PMID 16246725];
                     GO_process: GO:0006362 - transcription elongation from RNA
                     polymerase I promoter [Evidence IMP] [PMID 19164765];
                     GO_process: GO:0006368 - transcription elongation from RNA
                     polymerase II promoter [Evidence IGI,IMP] [PMID 11927560];
                     GO_process: GO:0006360 - transcription from RNA polymerase
                     I promoter [Evidence IGI,IMP] [PMID 20299458]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Paf1p"
                     /protein_id="XP_018734393.1"
                     /db_xref="GeneID:30033231"
                     /translation="MSRRQDYIARIRYQNDLPPPPCPPKLLNIPLDTSKLASSPAVLT
                     NLVRKQPINVDIDIDLGMPLDLTEVQGIFDRGDEAGIYPSSTAPSVDRLDPKDRALLR
                     NPKGITSVSKTQPGVSFLRRTEYISSEAVRQSSDSPLRSTALLRQKRLSVVSGPEEQL
                     RIVENTFDASAEDLSKLKHPKKKNLKAVESWQLFPDSKMFDLQYLSVKLVGSASLSSS
                     KRKFAPESLETAIFRQNSASNGEEWMSLYTADEETGKKLKSRLDSTEDTVVDDEEDDD
                     QSYRFTRVQDNDIDLKLHPSSSFAEIAISFTDDGEAYYLPVVGRASLKRRRVTTLKQE
                     LINEHNIDAIDLSIREITPKESVIRDNQRSEYDKISFPYTENVDDDEDEDRPGESPEA
                     NENENDDDDEENNDLEEN"
     gene            complement(<457981..>458799)
                     /gene="PET8"
                     /locus_tag="AWJ20_144"
                     /db_xref="GeneID:30033242"
     mRNA            complement(<457981..>458799)
                     /gene="PET8"
                     /locus_tag="AWJ20_144"
                     /product="Pet8p"
                     /transcript_id="XM_018878319.1"
                     /db_xref="GeneID:30033242"
     CDS             complement(457981..458799)
                     /gene="PET8"
                     /locus_tag="AWJ20_144"
                     /inference="similar to AA sequence:KEGG_Orthology:K15111"
                     /note="S-adenosylmethionine transporter of the
                     mitochondrial inner membrane; member of the mitochondrial
                     carrier family; required for biotin biosynthesis and
                     respiratory growth; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005743 - mitochondrial
                     inner membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence ISS]
                     [PMID 10930523]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14609944];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0000095 -
                     S-adenosyl-L-methionine transmembrane transporter activity
                     [Evidence IDA,IGI,IMP] [PMID 14609944]; GO_process:
                     GO:0015805 - S-adenosyl-L-methionine transport [Evidence
                     IDA,IGI,IMP] [PMID 14609944]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Pet8p"
                     /protein_id="XP_018734394.1"
                     /db_xref="GeneID:30033242"
                     /translation="MAGTSTDLFFFPIDTLKTRLQAKGGFFANGGWHGMYRGLGSAVV
                     ASAPGASLFFLSYESSKKYLTPIMTSKIENETLAHGLVHMLAASVGEVAACSVRVPAE
                     VVKQRVQTSQEATSLQALKSILTNKYGEGIWRGLYRGWGTTIMREIPFTMLQFPLYEY
                     LKHQRALSLGVDKISPGEGAVCGSIAGGFAAALTTPLDVIKTRLMLRKSRASALQVAK
                     QLLKDEGYSAFFKGIGPRTMWISAGGAIFLGVYEAAKDTTSWLLASQASNAEPL"
     gene            <459771..>461255
                     /gene="NFS1"
                     /locus_tag="AWJ20_145"
                     /db_xref="GeneID:30033253"
     mRNA            <459771..>461255
                     /gene="NFS1"
                     /locus_tag="AWJ20_145"
                     /product="Nfs1p"
                     /transcript_id="XM_018878330.1"
                     /db_xref="GeneID:30033253"
     CDS             459771..461255
                     /gene="NFS1"
                     /locus_tag="AWJ20_145"
                     /inference="similar to AA sequence:KEGG_Orthology:K04487"
                     /note="Cysteine desulfurase; involved in iron-sulfur
                     cluster (Fe/S) biogenesis and in thio-modification of
                     mitochondrial and cytoplasmic tRNAs; essential protein
                     located predominantly in mitochondria; GO_component:
                     GO:1990221 - L-cysteine desulfurase complex [Evidence IPI]
                     [PMID 24045011]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 10406803];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 19720832];
                     GO_component: GO:0005634 - nucleus [Evidence IMP] [PMID
                     11110795]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 19720832]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0031071 -
                     cysteine desulfurase activity [Evidence IEA,IEA];
                     GO_function: GO:0031071 - cysteine desulfurase activity
                     [Evidence IDA] [PMID 12065597]; GO_function: GO:0031071 -
                     cysteine desulfurase activity [Evidence IDA] [PMID
                     15220327]; GO_function: GO:0030170 - pyridoxal phosphate
                     binding [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0006879 - cellular iron ion homeostasis [Evidence IMP]
                     [PMID 10551871]; GO_process: GO:0006534 - cysteine
                     metabolic process [Evidence IEA]; GO_process: GO:0016226 -
                     iron-sulfur cluster assembly [Evidence IMP] [PMID
                     12970193]; GO_process: GO:0016226 - iron-sulfur cluster
                     assembly [Evidence IDA] [PMID 15220327]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0070903 - mitochondrial tRNA thio-modification
                     [Evidence IMP] [PMID 14722066]; GO_process: GO:0008033 -
                     tRNA processing [Evidence IEA]; GO_process: GO:0034227 -
                     tRNA thio-modification [Evidence IMP] [PMID 14722066];
                     GO_process: GO:0034227 - tRNA thio-modification [Evidence
                     IMP] [PMID 15220327]; GO_process: GO:0002098 - tRNA wobble
                     uridine modification [Evidence IMP] [PMID 18755837]"
                     /codon_start=1
                     /product="Nfs1p"
                     /protein_id="XP_018734395.1"
                     /db_xref="GeneID:30033253"
                     /translation="MLNITRRSVASVASIANAASTQARAASIGHRYSSTLPLIKETVS
                     SNHVADVLSSIASRTVNAPSGPTPVAPAGSYVEEALKESKLVGQSSPGTGRPIYLDMQ
                     ATTPTDPRVLDYMLQFYTGQYGNPHSRTHAYGWETDTAVETARKHVADVIGADAKEII
                     FTSGATESNNMSLKGVARFYKKTKNHIITTQTEHKCVLDSCRHLQDEGFDVTYLPVKS
                     NGLIDLEDLERAIRPETAIVSIMFVNNEIGVIQPMEEIGRLCRKNKVFFHTDAAQAFG
                     KIPIDVNKLNIDLMSISGHKIYGPKGIGACYVRRRPRVRLEPIINGGGQERGLRSGTL
                     APPLVAGFGEAARLMMSEMEYDSQHIRRLSNKLTSNILQLEHTVLNGDKDAHYPGCVN
                     ISFAYVEGESLLMALNDIALSSGSACTSASLEPSYVLRALGADDALAHSSIRFGIGRF
                     TTEAEIDYVLQTVVSKVNKLRELSPLWEMVQEGIDLETIQWSQH"
     gene            <461730..>462188
                     /gene="HPA2"
                     /locus_tag="AWJ20_146"
                     /db_xref="GeneID:30033264"
     mRNA            <461730..>462188
                     /gene="HPA2"
                     /locus_tag="AWJ20_146"
                     /product="Hpa2p"
                     /transcript_id="XM_018878341.1"
                     /db_xref="GeneID:30033264"
     CDS             461730..462188
                     /gene="HPA2"
                     /locus_tag="AWJ20_146"
                     /inference="similar to AA sequence:KEGG_Orthology:K18852"
                     /note="Tetrameric histone acetyltransferase; has
                     similarity to Gcn5p, Hat1p, Elp3p, and Hpa3p; acetylates
                     histones H3 and H4 in vitro and exhibits autoacetylation
                     activity; also acetylates polyamines; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_function: GO:0008080 - N-acetyltransferase activity
                     [Evidence IEA]; GO_function: GO:0004402 - histone
                     acetyltransferase activity [Evidence IEA]; GO_function:
                     GO:0004402 - histone acetyltransferase activity [Evidence
                     ISS] [PMID 10600387]; GO_function: GO:0042803 - protein
                     homodimerization activity [Evidence IDA] [PMID 10600387];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016746 - transferase activity,
                     transferring acyl groups [Evidence IEA]; GO_process:
                     GO:0016568 - chromatin modification [Evidence IEA];
                     GO_process: GO:0016573 - histone acetylation [Evidence
                     ISS] [PMID 10600387]; GO_process: GO:0051289 - protein
                     homotetramerization [Evidence IDA] [PMID 10600387]"
                     /codon_start=1
                     /product="Hpa2p"
                     /protein_id="XP_018734396.1"
                     /db_xref="GeneID:30033264"
                     /translation="MTVTIRPIEQSDKSQYSSLFAAYLVFYKAQLPEKILEKTWERFF
                     DDKEPVYAAVAFDDESPEKLIGFVTYVFHRSTWQYNDVIYLHDLFVDPEVRSRGTGRK
                     LIEYVYGEADKHEVAKVYWHTQIFNHRAQLLYTKVGVRDDFVSYQRPAKK"
     gene            complement(<462286..>464847)
                     /gene="BFA1"
                     /locus_tag="AWJ20_147"
                     /db_xref="GeneID:30033275"
     mRNA            complement(<462286..>464847)
                     /gene="BFA1"
                     /locus_tag="AWJ20_147"
                     /product="Bfa1p"
                     /transcript_id="XM_018878352.1"
                     /db_xref="GeneID:30033275"
     CDS             complement(462286..464847)
                     /gene="BFA1"
                     /locus_tag="AWJ20_147"
                     /inference="similar to AA sequence:KEGG_Orthology:K02181"
                     /note="Component of the GTPase-activating Bfa1p-Bub2p
                     complex; involved in multiple cell cycle checkpoint
                     pathways that control exit from mitosis; specifically
                     required when telomeres are damaged, but not for all types
                     of chromosomal DNA damage; phosphorylated by the Polo-like
                     kinase Cdc5p; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA]; GO_component: GO:0000922 - spindle pole
                     [Evidence IEA]; GO_component: GO:0005816 - spindle pole
                     body [Evidence IDA] [PMID 10220406]; GO_component:
                     GO:0005816 - spindle pole body [Evidence IDA] [PMID
                     15147270]; GO_function: GO:0005096 - GTPase activator
                     activity [Evidence IDA] [PMID 16682821]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0007067 - mitotic nuclear division [Evidence IEA];
                     GO_process: GO:0031578 - mitotic spindle orientation
                     checkpoint [Evidence IGI,IMP] [PMID 16039591]; GO_process:
                     GO:0007096 - regulation of exit from mitosis [Evidence
                     IMP] [PMID 15147270]"
                     /codon_start=1
                     /product="Bfa1p"
                     /protein_id="XP_018734397.1"
                     /db_xref="GeneID:30033275"
                     /translation="MPSKGVENWDDDDEFADIDESNFLISSVSSAGTQEGFYQMPASA
                     TDAAFSASNSESLRSSNLRGHASRPSNLRSFSEADENDDFSNDFDDLTTKMSKIDLAK
                     LQGARKPSIDYSTITGTITGTVRRLGGSGSSASSGPEHYGGAFRDDMDMDLDGEDIQT
                     IRVASGRKISSNSMAVPRVSSNARSNSRMLISGDFYRPPEQIETENKNRKKNISFDND
                     DEIIFDDTENLADRFTRVKNNRQMEVPGSLDDSLDDSFGFGTESRLSTYSLTTSATSY
                     TDNEEDDDDFGFSKEAGDLFDKPSVLQQRLKEVRHQNELESERDRELLAKGRKYDTIR
                     SNGSGNSIKANFRDNDNTITNKQVLVDFEDPDEDLLQGFDLKQGDDFISTKGTLHRNV
                     VIKATNQRTGTSPQKKAPRETQSIADFKAIGAVPGGPDYSSVRVKKSMPVLRPPINQK
                     ISNGRGTNIAGSTSPQRPRPTHHTERRVSGNVASGSPPKQFIRASNPRPPSRNQDMFE
                     NEDYGNLTIDATSTLAMKPGQFQPKRLRPVQSMLTMQPQEQSKASRQFVRPRRGPTFE
                     QDVLDQFDDLDVDFETESRFVATPKSKGHLYSGTVNNTSVKHVPLDTFREKFRPRKLR
                     EKDPVQNSQFSPQYQNQTPPQHQHQQHPSTVRSPTKSSLLKDNSQKKRGPKRRGPGLI
                     RHLGVPIASEESNGMHFNPTKLVWEGNDIELKKFESVNPKTPGLIAFISNKGQQVVGD
                     MVFDPDRLCWINIKDDHSDPFEGLDDLEVSSSIGGKHHNNAAVASAAVTAAEKLASSI
                     GGDFAVGNEFNLSAKFIEKMKHEDDRWARKTKGWFSPNEQIDREFLKEIRSMVMR"
     gene            complement(<465170..>468430)
                     /gene="KIP1"
                     /locus_tag="AWJ20_148"
                     /db_xref="GeneID:30033286"
     mRNA            complement(<465170..>468430)
                     /gene="KIP1"
                     /locus_tag="AWJ20_148"
                     /product="Kip1p"
                     /transcript_id="XM_018878363.1"
                     /db_xref="GeneID:30033286"
     CDS             complement(465170..468430)
                     /gene="KIP1"
                     /locus_tag="AWJ20_148"
                     /inference="similar to AA sequence:KEGG_Orthology:K10398"
                     /note="Kinesin-related motor protein; required for mitotic
                     spindle assembly, chromosome segregation, and 2 micron
                     plasmid partitioning; functionally redundant with Cin8p
                     for chromosomal but not plasmid functions; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005856 - cytoskeleton [Evidence IEA]; GO_component:
                     GO:0005871 - kinesin complex [Evidence IEA]; GO_component:
                     GO:0005871 - kinesin complex [Evidence TAS] [PMID
                     9153752]; GO_component: GO:0005874 - microtubule [Evidence
                     IEA]; GO_component: GO:0005634 - nucleus [Evidence IDA]
                     [PMID 22842922]; GO_component: GO:0005819 - spindle
                     [Evidence IEA]; GO_component: GO:0005876 - spindle
                     microtubule [Evidence IDA] [PMID 1618910]; GO_component:
                     GO:0005816 - spindle pole body [Evidence IDA] [PMID
                     9585415]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0008017 - microtubule binding
                     [Evidence IEA]; GO_function: GO:0003777 - microtubule
                     motor activity [Evidence IEA]; GO_function: GO:0003777 -
                     microtubule motor activity [Evidence IGI] [PMID 1618910];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0005200 - structural constituent of
                     cytoskeleton [Evidence IPI] [PMID 9585415]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0007019 - microtubule depolymerization [Evidence IMP]
                     [PMID 19041752]; GO_process: GO:0007018 -
                     microtubule-based movement [Evidence IEA]; GO_process:
                     GO:0007067 - mitotic nuclear division [Evidence IEA];
                     GO_process: GO:0000070 - mitotic sister chromatid
                     segregation [Evidence IGI] [PMID 7860634]; GO_process:
                     GO:0000022 - mitotic spindle elongation [Evidence IMP]
                     [PMID 9813090]; GO_process: GO:0030541 - plasmid
                     partitioning [Evidence IMP] [PMID 19364922]; GO_process:
                     GO:0090307 - spindle assembly involved in mitosis
                     [Evidence IMP] [PMID 9813090]; GO_process: GO:0000073 -
                     spindle pole body separation [Evidence IGI] [PMID
                     1618897]; GO_process: GO:0000073 - spindle pole body
                     separation [Evidence IGI] [PMID 1618910]"
                     /codon_start=1
                     /product="Kip1p"
                     /protein_id="XP_018734398.1"
                     /db_xref="GeneID:30033286"
                     /translation="MTSPKASKDIPNYMKPRSPLSSSSGILTSSAGSDSPIRTPRKKS
                     SLAMNRGPGVRSTMVTNGTPKIRKSMIRNELPNSNAAAIRSENLGGSTESESNIRVYV
                     RCRGRNAREISENSGVVVKTNGGMKNKDITLQTGNTYSNKTYTFDRVFGPEADQEMVY
                     EEVANKSLEEMLQGFNCTVFAYGQTGTGKTYTMTGDIDSIGKSESSGRPEENTGIIPR
                     ILFNLFKSLTAESKKRKLEHSIKLSYIELYNEELRDLIAAEGEDDKKVKIYDDSSKKG
                     VVIHGMEEAFVKTVDEAMEVLRLGSVRRHVAATGCNDQSSRSHSVFTITVHIKEISDL
                     TGQEFVRIGKLNLVDLAGSENINRSGAENKRAREAGMINQSLLTLGRVINALVDRSPH
                     IPYRESKLTRILQDSLGGRTKTCIIATISPAKVSLDETLSTLDYASRAKNIKNKPQPN
                     QTMSKQTHLMEYVMEIERLKQDLQSSRQKNGVYLSAESHQTLVDESESRRIQVEEQKM
                     RLDVVEHQLRAAKERSDTFDQQVADMQNQIDEKSRAYDQLQNQFRLAQEELAASKLKL
                     EQETIVRQAHQDTENKLHIIGNDLVNKLSSTVNDLDHLHSKLTSAVELSQSNELVIVS
                     AKDRVSKAIDDIETGAYEFRDNFTAHNKSLHKTATDLIETMESTLTEVLSSIQSTANS
                     SQGASGNMQHALVECENDTAVAIAEINKVKETIQSSISLQLKNIEATLVDHLDVVLGS
                     VRNQYNYTKDFFDRISEQLSQSTTTTNERLNGQRQQVDEIIETLEKLSNNITRVTTRY
                     NEQQYSLLEVELSSTTKEQELLVGQVQSALQDLTSKINILAEERKSRLTANHDLSKQQ
                     LSQIAVELGNVAGNIVPNHVMPLLDSQKESLEALASHDERIKSSLKEVKDGSKSFAHQ
                     IYKQTKETKASVANDISQNIEVAQHSATELGPLAEKLVQVNHTGYESLGRLVESQSAE
                     LRESLTNIETNIGSFESKILDCSETLATELGAHHDIWQVQQDQQLRELGDLKVYTTEN
                     LQARLVPDDMIPDRKAYSYLKVLPKTLARDVLLKQPYDENTNPREPLLDIDINSVS"
     gene            complement(<469640..>470230)
                     /gene="CAT5"
                     /locus_tag="AWJ20_149"
                     /db_xref="GeneID:30033297"
     mRNA            complement(<469640..>470230)
                     /gene="CAT5"
                     /locus_tag="AWJ20_149"
                     /product="putative monooxygenase CAT5"
                     /transcript_id="XM_018878374.1"
                     /db_xref="GeneID:30033297"
     CDS             complement(469640..470230)
                     /gene="CAT5"
                     /locus_tag="AWJ20_149"
                     /inference="similar to AA sequence:KEGG_Orthology:K06134"
                     /note="Protein required for ubiquinone (Coenzyme Q)
                     biosynthesis; localizes to the matrix face of the
                     mitochondrial inner membrane in a large complex with
                     ubiquinone biosynthetic enzymes; required for
                     gluconeogenic gene activation; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IDA] [PMID 9452453]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004497 - monooxygenase activity [Evidence
                     ISS] [PMID 11435415]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0006094 - gluconeogenesis [Evidence IEA]; GO_process:
                     GO:0006006 - glucose metabolic process [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]; GO_process: GO:0006744 - ubiquinone
                     biosynthetic process [Evidence IEA,IEA,IEA]; GO_process:
                     GO:0006744 - ubiquinone biosynthetic process [Evidence
                     IMP] [PMID 9452453]"
                     /codon_start=1
                     /product="putative monooxygenase CAT5"
                     /protein_id="XP_018734399.1"
                     /db_xref="GeneID:30033297"
                     /translation="MLKRAINSVKHTNLTAKQQSKIQKIVRVDQAGELGADYIYAGQH
                     LVFSNTKPALAPLIKHMWEQEIHHHNTFDSIQTEGRVRPSLLTPVWKAAAFGLGVGTA
                     ALGKEAAMACTEAVETVIGGHYNTQLRWLHKEFADSDIEGITELKEIIKNFRDDELEH
                     LDTAVVEGAKQAVPYYLLTETIKTGCRVAIWIAERV"
     gene            <472691..>474421
                     /gene="CNE1"
                     /locus_tag="AWJ20_150"
                     /db_xref="GeneID:30033309"
     mRNA            <472691..>474421
                     /gene="CNE1"
                     /locus_tag="AWJ20_150"
                     /product="calnexin"
                     /transcript_id="XM_018878386.1"
                     /db_xref="GeneID:30033309"
     CDS             472691..474421
                     /gene="CNE1"
                     /locus_tag="AWJ20_150"
                     /inference="similar to AA sequence:KEGG_Orthology:K08054"
                     /codon_start=1
                     /product="calnexin"
                     /protein_id="XP_018734400.1"
                     /db_xref="GeneID:30033309"
                     /translation="MKFIESVAYALLTSSLTLGSVRAANEKPISREVDHPDFVPFNNV
                     DPEAGLWEQFADSDEELAKRWKPSSAKSLEGTGDEYSYVGQWAFEEPTVLSGFKGDKG
                     LVVKSPAARHAISAKLDRTLDNKDKTLVVQYEVKLQKGLECGGAYLKLLSENEDLHAE
                     EFSGETPYQVMFGPDKCGSTNKVHFIIRRKNPISGEYEEKHLVAPPAARLNKLSNLYT
                     LIIHPDQQFEIRIDGHTVKAGSIIEEGVFRPSFNPPKTVYDEDDVKPDDWVEDRYIPD
                     PEQAEKPEDWDEDAPFQIPDPEAVKPADWNDDEEPFIPDPEAIKPEDWDDEEDGEWVA
                     PEIPNPACAAGCGVWEAPKIRNPAYKGKWVQPQIENPDYKGEWEPRQIANPNYFEDSR
                     PSDLEPIGAVGFELWTMQNDILFDNIYIGHSVAAAEYAGNNTFLPKLFIESEEEKANA
                     PKPLKERKQYESALEFFRDDPVGYITEVTRVFILNFFVDYKQAILNQPLVALGLATAV
                     LSAIVAALGILVGGFALIKNGVFGSSKPTPSAVADKKAKSAVAADASDADSATTTSSA
                     TSTNAVKRKT"
     gene            <475806..>480002
                     /gene="BUD3"
                     /locus_tag="AWJ20_151"
                     /db_xref="GeneID:30033320"
     mRNA            <475806..>480002
                     /gene="BUD3"
                     /locus_tag="AWJ20_151"
                     /product="Bud3p"
                     /transcript_id="XM_018878397.1"
                     /db_xref="GeneID:30033320"
     CDS             475806..480002
                     /gene="BUD3"
                     /locus_tag="AWJ20_151"
                     /note="Protein involved in bud-site selection; required
                     for axial budding pattern; localizes with septins to bud
                     neck in mitosis and may constitute an axial landmark for
                     next round of budding; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 12972503]; GO_component:
                     GO:0000142 - cellular bud neck contractile ring [Evidence
                     IDA] [PMID 7730410]; GO_function: GO:0005089 - Rho
                     guanyl-nucleotide exchange factor activity [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0007120 - axial cellular bud site
                     selection [Evidence IMP] [PMID 2065354]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0032319 - regulation of Rho GTPase activity [Evidence
                     IEA]; GO_process: GO:0035023 - regulation of Rho protein
                     signal transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Bud3p"
                     /protein_id="XP_018734401.1"
                     /db_xref="GeneID:30033320"
                     /translation="MTSQDPLFGPILAVVYRSSQKIGNKSNISSILISSHGTSGFLNV
                     TLDEKSRFYVACQNLPEDHRNSLVRKALAVSCLRAFATMDSFTRAKLISAEVERTPIP
                     TSGSQFSVNSNGQYVDNKMVIFDWDETAAGSLASRFRLADGKYPREIGQAILNTGVIE
                     PKLIQANAIDVVYEDDDQTIDNNNELVYLLGEQLEQLFDPLTEYSPEHTERLYNPPLQ
                     NESYATLSDETELVRTICEELYLLQSHMRVDLMDFLHEFLIPLRVQVLGEEEEFEANG
                     GNEHQHQQQPSNASEGDNPDTPRKLRQGRMTIRKLNTIFPPTIDEVVRINNIFYDALQ
                     QALSFGSYEVLKACGTTIPYFYKACMRHEAATKNLSRNLNYHLAALHQRCPPATAKKY
                     TPRRIESILQSGLHLTKIKMILDRLMKTKEWSPEEKPTVDEYYQSAVGTIDAFGKQHS
                     VAPYERFVFTPTGKILVEVASGWPKELEYGWLNRRVVCIFDAVNVLAEDTQSRDRHAV
                     IILFTDSLVILEPKKPIPMVSASGLHIPSVADMLMHSMINEVPLRNVPEMAVVAWSKI
                     ENVHFSEYNKSKNLSILASGDGFSCSDGVKRHLALYELIRPDYTATKIVELVAKAKIT
                     NKTQPFHLFRTTRPQLKLYSTVHELEGYVNETRKSPIAVFLNLEADKATMKAHNLAAC
                     INVQFLDTAFVKVKSLSFMEYGQEKVVHKSQFADTIASEVSYLFTLFLSSANETMIDC
                     IVSGNQLVTNFLVNYALNPSVSLIEKQKSHATSLHKRYMVTSPRAEIPTVPAIAVAPI
                     TSTKSPVVTSPAIASPPVVSPTVVKQENSPVPVEEEILTLEPPSKIAASQEKRRVSPV
                     QFLKQKVVKSGTTNESIQKKKSFNFLRGILGTSEPPMPVIEPLKIEQPKPVQAVNPAP
                     QPMAGASIELTAEPSMRSVSPASISSPFSQASSPYVGYTRPQKGAQIKYKPGGNIASD
                     DEDYEDWEDMSSDGISIVSDVTSMDNAEEQQQRDVEEWFNNISEDDGDLDSVAPEFDD
                     MNEQNATADMTVEDDDEVKSIQLTKFLDPVLKDVYNRHARNGSYARVRDTGSNPDTSM
                     EIGQSEHETLDTLNFEDDFSYLAGLVGDEDTKTTNLEELPTSDSRRLYPDLRDSSVIF
                     LSSYIRSSKDSTSGSFSAGHSICSSIEVVRVKRESSWESMGTSSNSSGQQVRTMPSVS
                     ELGIPMKQSYDDLPRPSQYPARVPSSGKNSLAHSRRNPSLQMRFEFPPRPQAPPPPLP
                     VISPSFRRMINASSVNTLQLASFTVQIDRTIQELTQLKNWSLVREFQRTKRTVMQLYE
                     MARMPVPDVVTLARTELEIRKVVTSTVWIMLSFAEQDPARSSVYHELFGSLLEMEWLR
                     RNKILENLGDTPSIDIWTTN"
     gene            complement(<480361..>481695)
                     /locus_tag="AWJ20_152"
                     /db_xref="GeneID:30033331"
     mRNA            complement(<480361..>481695)
                     /locus_tag="AWJ20_152"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878408.1"
                     /db_xref="GeneID:30033331"
     CDS             complement(480361..481695)
                     /locus_tag="AWJ20_152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734402.1"
                     /db_xref="GeneID:30033331"
                     /translation="MSSWLYLDDYPFNTDHSNGSGPLSGSSFDTSGMWFDNNNNNSGS
                     NSINYKDYPTALLSNPTNFSDIGGFDDFLFEGNNNHQNVSGSHHTAAPASTSSSSSPV
                     LPQTPTDMMISTSNHGPYLGEVNDFSDSVSSTLAGVSDIGASYDHTYSNTYTNTSSNI
                     ASSSNSSTSSNATISASTSGSFSQDGYKQPNVSFSTTTNYTNDPSRLQYSPSLTDSQM
                     NSFSSFSMDFSEFKAPLVSSVIPSVTDDLTTNTLPILPPSPKSSVSPTSADTPKSKRR
                     LSNTRKVGESVQFSSSTNSTASPITVSSSSAASSALSGANPPRTGRKHSESRMSLPEL
                     YNLMGLGHNPTEARTREKRVLDLLQKEGFLLGQRTWIRDTEQAERQRIIDNIYAITNK
                     DYHYTKDLIELIIRRGTYYVMQGRLRRIRRNKRAQELSNNDPDDTTENDMNL"
     gene            complement(<488874..>489359)
                     /gene="GSF2"
                     /locus_tag="AWJ20_153"
                     /db_xref="GeneID:30033342"
     mRNA            complement(<488874..>489359)
                     /gene="GSF2"
                     /locus_tag="AWJ20_153"
                     /product="Gsf2p"
                     /transcript_id="XM_018878419.1"
                     /db_xref="GeneID:30033342"
     CDS             complement(488874..489359)
                     /gene="GSF2"
                     /locus_tag="AWJ20_153"
                     /note="Endoplasmic reticulum (ER) localized integral
                     membrane protein; may promote secretion of certain hexose
                     transporters, including Gal2p; involved in
                     glucose-dependent repression; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA]; GO_component: GO:0030176 - integral
                     component of endoplasmic reticulum membrane [Evidence IDA]
                     [PMID 10377429]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005741 - mitochondrial outer membrane [Evidence IDA]
                     [PMID 16407407]; GO_function: GO:0051082 - unfolded
                     protein binding [Evidence IMP] [PMID 15623581];
                     GO_process: GO:0006457 - protein folding [Evidence IMP]
                     [PMID 15623581]; GO_process: GO:0034394 - protein
                     localization to cell surface [Evidence IGI,IMP] [PMID
                     10377429]"
                     /codon_start=1
                     /product="Gsf2p"
                     /protein_id="XP_018734403.1"
                     /db_xref="GeneID:30033342"
                     /translation="MNPLKNRSHAKKEITREELLSIGWTGTRRATAFEWSEENRKTKI
                     EAAGGVVNAYHQGILEDLRNSCIKLDKGEGWDSPGPQEKQKSESEVEEGRFLLSTNYF
                     KLVYSPLAELIEDESIDQATKNTALKTFRRNGPANAPEELKEIFRKRRALEPVDKKKK
                     K"
     gene            <492373..>496050
                     /gene="RSE1"
                     /locus_tag="AWJ20_154"
                     /db_xref="GeneID:30033353"
     mRNA            <492373..>496050
                     /gene="RSE1"
                     /locus_tag="AWJ20_154"
                     /product="Rse1p"
                     /transcript_id="XM_018878429.1"
                     /db_xref="GeneID:30033353"
     CDS             492373..496050
                     /gene="RSE1"
                     /locus_tag="AWJ20_154"
                     /inference="similar to AA sequence:KEGG_Orthology:K12830"
                     /note="Protein involved in pre-mRNA splicing; component of
                     the pre-spliceosome; associates with U2 snRNA; involved in
                     ER to Golgi transport; GO_component: GO:0005686 - U2 snRNP
                     [Evidence IPI] [PMID 10369685]; GO_component: GO:0005686 -
                     U2 snRNP [Evidence IDA] [PMID 15565172]; GO_component:
                     GO:0005686 - U2 snRNP [Evidence IDA] [PMID 16314500];
                     GO_component: GO:0071004 - U2-type prespliceosome
                     [Evidence IDA] [PMID 16618970]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA,IEA]; GO_component: GO:0005681 -
                     spliceosomal complex [Evidence IEA]; GO_function:
                     GO:0030620 - U2 snRNA binding [Evidence IPI] [PMID
                     10369685]; GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]; GO_process: GO:0008380 - RNA splicing
                     [Evidence IEA]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0006397 - mRNA processing
                     [Evidence IEA]; GO_process: GO:0000398 - mRNA splicing,
                     via spliceosome [Evidence IPI] [PMID 16314500];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IGI,IMP] [PMID 9819400]; GO_process: GO:0000245
                     - spliceosomal complex assembly [Evidence IDA] [PMID
                     10369685]"
                     /codon_start=1
                     /product="Rse1p"
                     /protein_id="XP_018734404.1"
                     /db_xref="GeneID:30033353"
                     /translation="MSLALYSLTLQKPGAITASIVGQFSGNRNQEIVVARGSWLELLK
                     PDPNLGQLRSVLSYNCFGILRSLQTFRIAGSTKDNIVIGSDSGRIAILEYDEKKNTFK
                     QIHLETFGKTGVRRIVPGQYLAVDPKGRATMIASVERNKIVYVLNRDAQLNITISSPL
                     EAHTVKSLVYALISVDVGYDNPVFAAIECDYDDDKVYSSKLSAKVYRKKYGHDPSGEL
                     DDEDVDMEDDVPPMRRKKLTYYELDLGLNHVVRKWTDRIDSTANILVQVPGGNDGPSG
                     VLVASDNTITYKHLNNPSHTVPIPKRRRKNYEIPAVKDETNGHTSSEFSDPDYESPVY
                     IVSALVHKMRGAFFFLLQSNYGDVYKLWLDHDGQSVQKMYIKYFDTIPLTVSLNILKS
                     GFLFSASESGDHLFYQFEKLGDNDDETEFTSVDEYKLKDIVFTPKPLDNIQLVDRITA
                     LNPLLQTQVANLTGDDAPQIYTITGQSNHSSLRKLEHGLLVNEIVSTELPAAPIGLWT
                     TKVTSDDEFDKYIVLSFSNETLVLSIGASVEEVNDSAFLTSISTILVQQLGRDSLLQV
                     HSRGVRHITANKEVNEWEPPVGTSILCASSNNSQVAVGLSSNEIVYFEVDEEGNLNEY
                     EDHKELSESPISIAIGDIPAGRVRSPFLAVGTVDSTIRILSLDLDTTLDTLSVQALSA
                     NPSSIRIMNMDDTGFVYLHIGLENGVYIMSILDSVTGELSDTRTRFLGPRRVQLFKGK
                     TSGVLDANGEYQGSDEIVLALSTKPWIGYTRNLSFDMVPLSYVPLSYASGFSSQDCPQ
                     GIVSVGGNMLRIFTIDSVEEKINQAKTDLKYTPRRMAENSFSNNFYVIETENNTVPDV
                     YDQVPVDGVYNKRDSQWASSISVIDPLSQSVLSRIHLEENEAAFSIANCRFESHDAEY
                     LIVGTAKDQIMLPQSNSGSFIRVYEYVDNGLKFLHKTAVESVPIALLEFQGRLVAGIG
                     GKLRIYDLGLKQLLRKCEEDLGLNNIMTLNTQGNRIVVGDIRSSLTFVVYKEKENRLI
                     PFADDPVARHITCAVMLDYDTVAAGDRFGNIFVLQCPKTISDASDEDGYGTFIRSQGH
                     FLNGQASKLELVTHYYLEDIPTSLQRASLVSGGNECIICSGLQGTIAAFVPLTSKQDV
                     KFFAQLENLLRENDVPIAGRDHMMYRSYYAPVKSTFDGDLCERFATLSHDKQEQIAAS
                     LDRTVREIERKVADVRVRAAF"
     gene            complement(<496166..>498571)
                     /gene="PTR3"
                     /locus_tag="AWJ20_155"
                     /db_xref="GeneID:30033364"
     mRNA            complement(<496166..>498571)
                     /gene="PTR3"
                     /locus_tag="AWJ20_155"
                     /product="Ptr3p"
                     /transcript_id="XM_018878439.1"
                     /db_xref="GeneID:30033364"
     CDS             complement(496166..498571)
                     /gene="PTR3"
                     /locus_tag="AWJ20_155"
                     /note="Component of the SPS plasma membrane amino acid
                     sensor system; senses external amino acid concentration
                     and transmits intracellular signals that result in
                     regulation of expression of amino acid permease genes;
                     other members are Ssy1p, Ptr3p, and Ssy5p; GO_component:
                     GO:0019897 - extrinsic component of plasma membrane
                     [Evidence IDA] [PMID 10409731]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0043200 -
                     response to amino acid [Evidence IMP] [PMID 10409731]"
                     /codon_start=1
                     /product="Ptr3p"
                     /protein_id="XP_018734405.1"
                     /db_xref="GeneID:30033364"
                     /translation="MLASVSTSANYSVLKGKERINPAASNKNTVTSWSDFLYSLEKLV
                     THPEYVVLSCGCVLPEDDDGLQGFPWKSKSDSSQRNATRTDSNLNTICPICATPDVQI
                     LNRVPILHDIYQVIANNKRALGLGSSSASSPNNASNRRSSSTTTTQSLPQKAYTETNN
                     SNVEIASSSPSQKRGLIELLREAARTAAANEVGIIPGKDNLIAKPVTADSNVTTSIGG
                     FGPTSSTLTTTNGSSNMSTSATAGDSIKFDVGEWMSNIASDQQSQHTQLSEVSDLSQR
                     SQLSQLSQPSQTSHQSQTSQLSQASKLSQTSFHSQSPQPGSQPTTMPPPSQPTSIPAP
                     QQSQANLSRSPNFSSTSPLSQQQILHNHQKLMPSQPLFSQAELELREFNFSKSFPIYR
                     KQFVHPTQPRNFLRSNKNSLASAISPDISHIMFASKGKCLFYTLPQDFNDPPILQHTL
                     ILENSDSSDSASIRSNKTSSSSQVTDWDKPMVSMTNNLAVVASQSGILKVIRLEPGYS
                     EVYSYQSSFGIHCMTISPRGDLIAYAIVGRDKISGGSQPMIVLHRLGRSSLSSSHSSY
                     LSNADSISWNEDNVNIVTLTIPYRDPIATLSFSSDACYLSCSTCTESRFMVISVMNPQ
                     EPRLVMKSSRRADVGPEYEGITSVRFFPSNSRYLAVTSVASSAPPIILDSKVSTSTRS
                     MSSGASSGLSHPSVMMRVDKVGSSIHKAEISPRGDAVAFLDKNGLVSVMYSKGMVSEL
                     KRITIVDEVATAQTLKEAAAMQFSPNGHVLVIADRKGNVHIEDFGAALPHQAGMGKCR
                     ILS"
     gene            complement(<499919..>500650)
                     /gene="APD1"
                     /locus_tag="AWJ20_156"
                     /db_xref="GeneID:30033375"
     mRNA            complement(<499919..>500650)
                     /gene="APD1"
                     /locus_tag="AWJ20_156"
                     /product="Apd1p"
                     /transcript_id="XM_018878450.1"
                     /db_xref="GeneID:30033375"
     CDS             complement(499919..500650)
                     /gene="APD1"
                     /locus_tag="AWJ20_156"
                     /note="hypothetical protein; required for normal
                     localization of actin patches and for normal tolerance of
                     sodium ions and hydrogen peroxide; localizes to both
                     cytoplasm and nucleus; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0008150 - biological_process [Evidence
                     ND]"
                     /codon_start=1
                     /product="Apd1p"
                     /protein_id="XP_018734406.1"
                     /db_xref="GeneID:30033375"
                     /translation="MPDMSLFPKQDKPLPPSPIHAKQLVICSGTSDWPSKIDGDTTSL
                     AGIIGASKRTLFRPQYPVMVVNCDLPATTSSKSPNSASAYLFPDNLYFDDIPLDKVDK
                     FFENYVRPSSTEAVQSEDIPNPRPASPLILICGHASRDVRCGVIAPLLVEEFTKVLTE
                     KGLYFDAETNPTGIRVSVSSHVGGHAFAGNVIYHPSDSSSAALPASVWYGKVFPHHVQ
                     GIVEETILNGRVVQPLLRGYGPRKW"
     gene            complement(<501788..>502357)
                     /locus_tag="AWJ20_157"
                     /db_xref="GeneID:30033386"
     mRNA            complement(<501788..>502357)
                     /locus_tag="AWJ20_157"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878461.1"
                     /db_xref="GeneID:30033386"
     CDS             complement(501788..502357)
                     /locus_tag="AWJ20_157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734407.1"
                     /db_xref="GeneID:30033386"
                     /translation="MFDFGAPNNKDGKLYRYDAKSSKVEVIADGLQIPNGIGFSPDNK
                     VMYFIDSLTHFIFKFDYDVATGELSNRREFIRVDPGEPDGMTTSKDGHLWVAVWGQSS
                     VLRYSPEGELVEVYKFPAERTSCPTFAGPNFDELIVTTASLVHADEEETEEKKNKING
                     TNGYAKDFGGTIFRVKVDVSGIPSNIVSI"
     gene            complement(<503259..>504443)
                     /gene="JLP1"
                     /locus_tag="AWJ20_158"
                     /db_xref="GeneID:30033397"
     mRNA            complement(<503259..>504443)
                     /gene="JLP1"
                     /locus_tag="AWJ20_158"
                     /product="Jlp1p"
                     /transcript_id="XM_018878472.1"
                     /db_xref="GeneID:30033397"
     CDS             complement(503259..504443)
                     /gene="JLP1"
                     /locus_tag="AWJ20_158"
                     /note="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase; involved in sulfonate catabolism for use as a
                     sulfur source; contains sequence that resembles a J domain
                     (typified by the E. coli DnaJ protein); induced by sulphur
                     starvation; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0051213 - dioxygenase
                     activity [Evidence IEA]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0000907 - sulfonate dioxygenase activity [Evidence IDA]
                     [PMID 10482536]; GO_process: GO:0046306 - alkanesulfonate
                     catabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0044273 - sulfur compound catabolic process
                     [Evidence IMP] [PMID 10482536]"
                     /codon_start=1
                     /product="Jlp1p"
                     /protein_id="XP_018734408.1"
                     /db_xref="GeneID:30033397"
                     /translation="MSPPTAVEIIEEGIRNQSIKTNNAVLKEGFAANYIDKLPEHSRK
                     RFERHGVDLSRGYPERPSHIPIWLDEAAKIHSSRSEYVEKGAKADPEKKALFGAAKEV
                     INLTKHIGTEIVGLQLADLNQTQLDELALLIAERSVVFFRDQDLAPQKQLEIGKYFGD
                     VEIHPQVPHVPGLPGVSVIWPDFQVFEGRVVNFRKPGGASGWHTDLDHLIQSAAITHL
                     HNDEIPAVGGDTSWSSGYGLYDKLSPALQKFLEGKTAIHRSAHAYLDKNDQFGGPKYI
                     ETEHPIVRTHPATGWKAVWVNRAHTVRIVGLEPAESAAILNLLYDIIEKNLDIQVRFR
                     WQPTKEGLGTSALWDNRITIHNAVGDYSEPRHGTRVSGLGEKPYYDPNSKSRHEALGL
                     SV"
     gene            <505286..>506869
                     /gene="SEO1"
                     /locus_tag="AWJ20_159"
                     /db_xref="GeneID:30033408"
     mRNA            <505286..>506869
                     /gene="SEO1"
                     /locus_tag="AWJ20_159"
                     /product="putative permease SEO1"
                     /transcript_id="XM_018878481.1"
                     /db_xref="GeneID:30033408"
     CDS             505286..506869
                     /gene="SEO1"
                     /locus_tag="AWJ20_159"
                     /codon_start=1
                     /product="putative permease SEO1"
                     /protein_id="XP_018734409.1"
                     /db_xref="GeneID:30033408"
                     /translation="MPRIKKPGPLLSDPYSTIGYQAMSSSIESISKTAEYPVEERQLS
                     SFDDVSEIEELERRKGWKYRLASVIWDSADKGKDERALLFKLDIFFLSSIMLGYFIKT
                     LDMNNINTAYINGMQEDLKMKGSDLNLIQTCWTVGYIVGQFPSNLILHRVSPRYYLGA
                     LEIMWSILTVLRITCNTLPKMYAISFFIGLLEAGFFPAVEFLLGSWYLPDELTKRSTL
                     FAVSGTAASMVTGYLQAAIIKTLSHKKLASYKYLFVLDAVISFPIALYTMVANPDTPA
                     YTTSWYLNDRDKKIAIARTTKYSGAKHPPKRKIGKDTLKRTFSTWHIFLFPVIFLAFN
                     NTCNSSSQPTFQSWLKSLGYTPVEYNVYPTAVNGAGIGFALVVAWISDAFNGLNWPFV
                     LLYFFLQALGSLFLAIWHIPRGLHWFSYFLVGIPTAWGQPMIFAWVNRLLSGDTDKRL
                     LTVTATNNLAYVTNAWVPILTWNAGDMPRYFIGFTYNATLAVVGFILTISAIFLERRD
                     KQTRKISEAEAHSSEVQDA"
     gene            <507292..>508113
                     /locus_tag="AWJ20_160"
                     /db_xref="GeneID:30033420"
     mRNA            <507292..>508113
                     /locus_tag="AWJ20_160"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878493.1"
                     /db_xref="GeneID:30033420"
     CDS             507292..508113
                     /locus_tag="AWJ20_160"
                     /inference="similar to AA sequence:KEGG_Orthology:K06911"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734410.1"
                     /db_xref="GeneID:30033420"
                     /translation="MFKVTLRGAATRRFVKTDWITAYQSFGEGPKYQFAGFGNLEALN
                     EDRFPPRRGVNMHHHNDHEIFTYMLSGGLTHRDTMAAKEEDKSYTIHRGDVQFISSGS
                     GIRHSEKNAQGNEVAHLLQFWVKPWKNCLGPRYETKTFSEADKRKGFVTIISPFSEKE
                     NSNSQPVVPGSIAINSDFSMGAAIIPPGEKFSWTVTGAANASGNSSVGDPSPSRNIYV
                     YLPSLQDGLSKIKVAGQETLSEGDGAFVENIRPGDLLEIESVGEKDAEVVVTDSA"
     gene            <509317..>510801
                     /gene="STL1"
                     /locus_tag="AWJ20_161"
                     /db_xref="GeneID:30033431"
     mRNA            <509317..>510801
                     /gene="STL1"
                     /locus_tag="AWJ20_161"
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /transcript_id="XM_018878504.1"
                     /db_xref="GeneID:30033431"
     CDS             509317..510801
                     /gene="STL1"
                     /locus_tag="AWJ20_161"
                     /codon_start=1
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /protein_id="XP_018734411.1"
                     /db_xref="GeneID:30033431"
                     /translation="MMPCFLWYGYNLAILGGVLSQPNFYNQFPKLNTDTTTGATHHYN
                     SNIQGTVSSIYTVGGMFGALSASFYGDILGRRKTIFIASILCLIGAVLMTSSFSLGQL
                     IVGRLILGLSAGTVSASVPVYQSEISSASKRGTHVAYTGFFITSGILIAYWIDFGCSY
                     INSSASWRVPFAVQLILPLISGTLIFFLPESPHWLIKVGRVDEARSIMSLFVDNADPY
                     SDPVEEQVAEIQRSLSVMQTLRFRDVLSMKDSRIFHRVLLALFSLFCSQACGVNAVTF
                     YAPSLLAQAGISPGMAGWLAGCTEIVQPIGAYLAVLTVDSFGRRRLLMTAAIGMGISM
                     IVMAACTAQTENKSALHAGVAFLFIINLAYSYGFLGVCFVYSAEIAPQRIRALINGFA
                     TFVTWGTNFWVVEVTPVAFASIGWRYYIVYAATNLALILPVLYFCFPETSGLHLDQID
                     EVFSKAKGFFDIVRVAKEVKQEGYQHEPSVIDTKEQIEEEESIN"
     gene            complement(<511409..>512173)
                     /gene="DCC1"
                     /locus_tag="AWJ20_162"
                     /db_xref="GeneID:30033442"
     mRNA            complement(<511409..>512173)
                     /gene="DCC1"
                     /locus_tag="AWJ20_162"
                     /product="Dcc1p"
                     /transcript_id="XM_018878515.1"
                     /db_xref="GeneID:30033442"
     CDS             complement(511409..512173)
                     /gene="DCC1"
                     /locus_tag="AWJ20_162"
                     /note="Subunit of a complex with Ctf8p and Ctf18p; shares
                     some components with Replication Factor C; required for
                     sister chromatid cohesion and telomere length maintenance;
                     GO_component: GO:0031390 - Ctf18 RFC-like complex
                     [Evidence IPI] [PMID 11389843]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006260 -
                     DNA replication [Evidence IEA]; GO_process: GO:0006974 -
                     cellular response to DNA damage stimulus [Evidence IMP]
                     [PMID 12482937]; GO_process: GO:0035753 - maintenance of
                     DNA trinucleotide repeats [Evidence IMP] [PMID 21347277];
                     GO_process: GO:0007064 - mitotic sister chromatid cohesion
                     [Evidence IMP] [PMID 11389843]; GO_process: GO:0007064 -
                     mitotic sister chromatid cohesion [Evidence IGI] [PMID
                     17483413]"
                     /codon_start=1
                     /product="Dcc1p"
                     /protein_id="XP_018734412.1"
                     /db_xref="GeneID:30033442"
                     /translation="MADQSSTPSIEFYSQLEPDGFYRLLELTPELADILESGASLSLK
                     APETDSHLILCTVSKTYRVRQMNQSNTLLLSDSRDLSFSSESSEAPPYLVAFGSASSY
                     LEVIDEQSPKLSVESIPLYMGNGVISGLHEPNRPTSIHYESLGVLRSRAPLSDAEFNE
                     KWRLQGGVEIDDIACRINDSLTHSIICDILATVIGSKLDLSAVNCIQLLPLLPSDAEP
                     LAVVEAVMARFSQSASSNCKYLVPQFLFYIYCFPLK"
     gene            <512409..>515585
                     /gene="RAD54"
                     /locus_tag="AWJ20_163"
                     /db_xref="GeneID:30033453"
     mRNA            <512409..>515585
                     /gene="RAD54"
                     /locus_tag="AWJ20_163"
                     /product="DNA-dependent ATPase RAD54"
                     /transcript_id="XM_018878526.1"
                     /db_xref="GeneID:30033453"
     CDS             512409..515585
                     /gene="RAD54"
                     /locus_tag="AWJ20_163"
                     /inference="similar to AA sequence:KEGG_Orthology:K10875"
                     /note="DNA-dependent ATPase that stimulates strand
                     exchange; modifies the topology of double-stranded DNA;
                     involved in the recombinational repair of double-strand
                     breaks in DNA during vegetative growth and meiosis; member
                     of the SWI/SNF family of DNA translocases; forms nuclear
                     foci upon DNA replication stress; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IMP] [PMID 12399378];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA,IEA]; GO_function: GO:0015616 - DNA translocase
                     activity [Evidence IDA] [PMID 10506208]; GO_function:
                     GO:0008094 - DNA-dependent ATPase activity [Evidence IDA]
                     [PMID 10506208]; GO_function: GO:0004386 - helicase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0016817
                     - hydrolase activity, acting on acid anhydrides [Evidence
                     IEA]; GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0032392 - DNA
                     geometric change [Evidence IDA] [PMID 10506208];
                     GO_process: GO:0006281 - DNA repair [Evidence IEA];
                     GO_process: GO:0006974 - cellular response to DNA damage
                     stimulus [Evidence IEA]; GO_process: GO:0006338 -
                     chromatin remodeling [Evidence IDA] [PMID 12577053];
                     GO_process: GO:0045002 - double-strand break repair via
                     single-strand annealing [Evidence IMP] [PMID 8849880];
                     GO_process: GO:0045003 - double-strand break repair via
                     synthesis-dependent strand annealing [Evidence TAS] [PMID
                     10357855]; GO_process: GO:0030491 - heteroduplex formation
                     [Evidence IDA] [PMID 10506208]; GO_process: GO:0032079 -
                     positive regulation of endodeoxyribonuclease activity
                     [Evidence IDA] [PMID 19129197]; GO_process: GO:0000722 -
                     telomere maintenance via recombination [Evidence IMP]
                     [PMID 11238918]"
                     /codon_start=1
                     /product="DNA-dependent ATPase RAD54"
                     /protein_id="XP_018734413.1"
                     /db_xref="GeneID:30033453"
                     /translation="MMAEVRPRTTTRKRLPRLTSSGGSDLVVIPYDQHEEPTPILQNT
                     INECILPDNGGIIDGYEPIYLDNETDVNLIDGLMVVPDHATGIDGLPITPIDTSPSHT
                     DVMSIGAVLSNSQPTELSLDNGDTLGEIEEVSTPVAEKSQPKSRKESKSKADSQKKSK
                     SSQGSSQNMNQAKSRSQKRSQSQNQIVENIALEEEENEVKEAEKTEENQEVIKKPKSL
                     PRRPRPFDLASPCTPIHSSAIRRPQSAQNSPLGINKRLKTDPLSTITKPFRVPTKSAI
                     NANRPFSRRDDLSRSASRKIKSYAEIENIETEQFNKEIEQPASPYTPGGGIKRLGTKV
                     DPALKNSIDASDMILGRRFITPLKEKPLNMGPSAALGMKRRHEFVPRPLHDPSGEFAI
                     VLFDPTIDDEPVEEIDPNKIVEGSEDENLGETEVTPVAPTTPSKPSLADILGLSNEKK
                     KVYPKVPVVIDPRLAKILRPHQVEGVKFLYKCVTGRVQKDANGCIMADEMGLGKTLQC
                     ITLMWTLLKQSPEGNGGTISKCIVVCPSSLVRNWANELVKWLGEGAITPLAADGKSVK
                     NADLSAALRQWSTASGRQIVRPVLIISYETLRRHCDDLRNTEIGLLLADEGHRLKNGE
                     SLTFTALDALNVQRRVILSGTPIQNDLSEYFSLLSFANPGLLGTRLEFRKNYENAILK
                     GRDSFATEEEVTDGETKLKELSLLVSRFIIRRTNDILSKYLPVKYEHVVFCNMTEFQI
                     NLYNKFIASPDVKKVIKGSKNNPLKSIGILKKLCNHPDLLDLSRDIQGAEDVLPSDYV
                     HPSHRGGRDRGVRTLYSGKFMVLERMLARIRYETNDKIVIISNYTQTLDLIEAMCRES
                     RYGAFRLDGKMAISKRQKLVDKFNDPEGSEFVFLLSSKAGGCGINLIGANRLILMDPD
                     WNPAADQQALARVWRDGQKKDCFVYRFISTGSIEEKIFQRQSMKQSLSSCVVDEAEDV
                     ERLFSFNDLKKLFSFDGHTLSDTHDTFKCKRCKDNRQVAKAPAMLYGDATTWNHFTKP
                     ELENIQDLLLRQELTEEIVSFVFQYISH"
     gene            complement(<515730..>521126)
                     /gene="FAS2"
                     /locus_tag="AWJ20_164"
                     /db_xref="GeneID:30033464"
     mRNA            complement(<515730..>521126)
                     /gene="FAS2"
                     /locus_tag="AWJ20_164"
                     /product="trifunctional fatty acid synthase subunit FAS2"
                     /transcript_id="XM_018878537.1"
                     /db_xref="GeneID:30033464"
     CDS             complement(515730..521126)
                     /gene="FAS2"
                     /locus_tag="AWJ20_164"
                     /inference="similar to AA sequence:KEGG_Orthology:K00667"
                     /note="Alpha subunit of fatty acid synthetase; complex
                     catalyzes the synthesis of long-chain saturated fatty
                     acids; contains the acyl-carrier protein domain and
                     beta-ketoacyl reductase, beta-ketoacyl synthase and
                     self-pantetheinylation activities; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     6025308]; GO_component: GO:0005835 - fatty acid synthase
                     complex [Evidence IDA] [PMID 65153]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004316 -
                     3-oxoacyl-[acyl-carrier-protein] reductase (NADPH)
                     activity [Evidence IEA]; GO_function: GO:0004316 -
                     3-oxoacyl-[acyl-carrier-protein] reductase (NADPH)
                     activity [Evidence IDA] [PMID 365179]; GO_function:
                     GO:0004315 - 3-oxoacyl-[acyl-carrier-protein] synthase
                     activity [Evidence IEA]; GO_function: GO:0004315 -
                     3-oxoacyl-[acyl-carrier-protein] synthase activity
                     [Evidence IMP] [PMID 1100391]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA,IEA]; GO_function:
                     GO:0004312 - fatty acid synthase activity [Evidence IGI]
                     [PMID 10785388]; GO_function: GO:0004312 - fatty acid
                     synthase activity [Evidence IMP] [PMID 65153];
                     GO_function: GO:0004321 - fatty-acyl-CoA synthase activity
                     [Evidence IEA]; GO_function: GO:0008897 -
                     holo-[acyl-carrier-protein] synthase activity [Evidence
                     IEA]; GO_function: GO:0008897 -
                     holo-[acyl-carrier-protein] synthase activity [Evidence
                     IGI,IMP] [PMID 10785388]; GO_function: GO:0000287 -
                     magnesium ion binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA,IEA]; GO_process: GO:0006633 -
                     fatty acid biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA]; GO_process: GO:0006629 - lipid metabolic
                     process [Evidence IEA]; GO_process: GO:0042759 -
                     long-chain fatty acid biosynthetic process [Evidence IMP]
                     [PMID 1735446]; GO_process: GO:0009059 - macromolecule
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA,IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="trifunctional fatty acid synthase subunit FAS2"
                     /protein_id="XP_018734414.1"
                     /db_xref="GeneID:30033464"
                     /translation="MATRTLKSKYESYDAALSLQRQVLCYSKDTKEIYYTPDPVEPAE
                     SESTPASGDAPAAAAPAAVAAAPVAAAAAAGPAASVEDTPVKAVEVLHALVAQKIKKT
                     LDQVPLSKAVKDLVGGKSTVQNEILGDLGKEFGSTPEKPEETPLGELAEQFQDSFSGQ
                     LGKQSSSLVSRLISSKMPGGFNITSARKYLNTRWGLGPGRQDSVFLVAITLEPKNRLG
                     DEAAAKAFLDDVTTKYASIAGVNLSSASAAGGAAAGGAGGAVIDSAAFEELTKDQRYL
                     VQQQLELFARYLKVDLRDGDKAFVAQKEATALLQQELDLWYSEHGDFYASGIKPVFSP
                     LKARVYDSYWNWARQDCLTMFYDIIFGRLSNVDREIVSRCISIMNRTNPTLIDFMQYY
                     IDHVPTDRGATYELAQELAQKLLQNCKEAVDADPVYKDVNYPTGPKTTVDSNGNISYA
                     EVPRPAVRKLEQYVQDMAAGGEMTKDPAAGSHTRAELAKIYKRISSAADGKSSGKLKL
                     DALYADLIKAIDTVEAESSPKKALDTVSAKHMREETIPFLHLKKKSGEIWDFDRDLSA
                     TYLDGLEVAARDGLTFANKNVLITGAGAGSIGADILQGLISGGAKVVVTTSRYSREVT
                     EYYQSIYTKFGASGSTLIVVPFNQASSSDVRALVDYIYNDTKKGGLGWDLDFVIPFAA
                     IPENGIELDGIDSKSELAHRLMLTNLLRLLGSIKSHKAANGFETRPAQVILPMSPNHG
                     TFGADGLYSESKLSLETLFNRWYSESWSSYLTICGAVIGWTRGTGLMSQNNIIAEGVE
                     SLGVRTFSQKEMAFNILGLMTPTIVNICQQQPVWADLNGGLQFVENLKDVTGKLRKEL
                     VDSSELRRAVSVETAIEHKVVNGPDADLPYQKAIVKPRANHKFEFPKLKSYEELRKIA
                     PELEGILDLEKVVVATGFSEVGPWGNSRTRWDMEINGAFSLEGAIEMAWIMGLIKHHS
                     GPLKGKPYTGWVDTKTNEPVDDKDVKSKYESYILEHSGIRLIEPELFHGYDPLKKQLL
                     QEIIVEHDLEPFEASKEAADQFKLEQGNKVEVFEIPESGQYTVRFLKGAKIYIPKALK
                     FDRLVAGQIPTGWDARRYGIGEDIISQVDPITLYVLVSTVEALLSAGITDPYEFYKYV
                     HLSEVGNCSGSGMGGVTALRGMFKDRYLDRPVQNDILQESFINTMSAWVNMLLLSSSG
                     PIKTPVGACATAIESVDSGIELIESGKAKIVIVGGYDDFQEEGSHEFGNMNATSNSLT
                     EFEHGRTPKEMSRPNSTSRSGFMESQGAGIQILMNAKLAIDMGVPIYGIVALTSTASD
                     KIGRSVPAPGKGIMTTARENISDLKFPYRLLDVKYRKRQIESRRAQIKQWTESEFEYL
                     QDEFEAIKATTSAADAEAFFKERSQQIENEARRQEKEALGTWGNNFYKSDPRIAPIRG
                     ALATYNLTIDDIGVSSFHGTSTKANDKNESGAINGMLNHLGRSKGNPVLGVFQKYLTG
                     HPKGAAGAWMLNGVMQILNSGTVPGNPNADNIDAQMEGFDKIVYPSVTLQTYGVKAAT
                     VTSFGFGQKGAIAVVIHPDYVLATLNKKAYETYAAKVGTRYNKAYRYLHNAIAENSMF
                     VSKSKAPYTDEQEMSVYLNPLARVSYDKKSESLIFNAKKLEQANPTQSSGHTEAVLKQ
                     LAANSLSGGAGNIGVDVQSLSGVNVENETFLERNFTDAERQYCAKSADPLSSYTGTWS
                     AKEAVFKSLGVKSQGAGASLKSIEVLRDAKGAPVVTLHGEAKAAADAAGVKNVKVSIS
                     HDEFQAVAVAVSEK"
     gene            complement(<522891..>524120)
                     /gene="GPI8"
                     /locus_tag="AWJ20_165"
                     /db_xref="GeneID:30033475"
     mRNA            complement(<522891..>524120)
                     /gene="GPI8"
                     /locus_tag="AWJ20_165"
                     /product="Gpi8p"
                     /transcript_id="XM_018878547.1"
                     /db_xref="GeneID:30033475"
     CDS             complement(522891..524120)
                     /gene="GPI8"
                     /locus_tag="AWJ20_165"
                     /inference="similar to AA sequence:KEGG_Orthology:K05290"
                     /note="ER membrane glycoprotein subunit of the GPI
                     transamidase complex; adds glycosylphosphatidylinositol
                     (GPI) anchors to newly synthesized proteins; human PIG-K
                     protein is a functional homolog; GO_component: GO:0042765
                     - GPI-anchor transamidase complex [Evidence IEA];
                     GO_component: GO:0042765 - GPI-anchor transamidase complex
                     [Evidence IDA] [PMID 11598210]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IDA] [PMID 8978684]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0003923 - GPI-anchor transamidase activity
                     [Evidence IEA]; GO_function: GO:0003923 - GPI-anchor
                     transamidase activity [Evidence IMP] [PMID 10793132];
                     GO_function: GO:0003923 - GPI-anchor transamidase activity
                     [Evidence IMP] [PMID 11598210]; GO_function: GO:0004197 -
                     cysteine-type endopeptidase activity [Evidence IEA];
                     GO_function: GO:0008234 - cysteine-type peptidase activity
                     [Evidence IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0008233 -
                     peptidase activity [Evidence IEA]; GO_process: GO:0006506
                     - GPI anchor biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0016255 - attachment of GPI anchor to
                     protein [Evidence IEA]; GO_process: GO:0016255 -
                     attachment of GPI anchor to protein [Evidence IMP] [PMID
                     11598210]; GO_process: GO:0006508 - proteolysis [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Gpi8p"
                     /protein_id="XP_018734415.1"
                     /db_xref="GeneID:30033475"
                     /translation="MRFIYFLNLLQIAAVLLLGFSRAQEFTEEAAPEETAEKFFRTSR
                     HTNNWAVLVSTSRFWFNYRHMANVLSMYRTIKRLGIPDSQIILMLSDDVSCNPRNAFP
                     GTVYNNADRALDLYGDNIEVDYRGYDVTVENFIRLLTDRWDADTPRSKRLLTDDRSNI
                     FVYMTGHGGNEFLKFQDAEEIGAFDIADAFEQMWEKRRYNEILFMIDTCQANTMYSKF
                     YSPNILAVGSSAMDENSYSHHADQDVGVAVIDRFTYYNLEFLESIDKTSKETMADLFA
                     SYNPADIHSNPGIRSDLFKDPLDQVLITDFFGNVQNVELGQVETNVLELAKLARDEEL
                     IGQNAFNGENTSTPEKKPNLPQPEVNSGSRAKNKPNSPSPIQHLLESEAKSSSHFLIA
                     ISILTAVTALVVGSSYF"
     gene            <525252..>527288
                     /gene="IRC3"
                     /locus_tag="AWJ20_166"
                     /db_xref="GeneID:30033486"
     mRNA            <525252..>527288
                     /gene="IRC3"
                     /locus_tag="AWJ20_166"
                     /product="Irc3p"
                     /transcript_id="XM_018878557.1"
                     /db_xref="GeneID:30033486"
     CDS             525252..527288
                     /gene="IRC3"
                     /locus_tag="AWJ20_166"
                     /inference="similar to AA sequence:KEGG_Orthology:K17677"
                     /note="Putative RNA helicase of the DEAH/D-box family;
                     null mutant displays increased levels of spontaneous
                     Rad52p foci; green fluorescent protein (GFP)-fusion
                     protein localizes to the mitochondrion; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004004 -
                     ATP-dependent RNA helicase activity [Evidence ISS] [PMID
                     10322435]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0004386 - helicase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0003676 -
                     nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0008150 - biological_process [Evidence ND];
                     GO_process: GO:0008152 - metabolic process [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Irc3p"
                     /protein_id="XP_018734416.1"
                     /db_xref="GeneID:30033486"
                     /translation="MIVRKAFPGSLLSSESTLTARFLSRLSAYNNLKSCSQCFVPSIY
                     AQHGTFLRHNSTKLGRPEGLPLRDYQQECIEECLITIKKGYRRFAVSMPTGSGKTRTF
                     YGLLEAISRGGAHSGHGKKWLILAHREELITQAYDHAKRLFPDLKTSMEMGKHTADPD
                     ADIIVASVQSISREKRLERFDGSDFSAIVIDEAHHAPAASYAKVLNHLGANNPDSEIV
                     VAGFSATLSRMDGLALGSTFDYIAYHKDLSEMIKNGYLTDIKFTTIATDVDLTGVKKA
                     RGDFATGSLSKAVDTPALNELVYKAWKRQSGKHSLIFGVNIEHVSNLALTFRENGIDA
                     HVVTSDTPRDLRRGLVEDFRNGHLPVLINCGIFTEGTDIPNIDTVILVRPTRSAGLLM
                     QMIGRGLRLHPGKEVCHIIDMFGSSSNANALATVPTLAGLDPSQVRVIDKAEIANGVS
                     RPRVVASSKDPDSVYVEDFDNLDDFLNRNGGKLNTSAISRSRLNWIPSGQNNFLLFGK
                     EGYLRLCPDANPSKLAPKYSLIQYFENPFREDNRGAKYLRKYIFESMPDFNAAVNAAE
                     LFARQNCPYHLVAKNVPWRSQPCTINQEKAVMKLFTKVVVDGDEEGMKRAKTICKDLT
                     KGQSANIINLASIGNKSILKDMLYPKKEKKSKADLFEFLQAGPVNKLEIKLSQN"
     gene            <527434..>529569
                     /locus_tag="AWJ20_167"
                     /db_xref="GeneID:30033497"
     mRNA            <527434..>529569
                     /locus_tag="AWJ20_167"
                     /product="Zinc transport protein zntB"
                     /transcript_id="XM_018878567.1"
                     /db_xref="GeneID:30033497"
     CDS             527434..529569
                     /locus_tag="AWJ20_167"
                     /codon_start=1
                     /product="Zinc transport protein zntB"
                     /protein_id="XP_018734417.1"
                     /db_xref="GeneID:30033497"
                     /translation="MTVFVEYDTGDANLPNPSGHVNDLYEDISDSTETDSLTDDEEST
                     FESRHPRSSWIFSNIASINPIHSFENRRNNVPPPVSLQHPKDDVPSHKSPIPVSPLSN
                     TRPISDIILKQSIDDKGRQLPAVPPKSDGPQNARFDSQNIYTDTVRVKRRYSSHPGVT
                     NAAKRKPGWEPGIDLDTTDIILESSGSIVTVVDYNSDRCRLARTEFYSNPRDTSSMDS
                     CFYDKTHDVDLSLTKYLESRPKWSKVRWINVNGLSKTAIYTIGQHYKLHKLAIEDMVD
                     IPQRTKVDEYPLHTFCCLPLHRLIPYKHLTGPRVRYNQFFNFFTKRFGGNNDNFAPQS
                     ATARFSTLAAVDSAKLAKSNINYKIKPHFDTLQSRLASTRNMKSMYQWSNPTQLQRSD
                     YLESRRPLASRQKMVGVEQVSLYLTHEGTVISFFEGSGDEIEKPILERLESESTILRE
                     SADPSILFQAIIDAIVDLLHPIIAAYRSRLAELELAAILNPSMAHTRDLHLINADLTV
                     LRNSITPVTSLINSLRDRAGNSRKKSDSDKGTSSATGVSSSCTTKPSRASSTRSDYSK
                     ISQEACVYLADVADHTLSYTQDLDVMRNNTKSMIDLIFNTISIQSSDAVKLLSLVTVI
                     FLPLSFLTGYFGMNFTGFDALSNGVGYYWGIAVPSSASMTILLMYPWVRDNVRKIHQL
                     IKRSRDHNRRKKQTRRKQKRRQVTVIESV"
     gene            complement(<529766..>531430)
                     /gene="UBX5"
                     /locus_tag="AWJ20_168"
                     /db_xref="GeneID:30033508"
     mRNA            complement(<529766..>531430)
                     /gene="UBX5"
                     /locus_tag="AWJ20_168"
                     /product="Ubx5p"
                     /transcript_id="XM_018878577.1"
                     /db_xref="GeneID:30033508"
     CDS             complement(529766..531430)
                     /gene="UBX5"
                     /locus_tag="AWJ20_168"
                     /note="UBX domain-containing protein that interacts with
                     Cdc48p; ubiquitin regulatory X is also known as UBX;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0043161 -
                     proteasome-mediated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 21211725]"
                     /codon_start=1
                     /product="Ubx5p"
                     /protein_id="XP_018734418.1"
                     /db_xref="GeneID:30033508"
                     /translation="MDQDHSDEIAAFCAVTAADPESAQQYLAVADYDLDTAVTLFLEA
                     GGPSIESQHRAASSTNVAGGAGGTGSGAASVHSPDPMDSGINNTNDEDEEAFVQRLQE
                     EEYAQAGNGGGGTGGFGSGNDEVRERIRPVTERLVDPGFGAGFGGFGEADDFLGRMTR
                     NLAMRGVTPRGIFNQGMPSQQIRRRQRGVFDNDEDEEDEDDDSDMEITGSNSFMEETV
                     GSSNLTPHANRLAALFRPPFDLIQDVDLELAKNLGQEEKKWILVDIQNSREFSCQKLN
                     RDLWSNKDVKATVKANFIFLQYSSEDSYGINYLQYYPYQGYPHIAILDPRTGERLRVW
                     SEVPEPLQWIDDVHNFLSRYSLDPSHKNPIAKISRTKTDVQHMTEEEQIEFAVRQSLG
                     VKSNSSSDDDFVSVHSDVMDEDSNDEIEVVEERSAVPESSGSSSRVPQAPDISESEPE
                     DDHDLTEEDIFASILPREIQEPEADPKTTTRIQFRLADGSRIIRRFRLDDSVRTIFAF
                     LKQNVEALSGHHFGLASDRRKLIDLVDETIQSAKLQNSVVLVEILD"
     gene            <533331..>534845
                     /gene="TNA1"
                     /locus_tag="AWJ20_169"
                     /db_xref="GeneID:30033519"
     mRNA            <533331..>534845
                     /gene="TNA1"
                     /locus_tag="AWJ20_169"
                     /product="Tna1p"
                     /transcript_id="XM_018878588.1"
                     /db_xref="GeneID:30033519"
     CDS             533331..534845
                     /gene="TNA1"
                     /locus_tag="AWJ20_169"
                     /note="High affinity nicotinic acid plasma membrane
                     permease; responsible for uptake of low levels of
                     nicotinic acid; expression of the gene increases in the
                     absence of extracellular nicotinic acid or
                     para-aminobenzoate (PABA); GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005887 -
                     integral component of plasma membrane [Evidence ISS] [PMID
                     9678606]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0015663 - nicotinamide mononucleotide transmembrane
                     transporter activity [Evidence IMP] [PMID 10869563];
                     GO_process: GO:0015890 - nicotinamide mononucleotide
                     transport [Evidence IEP,IMP] [PMID 10869563]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tna1p"
                     /protein_id="XP_018734419.1"
                     /db_xref="GeneID:30033519"
                     /translation="MVKQETSVVDIEQPQELELATTNVSHEKKGISVEVQEALDYEYT
                     PEEEKRVVRKFDMNILIYLFFLYMLSFLDRGNIGNANTAGMSKDLNMSDSQYQWLLTI
                     FYIFYICFEFMILCYKIFPPRLYVPTIVIGWGITSTCCAAAQKWEHLMGLRALLGIFE
                     ASFGPGAILYISFFYYRHEVAAKNAIFLSSAPLATTFSGALAYGITKHNLAIASWRVL
                     FLVEGLPTIVVGAIGYYAIPNGPTTCRFLTEHEKRIAGARMAKQTGRVNMEKTLHFKE
                     MLRAAIDIKVWIPMIMYFSINVPFSSLPVFTPAIIEGMGFTSVNSQGLSALPYIYTFL
                     TMLGAAYLSDRIKRRGIVIAFLALHGAAGYLILALSTTVGARYFALFLAAGGIFPCIA
                     LVLSWQSNNQGTESQRATGFVLLQTLGQSGPLVGTRLFPSTDAPLYHKGFWVSFGFCC
                     LLFACACTLMTHLYFENKKLDARYGPIEESDEVEVTSDAYNAEGEFNPRFRYIM"
     gene            <535821..>536402
                     /locus_tag="AWJ20_170"
                     /db_xref="GeneID:30033531"
     mRNA            <535821..>536402
                     /locus_tag="AWJ20_170"
                     /product="AAT-domain-containing protein"
                     /transcript_id="XM_018878599.1"
                     /db_xref="GeneID:30033531"
     CDS             535821..536402
                     /locus_tag="AWJ20_170"
                     /inference="similar to AA sequence:KEGG_Orthology:K19200"
                     /codon_start=1
                     /product="AAT-domain-containing protein"
                     /protein_id="XP_018734420.1"
                     /db_xref="GeneID:30033531"
                     /translation="MTEGGIVGKIGLNEYGVGCCLNAIMAKGVDKNKIPIHLALRLVV
                     SSKSAEEAIETLTKTGCASAGHIFVADSTTARGLEFSAFDYKALDLDGKNHLFHTNHY
                     LAPHNAEEGQTEWVSDSPFRLSRIEELSKSLKPSIEGIQEAFKDEKNSPGSICRIGSS
                     VTLFNIVMDLSAKTAAVTIGRPIDPDSKLTFSF"
     gene            complement(<537433..>538800)
                     /gene="MRF1"
                     /locus_tag="AWJ20_171"
                     /db_xref="GeneID:30033542"
     mRNA            complement(<537433..>538800)
                     /gene="MRF1"
                     /locus_tag="AWJ20_171"
                     /product="Mrf1p"
                     /transcript_id="XM_018878610.1"
                     /db_xref="GeneID:30033542"
     CDS             complement(537433..538800)
                     /gene="MRF1"
                     /locus_tag="AWJ20_171"
                     /inference="similar to AA sequence:KEGG_Orthology:K02835"
                     /note="Mitochondrial translation release factor; involved
                     in stop codon recognition and hydrolysis of the
                     peptidyl-tRNA bond during mitochondrial translation; lack
                     of MRF1 causes mitochondrial genome instability;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 11502169]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IMP]
                     [PMID 1475194]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 8265342]; GO_function:
                     GO:0003747 - translation release factor activity [Evidence
                     IEA]; GO_function: GO:0003747 - translation release factor
                     activity [Evidence IDA] [PMID 10748224]; GO_function:
                     GO:0003747 - translation release factor activity [Evidence
                     IGI] [PMID 1475194]; GO_function: GO:0016149 - translation
                     release factor activity, codon specific [Evidence IEA];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IMP] [PMID 14734569]; GO_process: GO:0070126 -
                     mitochondrial translational termination [Evidence IGI]
                     [PMID 1475194]; GO_process: GO:0070126 - mitochondrial
                     translational termination [Evidence IMP] [PMID 15827612];
                     GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0006415 - translational termination
                     [Evidence IEA]; GO_process: GO:0006415 - translational
                     termination [Evidence IMP] [PMID 1475194]"
                     /codon_start=1
                     /product="Mrf1p"
                     /protein_id="XP_018734421.1"
                     /db_xref="GeneID:30033542"
                     /translation="MGPEKCFSAVNGGFETRSLQKGRSLVRHFQTLLGKTRAGLDLNQ
                     FRNGWNTTQNREFGVRRCYSTEETPESSTEVEVELLHPLLVQKAEQLKVEYNGLAQEM
                     SSESGSGFDQVKATRMSRLGFVVDLFDQYESMEKEYQELLHLLNDPSLKEEAESELKS
                     VESNLTALTATLQSKLVPTNPFVDKACILELRPGVGGSEAAIFANDLLTMYENYAIKN
                     KWDTRMISITKTPAGNGIVEAIFNINAAGAYERLQYEGGVHRVQRIPETETKGRVHTS
                     TAAVVVLPTEVMEPGADESKAGEEAERTFQANEVRVDVMRARGAGGQHVNTTDSAVRL
                     THIPSGIVVVIQDERSQHKNKAKAFTILRARLDEIERQEKVREERSKRTAQVTTTERS
                     DKIRTYNYPQNRITDHRCGSTTYKLDDVVKGEINEFNEVVDQMDAFAKTEAMKQLLED
                     QASSL"
     gene            <539360..>539953
                     /locus_tag="AWJ20_172"
                     /db_xref="GeneID:30033553"
     mRNA            <539360..>539953
                     /locus_tag="AWJ20_172"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878621.1"
                     /db_xref="GeneID:30033553"
     CDS             539360..539953
                     /locus_tag="AWJ20_172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734422.1"
                     /db_xref="GeneID:30033553"
                     /translation="MAVEQAAKRAVESEAAVLGTSGKSGGSSGGPVDTERELAQLYTR
                     LSIAEEKAKNLETLKSTYEKTTSQLTRRLTEEQAKAQNYRDEVDLKTTSMQHLQDEML
                     ALQIQLNVIEDNMKQVQKENEALVERWMAKVAGEAEKLNDANAFIERYSFTGWRSVPP
                     AAGAPPQTPWLLLRRSLRGEMVANRNSLKRIKPPSEG"
     gene            complement(<540086..>541918)
                     /gene="DOT1"
                     /locus_tag="AWJ20_173"
                     /db_xref="GeneID:30033564"
     mRNA            complement(<540086..>541918)
                     /gene="DOT1"
                     /locus_tag="AWJ20_173"
                     /product="histone methyltransferase DOT1"
                     /transcript_id="XM_018878632.1"
                     /db_xref="GeneID:30033564"
     CDS             complement(540086..541918)
                     /gene="DOT1"
                     /locus_tag="AWJ20_173"
                     /inference="similar to AA sequence:KEGG_Orthology:K11427"
                     /codon_start=1
                     /product="histone methyltransferase DOT1"
                     /protein_id="XP_018734423.1"
                     /db_xref="GeneID:30033564"
                     /translation="MFFSQLSKVSGSASKGHPQNSANVKKTVITTTKVVRKSSSPLAQ
                     PAAAASGSHGSGSSSGSGISGGIAGSNVGNNSSKRDRQVKNRHSSEPVASSKRKRVEN
                     RSTAGARTGRATAGSSPLATDQNGSTGSTGGSSGVGGRGGDRATSSPKPRKRRTAKSY
                     NTRVSDESSSEEEENWELTLKKPSSASITATQSPSSDLEFEDGQTSRQFYLDPENHSS
                     ELAGPVDIISFAQLVTSTSRNVRYKPLFDFKKNTVNNSRNESYKTNEPENEQKDDEKR
                     TITLQLPFGSEEYPVMIPSKVEEANPIDEIAAVFEMTATVFVPGGGENSPSWLIKHPS
                     NQDCILRRLRRAVKNNDSQSFHRSIDEFNDLILSLRESGAIESTIKSIDRLPTPTIYE
                     LLNQVYRRVVSPRTHELRDYKAFSSNVYGELLPPFVTEIFRQTKLVPSSVFIDLGSGV
                     GNCVLQAALEIGCESWGCEMMKTASELATKQKTELENRVNKLYRLAMGSINLVSSDFV
                     QDESIHAVLHRADVLLVNNYAFDAELNGQLVNMFLDLKDGCKIVSLRSFVPTGHVITE
                     HNRESPINILRVEKRHFSNDSVSWTTAGGDYYIATIDRSRLTAS"
     gene            <542581..>544245
                     /gene="GPI10"
                     /locus_tag="AWJ20_174"
                     /db_xref="GeneID:30033575"
     mRNA            <542581..>544245
                     /gene="GPI10"
                     /locus_tag="AWJ20_174"
                     /product="Gpi10p"
                     /transcript_id="XM_018878643.1"
                     /db_xref="GeneID:30033575"
     CDS             542581..544245
                     /gene="GPI10"
                     /locus_tag="AWJ20_174"
                     /inference="similar to AA sequence:KEGG_Orthology:K05286"
                     /note="Integral membrane protein involved in GPI anchor
                     synthesis; putative alpha 1,2 mannosyltransferase required
                     for addition of the third mannose onto the
                     glycosylphosphatidylinositol (GPI) core structure; human
                     PIG-Bp is a functional homolog; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence ISS] [PMID 9639537]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0004584 - dolichyl-phosphate-mannose-glycolipid
                     alpha-mannosyltransferase activity [Evidence IMP] [PMID
                     9576863]; GO_function: GO:0004584 -
                     dolichyl-phosphate-mannose-glycolipid
                     alpha-mannosyltransferase activity [Evidence IMP] [PMID
                     9639537]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016757 - transferase
                     activity, transferring glycosyl groups [Evidence IEA,IEA];
                     GO_process: GO:0006506 - GPI anchor biosynthetic process
                     [Evidence IEA,IEA]; GO_process: GO:0006506 - GPI anchor
                     biosynthetic process [Evidence IMP] [PMID 9759715]"
                     /codon_start=1
                     /product="Gpi10p"
                     /protein_id="XP_018734424.1"
                     /db_xref="GeneID:30033575"
                     /translation="MQYSSRRWIHLPLYAIPLLVAFRVFNALSIKTFFQPDEYWQSLE
                     PAHIAVYGYGYLTWEWREHLRSAAHPLLFAGVYKLANWLDIDPVLGPKLFQGVVAAIG
                     DIYTYELAIQATNTPSASVAKLALFANLASAFNWFCLPRTFSNSLETVLTTIALSYWP
                     WKSFTSGSPIIWPRFVLSLAIASIACIFRPTNALLWLFLGIHFLWTSSSSRQTTVKII
                     AATSAVLTLSLCFNGLVDYVYFGEPVFPLLNFIKFNIVESLSQFYGVNQWHYYLSQGL
                     PLLTMAYLPLVLTGLYQYKSTIIVQLILFIIGSYSLLAHKEVRFIFPLIPLLHLLVAA
                     ALDRIRRRAIFPLPYLVAILLAINVPVATYFSLYHQRGVIDVISYLRHEPTVSSVGFL
                     MPCHSTPWQSHIHRPDITAWFLTCEPPLGLTAKQQKSYLDIADQFYADPTTFLDTHFP
                     PLDDAPTDTPPSHSDYDWPSHLVFFAALEPLASRYLSPVYQEVSSFFPGAGASGGWGS
                     APDPAAPLAALESFSSTVLAISCEAGATGSGAEPQPPEAPWPPDTV"
     gene            complement(<544341..>545237)
                     /gene="UNG1"
                     /locus_tag="AWJ20_175"
                     /db_xref="GeneID:30033586"
     mRNA            complement(<544341..>545237)
                     /gene="UNG1"
                     /locus_tag="AWJ20_175"
                     /product="Ung1p"
                     /transcript_id="XM_018878654.1"
                     /db_xref="GeneID:30033586"
     CDS             complement(544341..545237)
                     /gene="UNG1"
                     /locus_tag="AWJ20_175"
                     /inference="similar to AA sequence:KEGG_Orthology:K03648"
                     /note="Uracil-DNA glycosylase; required for repair of
                     uracil in DNA formed by spontaneous cytosine deamination;
                     efficiently excises uracil from single-stranded DNA in
                     vivo; not required for strand-specific mismatch repair;
                     cell-cycle regulated, expressed in late G1; localizes to
                     mitochondria and nucleus; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 11812822];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 24034606]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 11812822]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 24034606]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0016798 - hydrolase activity, acting on
                     glycosyl bonds [Evidence IEA]; GO_function: GO:0016799 -
                     hydrolase activity, hydrolyzing N-glycosyl compounds
                     [Evidence IEA]; GO_function: GO:0004844 - uracil DNA
                     N-glycosylase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004844 - uracil DNA N-glycosylase activity [Evidence
                     IDA] [PMID 2644266]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA,IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IMP] [PMID 1938887]; GO_process: GO:0006284 -
                     base-excision repair [Evidence IEA,IEA]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Ung1p"
                     /protein_id="XP_018734425.1"
                     /db_xref="GeneID:30033586"
                     /translation="MTFLSPETNRQTVSRAEILTRCRLEITTLDESWLAVLHKELSKP
                     YFLNLKKFIKTEINNGKRIFPPLQDIYSWSRHTPLDSVRVVILGQDPYHGPNQAHGLA
                     FSVNPPTPPPPSLRNIYKGIAIDYPDFVVPKSGLLTPWANRGVLLLNTCLTVQAANAN
                     SHAGKGWETFTEEVLKAAVKARPSGICFLAWGNPAYARMQKIRPSSEHLVLRSVHPSP
                     LSASRGFFECNHFRKANEWLFEKYGPAGVVDWALQTGNKLQAIELLLDPAKQQQLKEL
                     ETLLADDDDEDDDEIPPTTTKN"
     gene            complement(<546078..>547541)
                     /gene="MSS2"
                     /locus_tag="AWJ20_176"
                     /db_xref="GeneID:30033597"
     mRNA            complement(<546078..>547541)
                     /gene="MSS2"
                     /locus_tag="AWJ20_176"
                     /product="Mss2p"
                     /transcript_id="XM_018878663.1"
                     /db_xref="GeneID:30033597"
     CDS             complement(546078..547541)
                     /gene="MSS2"
                     /locus_tag="AWJ20_176"
                     /inference="similar to AA sequence:KEGG_Orthology:K17798"
                     /note="Peripherally bound inner membrane protein of the
                     mitochondrial matrix; involved in membrane insertion of
                     C-terminus of Cox2p, interacts genetically and physically
                     with Cox18p; GO_component: GO:0031314 - extrinsic
                     component of mitochondrial inner membrane [Evidence IDA]
                     [PMID 11604502]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005743 - mitochondrial
                     inner membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IDA] [PMID
                     11604502]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0032979 -
                     protein insertion into mitochondrial membrane from inner
                     side [Evidence IMP] [PMID 11604502]; GO_process:
                     GO:0032979 - protein insertion into mitochondrial membrane
                     from inner side [Evidence IGI,IPI] [PMID 11950926];
                     GO_process: GO:0032979 - protein insertion into
                     mitochondrial membrane from inner side [Evidence IPI]
                     [PMID 17452441]"
                     /codon_start=1
                     /product="Mss2p"
                     /protein_id="XP_018734426.1"
                     /db_xref="GeneID:30033597"
                     /translation="MRISGVLLAEFSLIPKRALRKYLFDFRVPLGYKTVVRVYQSCLD
                     ESDPNFLQPSKDVDQVPPYQLMTLKRILENYRKSSGVISKRAVDVENNLVDRASELGD
                     YAAIALLCGRTLASSPGSDQQLTRSTSDTSATSATSSALSGATASTAGSSNITAATSA
                     TSSGTSATDSTTASSSGTTSATTPANNTDRTTSGIASSAASSAAPTLPDADSSNASVN
                     ADVSTGNGSNTPSNNGASSIVVKESSLPKDEITVEDRQHANLLLRQLMDKKFPLAFKI
                     AGDLAYQRNQREKARQFYQLAIDNGIQSDNSLYVECLRNIGLICLMTKDQIDLVTARR
                     YFDKAVASALDLNQVSDCHFYLGQILEKNQTASRYHLEKAASTGLRQAFAPLGFLLLN
                     YFNKVELAQQWFELGSSIDDINCHTGLFDCLMKLGDYEGAARVLDKIRRDEKGDLVVQ
                     SRKKLIEQLEQHRQGPPPGGSGNRNDGADAGSERWSF"
     gene            <553718..>558487
                     /gene="SNF2"
                     /locus_tag="AWJ20_177"
                     /db_xref="GeneID:30033608"
     mRNA            <553718..>558487
                     /gene="SNF2"
                     /locus_tag="AWJ20_177"
                     /product="SWI/SNF catalytic subunit SNF2"
                     /transcript_id="XM_018878674.1"
                     /db_xref="GeneID:30033608"
     CDS             553718..558487
                     /gene="SNF2"
                     /locus_tag="AWJ20_177"
                     /inference="similar to AA sequence:KEGG_Orthology:K11786"
                     /codon_start=1
                     /product="SWI/SNF catalytic subunit SNF2"
                     /protein_id="XP_018734427.1"
                     /db_xref="GeneID:30033608"
                     /translation="MGSGPGAGLGQGQGPQGPMRQQPPMPSLGPDSPFNQEQMMLLRN
                     QMIAYRALSKNAPIAQAMQAVQQALASNIRLQLPGQQPQQQQQQQTQQSQQPQQQQPQ
                     PQQQPQQQQQPQAQLQAQLGPGAAAQGSPNAAVLNHQRQPSVPVPDEFQNSPGRGFRK
                     PAPSMSQRSFSRASSISSPVATPQTPASGAGTGPATGGTDPLLGVGGVSGQASAGLGN
                     TPSPQPPMPVNLPPSVKLFGVSSYIDPRSPSYLAQSVSFEDYTARQQQLFIPTIMPVG
                     LDVVDMKLERERRVQQAMHNRMAYLEEQESESSSGLSIDEKIELKSLRLANYNKALRG
                     DILANVYYFNMVALDESNKGRYTRMKKLSLQEAIATEQFTYQQRVERQRRENQRKIDN
                     IQSTVKHAVDVANSVTQKRSRLSRLQKSIVSFHAYTEKEEQKRLERTAKQRLQALRAN
                     DEEAYIKLLDQTKDTRITHLLRQTNTFLHSLTKAVESQQRENKGLATLNTELPDIQEG
                     DEDSEVRDYYAVAHRIKEEITKQPSILVGGTLKEYQLKGLQWMVSLYNNSLNGILADE
                     MGLGKTIQSISLITYLIEMKQLAGPFLVIVPLSTLTNWNLEFEKWAPSVKKVVYKGPP
                     MARKAQQGIIRSGDFQVLLTTYEYIIKDRPILSRIKWAHMIIDEGHRMKNTQSKLSFT
                     LTTYYSTRYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQD
                     KMDLSEEETLLIIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKVIKCKMSALQQKLYQQ
                     MIKYKLLILGDNVQGASASGLKGLNNQIMQLRKICNHPFVFEEVENLVNPNKETNDDL
                     FRAAGKFELLDRILPKFKKTGHRVLIFFQMTQIMDIMEDYLRLRDMQYLRLDGSTKAE
                     DRSDLLKKFNAPDSPYFAFLLSTRAGGLGLNLQTADTVIIYDTDWNPHQDLQAQDRAH
                     RIGQTKEVRILRLITEDSVEEHILEKAHRKLEIDGKVIQAGKFDNKSTNEEQEAFLRS
                     LLEAEEAKKGHKDDDDEEMDDEELNEVLARDDNEKEIFREIDRIRAADYGKSGARARL
                     ITEDELPDIYKQDVSHLVKPEPMENYGRGTRERKVLHYDDGLTEEQWLEAVDNDDDTI
                     EDAIARKRQRINKRQQNKLRDREEDSADVSSPGTPLAGGDFAVSTPGTNGKRKRGRKA
                     RDTTASVSASATGNVGTPTAKDESPASAIILPVRKRAKGRPPKVKETLSPQARRQLTE
                     QMEEIFNFVTTQVKDDDERNRIDLFLERPPKRIYPDYYLLIENPIACDIIRKRINDAY
                     YQSLPQFREDFRLMFRNARTYNEEGSFVVQDANILENMVNTLYYKYIPEAEAIDKAEA
                     ERVLQEKLKKEETAKLMKSEVTQTTVSDATTVSGGNAGVTSTSVGESTSKVELMKLPL
                     SSLANEQEPKQVFKASDSESDHDKAHLSPRLKETSSSSTSPLENGSIAGGAIKDSARI
                     SPGIHSGNSSDGGSAASQLGPGEDGDDENMDGGDNSLLVSGQQSAVDGSTVQGDEDED
                     DDALMHDHDGLELDPFGGDFNDYGNDFDNSNLLDRLN"
     gene            <564683..>569263
                     /gene="INO80"
                     /locus_tag="AWJ20_178"
                     /db_xref="GeneID:30033619"
     mRNA            <564683..>569263
                     /gene="INO80"
                     /locus_tag="AWJ20_178"
                     /product="chromatin-remodeling ATPase INO80"
                     /transcript_id="XM_018878685.1"
                     /db_xref="GeneID:30033619"
     CDS             564683..569263
                     /gene="INO80"
                     /locus_tag="AWJ20_178"
                     /inference="similar to AA sequence:KEGG_Orthology:K11665"
                     /note="ATPase and nucleosome spacing factor; subunit of
                     complex containing actin and actin-related proteins that
                     has chromatin remodeling activity and 3' to 5' DNA
                     helicase activity in vitro; promotes nucleosome shifts in
                     the 3 prime direction; has a role in modulating stress
                     gene transcription; GO_component: GO:0031011 - Ino80
                     complex [Evidence IDA] [PMID 10361278]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0043140 - ATP-dependent 3'-5' DNA helicase activity
                     [Evidence IDA] [PMID 10952318]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IDA] [PMID 10952318];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0016817 - hydrolase
                     activity, acting on acid anhydrides [Evidence IEA];
                     GO_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IDA,IMP] [PMID 10952318]; GO_process: GO:0006974
                     - cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0016568 - chromatin modification [Evidence
                     IEA]; GO_process: GO:0006338 - chromatin remodeling
                     [Evidence IDA] [PMID 10952318]; GO_process: GO:0006338 -
                     chromatin remodeling [Evidence IMP] [PMID 23207916];
                     GO_process: GO:0006348 - chromatin silencing at telomere
                     [Evidence IMP] [PMID 18258182]; GO_process: GO:0043486 -
                     histone exchange [Evidence IDA] [PMID 21241891];
                     GO_process: GO:0042766 - nucleosome mobilization [Evidence
                     IMP] [PMID 17681272]; GO_process: GO:0016584 - nucleosome
                     positioning [Evidence IDA] [PMID 21135121]; GO_process:
                     GO:0045944 - positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 17681272];
                     GO_process: GO:0051983 - regulation of chromosome
                     segregation [Evidence IMP] [PMID 23207916]; GO_process:
                     GO:0043618 - regulation of transcription from RNA
                     polymerase II promoter in response to stress [Evidence
                     IMP] [PMID 19620280]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0000722 - telomere maintenance via
                     recombination [Evidence IGI] [PMID 23390378]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IDA,IMP] [PMID 10952318]; GO_process: GO:0006351
                     - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="chromatin-remodeling ATPase INO80"
                     /protein_id="XP_018734428.1"
                     /db_xref="GeneID:30033619"
                     /translation="MAISSLLSGSEESGAGGGAVGSVGGPGSSSVGDIASGGFGSVAS
                     SDGGFAVSSSDKSGLDRYTYNGTSHVKSSMNGFGAFKVNKWYNQPNYQMHFDWPTSLA
                     DNDAGEIAKQAAEPRYSSEKSEFLSSVRSKLENRMNQYHEKTKVEKRTEAHNTLLAKH
                     SSRAKLLVNYANAELHTRALSHVLSGEESVYLEERQRMKRLEANSKRRDQRRLQKQRM
                     ALAEKADKIARGEIEAPEGEEQRIASLIASTKRKPGPKPKKEREEYEMLLDELELATT
                     PDSQGAPETPATGKGKSKSKTKGKSLSSTGTGSTATPKSHKRKSTDTGGDDQTPSDKK
                     TKLANGSAAVSAAAGTPKTKGEKAAERAAEKAAAKAAKDAAKQAEKAAKEEQKAADKA
                     AAAAAAAAAEQTKGPSQKEIKAVARLYQNTYESIWKDMARRDSGKVYRLMQSSTNMKL
                     SNVKKTAMLAAKEARRWQLKTNKSAKDIPARARRGMREMLTFWKRNEKEERDLRRKAE
                     KEAIEQAKKDEELRESKRQAKKLNFLITQTELYSHFIGRKIKTAEAAGEEVNQDDDPH
                     GIKQLESGDSAGRVEDIDFDNTDDNEIKRIAMNNAQKAVMDAQTKARNFNNSAEIKNV
                     DIDDDDMNFQNPTSLGDEVIAQPKMLSCQLKEYQLKGLTWLANLYEQGINGILADEMG
                     LGKTVQSISVMAYLAETHNIWGPFLVIAPASTLHNWQQEISKFVPQFKALPYWGSGKD
                     RKVLRKFWDRKQVTYTKDSPFHVLITSYQLVVADAQYFQRFKWQYMILDEAQAIKSSS
                     STRWKSLLSFRCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHEEFSEWFSKDIES
                     HAQNNSQLNEQQLKRLHMILKPFMLRRVKKHVQQELGDKIEIDVYCNLTSRQRVLYKM
                     LRSQISLMDLIERATSSSDDGTQSLMNLVMQFRKVCNHPDLFERADVKSAFNFATFAQ
                     TVNVNRDGPVIDVAYTAVNHISYSVPKLAYRDGGFLDIPSQGNYRVGFNQKYLKNKFS
                     VWDPSNILESSADPNGAFTWSRFVGKSAGEIAKLSQQGVYERAIAGYSIAEKIHHEAL
                     VQQIYDEQEPDNSYVPGSKLFLIDDRYGHVEQLKSRASLGDGPLHELLSIADNVEIDN
                     YYHVSEKAYDSRVLCPPISLVGSDMGLVNDQQSTLFNLSVRSTLDPLTLDQEWDLLQH
                     GVKPGDFPASNLYPKERNTRAGYTSIRMPSMAKFVYESGKLLKLDQLLTELKANDHRV
                     LIYFQMTKMMDLMEEYLTYRQYKYCRLDGSSKLSDRRDLVNDWQTRPDLFVFLLSTRA
                     GGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVKGTIEERMRD
                     RAKQKMHVQAVVMEGGGAAGSGVDFQKPGREVAFWLLDDDDAVDAALRQKEREKQLSE
                     IKTSKKSRKSAGTGTGTGSNGTPAPIAAPVPRKQITLEDMYHEDEGNFDESSRPATGA
                     TTPVARGETPPVFKPKKRMTTEQRLRAVGDIA"
     gene            <570091..>572439
                     /gene="NPP1"
                     /locus_tag="AWJ20_179"
                     /db_xref="GeneID:30033630"
     mRNA            <570091..>572439
                     /gene="NPP1"
                     /locus_tag="AWJ20_179"
                     /product="Npp1p"
                     /transcript_id="XM_018878695.1"
                     /db_xref="GeneID:30033630"
     CDS             570091..572439
                     /gene="NPP1"
                     /locus_tag="AWJ20_179"
                     /note="Nucleotide pyrophosphatase/phosphodiesterase;
                     mediates extracellular nucleotide phosphate hydrolysis
                     along with Npp2p and Pho5p; activity and expression
                     enhanced during conditions of phosphate starvation;
                     involved in spore wall assembly; NPP1 has a paralog, NPP2,
                     that arose from the whole genome duplication, and an npp1
                     npp2 double mutant exhibits reduced dityrosine
                     fluorescence relative to the single mutants; GO_component:
                     GO:0005575 - cellular_component [Evidence ND];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_function: GO:0035529 - NADH
                     pyrophosphatase activity [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA,IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IGI,IMP] [PMID 16278456]; GO_function:
                     GO:0047429 - nucleoside-triphosphate diphosphatase
                     activity [Evidence IDA,IGI,IMP] [PMID 16278456];
                     GO_function: GO:0004551 - nucleotide diphosphatase
                     activity [Evidence IEA]; GO_function: GO:0004551 -
                     nucleotide diphosphatase activity [Evidence ISS] [PMID
                     16278456]; GO_function: GO:0004528 - phosphodiesterase I
                     activity [Evidence IEA]; GO_function: GO:0004528 -
                     phosphodiesterase I activity [Evidence ISS] [PMID
                     16278456]; GO_process: GO:0016036 - cellular response to
                     phosphate starvation [Evidence IEP,IMP] [PMID 16278456];
                     GO_process: GO:0008152 - metabolic process [Evidence
                     IEA,IEA]; GO_process: GO:0090305 - nucleic acid
                     phosphodiester bond hydrolysis [Evidence IEA]; GO_process:
                     GO:0009141 - nucleoside triphosphate metabolic process
                     [Evidence IMP] [PMID 16278456]; GO_process: GO:0006796 -
                     phosphate-containing compound metabolic process [Evidence
                     ISS] [PMID 16278456]"
                     /codon_start=1
                     /product="Npp1p"
                     /protein_id="XP_018734429.1"
                     /db_xref="GeneID:30033630"
                     /translation="MASGYSLDIPRESLDGDDESDIVASGGPVTDRDRDLLRADDEVL
                     KALAGSSSSKSRTTPNIKSLLPKKKFLSFATPKKSSRPSPGGDYASLGDGSFKDEDDG
                     FDIDSDDNDNLQGTGSSSSGGGRNGNPGKPKRSFFGGHKLDTFRREGDISNADSDFSS
                     EDDFDIEIDVETQPGKRKKRRSRNSQMTGRKHLLVFLLIILGFGLLYSIHGSDDDEDT
                     QKSGGSKKPKYKKLVKSLQSNGTHEFYPTTVVISLDGFHPHYVSEELTPNLHSLFVDH
                     SGVPYMIPSFPSSTFPNHWTLVTGLYPANHGIIGNTFFDTKTGKQFFNTKPGQSLQRE
                     WWGGEPIWETAALQGVSTAVHMWPGSEVDWEDVAPVAVDKFNKSEPLTSKTNRVFQWL
                     DNGNYEQRPELILTYVPNVDTVGHQVGISGPEIRATLQEVDSFVGSILSGIKSRNLDS
                     IVNVMVLSDHGMAPTSNDRIVFLEDLMDTNSIEHLDGWPLVGLRLKNPTSSNSQKGGG
                     SLDDAVNKNIDSKESTKSLEQTIQSTYQSLKSKEDPSKFKVFLKDNMPREWNFGGMNS
                     QYSSRIAPLWLVPQVGWSITTRKQLEDMGGRYQPFGVHGYNNTESLMRALFLATGPYF
                     SQDQMFHPIPNVDVYNIICDTLNLVPAHTDGAPVRRALESLPSKWVDPQPYPGVEFHT
                     EILKVNSTYDILFGGSGGSNQYKVKEPSKSSSATNPSSTSSTATGPASTSSLPENSEK
                     PSFFGKVTDWWNSISTATSDALSSAKDWVSSKFSSADKGESR"
     gene            complement(<572597..>574318)
                     /locus_tag="AWJ20_180"
                     /db_xref="GeneID:30033642"
     mRNA            complement(<572597..>574318)
                     /locus_tag="AWJ20_180"
                     /product="putative indolepyruvate decarboxylase family
                     protein"
                     /transcript_id="XM_018878707.1"
                     /db_xref="GeneID:30033642"
     CDS             complement(572597..574318)
                     /locus_tag="AWJ20_180"
                     /inference="similar to AA sequence:KEGG_Orthology:K12261"
                     /note="hypothetical protein with low sequence identity to
                     Pdc1p; mRNA identified as translated by ribosome profiling
                     data; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0016831 -
                     carboxy-lyase activity [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0016829 - lyase activity [Evidence IEA];
                     GO_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_function: GO:0030976 - thiamine
                     pyrophosphate binding [Evidence IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="putative indolepyruvate decarboxylase family
                     protein"
                     /protein_id="XP_018734430.1"
                     /db_xref="GeneID:30033642"
                     /translation="MSVISGSEIIANSLVQLGVTHIFGIVGIPVIEVAEACINRGIKF
                     ISFRNEQAATYAATAYGYLTGKPGVSLVVGGPGVVHAMAGIENANSNHFPLLLLAGSS
                     ETHQRGKGAFQELNQVALLYPHTKFANQPSTVKSVPYMIEKAYRTSYFGRPGSTYIDL
                     PADIIQAKLDIKNHQSKESVVQKLVPPGLAPKTMGDPERIRRAVNVLKTAKSPLLIVG
                     KGAAYGRAENIIRQFQERTNIPFLPTPMGKGVIPDDNSLNVSAARSAALKNADVILLL
                     GARLNWILHYGDSPKFSDNVKIIQVDSAAEELGNNSGNPELGIAGDIELVVHQILNEL
                     TSHGNSSWRSPPLLKEIADTKASNQAKAEKVDSTVTDPIKYQAVYKTIRETFSETLPS
                     SKEIIYVSEGANTMDISRSSFSLNSPRTRLDAGTNATMGVGLGYAIAAKAASPDSLVV
                     AIEGDSAFGFSAVEVETAVRSQLPMIIYVMNNSGVYHGVDPTAYDNVDDKPLPSTALQ
                     LNTAYHTLAESLGAKGYLAKTLDEVRSATLEAIRSDNVSVINVIIDSGKDKKLEFGWM
                     ASTKPKL"
     gene            complement(<575899..>576312)
                     /gene="BET3"
                     /locus_tag="AWJ20_181"
                     /db_xref="GeneID:30033653"
     mRNA            complement(<575899..>576312)
                     /gene="BET3"
                     /locus_tag="AWJ20_181"
                     /product="TRAPP complex core subunit BET3"
                     /transcript_id="XM_018878717.1"
                     /db_xref="GeneID:30033653"
     CDS             complement(575899..576312)
                     /gene="BET3"
                     /locus_tag="AWJ20_181"
                     /note="Core component of transport protein particle
                     (TRAPP) complexes I-III; TRAPP complexes are related
                     multimeric guanine nucleotide-exchange factors for the
                     GTPase Ypt1, regulating ER-Golgi traffic (TRAPPI),
                     intra-Golgi traffic (TRAPPII), endosome-Golgi traffic
                     (TRAPPII and III) and autophagy (TRAPPIII); hydrophilic
                     homodimeric protein that acts in conjunction with SNARE
                     proteins in targeting and fusion of ER to Golgi transport
                     vesicles; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IEA,IEA]; GO_component: GO:1990070 - TRAPPI
                     protein complex [Evidence IDA] [PMID 11239471];
                     GO_component: GO:1990071 - TRAPPII protein complex
                     [Evidence IDA] [PMID 11239471]; GO_component: GO:1990072 -
                     TRAPPIII protein complex [Evidence IDA] [PMID 20375281];
                     GO_component: GO:0033106 - cis-Golgi network membrane
                     [Evidence IDA] [PMID 9564032]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA,IEA]; GO_component:
                     GO:0000407 - pre-autophagosomal structure [Evidence IEA];
                     GO_function: GO:0017112 - Rab guanyl-nucleotide exchange
                     factor activity [Evidence IGI] [PMID 11102533];
                     GO_function: GO:0017112 - Rab guanyl-nucleotide exchange
                     factor activity [Evidence IGI] [PMID 17041589];
                     GO_function: GO:0017112 - Rab guanyl-nucleotide exchange
                     factor activity [Evidence IDA] [PMID 17110339];
                     GO_function: GO:0017112 - Rab guanyl-nucleotide exchange
                     factor activity [Evidence IMP] [PMID 17287728];
                     GO_function: GO:0017112 - Rab guanyl-nucleotide exchange
                     factor activity [Evidence IGI] [PMID 8590804]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IMP] [PMID 11239471]; GO_process: GO:0006888 -
                     ER to Golgi vesicle-mediated transport [Evidence IGI,IMP]
                     [PMID 8590804]; GO_process: GO:0006914 - autophagy
                     [Evidence IEA]; GO_process: GO:0006891 - intra-Golgi
                     vesicle-mediated transport [Evidence IMP] [PMID 11239471];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="TRAPP complex core subunit BET3"
                     /protein_id="XP_018734431.1"
                     /db_xref="GeneID:30033653"
                     /translation="MGYNIGLRLIEEFLAKSGTGRCRELKETAEIISKVGFKMFLNIT
                     PTIDNWTADFKQFSLIFDENPLAEFVELPDDGRAHRELWYSNLLAGVIRGALEMVQLQ
                     VETEFVSDTLQGSDYTELRVKFIKTLEDEIPPGED"
     gene            <576947..>578164
                     /gene="ERG12"
                     /locus_tag="AWJ20_182"
                     /db_xref="GeneID:30033664"
     mRNA            <576947..>578164
                     /gene="ERG12"
                     /locus_tag="AWJ20_182"
                     /product="mevalonate kinase"
                     /transcript_id="XM_018878728.1"
                     /db_xref="GeneID:30033664"
     CDS             576947..578164
                     /gene="ERG12"
                     /locus_tag="AWJ20_182"
                     /inference="similar to AA sequence:KEGG_Orthology:K00869"
                     /note="Mevalonate kinase; acts in the biosynthesis of
                     isoprenoids and sterols, including ergosterol, from
                     mevalonate; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0016301 - kinase activity [Evidence IEA,IEA];
                     GO_function: GO:0004496 - mevalonate kinase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004496 - mevalonate
                     kinase activity [Evidence IDA] [PMID 16477420];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0016773 - phosphotransferase
                     activity, alcohol group as acceptor [Evidence IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0006696 - ergosterol biosynthetic
                     process [Evidence IMP] [PMID 200835]; GO_process:
                     GO:0010142 - farnesyl diphosphate biosynthetic process,
                     mevalonate pathway [Evidence IMP] [PMID 200835];
                     GO_process: GO:0019287 - isopentenyl diphosphate
                     biosynthetic process, mevalonate pathway [Evidence IEA];
                     GO_process: GO:0019287 - isopentenyl diphosphate
                     biosynthetic process, mevalonate pathway [Evidence IMP]
                     [PMID 200835]; GO_process: GO:0008299 - isoprenoid
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006629 - lipid metabolic process [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0016310 - phosphorylation [Evidence IEA];
                     GO_process: GO:0006694 - steroid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008202 - steroid metabolic
                     process [Evidence IEA]; GO_process: GO:0016126 - sterol
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="mevalonate kinase"
                     /protein_id="XP_018734432.1"
                     /db_xref="GeneID:30033664"
                     /translation="MKNFIVSAPGKVILFGEHAVVHNKPAIAAAVSLRTYTGVEDLAD
                     TSKIELDFADIKFDHQWAIEDLPWNELSASRSSESAIPTSLDQHVVDILNETALKGIT
                     NTFQHAAAFAFIYLYMSICSRDTPGKKFTTRSTLPVGAGLGSSACLSVCLSSALLRVA
                     GQITNPEPTPSEEFIDLINNWAFIGECCIHGNPSGIDNTVATRGGAVKFRRPNIMEPI
                     ANFPPVKLVLTNTGYPRRTSELVANVGKLRKNLPTVVEPILDAIEHVSEEAYKILNSG
                     QSSSAIAANLGSLVHINHALLVALGVSHPALEQTKYVADSLKLGETKLTGAGGGGCAI
                     TLVTEDVSKEEVHSKVAQLREKLPAEFQIFDTILGGPGVGYTEDYPQAVADKFASMEN
                     DDFEKLSWSYWSS"
     gene            complement(<578378..>579361)
                     /gene="FSF1"
                     /locus_tag="AWJ20_183"
                     /db_xref="GeneID:30033675"
     mRNA            complement(<578378..>579361)
                     /gene="FSF1"
                     /locus_tag="AWJ20_183"
                     /product="Fsf1p"
                     /transcript_id="XM_018878738.1"
                     /db_xref="GeneID:30033675"
     CDS             complement(578378..579361)
                     /gene="FSF1"
                     /locus_tag="AWJ20_183"
                     /note="Putative protein; predicted to be an
                     alpha-isopropylmalate carrier; belongs to the
                     sideroblastic-associated protein family; non-tagged
                     protein is detected in purified mitochondria; likely to
                     play a role in iron homeostasis; GO_component: GO:0016021
                     - integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0008324 - cation
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0008150 - biological_process [Evidence
                     ND]; GO_process: GO:0006812 - cation transport [Evidence
                     IEA]; GO_process: GO:0006811 - ion transport [Evidence
                     IEA]; GO_process: GO:0055072 - iron ion homeostasis
                     [Evidence IEA]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Fsf1p"
                     /protein_id="XP_018734433.1"
                     /db_xref="GeneID:30033675"
                     /translation="MASSVPGNRPLPESRYDLSTYMGRVRHCAEVSDPRMLFNTSKDI
                     ELARKLIGDYKNSDGPMTPELWRAKRVLDSTLHPDTGLPVVLPFRMSSYVLSNLVVTV
                     GMLTPGLGTAGTLFWQIANQSLNVAVNTANANKSHPLSTQQLITNYLLAVSGSCSVAL
                     GLNAIVPRLKNVSASTKTILSRLVPFAAVVSAGIVNVFLMRGEEIRKGITVHDPETNE
                     PVGTSKTAAKYAVGETALSRVITATPIMVFPPLILYRLQRGILRGKSNLAVTAANLGL
                     ITITSFAVLPFALGVFPTKRVKSTTQLEPELSNLKNSKGTPVSEVWFNRGM"
     gene            complement(<580465..>582048)
                     /gene="GUA1"
                     /locus_tag="AWJ20_184"
                     /db_xref="GeneID:30033686"
     mRNA            complement(<580465..>582048)
                     /gene="GUA1"
                     /locus_tag="AWJ20_184"
                     /product="GMP synthase (glutamine-hydrolyzing)"
                     /transcript_id="XM_018878749.1"
                     /db_xref="GeneID:30033686"
     CDS             complement(580465..582048)
                     /gene="GUA1"
                     /locus_tag="AWJ20_184"
                     /inference="similar to AA sequence:KEGG_Orthology:K01951"
                     /note="GMP synthase; highly conserved enzyme that
                     catalyzes the second step in the biosynthesis of GMP from
                     inosine 5'-phosphate (IMP); transcription is not subject
                     to regulation by guanine but is negatively regulated by
                     nutrient starvation; reduction-of-function mutation
                     gua1-G388D causes changes in cellular guanine nucleotide
                     pools, defects in general protein synthesis, and impaired
                     translation of GCN4 mRNA; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_component: GO:0005737
                     - cytoplasm [Evidence IEA,IEA]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0003922 -
                     GMP synthase (glutamine-hydrolyzing) activity [Evidence
                     IEA,IEA]; GO_function: GO:0003922 - GMP synthase
                     (glutamine-hydrolyzing) activity [Evidence IMP,ISS] [PMID
                     8112582]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0016462 -
                     pyrophosphatase activity [Evidence IEA]; GO_process:
                     GO:0006177 - GMP biosynthetic process [Evidence
                     IEA,IEA,IEA]; GO_process: GO:0006177 - GMP biosynthetic
                     process [Evidence IMP] [PMID 20980241]; GO_process:
                     GO:0006541 - glutamine metabolic process [Evidence IEA];
                     GO_process: GO:0006164 - purine nucleotide biosynthetic
                     process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="GMP synthase (glutamine-hydrolyzing)"
                     /protein_id="XP_018734434.1"
                     /db_xref="GeneID:30033686"
                     /translation="MSSEPVVEVSAVFDTILVLDFGSQYSHLITRRLREFNVYAEMLP
                     CTQKISELTWKPKGVILSGGPYSVYDKDAPHVDHDVFKLDVPILGICYGMQELAWING
                     RGVARGEHREYGHATIHVKDSDNKLFHGIDNFQVWMSHGDKLNDLPTGFKTIATTDNS
                     PYAAIAHEKENIWGIQFHPEVTHTTKGKQLLRNFAIDICQADQKWNMKNFIHTEIERI
                     RTLVGEHGEVIGAVSGGVDSTVAAKLMKEAIGDRFHAILVDNGVMRLNECAEVKKTLS
                     DGLGINLTVIDAADEFLSKLKGVTDPEKKRKIIGNTFIHIFEREAARIQPKAGGEIEY
                     LLQGTLYPDVIESISFKGPSQTIKTHHNVGGLLEDMKLKLIEPLRELFKDEVRALGEL
                     MGIPHDLVWRHPFPGPGIAIRILGEVTPEQIKIARHADHIYIEEIKKAGIYDKISQAF
                     ACLLPVKSVGVMGDQRTYEQVIALRAIETSDFMTADWYIFDAAFLKNVAKRIVNEVDG
                     VARVVYDITSKPPATVEWE"
     gene            <582904..>583980
                     /gene="RAM2"
                     /locus_tag="AWJ20_185"
                     /db_xref="GeneID:30033697"
     mRNA            <582904..>583980
                     /gene="RAM2"
                     /locus_tag="AWJ20_185"
                     /product="bifunctional protein farnesyltransferase/protein
                     geranylgeranyltransferase"
                     /transcript_id="XM_018878760.1"
                     /db_xref="GeneID:30033697"
     CDS             582904..583980
                     /gene="RAM2"
                     /locus_tag="AWJ20_185"
                     /inference="similar to AA sequence:KEGG_Orthology:K05955"
                     /note="Alpha subunit of farnesyltransferase and
                     geranylgeranyltransferase-I; farnesyltransferase
                     (RAM2-RAM1 heterodimer) catalyzes the addition of
                     15-carbon isoprenoid farnesyl to substrate proteins
                     containing a CAAX consensus motif; type I
                     geranylgeranyltransferase (RAM2-CDC43 heterodimer)
                     catalyzes the addition of the 20-carbon isoprenoid
                     geranylgeranyl to substrate proteins containing a CaaL
                     consensus motif; required for membrane localization of Ras
                     proteins and a-factor; GO_component: GO:0005953 -
                     CAAX-protein geranylgeranyltransferase complex [Evidence
                     IDA] [PMID 1400380]; GO_component: GO:0005965 - protein
                     farnesyltransferase complex [Evidence IDA] [PMID 1763050];
                     GO_function: GO:0004662 - CAAX-protein
                     geranylgeranyltransferase activity [Evidence IEA];
                     GO_function: GO:0004662 - CAAX-protein
                     geranylgeranyltransferase activity [Evidence IDA] [PMID
                     1400380]; GO_function: GO:0004659 - prenyltransferase
                     activity [Evidence IEA]; GO_function: GO:0004660 - protein
                     farnesyltransferase activity [Evidence IEA]; GO_function:
                     GO:0004660 - protein farnesyltransferase activity
                     [Evidence IDA] [PMID 1763050]; GO_function: GO:0004661 -
                     protein geranylgeranyltransferase activity [Evidence IDA]
                     [PMID 2034682]; GO_function: GO:0008318 - protein
                     prenyltransferase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0007323 - peptide pheromone maturation
                     [Evidence IDA] [PMID 1763050]; GO_process: GO:0018343 -
                     protein farnesylation [Evidence IDA] [PMID 1763050];
                     GO_process: GO:0018344 - protein geranylgeranylation
                     [Evidence IDA] [PMID 1400380]; GO_process: GO:0018342 -
                     protein prenylation [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional protein farnesyltransferase/protein
                     geranylgeranyltransferase"
                     /protein_id="XP_018734435.1"
                     /db_xref="GeneID:30033697"
                     /translation="MATTYDWSDLKAIPQNDGGKPLAPISYNAEYVAAMNLLRGVMAV
                     EEYSERALALTAEVIEMNPAHYTVWEYRSRILKSIGKDIVPKDKRLVPDGDEDFDIVD
                     FADWLNATSLDNPKNYQVWNYRQLLEPVRSDNPESKIFYLMELELVRDVISDDTKNFH
                     AWSHLKWVVNRVSERYEESGGSSTISKADSDDKAQEKTAEESDFTEVFSLKGQLKFSD
                     LFIEEDVYNNSAWSYRYFVHSQWGILSKVELAASEERFNEEINYVKERIALAPQNEAV
                     WTYLVGIYDKYDHDAHPLDELESLCIQYAAADHIESSHALELLLRIYEQRQDKAKASA
                     ALDTLEKLLPMRSGYWEYKRRSLG"
     gene            complement(<584733..>585803)
                     /gene="CHA1"
                     /locus_tag="AWJ20_186"
                     /db_xref="GeneID:30033708"
     mRNA            complement(<584733..>585803)
                     /gene="CHA1"
                     /locus_tag="AWJ20_186"
                     /product="L-serine/L-threonine ammonia-lyase CHA1"
                     /transcript_id="XM_018878771.1"
                     /db_xref="GeneID:30033708"
     CDS             complement(584733..585803)
                     /gene="CHA1"
                     /locus_tag="AWJ20_186"
                     /inference="similar to AA sequence:KEGG_Orthology:K17989"
                     /note="Catabolic L-serine (L-threonine) deaminase;
                     catalyzes the degradation of both L-serine and
                     L-threonine; required to use serine or threonine as the
                     sole nitrogen source, transcriptionally induced by serine
                     and threonine; GO_component: GO:0042645 - mitochondrial
                     nucleoid [Evidence IDA] [PMID 15692048]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0003941 -
                     L-serine ammonia-lyase activity [Evidence IEA];
                     GO_function: GO:0003941 - L-serine ammonia-lyase activity
                     [Evidence IDA] [PMID 7042346]; GO_function: GO:0004794 -
                     L-threonine ammonia-lyase activity [Evidence IEA];
                     GO_function: GO:0004794 - L-threonine ammonia-lyase
                     activity [Evidence IDA] [PMID 7042346]; GO_function:
                     GO:0016829 - lyase activity [Evidence IEA]; GO_function:
                     GO:0030170 - pyridoxal phosphate binding [Evidence IEA];
                     GO_process: GO:0006565 - L-serine catabolic process
                     [Evidence IGI] [PMID 7042346]; GO_process: GO:0006520 -
                     cellular amino acid metabolic process [Evidence IEA];
                     GO_process: GO:0006567 - threonine catabolic process
                     [Evidence IGI] [PMID 7042346]"
                     /codon_start=1
                     /product="L-serine/L-threonine ammonia-lyase CHA1"
                     /protein_id="XP_018734436.1"
                     /db_xref="GeneID:30033708"
                     /translation="MSIICENMTPTPTVLPSSELERPNPLPLPYIETPLIPSLYLSER
                     VGCSVYLKLEQVQPSGSFKSRGLGNLVYETIRSSPFGSQFHFFSSSGGNAGCATAYAA
                     KLYKQKCTVCVPISTPVAMVERIRRAGANVVVHGKYIADSDKYLREELIPSSDLPAVY
                     CHPYDNELVWEGNSTLASEIVSQMSILGQKKPSAVICSVGGGGMFNGLVQGFQKANWQ
                     DVPILAVETEGCATLNKSIKSGGQQVRVEHPSTIARSLSTVSVTRETIDYAMHKHPTH
                     SMTVSDAEAATACIEFANDHKLLIEAACGTALAPLYTNRIHEVVPGLSADSVLVVVVC
                     GGTAVNWEILEQYSKEYGVPLY"
     gene            complement(<587294..>589237)
                     /gene="NOG1"
                     /locus_tag="AWJ20_187"
                     /db_xref="GeneID:30033719"
     mRNA            complement(<587294..>589237)
                     /gene="NOG1"
                     /locus_tag="AWJ20_187"
                     /product="Nog1p"
                     /transcript_id="XM_018878782.1"
                     /db_xref="GeneID:30033719"
     CDS             complement(587294..589237)
                     /gene="NOG1"
                     /locus_tag="AWJ20_187"
                     /inference="similar to AA sequence:KEGG_Orthology:K06943"
                     /note="Putative GTPase; associates with free 60S ribosomal
                     subunits in the nucleolus and is required for 60S
                     ribosomal subunit biogenesis; constituent of 66S
                     pre-ribosomal particles; member of the ODN family of
                     nucleolar G-proteins; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA,IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 11112701]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     11583614]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 16861225];
                     GO_component: GO:0030687 - preribosome, large subunit
                     precursor [Evidence IDA] [PMID 17443350]; GO_component:
                     GO:0030687 - preribosome, large subunit precursor
                     [Evidence IDA] [PMID 23212245]; GO_function: GO:0005525 -
                     GTP binding [Evidence IEA,IEA]; GO_function: GO:0005525 -
                     GTP binding [Evidence ISS] [PMID 11112701]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:1902626 - assembly of large subunit
                     precursor of preribosome [Evidence IMP] [PMID 22735702];
                     GO_process: GO:0006364 - rRNA processing [Evidence IMP]
                     [PMID 12773575]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IDA] [PMID 16888624];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IMP] [PMID 17443350]; GO_process:
                     GO:0000054 - ribosomal subunit export from nucleus
                     [Evidence IMP,IPI] [PMID 12773575]; GO_process: GO:0042254
                     - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Nog1p"
                     /protein_id="XP_018734437.1"
                     /db_xref="GeneID:30033719"
                     /translation="MQLTWKDIPTIPNANEFLDVVLNRTQRKTPTVIRAGFKITRIRA
                     FYMRKVRYTADGFSEKLQQIVDSFPNINEIHPFHRDLLDTLYEKNHYKVSLAAVSRAK
                     SLVEQVSRDYVRLLKFGQSLFQCKQLKRAAMGRMATIVKRLKDALLYLEQVRQHLGRL
                     PSIDPNTRTLLICGYPNVGKSSFLKSITRADVEVQPYAFTTKSLYVGHFDYKYLRFQA
                     IDTPGILDRPTEEMNNIEMQSIYAIAHIRSCVLYFMDLSEQCGFSVADQVKLFHSIKP
                     LFANKSVMVVINKIDLVKPQDLDEEKQALLKSMTATDGSMTVEILQASCHTEEGIMDV
                     RNKACDKLLTARIEQKMKSSSRINSILNKIHVARPSPRDDVPVARDPFVPAGALERAT
                     SYDPEDPNRRRLQKDIEIENGGAGVFQPDYKDAYILEDEAWKHDIIPELLDGKNVYDF
                     IDPEISAKLQALEEEEEKLEQQGFYDSDDDDMDNSEDEEIAAKAEWIRNKHKLMLNAA
                     RSKRTIKNRGGVIPRKLAKRTLSQMETHFDNIGVDASAVSTRARALAARAETATGQDV
                     VMNQQEGPVIDTARIPKRDQSDRRYDGVGASKRSKAERLAKLDQRDRNRAARAGEGDR
                     HTTASIPKHLFSGKRGMGKTQRR"
     gene            <591808..>592320
                     /locus_tag="AWJ20_188"
                     /db_xref="GeneID:30033730"
     mRNA            <591808..>592320
                     /locus_tag="AWJ20_188"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878792.1"
                     /db_xref="GeneID:30033730"
     CDS             591808..592320
                     /locus_tag="AWJ20_188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734438.1"
                     /db_xref="GeneID:30033730"
                     /translation="MSINWVTVENGSPLELPGERFQFQKFGAAIELWHPRPVPGQTAT
                     TRISSNRGTIYVSNKRVVFHPQSPHNFTVVGRGDREFRSFACDLAKMYQCQLVQPWFG
                     ANYWQADIVPTKVNGGLEPDSDLWKLKIVFKEGGVFDFTEAVSKAQAEARHLQQDGLD
                     EALPAYSELS"
     gene            complement(<592836..>594251)
                     /gene="CMR3"
                     /locus_tag="AWJ20_189"
                     /db_xref="GeneID:30033741"
     mRNA            complement(<592836..>594251)
                     /gene="CMR3"
                     /locus_tag="AWJ20_189"
                     /product="Cmr3p"
                     /transcript_id="XM_018878803.1"
                     /db_xref="GeneID:30033741"
     CDS             complement(592836..594251)
                     /gene="CMR3"
                     /locus_tag="AWJ20_189"
                     /note="Putative zinc finger protein; YPR013C is not an
                     essential gene; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0003677
                     - DNA binding [Evidence IDA] [PMID 23012409]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA,IEA];
                     GO_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19111667]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 19158363]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Cmr3p"
                     /protein_id="XP_018734439.1"
                     /db_xref="GeneID:30033741"
                     /translation="MIAASLQEMPVGNSRYSSEGYNNYQVSAAAAGGNNNGHQAGMLM
                     GGGTGGAVTGMTTTTHNSSNHSSPTTTNSSMSSYPMPQLHQSSNGIPKLEPQSASVGY
                     SQSTTTADHAAASAAAAAAANSDPNYYYYSSQQHQQQQAHLGRLSTESLDHLGQSYSR
                     NQSIPSLPPPSYNRPMSSLPSVSGGVDESTQQAVSASSDSNNISRTSQGLHTHDHNTP
                     SPTQHQQPSLQHQQSLLPQQQQQQHQQPLQQQQQPQQQIPTTQQQQQFHQTAMSGIPQ
                     PQLPALYQQPYPPLYQQPQQPQPGSSTGGYGDLTPQQQRSLSIGQPMTQPIGHPLSHH
                     PMYMQQQPPIPGGTGTAPLPNLSSIPLGAYTTNASGQVVSTTPGPTNIIPGPAGTGTT
                     SGPPSHLMTTFNSKISLRSLKKHACSVCGKRFTRPSSLQTHMYSHTGEKPFKCEYEGC
                     GRSFSVVSNLRRHKKIHGIYP"
     gene            <599111..>600202
                     /locus_tag="AWJ20_190"
                     /db_xref="GeneID:30033753"
     mRNA            <599111..>600202
                     /locus_tag="AWJ20_190"
                     /product="histone N-acetyltransferase (predicted)"
                     /transcript_id="XM_018878814.1"
                     /db_xref="GeneID:30033753"
     CDS             599111..600202
                     /locus_tag="AWJ20_190"
                     /codon_start=1
                     /product="histone N-acetyltransferase (predicted)"
                     /protein_id="XP_018734440.1"
                     /db_xref="GeneID:30033753"
                     /translation="MTLNLESVTSDAADADSAAAAVTAAVTGPVTSVTPVTPVTPVRA
                     DLPTKGSTDIQSDPESGFSAAAAAAAAAATSAADTNTGAEVDAETEAGGDTGTDSNPK
                     SNDKLSPKIISETNAKSNVNSSLQTSSRATSTTDPITPLPLPVTDHLNGGQNGDAGPA
                     AVNPNGGTASQTPATAAAAAAELISAQLLTNEDFIACYNMVRKLRGLYIASGLGWNAK
                     DKKAEMRYTPGMQFLVIRSPATSTPITSSPVTPNTDTAPAVTAFASFVLDDHLNEDGT
                     GDRVTYLYELHVSPTNQGSGYGRQLINEIRRLSTLKTGSPLPIALTVINANHKARAFY
                     RHLGFTPIANDDEPPAKRSRTGWHQLRLE"
     gene            <607793..>608863
                     /gene="MNN9"
                     /locus_tag="AWJ20_191"
                     /db_xref="GeneID:30033763"
     mRNA            <607793..>608863
                     /gene="MNN9"
                     /locus_tag="AWJ20_191"
                     /product="mannosyltransferase complex subunit MNN9"
                     /transcript_id="XM_018878823.1"
                     /db_xref="GeneID:30033763"
     CDS             607793..608863
                     /gene="MNN9"
                     /locus_tag="AWJ20_191"
                     /inference="similar to AA sequence:KEGG_Orthology:K05529"
                     /note="Subunit of Golgi mannosyltransferase complex; this
                     complex mediates elongation of the polysaccharide mannan
                     backbone; forms a separate complex with Van1p that is also
                     involved in backbone elongation; this complex also
                     contains Anp1p, Mnn10p, Mnn11p, and Hoc1p; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component:
                     GO:0000139 - Golgi membrane [Evidence IEA]; GO_component:
                     GO:0000136 - alpha-1,6-mannosyltransferase complex
                     [Evidence IPI] [PMID 9430634]; GO_component: GO:0005801 -
                     cis-Golgi network [Evidence IDA] [PMID 9430634];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0000009 - alpha-1,6-mannosyltransferase
                     activity [Evidence IDA] [PMID 19249370]; GO_function:
                     GO:0000009 - alpha-1,6-mannosyltransferase activity
                     [Evidence IDA] [PMID 9430634]; GO_process: GO:0006487 -
                     protein N-linked glycosylation [Evidence IDA] [PMID
                     19249370]; GO_process: GO:0006487 - protein N-linked
                     glycosylation [Evidence IDA] [PMID 9430634]; GO_process:
                     GO:0006486 - protein glycosylation [Evidence IEA]"
                     /codon_start=1
                     /product="mannosyltransferase complex subunit MNN9"
                     /protein_id="XP_018734441.1"
                     /db_xref="GeneID:30033763"
                     /translation="MATVGPVRRPASVLIIVISLLAVVYLLFSPFSQPSTSVSAIPRV
                     IQQNNAGKGTTAEKYIKNHKMNSLAATAKSADNNEKVLILTPLARFYPEYWENLLKLT
                     YPRKLVELGFIVPRSSQGDEVLKSLNKAVNKVQSSSKKDERFAKITILRQDTESLDSQ
                     SEKDRHALSVQKKRRAQMSLARNSLLFTTIDADTSWVLWLDSDIVESPPTLIQDLARH
                     DKDLIVANCFQRYTTDDGKPDIRPYDFNSWQESDTARELMSKMGDDEIILEGYAEMAT
                     YRVLMAHIYNAKDDIHTELPLDGVGGTALLVKADVHRDGAMFPPFPFYHLMETEGFAK
                     MAKRLGYQAFGLPNYLVYHYNE"
     gene            <610869..>611369
                     /gene="EMP24"
                     /locus_tag="AWJ20_192"
                     /db_xref="GeneID:30033774"
     mRNA            <610869..>611369
                     /gene="EMP24"
                     /locus_tag="AWJ20_192"
                     /product="Emp24p"
                     /transcript_id="XM_018878834.1"
                     /db_xref="GeneID:30033774"
     CDS             610869..611369
                     /gene="EMP24"
                     /locus_tag="AWJ20_192"
                     /note="Component of the p24 complex; role in misfolded
                     protein quality control; binds to GPI anchor proteins and
                     mediates their efficient transport from the ER to the
                     Golgi; integral membrane protein that associates with
                     endoplasmic reticulum-derived COPII-coated vesicles;
                     GO_component: GO:0030134 - ER to Golgi transport vesicle
                     [Evidence IDA] [PMID 11157978]; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IEA]; GO_component: GO:0000139 -
                     Golgi membrane [Evidence IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     8862519]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISS] [PMID 8862519]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006888 -
                     ER to Golgi vesicle-mediated transport [Evidence IPI]
                     [PMID 11157978]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IMP] [PMID 8862519];
                     GO_process: GO:0006621 - protein retention in ER lumen
                     [Evidence IMP] [PMID 8862519]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0016050 -
                     vesicle organization [Evidence IGI,IMP] [PMID 8862519];
                     GO_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Emp24p"
                     /protein_id="XP_018734442.1"
                     /db_xref="GeneID:30033774"
                     /translation="MRKGDQLAISFQVGDRDPSSSNQLEVDFWITDPHKNQIRSLHRV
                     ADGDASVEITESGRYEYCFSNEFSHVGTKDVTFHIHGIVYVDNDNPSPDSLDSQVKIL
                     SRLVQEVKNEQGYLVIRERTHRNTAESTNSRVKWWSLFQIIVVAVNSLFQIYYLKRFF
                     EVKTNV"
     gene            complement(<619707..>621299)
                     /gene="THI73"
                     /locus_tag="AWJ20_193"
                     /db_xref="GeneID:30033785"
     mRNA            complement(<619707..>621299)
                     /gene="THI73"
                     /locus_tag="AWJ20_193"
                     /product="Thi73p"
                     /transcript_id="XM_018878845.1"
                     /db_xref="GeneID:30033785"
     CDS             complement(619707..621299)
                     /gene="THI73"
                     /locus_tag="AWJ20_193"
                     /note="Putative plasma membrane permease; proposed to be
                     involved in carboxylic acid uptake and repressed by
                     thiamine; substrate of Dbf2p/Mob1p kinase; transcription
                     is altered if mitochondrial dysfunction occurs;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IDA] [PMID 16850348]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISS] [PMID 10869563];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_function: GO:0005215 -
                     transporter activity [Evidence ISS] [PMID 10869563];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence ISS] [PMID
                     10869563]"
                     /codon_start=1
                     /product="Thi73p"
                     /protein_id="XP_018734443.1"
                     /db_xref="GeneID:30033785"
                     /translation="MSSKGIQVETVEDVEAHRIETIDGTAPPAGVDKALRVLKAADGP
                     VHISDEDDKRLLRKIDLHILPIMLFGYMLQQLDKSSLSYTSVFGLAKDANLKGNEYSN
                     LGSAIYWLQVAAQPTTAYALVKLPPAKFMGINILCWGVVLCCSAIAKNYTGLLICRIL
                     MGAFEATIAPTYVALVAMWWRRAEQSNRNAAWYCMNGVAAMFGSLIAYGLGHIQSKLH
                     SYQIIFLFTGCLTIVFSIVILLFLPDSPLTARFLTEQERIMVIERLRHNQMGIETNVW
                     KWEQVLETALDLKTYVWMLLLFCVSVVSGGISTFGPLIIQEFGFTSFQTILLNIPSGF
                     VQIMIVLIAGFVATRMKLKSPILMFAILGSLVGCIMIRFIDRTPSHRGVLLFAYYLLQ
                     FFTAITPMTYSWATQNTAGETKKKCTNAAIFLGQYAGNIVGPLLYSSKQAPLYRTGLT
                     INMCMFAALVGLIVMAVLTLKVLNRKHAATRVSMGKSAQINDLSMAVHNYNVDDAGEA
                     YDVDNAFRDLTDKKNEDFIYVF"
     gene            <625900..>628782
                     /gene="EPL1"
                     /locus_tag="AWJ20_194"
                     /db_xref="GeneID:30033796"
     mRNA            <625900..>628782
                     /gene="EPL1"
                     /locus_tag="AWJ20_194"
                     /product="Epl1p"
                     /transcript_id="XM_018878856.1"
                     /db_xref="GeneID:30033796"
     CDS             625900..628782
                     /gene="EPL1"
                     /locus_tag="AWJ20_194"
                     /inference="similar to AA sequence:KEGG_Orthology:K11322"
                     /note="Subunit of NuA4, an essential histone H4/H2A
                     acetyltransferase complex; conserved region at N-terminus
                     is essential for interaction with the NPC (nucleosome core
                     particle); required for autophagy; homologous to
                     Drosophila Enhancer of Polycomb; coding sequence contains
                     length polymorphisms in different strains; GO_component:
                     GO:0035267 - NuA4 histone acetyltransferase complex
                     [Evidence IEA]; GO_component: GO:0035267 - NuA4 histone
                     acetyltransferase complex [Evidence IDA] [PMID 10911987];
                     GO_component: GO:0035267 - NuA4 histone acetyltransferase
                     complex [Evidence IPI] [PMID 15485911]; GO_component:
                     GO:0032777 - Piccolo NuA4 histone acetyltransferase
                     complex [Evidence IEA]; GO_component: GO:0032777 - Piccolo
                     NuA4 histone acetyltransferase complex [Evidence IDA]
                     [PMID 12782659]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_function: GO:0004402 - histone
                     acetyltransferase activity [Evidence IDA] [PMID 10911987];
                     GO_function: GO:0004402 - histone acetyltransferase
                     activity [Evidence IDA] [PMID 17274630]; GO_process:
                     GO:0006281 - DNA repair [Evidence IEA]; GO_process:
                     GO:0006281 - DNA repair [Evidence IDA] [PMID 15610740];
                     GO_process: GO:0006281 - DNA repair [Evidence IDA] [PMID
                     16135807]; GO_process: GO:0007049 - cell cycle [Evidence
                     IEA]; GO_process: GO:0006974 - cellular response to DNA
                     damage stimulus [Evidence IEA]; GO_process: GO:0016573 -
                     histone acetylation [Evidence IDA] [PMID 10911987];
                     GO_process: GO:0016239 - positive regulation of
                     macroautophagy [Evidence IMP] [PMID 22539722]; GO_process:
                     GO:0006357 - regulation of transcription from RNA
                     polymerase II promoter [Evidence IDA] [PMID 10911987];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Epl1p"
                     /protein_id="XP_018734444.1"
                     /db_xref="GeneID:30033796"
                     /translation="MPTSTPAARFRQRKISVKQTLAVVKQTDIPDLEDEQQRELQQIE
                     TGVEKAEESEHHLKEVMNAHAAATSGAKVAQVYIPTPDASKKWSEFAKFYKGKFTPPA
                     VYIRTSATVEDTEGCPYSMDEEDDAFLQKMNEEAIAESKKASSTGSDSKASSPNICTP
                     DEFEMICHKFESVVSEKQPFLSTAPNSLLSLEELSETIIEQITQAENDPSSPEFLLRN
                     MSASALASPGAGMYTPLYRKGPRPLVKSFQLFSAKIYPHYRERKIARGGKSVFPTLKF
                     EDNSEKDDSDPYVCFRRREVRQVRKTRRTDMQSSERLRRLQAEMEAARELVELVVKRE
                     QLRKEALMSELNIFEHRVKVKTLKRTLGIKGDDEDLVAHKKKKVEEKKVGKDGKPLRK
                     STGTGLGGEKGSSAAAVAAANASTGSGAGTTGSSKAGSGTGSSSAPATVIIGPDGVIT
                     STAPNGVNQVVPPNVRLPASKIPDMDLLSIEQVLREKEMAIRNAVKSKLKTRAQQDRE
                     WVNYTDNPFVPYCDYFDPGLERQMSEHGRIMDAKHSAYSSIASSYPPSTDMLLKLPLA
                     ASLGSSYSSRVEVSPVVMRTALNPETGDLELIAKAGEKDMNASGSFQVPRFSSTSLRK
                     RIGRGGRIMVDRRGLVARPVSLNDDVLDKNTDDVEGQRLVDRYKYDSENHADNMEFAC
                     SDPCRLNGISDATQSIRFGGMLLSKAYETYREAYQQRQQQLLNLQQKLIQQQQLQLQQ
                     QQQQRQQQIQQRQQQRLQQQQAQQAQQQAQQQQQQQQGANLTPEQIQLRQRQLQQMQQ
                     QMQQQQLNGGGAVTGASANGASQATGQPQSQAQFQASQAQLAAAAAAAGRTTPLIRPP
                     PSATMGVNGVPKLPPTTQAGGQQLTPQQQQQANIALLKQQQAAKLAAQQRTQAQIQAQ
                     AQAQQAKSAPTPPPRSPSTNSPSSSTASATPTPNRVVPVRKVEANV"
     gene            <630824..>631774
                     /gene="CAM1"
                     /locus_tag="AWJ20_195"
                     /db_xref="GeneID:30033807"
     mRNA            <630824..>631774
                     /gene="CAM1"
                     /locus_tag="AWJ20_195"
                     /product="Cam1p"
                     /transcript_id="XM_018878867.1"
                     /db_xref="GeneID:30033807"
     CDS             630824..631774
                     /gene="CAM1"
                     /locus_tag="AWJ20_195"
                     /inference="similar to AA sequence:KEGG_Orthology:K03233"
                     /note="Nuclear protein required for transcription of MXR1;
                     binds the MXR1 promoter in the presence of other nuclear
                     factors; binds calcium and phospholipids; has similarity
                     to translational cofactor EF-1 gamma; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005853 - eukaryotic translation elongation factor 1
                     complex [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 12824466]; GO_function: GO:0005509 -
                     calcium ion binding [Evidence IDA] [PMID 8465602];
                     GO_function: GO:0005543 - phospholipid binding [Evidence
                     IDA] [PMID 8465602]; GO_function: GO:0003713 -
                     transcription coactivator activity [Evidence IMP] [PMID
                     12824466]; GO_function: GO:0003746 - translation
                     elongation factor activity [Evidence IEA,IEA]; GO_process:
                     GO:0045944 - positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 12824466];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IGI] [PMID 8041634]; GO_process: GO:0006412 - translation
                     [Evidence IEA]; GO_process: GO:0006414 - translational
                     elongation [Evidence IEA,IEA,IEA]"
                     /codon_start=1
                     /product="Cam1p"
                     /protein_id="XP_018734445.1"
                     /db_xref="GeneID:30033807"
                     /translation="MSFVNAHIIVSAAAAFRPLLGIDPYNKKNVDTALENLASFTAIL
                     ESHLVKNTYLVGERVTVADIYAAGGIVSAFKNLFGAEWRKSHPAITRWFTTLLHTPYY
                     AKDYANFEFIAEPVKYTPPKKEEKPKQEKKKEEAKPKAAADDEEDEAPKEKKAAHPLA
                     ALGNPKVPIDNWKRVYSNEDTREKALPWFFENYDAADYSLWKVAYKYNDELTLTFMSN
                     NLIGGFFNRLSASTKYLFGAAVVYGENNNNGIVGAFLVRGQDYAPAFDVAPDWESYEY
                     TKLDISKPEDKELLGDLWAWDKPLVINGEKREIADGKVFK"
     gene            complement(<632487..>634517)
                     /locus_tag="AWJ20_196"
                     /db_xref="GeneID:30033818"
     mRNA            complement(<632487..>634517)
                     /locus_tag="AWJ20_196"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878878.1"
                     /db_xref="GeneID:30033818"
     CDS             complement(632487..634517)
                     /locus_tag="AWJ20_196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734446.1"
                     /db_xref="GeneID:30033818"
                     /translation="MDIVDQAPCKYFQKGNCKFGLKCALAHITPDGRRVNRPSQNQHS
                     HQHQNQNQNQNHSQNQNQGQNHNQNQNQSQNLGQNQSHGQNQAVNGSLASNGSVHGQH
                     HQQHQQTQHQQSQPLALSQTQQQQQQQQQQQQLLQNSVHTQSPLSQAVSSSPGAAAFG
                     SSASSSFHNRTWSYSHSNSGTSIPTTSGLSLALGSHNSTNNSSSTGLASGLASGLNSS
                     LNSGLNSGLSSGLGSGSLGNGSAGNNSYSFGLATGSLISAASSAIPPSSPYSKSANPF
                     STTLGTSSGGGGAIPGGGMAAASYSNHINSMLGNNTPNSNINSATNNSLRSMSASSTT
                     LWTDRPFIRSLRTSSFLFADNDSAIADDFEDHPAYRNIHGNSVSAIDDDDEEEDDNEG
                     QKAGKKDNDANDVNEKAEDDDDEDARTIYDRRYSNNHDDDEAIADDDPFEEEFVPSSL
                     KDLLTPRERKRRGSRVASSSGSAIASAAPGTPSSTGITGTTSTTSNVLLTPTGTSASI
                     AATQPIASSLSQSHKAIDIWASPRYPRQSFSESTGSPLKVLQPIGTPERTSHFQTPLG
                     SVSSSIGDVASASLSRSLHQSYQSHMLSPPPPRRDHTPVLTGLAGLPNQSNNPGYPSS
                     SSTSTATAGPATAGSSSLFDDDLEDTQFVMEQEDERLDHHSTRLQNLRLMDP"
     gene            complement(<637237..>640779)
                     /gene="LTE1"
                     /locus_tag="AWJ20_197"
                     /db_xref="GeneID:30033829"
     mRNA            complement(<637237..>640779)
                     /gene="LTE1"
                     /locus_tag="AWJ20_197"
                     /product="mitotic regulator LTE1"
                     /transcript_id="XM_018878889.1"
                     /db_xref="GeneID:30033829"
     CDS             complement(637237..640779)
                     /gene="LTE1"
                     /locus_tag="AWJ20_197"
                     /inference="similar to AA sequence:KEGG_Orthology:K06681"
                     /codon_start=1
                     /product="mitotic regulator LTE1"
                     /protein_id="XP_018734447.1"
                     /db_xref="GeneID:30033829"
                     /translation="MSEDEDPYSSSPIVASRRHGSRDLVDGGNAMSPLQTPKKTPNKR
                     SSDNETGYLASPFSVRNHATGNYRSGENHGKSSNIELPFVFDKFPMHMFDDISFIPGR
                     DDARISRFNETTKSLVSATIPRLVVQLTSHDVLDYNFMSDFFLSYRIFMSSDELLECL
                     FTRLIWAINLHTTKTTSSTASDKQDSEIGRDVSVRVFVVLRHWILNFFPDDFLVSFRL
                     RSKFSSTLNKLYSWNTVQEEVQFKRIVEQLKKAWIRVCCMYWQLGSPLNNSNFDVSLP
                     IFPGGTYGQINASRKHSTSTHQDKSTAIRRSTLLSFYKGPIRPAISNSDLKGADGISS
                     DQTAQDTMSAMLNIDKTLRNGALVNGGIILSADVEVKSIKPPTPVRVVQKNHEERGNE
                     GDCERKPANLTIPPPNYKPTLKSVMDSWRVKYKSSNRVLSLFSNIMAPRKPAVVEADS
                     RESSKSFSDIRIDILSARVIEELDYFLKIKSEKQLGHGLGLMRNTRLAAKQSVTNQGE
                     QVTSPSKVHRLSSSSESPTKRQRVHDRESVDLYSVSDTQDDERDQSSGILGDRFPIDK
                     FVNQSLSSKRTSMIDSLRIQDRLGNTSSSSIALSDHFQETDEPFEFSDSLSSLTSSGG
                     EGSLLSFDSYDSALSNQTVMATDKSAAELDENQLGLRRLRRWRNHENLRDITNFRTDG
                     RTSMISGSANISGRVTALRSRNTSHASHGSKTSDKSEKMMLPYSGVDSEVAARLAAIP
                     DDTPDEDAINAALLKLEGKYVRKRKNLSPEDDIFNFERTTAKTNGLIETTPSNTNTNR
                     HTNTNSQILHAPIITHSESEFGNKITIQYTESHNSNLFKAAFESKADIAALASSPSPS
                     TQSPVFSTPTRHQPFANSTPKERISRDQSQTQTQQDRSTVFSIPYSPEHPLSVSNIVT
                     QGNHTPFILNFGSDELCAQFTLIERDALAEIDWKDLIEMRWTRTVVPIQSWLEFLVER
                     DSRGVELVIARFNLMVNWIKSEILLTRQLDERAQTISRFIHIGHQARTLQNFATVMQI
                     VLALQSAVISKLKTTWEHVTENDRELLRQMTELTSPLKNFSKLRSQLNQLEPTKGCVP
                     FVGMYLSDLTFNAERPSFVDTDADHGTDNSTKLVNFDKFQTASSVVKSLLQCIEWSTN
                     YKLHPDHDLVAKCLYIQSLTVEEMDMCLDHLIDP"
     gene            complement(<643165..>644724)
                     /locus_tag="AWJ20_198"
                     /db_xref="GeneID:30033840"
     mRNA            complement(<643165..>644724)
                     /locus_tag="AWJ20_198"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878900.1"
                     /db_xref="GeneID:30033840"
     CDS             complement(643165..644724)
                     /locus_tag="AWJ20_198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734448.1"
                     /db_xref="GeneID:30033840"
                     /translation="MAKRVEALDEVVDGVLNPPPDRNKRKIILNAFVMNTPTHHNFGQ
                     WRNPADKTPLSDQDWNTIDYWVNIAKVCEKGKFHALFIADTLGAYDIYNGPDNFKPSV
                     RSGAQFPVNDPLLLVPALSYATESIGFGVTASTTYDHPYELARRFSTADHLSNGRVGW
                     NIVTSYLESAAKNHGLHTQVEHDERYQIADEYLEVVYKLWEGSWHDKAVTKDVERNVY
                     ADPEKVRAINHKGKYFKVPGPHITAPSKQRTPFLFQAGLSVAGKNFGAKHAEGIFVTG
                     DTPALVRKSVDDLRKKAQALGRDPYSLKTILGITVITAATDEEAQAKADEYTKYIDKE
                     AILVFISGGSGFDLGPYSDDFDLRDSENLGLANYIKKKAIGLNQENEKWTKWKLAESY
                     GLGNGSPVIIGGPETVTDKLLDWVDEGDVDGFNLKNLLLPGSYEDFIEYVVPELQKRN
                     RFWTDYDVPKGSIRENVYGTPGNSKLRHDHPAYVKYNWETGTAFHANGTELTHKSEGG
                     DLKRKYEDVEE"
     gene            <646449..>649100
                     /gene="BUD6"
                     /locus_tag="AWJ20_199"
                     /db_xref="GeneID:30033851"
     mRNA            <646449..>649100
                     /gene="BUD6"
                     /locus_tag="AWJ20_199"
                     /product="Bud6p"
                     /transcript_id="XM_018878911.1"
                     /db_xref="GeneID:30033851"
     CDS             646449..649100
                     /gene="BUD6"
                     /locus_tag="AWJ20_199"
                     /note="Actin- and formin-interacting protein; participates
                     in actin cable assembly and organization as a
                     nucleation-promoting factor (NPF) for formins Bni1p and
                     Bnr1p; a triple helical coiled-coil domain in the
                     C-terminal region interacts with Bni1p; involved in
                     polarized cell growth; isolated as bipolar budding mutant;
                     potential Cdc28p substrate; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IDA] [PMID 11071900];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 23671312]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 9247651]; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     11071900]; GO_component: GO:0005934 - cellular bud tip
                     [Evidence IDA] [PMID 23671312]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 9247651];
                     GO_component: GO:0000131 - incipient cellular bud site
                     [Evidence IDA] [PMID 11071900]; GO_component: GO:0000131 -
                     incipient cellular bud site [Evidence IDA] [PMID 9247651];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 9082982];
                     GO_component: GO:0000133 - polarisome [Evidence IDA] [PMID
                     9632790]; GO_component: GO:0005628 - prospore membrane
                     [Evidence IDA] [PMID 24390141]; GO_component: GO:0005816 -
                     spindle pole body [Evidence IDA] [PMID 17416900];
                     GO_function: GO:0003779 - actin binding [Evidence IDA]
                     [PMID 7719850]; GO_function: GO:0003779 - actin binding
                     [Evidence IDA] [PMID 9247651]; GO_function: GO:0005519 -
                     cytoskeletal regulatory protein binding [Evidence IPI]
                     [PMID 15923184]; GO_function: GO:0005519 - cytoskeletal
                     regulatory protein binding [Evidence IDA] [PMID 9082982];
                     GO_function: GO:0008047 - enzyme activator activity
                     [Evidence IMP] [PMID 23671312]; GO_process: GO:0051017 -
                     actin filament bundle assembly [Evidence IGI,IMP] [PMID
                     23671312]; GO_process: GO:0030953 - astral microtubule
                     organization [Evidence IMP] [PMID 22608510]; GO_process:
                     GO:0007121 - bipolar cellular bud site selection [Evidence
                     IMP] [PMID 8657162]; GO_process: GO:0007121 - bipolar
                     cellular bud site selection [Evidence IMP] [PMID 9247651];
                     GO_process: GO:0007118 - budding cell apical bud growth
                     [Evidence IGI,IMP] [PMID 10866679]; GO_process: GO:0030010
                     - establishment of cell polarity [Evidence IMP] [PMID
                     9247651]; GO_process: GO:0034652 - extrachromosomal
                     circular DNA localization involved in cell aging [Evidence
                     IMP] [PMID 18660802]; GO_process: GO:2000251 - positive
                     regulation of actin cytoskeleton reorganization [Evidence
                     IGI,IMP] [PMID 17237521]; GO_process: GO:0090338 -
                     positive regulation of formin-nucleated actin cable
                     assembly [Evidence IDA,IGI] [PMID 14657240]; GO_process:
                     GO:0090338 - positive regulation of formin-nucleated actin
                     cable assembly [Evidence IDA] [PMID 15923184]; GO_process:
                     GO:0007124 - pseudohyphal growth [Evidence IMP] [PMID
                     24603354]; GO_process: GO:0032880 - regulation of protein
                     localization [Evidence IMP] [PMID 10085294]"
                     /codon_start=1
                     /product="Bud6p"
                     /protein_id="XP_018734449.1"
                     /db_xref="GeneID:30033851"
                     /translation="MLRVILEKALSDDASHENLDKYLPDIREIIVTLLQKLKQKQALI
                     RASGSSVGSAPSIPLPTYHHNSTSHPQPPTHGRYQQTHQGPGPQPQQQSQPHSHQHAN
                     PGPPPSPRLQMQGQMSQISAPMKYPTRSESLSSPASPLASTMLPPRHNSVGGHSGAGP
                     RTSSAPDSVKLGGGVPGFQARPPPPPPGGPNGPNGPGPVPGPGGIHIKKNNSRSNLSN
                     ISITASNAPRSDYQRGPPSSSPRKESSNPLATLQRSEALERRASRRFSAYQFAKLTNG
                     PQAAREAVPEMPPLPSDKRSSLLPTTSSHSSSMADYTLSTSVVDKTNDQQHLAATIKD
                     TTPSGELAAQKESPSTQSRISSSPQVNGSQEQFPGTIPVFLQIGHKVKKAMVDPSDIT
                     IASLRLQFIEKFAYSPGSEAFPDIYIQDPKSGIRYELDETSLDEVKKGSVLVSLNIKE
                     MDEVKKHFSEGLAKLAETVNNLHSKIDDNTSAINQLKETKVNSIATTSSQTQSRSETP
                     MSTRPTSKISLKQVEAIRKDVAVLRQVSASSLGGLKDELAGILTKAKALQNTSFLIQQ
                     SGSSRAFMEQCHKKLSAESDSLLTNVDDLQDVIEALRKDVAQRGVRHTPRQLETVAKE
                     LAVAKEDLEKMTEYITNERPSWKKIWERELDVVCEEQQFFKLQEELVADLRDDLSKAE
                     ETFKLVEMCSQEQSKVSGGRRPTQPTILSAPVDGIVHVKDAVLSEVSALQPNHEQRVE
                     AIERAEKMRRKELELRSKGGEFEEELEEFVGENKLKKSGGVEETERRLKLREQKMLEE
                     QRKNDAEAKLIRDQERERRKLERQKERGKREPIPEDDVPLDAVDTANPVVEPEVNTTP
                     PEEHEVVTNATAEHASEPVEASVESLD"
     gene            complement(<649389..>652592)
                     /gene="EST2"
                     /locus_tag="AWJ20_200"
                     /db_xref="GeneID:30033864"
     mRNA            complement(<649389..>652592)
                     /gene="EST2"
                     /locus_tag="AWJ20_200"
                     /product="Est2p"
                     /transcript_id="XM_018878924.1"
                     /db_xref="GeneID:30033864"
     CDS             complement(649389..652592)
                     /gene="EST2"
                     /locus_tag="AWJ20_200"
                     /inference="similar to AA sequence:KEGG_Orthology:K11126"
                     /note="Reverse transcriptase subunit of the telomerase
                     holoenzyme; essential for telomerase core catalytic
                     activity, involved in other aspects of telomerase assembly
                     and function; mutations in human homolog are associated
                     with aplastic anemia; GO_component: GO:0005694 -
                     chromosome [Evidence IEA]; GO_component: GO:0000781 -
                     chromosome, telomeric region [Evidence IEA,IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     12101098]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 12101098]; GO_component: GO:0000333 -
                     telomerase catalytic core complex [Evidence IDA,IPI] [PMID
                     15813705]; GO_component: GO:0005697 - telomerase
                     holoenzyme complex [Evidence IDA,IPI] [PMID 10898986];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0003964 - RNA-directed DNA polymerase
                     activity [Evidence IEA,IEA,IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0016779
                     - nucleotidyltransferase activity [Evidence IEA];
                     GO_function: GO:0003720 - telomerase activity [Evidence
                     IDA] [PMID 15813705]; GO_function: GO:0042162 - telomeric
                     DNA binding [Evidence IDA] [PMID 17656141]; GO_function:
                     GO:0003721 - telomeric template RNA reverse transcriptase
                     activity [Evidence IEA]; GO_function: GO:0003721 -
                     telomeric template RNA reverse transcriptase activity
                     [Evidence TAS] [PMID 11884619]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0006278 - RNA-dependent DNA replication [Evidence IEA];
                     GO_process: GO:0001302 - replicative cell aging [Evidence
                     IGI] [PMID 18627461]; GO_process: GO:0007004 - telomere
                     maintenance via telomerase [Evidence IDA,IMP] [PMID
                     15813705]; GO_process: GO:0007004 - telomere maintenance
                     via telomerase [Evidence IMP] [PMID 8978029]"
                     /codon_start=1
                     /product="Est2p"
                     /protein_id="XP_018734450.1"
                     /db_xref="GeneID:30033864"
                     /translation="MSSGELTALSQVYKSVTPLDQFLETFLDPGQIDELYKPTIGNCD
                     FRKFLESVYVGVDFELNADSPPSYPTSIHAQRFRERYLSYKELISFATRNAYQQSLQY
                     TRTLDISESWKGTFSNVLSHGVTSTLKLSYDYPNATAMMFMQHEWRLLYSRLDSAWLY
                     YLLTQCSLFYYLEHCESYIQLTGVNVIYKLRDTLRSDGVGKRSSDGDVGAQRPKKKAK
                     TAGESISLVSNPLQSISTAHVLKQGSSRKKPIRTMLTKASKVFISKESCLYGPTPKND
                     VCFGFKRNFCLNRVPFREPGLDTQSPVKSSSDRSLSFHVRYLLALIFPSQYGLEGISK
                     LTGPSETNKWQKLNWKAETLRINNLVQTHLESKKRHKTRLLKTNATGKPVTPSIAHIL
                     QSSLSRHRHLPYAVFMDESFRIEHLKTAGTIDATKVEIEGSNSSALSVPYHRVSKFII
                     LVINYLFPKETFGSDYNWSLLYKKIGQYVRQRTSEKLSLLVYFEGFRIKDIPWLAPAN
                     GTGATSLARPDFEKRQDLFLEFLLWTFDSLIPNLVKANFYVSEISGQTSVSYYRQDVW
                     KIIYHKTVTRYIQEKLHCAPSDAHIQVAHRPYTGYSGLRIVPKPTGFRVIITLGKAPT
                     EGTAVLKSVNSYLSILKKVLDSSRILYHKTLPSHLSNPNEMFERLASFYKNCESPMKD
                     NSSFYFVKADITRCFDTIPVSKAFEIAKSIIKGEHFWLQKVQSYNLRIKGRYKYREEL
                     IARDLSAPMSFQANVSNAYCRKSSARSRILVDRGGDETVPGQKMVDLLEQHLNRCVVR
                     LEENNYWLREGIPQGSCISSLLCDLVYDAFVQKCLPYNEKTSIMFRYVDDFLFVSRAK
                     GEAERFLGLMVKGFSEFGVSINPRKTITNFESALPTEVMRTGHFPFLSHQIDCYTLRP
                     VNKRDFIRQTLVKTPLYRMPKSNISVLTEKIMRIINFRVNAKIIKELQISRLLRKYIS
                     NVCSNIASTVLTYDRICLQRLSAKQSSKPIASLLLDVVVRISSVVGESASSENRHGKN
                     FTELEILKSCLQGFNKVFRNKPRYASILDDLYRTLKI"
     gene            <652819..>653895
                     /gene="SFH1"
                     /locus_tag="AWJ20_201"
                     /db_xref="GeneID:30033875"
     mRNA            <652819..>653895
                     /gene="SFH1"
                     /locus_tag="AWJ20_201"
                     /product="Sfh1p"
                     /transcript_id="XM_018878935.1"
                     /db_xref="GeneID:30033875"
     CDS             652819..653895
                     /gene="SFH1"
                     /locus_tag="AWJ20_201"
                     /inference="similar to AA sequence:KEGG_Orthology:K11770"
                     /note="Component of the RSC chromatin remodeling complex;
                     essential gene required for cell cycle progression and
                     maintenance of proper ploidy; phosphorylated in the G1
                     phase of the cell cycle; Snf5p paralog; GO_component:
                     GO:0016586 - RSC complex [Evidence IDA] [PMID 10619019];
                     GO_component: GO:0016586 - RSC complex [Evidence IDA]
                     [PMID 12183366]; GO_component: GO:0016586 - RSC complex
                     [Evidence IDA] [PMID 9154831]; GO_component: GO:0000228 -
                     nuclear chromosome [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0015616 - DNA translocase activity [Evidence IDA] [PMID
                     12183366]; GO_function: GO:0015616 - DNA translocase
                     activity [Evidence IDA] [PMID 16455496]; GO_function:
                     GO:0015616 - DNA translocase activity [Evidence IDA] [PMID
                     17188033]; GO_function: GO:0015616 - DNA translocase
                     activity [Evidence IDA] [PMID 17918861]; GO_process:
                     GO:0043044 - ATP-dependent chromatin remodeling [Evidence
                     IDA] [PMID 12183366]; GO_process: GO:0000086 - G2/M
                     transition of mitotic cell cycle [Evidence IMP] [PMID
                     17542652]; GO_process: GO:0000086 - G2/M transition of
                     mitotic cell cycle [Evidence IMP] [PMID 9154831];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0016568 - chromatin modification [Evidence
                     IEA]; GO_process: GO:0006338 - chromatin remodeling
                     [Evidence IEA]; GO_process: GO:0031055 - chromatin
                     remodeling at centromere [Evidence IMP] [PMID 12697820];
                     GO_process: GO:0007059 - chromosome segregation [Evidence
                     IGI] [PMID 12697820]; GO_process: GO:0006302 -
                     double-strand break repair [Evidence IMP] [PMID 16024655];
                     GO_process: GO:0006337 - nucleosome disassembly [Evidence
                     IDA] [PMID 16492771]; GO_process: GO:0033262 - regulation
                     of nuclear cell cycle DNA replication [Evidence IGI] [PMID
                     17542652]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006368 - transcription elongation from RNA polymerase
                     II promoter [Evidence IDA] [PMID 17081996]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Sfh1p"
                     /protein_id="XP_018734451.1"
                     /db_xref="GeneID:30033875"
                     /translation="MAAAKLPQAVQTGFSSRLRLEQTSLFISTQPVVRATKRATANLI
                     SYAEIEEDYDDDDEDPSFGPDGSTGYGSTPAPTSHQQSQSQEPAEPKKVEVKRPAVRT
                     RHPLYTEQQLVDIAQREEILVPIKLALEFDTYRITDFLMWNLNEQVLTPESFAIITCN
                     DLELPVGYTNTISSSIKSQLAEYSSVANIQLPRDCGIHVIIHLSVNLDKELYEDKFEW
                     DLGCDLTPEMFAQSVVKDLGISGEFYPAIAHALHDVLIRMKKEAVEGHLPQEVDNLAA
                     FGAEAGWRVDQELLGAEWAPTLEKLSQEEIERREIERERNIRRLKRESARMGDITDIG
                     GLFGGRSKRRRYDSPSQGGSPAFW"
     gene            <655692..>657173
                     /gene="DSE1"
                     /locus_tag="AWJ20_202"
                     /db_xref="GeneID:30033886"
     mRNA            <655692..>657173
                     /gene="DSE1"
                     /locus_tag="AWJ20_202"
                     /product="Dse1p"
                     /transcript_id="XM_018878946.1"
                     /db_xref="GeneID:30033886"
     CDS             655692..657173
                     /gene="DSE1"
                     /locus_tag="AWJ20_202"
                     /note="Daughter cell-specific protein; may regulate
                     cross-talk between the mating and filamentation pathways;
                     deletion affects cell separation after division and
                     sensitivity to alpha-factor and drugs affecting the cell
                     wall; relocalizes from bud neck to cytoplasm upon DNA
                     replication stress; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IEA]; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0007109 - cytokinesis, completion of
                     separation [Evidence IMP] [PMID 11309124]; GO_process:
                     GO:0001403 - invasive growth in response to glucose
                     limitation [Evidence IMP] [PMID 19820940]; GO_process:
                     GO:0010969 - regulation of pheromone-dependent signal
                     transduction involved in conjugation with cellular fusion
                     [Evidence IMP] [PMID 19820940]"
                     /codon_start=1
                     /product="Dse1p"
                     /protein_id="XP_018734452.1"
                     /db_xref="GeneID:30033886"
                     /translation="MDGPIRVLGDGQVDPGFYNSDDYNSRLDGLKIRQEFEVPAAKQQ
                     LRHVNDVNDYFQPQEPTGEVSVSSHYWKIPDKRQYLTAIATHETDPLVAIASGSRESN
                     LFIYELDKNELDASKSILTHHQTITLAEIHSLAWASPNDPLGQQGNVIFTGHNTGMVH
                     MILLPDPYRSSDPAEIMKRFNHNRHVEGATSTRISQLGLTSGSWTCSAPTSIMSLFNE
                     HLFLWDPSRSDMPIMKKKIRGVSCFDISTLHDGVISVGSSKGISIRDVRAKGSHGLSP
                     PTGNDKKVTQVKWSPFDANIVAAVHDGNTLKVWDVRANAPMLTYHGHSDIINSINWSN
                     TDSNQLWSASDDNTIRMWDIDESQEQQRQVDSISNSVQSVRNNEKDAKWVPTKPWKLY
                     RQRLSRYNESFSLGYFVDPSQGGTLSSTTIFSESKQFLSLASFPNTRHGDQSILSIDN
                     DGFFGLHVKENSNAGSRRGSFGYSDSMDSSDSDIGSSYSVPTV"
     gene            complement(<657634..>658689)
                     /gene="EAF3"
                     /locus_tag="AWJ20_203"
                     /db_xref="GeneID:30033896"
     mRNA            complement(<657634..>658689)
                     /gene="EAF3"
                     /locus_tag="AWJ20_203"
                     /product="Eaf3p"
                     /transcript_id="XM_018878955.1"
                     /db_xref="GeneID:30033896"
     CDS             complement(657634..658689)
                     /gene="EAF3"
                     /locus_tag="AWJ20_203"
                     /inference="similar to AA sequence:KEGG_Orthology:K11339"
                     /note="Component of the Rpd3S histone deacetylase complex;
                     Esa1p-associated factor, nonessential component of the
                     NuA4 acetyltransferase complex, homologous to Drosophila
                     dosage compensation protein MSL3; plays a role in
                     regulating Ty1 transposition; GO_component: GO:0035267 -
                     NuA4 histone acetyltransferase complex [Evidence IPI]
                     [PMID 15485911]; GO_component: GO:0032221 - Rpd3S complex
                     [Evidence IDA] [PMID 16286007]; GO_component: GO:0032221 -
                     Rpd3S complex [Evidence IDA] [PMID 16286008];
                     GO_component: GO:0000123 - histone acetyltransferase
                     complex [Evidence IDA] [PMID 11036083]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_function:
                     GO:0004402 - histone acetyltransferase activity [Evidence
                     IDA] [PMID 11036083]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IDA] [PMID 16135807]; GO_process: GO:0006974 -
                     cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0016568 - chromatin modification [Evidence
                     IEA]; GO_process: GO:0016573 - histone acetylation
                     [Evidence IDA] [PMID 11036083]; GO_process: GO:0016575 -
                     histone deacetylation [Evidence IMP] [PMID 16286007];
                     GO_process: GO:0060195 - negative regulation of antisense
                     RNA transcription [Evidence IMP] [PMID 21248844];
                     GO_process: GO:0045892 - negative regulation of
                     transcription, DNA-templated [Evidence IMP] [PMID
                     16364921]; GO_process: GO:0030174 - regulation of
                     DNA-dependent DNA replication initiation [Evidence IMP]
                     [PMID 19417103]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 11036083]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006368 - transcription elongation from RNA
                     polymerase II promoter [Evidence IGI] [PMID 19948887];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Eaf3p"
                     /protein_id="XP_018734453.1"
                     /db_xref="GeneID:30033896"
                     /translation="MTKGPNVLAAGTKCLAFHGPLLYEAKIIKSYNPAVKQAMSRAPP
                     SEGGEKKADISDLPSEFKEKVAYFVHYKGWKSTWDEWIAADRVLQWNEENLRTQKELK
                     QAALAAVNQNKTKKTAASSSSTAGAATNGVSGSLAGETSSKRKDAPKEESGLSFSRSH
                     KRSRPSGQDDLEREEDFIKRLEINIMVPDSLKSLLVDDWEYITKEHQLLSLPQKPNVV
                     EILKKYRDSKPKMRVGSSEAEILDEVISGLKLYFDRSLGNMLLYRFERQQYLEIRKAH
                     PDKEMSELYGAQHLLRLFVSLPNLIALTNMDPQGVSVLKDHLEDCLQFLAKNRDQLFT
                     KAYENTSQRYEAFAKGV"
     gene            <659107..>660621
                     /gene="BNA4"
                     /locus_tag="AWJ20_204"
                     /db_xref="GeneID:30033907"
     mRNA            <659107..>660621
                     /gene="BNA4"
                     /locus_tag="AWJ20_204"
                     /product="kynurenine 3-monooxygenase"
                     /transcript_id="XM_018878966.1"
                     /db_xref="GeneID:30033907"
     CDS             659107..660621
                     /gene="BNA4"
                     /locus_tag="AWJ20_204"
                     /inference="similar to AA sequence:KEGG_Orthology:K00486"
                     /note="Kynurenine 3-mono oxygenase; required for the de
                     novo biosynthesis of NAD from tryptophan via kynurenine;
                     expression regulated by Hst1p; putative therapeutic target
                     for Huntington disease; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005741 - mitochondrial outer membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005741 - mitochondrial outer
                     membrane [Evidence IDA] [PMID 16407407]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0050660 -
                     flavin adenine dinucleotide binding [Evidence IEA];
                     GO_function: GO:0004502 - kynurenine 3-monooxygenase
                     activity [Evidence IEA,IEA,IEA]; GO_function: GO:0004502 -
                     kynurenine 3-monooxygenase activity [Evidence IMP] [PMID
                     15806102]; GO_function: GO:0004497 - monooxygenase
                     activity [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_process:
                     GO:0034354 - 'de novo' NAD biosynthetic process from
                     tryptophan [Evidence IEA]; GO_process: GO:0034354 - 'de
                     novo' NAD biosynthetic process from tryptophan [Evidence
                     IGI] [PMID 12062417]; GO_process: GO:0009435 - NAD
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0043420 - anthranilate metabolic process [Evidence
                     IEA]; GO_process: GO:0008152 - metabolic process [Evidence
                     IEA]; GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]; GO_process: GO:0019363 - pyridine
                     nucleotide biosynthetic process [Evidence IEA];
                     GO_process: GO:0019805 - quinolinate biosynthetic process
                     [Evidence IEA,IEA]; GO_process: GO:0006569 - tryptophan
                     catabolic process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="kynurenine 3-monooxygenase"
                     /protein_id="XP_018734454.1"
                     /db_xref="GeneID:30033907"
                     /translation="MSSNESHTVGIVGAGLVGCLAALAFANEGFKVELFESRPDLRDP
                     DQQVLSQLRSINLAVSARGITALRSVDEEMADRVLKDLVPMHGRMVHDLNGKQICQKY
                     GLYGECINSINRSLLNRSLLDELDKLDNVKVTFNHKLIRLDNLKRSSSDNLENAANSE
                     VVRGHFVGTKTNESLTVENVNVWIGADGSYSQVRSQIQRALQMNFSQEYIDHYYLELR
                     IPAKNETAKSSHFDSTCPEAVEVGTEAKFALNPNHLHIWPRHEYMLIALANSDGSFTC
                     TLFAPKSLFDKELAISASDADVVSFFRTNFPSAIELMGDDLLLESFRKNPRGSLVCVK
                     CSPYNVGGKAIIIGDAAHSMVPFYGQGMNCGFEDVRTLMAILKKHEFDFETGFNEYTE
                     TRRKDLGAIVDLSMRNYQEMRHDVTSTAYLLRKSVDGFLSRVMGDFWLPLYTMVSFRA
                     DIPYSRAVQERQWQNDILTWVIRASVGTSLLAGTALWHGRLFNTLSSLYSRLTR"
     gene            complement(<662932..>665021)
                     /gene="SWC4"
                     /locus_tag="AWJ20_205"
                     /db_xref="GeneID:30033918"
     mRNA            complement(join(<662932..664601,664919..>665021))
                     /gene="SWC4"
                     /locus_tag="AWJ20_205"
                     /product="Swc4p"
                     /transcript_id="XM_018878977.1"
                     /db_xref="GeneID:30033918"
     CDS             complement(join(662932..664601,664919..665021))
                     /gene="SWC4"
                     /locus_tag="AWJ20_205"
                     /inference="similar to AA sequence:KEGG_Orthology:K11324"
                     /note="Component of the Swr1p complex that incorporates
                     Htz1p into chromatin; component of the NuA4 histone
                     acetyltransferase complex; GO_component: GO:0035267 - NuA4
                     histone acetyltransferase complex [Evidence IEA];
                     GO_component: GO:0035267 - NuA4 histone acetyltransferase
                     complex [Evidence IPI] [PMID 15353583]; GO_component:
                     GO:0035267 - NuA4 histone acetyltransferase complex
                     [Evidence IPI] [PMID 15485911]; GO_component: GO:0000812 -
                     Swr1 complex [Evidence IDA] [PMID 14645854]; GO_component:
                     GO:0000812 - Swr1 complex [Evidence IDA] [PMID 14690608];
                     GO_component: GO:0000123 - histone acetyltransferase
                     complex [Evidence IPI] [PMID 12672825]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14690591]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0003677 - DNA binding [Evidence ISS]
                     [PMID 14690591]; GO_function: GO:0003682 - chromatin
                     binding [Evidence IEA]; GO_process: GO:0006281 - DNA
                     repair [Evidence IEA,IEA]; GO_process: GO:0006281 - DNA
                     repair [Evidence IDA] [PMID 16135807]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IEA]; GO_process: GO:0016568 -
                     chromatin modification [Evidence IPI] [PMID 12672825];
                     GO_process: GO:0006338 - chromatin remodeling [Evidence
                     IEA]; GO_process: GO:0006338 - chromatin remodeling
                     [Evidence IDA] [PMID 14645854]; GO_process: GO:0006338 -
                     chromatin remodeling [Evidence IPI] [PMID 14690608];
                     GO_process: GO:0051276 - chromosome organization [Evidence
                     IMP] [PMID 18439903]; GO_process: GO:0043968 - histone H2A
                     acetylation [Evidence IEA]; GO_process: GO:0043967 -
                     histone H4 acetylation [Evidence IEA]; GO_process:
                     GO:0016573 - histone acetylation [Evidence IPI] [PMID
                     14690591]; GO_process: GO:0043486 - histone exchange
                     [Evidence IPI] [PMID 16299513]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Swc4p"
                     /protein_id="XP_018734455.1"
                     /db_xref="GeneID:30033918"
                     /translation="MSSDVRDVLNLPSRPAPKPPVAKRQKTESAMKKMGRSTTAANKN
                     RVWSGFKNQAREDGLVLHHWVRGAAHQEDEEYPFAKYSQSIRVPRFDRQDYDEAFADD
                     SWSYDETCYLFGLCKEYDLRWVVIHDRYDFAKDSSNDNEKKDGQNEKAEGEDSDEKKA
                     EKEQGSDVDSSDEADKNESKEDADADAMDVDEEEPENADVKSSDDKESSGKDDDDSSK
                     DAAADKSNDEKKIEKTAEENQEKTGAVAAPDTQASRTIEDLKLRFYGVCRALLKLQQT
                     RSGIALSPAEEDLYKQMKFSKSNELQRKAHLENLLKRSPAEIAEEEALVIESRKLEAA
                     AERMLMERAELLKLLDAPQASGSIAQYQSSQGLAQLTSTLLTTDKTRKRKDATSSVPG
                     SPSHESAEQSPVVDGSVSSVSASASTGPGASNKSSHDTPTKTKSDEKNKGKPSDGSTD
                     KTGQRVKNEKDSEKAASATPSGGADKDKKTGAAAVAQLIQKKLTAKEEAAYGISYHDK
                     LSPGVSLRSSKITTLKATVQAKVSGVLNELGLPSRPTMPTAKVTAKFESLQQSISVLL
                     EAKKQLDKLDTEVRILKTQRETAK"
     gene            <665452..>666810
                     /gene="YTM1"
                     /locus_tag="AWJ20_206"
                     /db_xref="GeneID:30033929"
     mRNA            <665452..>666810
                     /gene="YTM1"
                     /locus_tag="AWJ20_206"
                     /product="Ytm1p"
                     /transcript_id="XM_018878987.1"
                     /db_xref="GeneID:30033929"
     CDS             665452..666810
                     /gene="YTM1"
                     /locus_tag="AWJ20_206"
                     /inference="similar to AA sequence:KEGG_Orthology:K14863"
                     /note="Constituent of 66S pre-ribosomal particles; forms a
                     complex with Nop7p and Erb1p that is required for
                     maturation of the large ribosomal subunit; has seven
                     C-terminal WD repeats; GO_component: GO:0070545 - PeBoW
                     complex [Evidence IDA,IPI] [PMID 16287855]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA,IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 11583614];
                     GO_component: GO:0005654 - nucleoplasm [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IEA]; GO_component: GO:0030687
                     - preribosome, large subunit precursor [Evidence IDA]
                     [PMID 11583614]; GO_component: GO:0030687 - preribosome,
                     large subunit precursor [Evidence IDA] [PMID 17443350];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0043021 - ribonucleoprotein complex
                     binding [Evidence IEA]; GO_process: GO:0051276 -
                     chromosome organization [Evidence IGI] [PMID 10454593];
                     GO_process: GO:0000466 - maturation of 5.8S rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IEA]; GO_process: GO:0000463 -
                     maturation of LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IEA];
                     GO_process: GO:0006364 - rRNA processing [Evidence IEA];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IEA]; GO_process: GO:0042273 -
                     ribosomal large subunit biogenesis [Evidence IMP,IPI]
                     [PMID 11583614]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IPI] [PMID 15100437];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Ytm1p"
                     /protein_id="XP_018734456.1"
                     /db_xref="GeneID:30033929"
                     /translation="MSEGANTRQVQIRLVTRDTELQVPDAPLYVPVSLKRYGLSEVVN
                     QLLDQDTPIPFDFLIDGKLLRSSLDGYLIANGLSNETTITLEYARSILPPSFLASFAH
                     QDWVSAVSISRNKATQKIATGSYDGVVRLWNHSGSVTHQLVGHNAAVKAVQWTDASRL
                     VSGGSDRILYLWKFANNNSNEETHDNDDEDDEDAASGKKGSIVAVLQGHTASVDDLAY
                     NKSTKQIVSASADSTLKVWSSNYKELPAAETLAKSSSTASQKRRRVAAASLTSSRTRG
                     ALSTLTGHSAPVTGVVYHHTDNHVVYSVSQDHTVRTWDTATESLVDTKTTSFPLLSIA
                     SLGPHTGLLACGSSARHITLIDPRTTTTTSQAQLIGHTNFVVSLAPSPDNHYMFCSGS
                     HDGTTRIWDVRAQKSVYVISRESGESPTAVYGVDWDTTVGIASAGQDKKLQINSAAFS
                     KK"
     gene            complement(<667298..>670910)
                     /gene="GFA1"
                     /locus_tag="AWJ20_207"
                     /db_xref="GeneID:30033940"
     mRNA            complement(join(<667298..669304,670842..>670910))
                     /gene="GFA1"
                     /locus_tag="AWJ20_207"
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing) GFA1"
                     /transcript_id="XM_018878997.1"
                     /db_xref="GeneID:30033940"
     CDS             complement(join(667298..669304,670842..670910))
                     /gene="GFA1"
                     /locus_tag="AWJ20_207"
                     /inference="similar to AA sequence:KEGG_Orthology:K00820"
                     /note="Glutamine-fructose-6-phosphate amidotransferase;
                     catalyzes the formation of glucosamine-6-P and glutamate
                     from fructose-6-P and glutamine in the first step of
                     chitin biosynthesis; GFA1 has a paralogous region,
                     comprising ORFs YMR084W-YMR085W, that arose from the whole
                     genome duplication; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0030246
                     - carbohydrate binding [Evidence IEA]; GO_function:
                     GO:0004360 - glutamine-fructose-6-phosphate transaminase
                     (isomerizing) activity [Evidence IEA,IEA]; GO_function:
                     GO:0004360 - glutamine-fructose-6-phosphate transaminase
                     (isomerizing) activity [Evidence IDA] [PMID 2656689];
                     GO_function: GO:0008483 - transaminase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0006048 -
                     UDP-N-acetylglucosamine biosynthetic process [Evidence
                     IEA]; GO_process: GO:0016051 - carbohydrate biosynthetic
                     process [Evidence IEA]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0034221 - fungal-type cell wall chitin biosynthetic
                     process [Evidence IGI] [PMID 11895440]; GO_process:
                     GO:0006541 - glutamine metabolic process [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="glutamine--fructose-6-phosphate transaminase
                     (isomerizing) GFA1"
                     /protein_id="XP_018734457.1"
                     /db_xref="GeneID:30033940"
                     /translation="MDLVTVGLRVRELAIPGARAMEAGLQRQEYRGYDSAGLAVDGDK
                     AGEVEIFRSVGKVKALAEVINNAKINTEKVFDCHAGIAHTRWATHGQPKTVNCHPQRS
                     DPNSEFTVVHNGIITNYREIRELLTSKGFKFESETDTEVIAKFFKYIYDSNKQHNLDF
                     SQLAKLVIIELEGAYGLLIKSIHYQDEVVATRKGSPLLVGVKTEKKLKTDFVDVEFPD
                     TLEELSSVPADANSNINGTANGLLIPKDNLRHSVSRAFMSDEGIPMAAEFFLASDPAA
                     VVEHTKKVLFLEDDDIAHIYDGQLHIHRSSNEVGASTIRSIQTLEMELAEIMKGSFDH
                     FMQKEIFEQPESVINTMRGRVDFETNTITLGGLRSYLTTIRRCRRLIMIACGTSYHSC
                     LATRAIFEELTEIPVSVELASDFLDRRSPVFRDDTVVFVSQSGETADTILALQYCLDR
                     GALTVGIVNSVGSSISRQTHCGVHINAGPEIGVASTKAYTSQYIALVMMALSLSDDSL
                     SKSARRLEIIEGLKNISEQISKVLELNDSIKTMCDETLSDQKSLLLLGRGYQHATALE
                     GALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIVMATRDSLFPKVMSAVQQVVAR
                     SGNPIIICNPGDKFDPKYKTLEVPATVDCLQGLLNVIPLQLMSYWLAVRKGIDVDFPR
                     NLAKSVTVE"
     gene            complement(<674142..>675548)
                     /gene="BSC6"
                     /locus_tag="AWJ20_208"
                     /db_xref="GeneID:30033951"
     mRNA            complement(<674142..>675548)
                     /gene="BSC6"
                     /locus_tag="AWJ20_208"
                     /product="Bsc6p"
                     /transcript_id="XM_018879007.1"
                     /db_xref="GeneID:30033951"
     CDS             complement(674142..675548)
                     /gene="BSC6"
                     /locus_tag="AWJ20_208"
                     /note="hypothetical protein with 8 putative transmembrane
                     segments; ORF exhibits genomic organization compatible
                     with a translational readthrough-dependent mode of
                     expression; GO_component: GO:0030137 - COPI-coated vesicle
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IEA,IEA]; GO_component:
                     GO:0030136 - clathrin-coated vesicle [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Bsc6p"
                     /protein_id="XP_018734458.1"
                     /db_xref="GeneID:30033951"
                     /translation="MAEKINAEEARQKSAGELDYQENKQNNTETLTLSVPPSDPEDHL
                     YDWNYPIRNIFRVAAGYYSFIICGMNDSSIGVLIPTLEPYYGLDYLLVSLAFLAPFIG
                     YSIAALISDKIHRLIGRCGVGIMGASCQVICYIVVCTAPPFPVFVIMYGIAGFGNGSI
                     DSTVNSWVGGLKHSNEALGLLHGCYGLGGTICPAIFTAMIGHGIRWNHCYFLLIGMGA
                     TSILAFASAFWGETAVKYKQEVEKDVTNSMTEERRGDIENSSHDVDTTVGEASNDNKI
                     MLRVVSDRLVWMLSITLFVYLGASVSFGGWISTFMIQVRHGAKDKMGYVTTGFWAGLT
                     VGRMTLGFLVGHFQAEDYFVIFFILVSLASVLIVWLVPVLGVSVAFTIVFGIISGPVF
                     PTIIASALRKLPKYLHVAGVGFCVAVGGGGAALPPFINGVIANKFGPRVLGPYTVILL
                     SLMLVMWLLILKLHPQRN"
     gene            <676215..>676287
                     /locus_tag="AWJ20_209"
                     /db_xref="GeneID:30033962"
     tRNA            <676215..>676287
                     /locus_tag="AWJ20_209"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:30033962"
     gene            <676544..>677500
                     /gene="ABP140"
                     /locus_tag="AWJ20_210"
                     /db_xref="GeneID:30033974"
     mRNA            <676544..>677500
                     /gene="ABP140"
                     /locus_tag="AWJ20_210"
                     /product="Abp140p"
                     /transcript_id="XM_018879027.1"
                     /db_xref="GeneID:30033974"
     CDS             676544..677500
                     /gene="ABP140"
                     /locus_tag="AWJ20_210"
                     /inference="similar to AA sequence:KEGG_Orthology:K17053"
                     /note="AdoMet-dependent tRNA methyltransferase and actin
                     binding protein; C-terminal domain is responsible for
                     3-methylcytidine modification of residue 32 of the tRNA
                     anticodon loop of tRNA-Thr and tRNA-Ser and contains an
                     S-adenosylmethionine (AdoMet) binding motif; N-terminal
                     actin binding sequence interacts with actin filaments and
                     localizes to actin patches and cables; N- and C-terminal
                     domains are encoded in separate ORFs that are translated
                     into one protein via a +1 frameshift; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IDA] [PMID
                     9467951]; GO_component: GO:0005884 - actin filament
                     [Evidence IDA] [PMID 9467951]; GO_component: GO:0032432 -
                     actin filament bundle [Evidence IDA] [PMID 11805329];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005856 - cytoskeleton [Evidence
                     IEA,IEA]; GO_component: GO:0043332 - mating projection tip
                     [Evidence IDA] [PMID 19053807]; GO_function: GO:0003779 -
                     actin binding [Evidence IEA]; GO_function: GO:0051015 -
                     actin filament binding [Evidence IDA] [PMID 9467951];
                     GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA]; GO_function: GO:0030674 - protein binding,
                     bridging [Evidence IDA] [PMID 9467951]; GO_function:
                     GO:0052735 - tRNA (cytosine-3-)-methyltransferase activity
                     [Evidence IDA,IMP] [PMID 21518804]; GO_function:
                     GO:0052735 - tRNA (cytosine-3-)-methyltransferase activity
                     [Evidence IDA] [PMID 21518805]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0051017 - actin filament bundle assembly [Evidence IDA]
                     [PMID 9467951]; GO_process: GO:0032259 - methylation
                     [Evidence IEA]; GO_process: GO:0030488 - tRNA methylation
                     [Evidence IMP] [PMID 21518804]; GO_process: GO:0030488 -
                     tRNA methylation [Evidence IMP] [PMID 21518805]"
                     /codon_start=1
                     /product="Abp140p"
                     /protein_id="XP_018734459.1"
                     /db_xref="GeneID:30033974"
                     /translation="MVEMPETQPEVPGPVDTSVSRLERGDTPFTFGQRNLVDEEQVWN
                     HNAWDNVEWGEEQITEAEEKLVKQREAPVKPFDKKLFMSDPAKYWNQFYRNNRENFFK
                     DRKWLRVEFPSLYEATRHDAGKRVILEVGCGAGNTMFPVLEANENPDLMITGVDFSNQ
                     AVKLVKESKSFDPKHAHAAVWDLAEPSGALPEGIEEHSVDIVVMIFVFSALAPDQWEQ
                     AVRNLKKLLKPDGEILFRDYGRYDLTQLRFKGGRLLDDNFYIRGDGTRVYFFTEEELE
                     QIFGKEFEVAKIAADRRLLVNRLRKLKMYRIWMQARFVNRLE"
     gene            complement(<677531..>678349)
                     /gene="ENV9"
                     /locus_tag="AWJ20_211"
                     /db_xref="GeneID:30033985"
     mRNA            complement(<677531..>678349)
                     /gene="ENV9"
                     /locus_tag="AWJ20_211"
                     /product="Env9p"
                     /transcript_id="XM_018879037.1"
                     /db_xref="GeneID:30033985"
     CDS             complement(677531..678349)
                     /gene="ENV9"
                     /locus_tag="AWJ20_211"
                     /note="Protein proposed to be involved in vacuolar
                     functions; mutant shows defect in CPY processing and
                     defects in vacuolar morphology; has similarity to
                     oxidoreductases, found in lipid particles; required for
                     replication of Brome mosaic virus in S. cerevisiae, a
                     model system for studying replication of positive-strand
                     RNA viruses in their natural hosts; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0005811 - lipid particle [Evidence
                     IEA,IEA]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence ISS] [PMID
                     8972580]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0006624 - vacuolar protein processing [Evidence IMP]
                     [PMID 21912603]; GO_process: GO:0007033 - vacuole
                     organization [Evidence IMP] [PMID 21912603]"
                     /codon_start=1
                     /product="Env9p"
                     /protein_id="XP_018734460.1"
                     /db_xref="GeneID:30033985"
                     /translation="MDRAHWAIRDIQIDAILRKPKLPDRCEFGELKFLRLDLTSLQMV
                     MQSVQNFKKQESSLDLLINNAGVMGLPYAETEDGFEIQTQTDHIGPFLFTIKLISTLR
                     KSKYEPRIVFVSSIGHYMATRKVDLSRSHNHRPNILWTWPRYGNAKTANIHTTIILSE
                     LYPDILSLVVHPGFSLQTGILSYWKDLPYVGAAFSQGFTLFNKVFGVTPEQASYSALQ
                     AAISDRFSLQKGDSGKYLVTYGAEGVASRRACSYTMARQTWQWTANELKSRNFL"
     gene            complement(<680825..>682444)
                     /locus_tag="AWJ20_212"
                     /db_xref="GeneID:30033996"
     mRNA            complement(join(<680825..681416,681564..>682444))
                     /locus_tag="AWJ20_212"
                     /product="Kinesin-like protein"
                     /transcript_id="XM_018879048.1"
                     /db_xref="GeneID:30033996"
     CDS             complement(join(680825..681416,681564..682444))
                     /locus_tag="AWJ20_212"
                     /codon_start=1
                     /product="Kinesin-like protein"
                     /protein_id="XP_018734461.1"
                     /db_xref="GeneID:30033996"
                     /translation="MIHAMAKQQASRSKFLRDVKANEKAIQQQQQLQQQLQQQQYQQQ
                     QLQQHKQRSHQVQPQRHFAQHEELTASLASARGIAPTTGSNTSKATGTAHLASGAKKK
                     LSEEDPFYKFYSSINSVFTKTFNASIEKAKEERLHQVQNHSSALHKNGMSSSGGASES
                     EANSAITSLMLPIKFDNESFYVVPNTNKSSIEELATENANLRQMINRTSIQLHAYETA
                     TKKQKDALKNNLMLLRNEFNSRESARNRQHEEEIEALTSEIDKLKIQIGRMKSRWDDL
                     KESARKRREESVTDDEDKTSNDTCIQEETPAEEPDFDSEAAAEELAEAEEAAAAAEVA
                     SVEVVSAEVVSDAVVVSAADVDNVVPGDVSAAEAALETSALEACAAEVIGEEATEAIE
                     EVVWKLSTAELGKTFTTEPPSEADAPKAPLELLESEDVPLPAEPAPLEPDEEPPEPDP
                     ESEPDPEPDPDVDPEPEVDPDPDPDPEEPEPEDELLPEPQ"
     gene            complement(<683097..>684227)
                     /locus_tag="AWJ20_213"
                     /db_xref="GeneID:30034007"
     mRNA            complement(<683097..>684227)
                     /locus_tag="AWJ20_213"
                     /product="glyoxylate reductase"
                     /transcript_id="XM_018879058.1"
                     /db_xref="GeneID:30034007"
     CDS             complement(683097..684227)
                     /locus_tag="AWJ20_213"
                     /note="Glyoxylate reductase; acts on glyoxylate and
                     hydroxypyruvate substrates; YPL113C is not an essential
                     gene; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0048037 - cofactor binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0016616 -
                     oxidoreductase activity, acting on the CH-OH group of
                     donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_function: GO:0016616 - oxidoreductase activity, acting
                     on the CH-OH group of donors, NAD or NADP as acceptor
                     [Evidence IMP] [PMID 17173333]; GO_process: GO:0008152 -
                     metabolic process [Evidence IMP] [PMID 17173333];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="glyoxylate reductase"
                     /protein_id="XP_018734462.1"
                     /db_xref="GeneID:30034007"
                     /translation="MTASVRPKILLLGVVHFIDKDILKRYESEFELINYDITTKEDLI
                     SKLETEFNDIVAIATVWFSFVPVGGLHDEKLLNALPKTLKVIATPTVGVDLYNLDALT
                     KRGIVLANSAGITSDDVADIALHLSLSAYRFTSLFENSLRTHRNTLSARYVVEDQFDK
                     AAGRASSEDVSAKRKMVYGHLVGNYKVDSPKGQVAGIVGFGSIGRAIAKRLAVLGMKI
                     HYLKRSPLTESEIEELGGTGSTPPFEITRHETFDSLAKVSNLLVLVVPLTSDTRHILN
                     ERTIALLPDAARVVNVGRGPLIDQKALIKALESGKLSSAGLDVYEQEPLIEPALAERH
                     DVTLLPHIGSCTDESAQAALENCFVNIKDVVLGSGKARNSVN"
     gene            complement(<684631..>685875)
                     /locus_tag="AWJ20_214"
                     /db_xref="GeneID:30034018"
     mRNA            complement(<684631..>685875)
                     /locus_tag="AWJ20_214"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879068.1"
                     /db_xref="GeneID:30034018"
     CDS             complement(684631..685875)
                     /locus_tag="AWJ20_214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734463.1"
                     /db_xref="GeneID:30034018"
                     /translation="MSELPDISHVAGVVVSFLKGEGFLGEGYENIEKLIVGMFAVLMS
                     YLARRLYKNYNPFGKDSQHQVRQGRYIAGRYPSAIVPVSRSFDWENENPRKYRPYKPG
                     PYFMTMGLRALDPNDWLLLENTYKDITKARAEIVENHRDNTVLTNPLAIEAVDETYDM
                     FVNYITKKFPKYFYTTRRRPGYIYNAIKKDYIPSTSEQYDKDFEESIPDKKERMDSKI
                     RLLAKHFEEDFLILIYDEKTQQYYLRAGSFAFPSGFNPAEKLNLALKDIHGPVPLYKE
                     KIENAMDRFFHKIEVGKWVQRYNWSIQGHTNLYAPTLNHAKKGAKLKAINPDELDFDK
                     VFLRVERQVLTRLPNTKHLLFTIRTYVTPLSQIREEDRALELVEAIDNLPDNVAHYKK
                     RDEWGPAVKAYLQRESDGIKKK"
     gene            complement(<688654..>689403)
                     /gene="tam14"
                     /locus_tag="AWJ20_215"
                     /db_xref="GeneID:30034029"
     mRNA            complement(<688654..>689403)
                     /gene="tam14"
                     /locus_tag="AWJ20_215"
                     /product="conserved fungal protein"
                     /transcript_id="XM_018879079.1"
                     /db_xref="GeneID:30034029"
     CDS             complement(688654..689403)
                     /gene="tam14"
                     /locus_tag="AWJ20_215"
                     /note="top hit is XP_002839470.1 originated in Tuber
                     melanosporum Mel28"
                     /codon_start=1
                     /product="conserved fungal protein"
                     /protein_id="XP_018734464.1"
                     /db_xref="GeneID:30034029"
                     /translation="MPRKRARNPLKRKQVDFDTAPSVLINPKKVSKKNKAASKPTQNG
                     DDMEDDMPKEFKRLMNWSNKKQGKVAKGTEGEERGRSRTRESTSSVASISNTTPAADL
                     KILPGERMSDFSRRVNEALPLVKARKGSPSRADKRKARKRAKDEANSRKKKDDDDDDD
                     NDEDDEDQKPKKGKREPSPDPWAHLESKKPKFGDVADRPPELNLPTKLLRNVPKSAGS
                     LARRVILEEERDRVIQSYRALMEQKRGGDVL"
     gene            <689818..>691890
                     /gene="NOC3"
                     /locus_tag="AWJ20_216"
                     /db_xref="GeneID:30034040"
     mRNA            <689818..>691890
                     /gene="NOC3"
                     /locus_tag="AWJ20_216"
                     /product="Noc3p"
                     /transcript_id="XM_018879089.1"
                     /db_xref="GeneID:30034040"
     CDS             689818..691890
                     /gene="NOC3"
                     /locus_tag="AWJ20_216"
                     /inference="similar to AA sequence:KEGG_Orthology:K14834"
                     /note="Subunit of a nuclear complex with Noc2p and
                     pre-replicative complexes; the Noc2p-Noc3p complex binds
                     to 66S ribosomal precursors to mediate their maturation
                     and intranuclear transport; binds to chromatin at active
                     replication origins, and is required for pre-RC formation
                     and maintenance during DNA replication licensing;
                     GO_component: GO:0030691 - Noc2p-Noc3p complex [Evidence
                     IPI] [PMID 11371346]; GO_component: GO:0005656 - nuclear
                     pre-replicative complex [Evidence IDA] [PMID 22421151];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     11371346]; GO_component: GO:0005654 - nucleoplasm
                     [Evidence IDA] [PMID 11371346]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 12110182]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     23212245]; GO_function: GO:0003682 - chromatin binding
                     [Evidence IDA] [PMID 12110182]; GO_process: GO:0006260 -
                     DNA replication [Evidence IEA]; GO_process: GO:0006270 -
                     DNA replication initiation [Evidence IDA] [PMID 12110182];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0006267 - pre-replicative complex assembly
                     involved in nuclear cell cycle DNA replication [Evidence
                     IMP] [PMID 22421151]; GO_process: GO:0006364 - rRNA
                     processing [Evidence IDA] [PMID 12110182]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Noc3p"
                     /protein_id="XP_018734465.1"
                     /db_xref="GeneID:30034040"
                     /translation="MAKRPRGKVAEKLAKRSKDRHTADSALSSSSWSALGEVDEDPNY
                     PDSDQEQDYDSRPRKFQVADDERVERLPVKTLEGEVKRVMGKKEKKIQKEVEEDKEDE
                     SESEEDESSKSEEVTTEQKASGDGEDDSDSEPEDNDPVSLNQKLLELKEIIAETAEKL
                     NEDPEEHISKLRELRELIASSKHFKAKQLIILSLVQIFQSLIPGYRIRPLTESEQKEK
                     VSKEVRKLRNFEESLLLNYKAYISTLQTFSRKGKSSQVGTVKYSLASVSILAACELLE
                     SVPYFNFRSELVQIIVDKLSTKKNDETFYKSIQTLETIFKADEEGQISFDLVRLLSKM
                     IKARKYKVDEKVINSLLHLRLLTELAARADLEKVQRFVEDEGPKKKKDRVHLSKKERK
                     ARKERKAITEEMMRAETAVSAEERERLQGETLKLVFILYFNILKERSEKLIGVTLEGL
                     AKFAHLINADLFGDLLEVLRELILERQKRIVGGEYEFKESATRESLLCIVTAFALLSA
                     QAGVGESMNLDLTFFVNHFYSSLYSLSLNADIEFSHKTLRLDDPLKAASITPNKYKVN
                     ISTETEMMIRAFEFIFFRQRSIGPNRVQSFAKRLAISTLHMPEKSCAASLRILDKMTK
                     KFNSMPALYSTEDRVANGVYNMEVDDPEHSNPGAATIWETVLLEKHYSPMVAKAAQAV
                     PKGAIVPT"
     gene            <695480..>696115
                     /locus_tag="AWJ20_217"
                     /db_xref="GeneID:30034051"
     mRNA            <695480..>696115
                     /locus_tag="AWJ20_217"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879098.1"
                     /db_xref="GeneID:30034051"
     CDS             695480..696115
                     /locus_tag="AWJ20_217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734466.1"
                     /db_xref="GeneID:30034051"
                     /translation="MTSPKSPNEKSVGAYRVDELSSSSLSIENEDLAVGQDNIFKDPA
                     IYEHYKKVYEEANYECRHLLDPDFEWTPQEERKLVWKTEWRCCFVAFLFFFNLDIDRG
                     NISSALGDNMLTDLKLTTNDYNLGSTINLVCFLSSELPSQLISKKLGPDVWIPLQMVL
                     FSAIAMSQMAIQNRAGFFATRALLGALQGGVSYSSKSCFQHKLSNLVTVHT"
     gene            <696333..>697175
                     /locus_tag="AWJ20_218"
                     /db_xref="GeneID:30034062"
     mRNA            <696333..>697175
                     /locus_tag="AWJ20_218"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879109.1"
                     /db_xref="GeneID:30034062"
     CDS             696333..697175
                     /locus_tag="AWJ20_218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734467.1"
                     /db_xref="GeneID:30034062"
                     /translation="MPPSVVQTKTWFRPKGWYTEREEKIQVNRILRDDPSKGDMHNRE
                     AIGPKLLYKCISDYHLWPIYFVRLLCDINVSPVSNYMTLTLRKLGFSTLNTTLLVIPS
                     SFISIATMLIVTYGSEFFNQRAFALLLTPLWCVPFLAVLRFWPGAQIEIWKTYAVLIL
                     ALSRPVASVLTISWAASNSSTVSTRTVSAALVNIFSQTAGIISTQIYRADDAPKYHRG
                     NLQLLLIAIGAIGMCLVAKAYYVIQNKRRDKVWNAMSKEEQTYYILNTKDKANNRLDF
                     RFVH"
     gene            <697550..>699979
                     /locus_tag="AWJ20_219"
                     /db_xref="GeneID:30034073"
     mRNA            <697550..>699979
                     /locus_tag="AWJ20_219"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879119.1"
                     /db_xref="GeneID:30034073"
     CDS             697550..699979
                     /locus_tag="AWJ20_219"
                     /inference="similar to AA sequence:KEGG_Orthology:K16572"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734468.1"
                     /db_xref="GeneID:30034073"
                     /translation="MSDHSRRRSEKIEQLVRSIVVQTSSKRFERILTWTKKQATADHI
                     SIDKDAVLNAYDGLIEKFDVLGRSDLSSALQDRIEELTPMVDNKDGYSSAQCLALIKD
                     LSVDPWRYPLVDLKARADLPRAAGAVPLTWKDIVDSEPLEGPHWEEVSEEETLSGLET
                     ESDDNGAENSVPDPSRPVTQPARRPSAARNPAPQAFIYPDPYSALEAIRLPSYGQSHL
                     PYWMVKDDGISTPPVISTADILREIVFALLGLPSSVFTRTTIDNFNIVVVDEAAVSFF
                     NLPHLSTEALLSILREFANFASIIAQLRQFSLIYFVMEHFQSFDYKNILAILDENCRK
                     IETSILEFQDELQNDKNSTVSLLSFETYCRQLLLPYTAVVSIIKTVCAESYKKVTVVS
                     LLDTLYDRLCTSDISGDDYYDLLYDIFCRVLQDYIEQLRPWLESGIVPQTRSFVVEAV
                     PDNRLPTSSGQFRLVKANIAECFNGCSKLVLSAGKAAYILKILASPDSIISDGISIPS
                     KLGFSETISGLGGKSAGNFADSLDQMLHAYFGNIEQRNNELLYRRIISDYHLKQNLIH
                     QFGIYFMFDGVSSALFLERLFERIDDRYPIDRYSVADILEETWSCDKLYPLFNITAVI
                     AQDALDFSIKIDVPLSTTVFKEIITHDTLAVYQSIWELQLHCRRIYYRLSRMRGLPVK
                     FLFINFLNAYMVYLQESVLRKESNHLLSKLDSPWLSFQELIDAHRMHLDIIYKRSLMG
                     THARKALWELLSYGYTLDHTGAPELRVFTQLYEQLQASFTGIDDPVIQTLAQLLSPDS
                     QIKIKENHAIS"
     gene            <706765..>707160
                     /locus_tag="AWJ20_220"
                     /db_xref="GeneID:30034085"
     mRNA            <706765..>707160
                     /locus_tag="AWJ20_220"
                     /product="DNA-binding protein C1D"
                     /transcript_id="XM_018879128.1"
                     /db_xref="GeneID:30034085"
     CDS             706765..707160
                     /locus_tag="AWJ20_220"
                     /codon_start=1
                     /product="DNA-binding protein C1D"
                     /protein_id="XP_018734469.1"
                     /db_xref="GeneID:30034085"
                     /translation="MNELERVKSYMNKVKEQTGEPVKKPQRARVVDKEAANRFIQNAL
                     SDSNDKTEVVFSGKHTRLDGDETKDKEDDKEGKAEERDVDTTAPKKRAAKSSSEAPPK
                     KKSNKKAVVRAKKKAAKEAAAEAAASARE"
     gene            <708488..>709039
                     /locus_tag="AWJ20_221"
                     /db_xref="GeneID:30034096"
     mRNA            <708488..>709039
                     /locus_tag="AWJ20_221"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879138.1"
                     /db_xref="GeneID:30034096"
     CDS             708488..709039
                     /locus_tag="AWJ20_221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734470.1"
                     /db_xref="GeneID:30034096"
                     /translation="MTAKPVSEEVEKMKTSTWGGSEKKETDMDGLGGLESGLAGSGTG
                     TSENDISDIEASERNFDKGKTFESAKPPFESSEVVQPDQAESKDEQISAPVTAPPLVG
                     PPPNGGLKAWLVVAGGFFALFNSWGVVNAFGSFQAYYSTNLLKNESDSAISWIGAIQG
                     FIIVSTGIIVSANGTGVPRVGVF"
     gene            complement(<710428..>711885)
                     /gene="PEX3"
                     /locus_tag="AWJ20_222"
                     /db_xref="GeneID:30034107"
     mRNA            complement(<710428..>711885)
                     /gene="PEX3"
                     /locus_tag="AWJ20_222"
                     /product="Pex3p"
                     /transcript_id="XM_018879149.1"
                     /db_xref="GeneID:30034107"
     CDS             complement(710428..711885)
                     /gene="PEX3"
                     /locus_tag="AWJ20_222"
                     /inference="similar to AA sequence:KEGG_Orthology:K13336"
                     /note="Peroxisomal membrane protein (PMP); required for
                     proper localization and stability of PMPs; anchors
                     peroxisome retention factor Inp1p at the peroxisomal
                     membrane; interacts with Pex19p; GO_component: GO:0005783
                     - endoplasmic reticulum [Evidence IDA] [PMID 16009135];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0005779 - integral
                     component of peroxisomal membrane [Evidence IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005778 - peroxisomal membrane [Evidence
                     IEA]; GO_component: GO:0005778 - peroxisomal membrane
                     [Evidence IDA] [PMID 1894692]; GO_component: GO:0005777 -
                     peroxisome [Evidence IEA]; GO_component: GO:0005777 -
                     peroxisome [Evidence IDA] [PMID 23900285]; GO_function:
                     GO:0005515 - protein binding [Evidence IPI] [PMID
                     9418908]; GO_function: GO:0030674 - protein binding,
                     bridging [Evidence IMP] [PMID 23900285]; GO_process:
                     GO:0032581 - ER-dependent peroxisome organization
                     [Evidence IDA] [PMID 17646399]; GO_process: GO:0032581 -
                     ER-dependent peroxisome organization [Evidence IMP] [PMID
                     20427571]; GO_process: GO:0045033 - peroxisome inheritance
                     [Evidence IMP] [PMID 19948495]; GO_process: GO:0007031 -
                     peroxisome organization [Evidence IEA]; GO_process:
                     GO:0045046 - protein import into peroxisome membrane
                     [Evidence IMP] [PMID 10637226]"
                     /codon_start=1
                     /product="Pex3p"
                     /protein_id="XP_018734471.1"
                     /db_xref="GeneID:30034107"
                     /translation="MFQSASNLVKRHKRKILVATGLVAGGYFVIDYVKNKFFELQDRL
                     ATERQARENLKRRFEQNQEDATFTIMALLPSLASQIMEKYPVEKITQELQAKRTERIA
                     TTAAIANEAVTNGTPSLNDSVQTLPSETSGNTPIPANSSSPAVANEGNTTNASTGPSA
                     PASLTGSWSVTEDAAPVVKKTKTELWRDLKIRSIARAMTLVYCSALLVFFTRLQLNIL
                     GRKNYVASVIHMAESRTKQQKLEQEENAYGAYISEPTEEDLVKLALEEEEVNINRMYL
                     TFSWWLLNKGWAALSERIEDAVTDVFDSVNPRTDLSLAEISDLIGQVQFKIDHPISVL
                     ESNNFINNLLPPTELESYVLSQAPVNPDNLSTLRSADNDENLVTPPLRRLLDETYDFI
                     ESPNAIDVIQRLVHSGLTVFVESISTIYPPGGADAEPSKVKLASILANVTRQGHALAA
                     GKPLDPNEYILAMINVPELDGFSALVYSNFGTSSE"
     gene            <713600..>714892
                     /locus_tag="AWJ20_223"
                     /db_xref="GeneID:30034118"
     mRNA            <713600..>714892
                     /locus_tag="AWJ20_223"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879160.1"
                     /db_xref="GeneID:30034118"
     CDS             713600..714892
                     /locus_tag="AWJ20_223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734472.1"
                     /db_xref="GeneID:30034118"
                     /translation="MGLASKLAAAGVAAAVSNMSGGAPGGPGGYGRPPAPGGYGQPQG
                     YNQGYSQQSGPGGYPPPGQQQPGHGYPPSQQQPGHGYPPSQQQPSHGYPPSQQHPGYP
                     SQQQPGYPSQQQPGYGQPGPGGYGAAAAGAALGAAAGYGAASYGGGPAGQAGGYYSIL
                     EAAVRENRLEAFYPPQRLQQVAASVSGQVQQLAQTWDIPMEIARDLVRLALYDIVLYV
                     DDSGSMAFEEKGERIDDLKLILHRVSFAASLFDTNGIEVRFMNNNYQGNGIRSEQQVG
                     QMMQNVKFQGLTPLGTNLRKKVLDPLVVGPASAGQLQKPVLIITITDGEPAGESSSTL
                     KHAIKNAKHQLQSTRYGPGALALQFGQVGNDLKARAFLASLDNDREVGPMIDCTSNFE
                     VEQDEMARIGVDLSPSLWLVKILVGSIDRSYDKKDERQ"
     gene            complement(<715148..>715918)
                     /gene="PCD1"
                     /locus_tag="AWJ20_224"
                     /db_xref="GeneID:30034129"
     mRNA            complement(<715148..>715918)
                     /gene="PCD1"
                     /locus_tag="AWJ20_224"
                     /product="Pcd1p"
                     /transcript_id="XM_018879171.1"
                     /db_xref="GeneID:30034129"
     CDS             complement(715148..715918)
                     /gene="PCD1"
                     /locus_tag="AWJ20_224"
                     /note="8-oxo-dGTP diphosphatase; prevents spontaneous
                     mutagenesis via sanitization of oxidized purine nucleoside
                     triphosphates; can also act as peroxisomal pyrophosphatase
                     with specificity for coenzyme A and CoA derivatives, may
                     function to remove potentially toxic oxidized CoA
                     disulfide from peroxisomes to maintain the capacity for
                     beta-oxidation of fatty acids; nudix hydrolase family
                     member; similar E. coli MutT and human, rat and mouse
                     MTH1; GO_component: GO:0005777 - peroxisome [Evidence
                     IEA,IEA]; GO_component: GO:0005777 - peroxisome [Evidence
                     IDA] [PMID 10922370]; GO_function: GO:0008413 -
                     8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase
                     activity [Evidence IDA,IMP] [PMID 15475388]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA,IEA];
                     GO_function: GO:0016818 - hydrolase activity, acting on
                     acid anhydrides, in phosphorus-containing anhydrides
                     [Evidence IEA]; GO_function: GO:0000287 - magnesium ion
                     binding [Evidence IEA]; GO_function: GO:0030145 -
                     manganese ion binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016462 - pyrophosphatase activity
                     [Evidence IDA] [PMID 10922370]; GO_process: GO:0006281 -
                     DNA repair [Evidence IMP] [PMID 15475388]; GO_process:
                     GO:0009132 - nucleoside diphosphate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Pcd1p"
                     /protein_id="XP_018734473.1"
                     /db_xref="GeneID:30034129"
                     /translation="MEINRLKSFQTDESDHLWTSVPYNKRAAVLIILYRNAAGKLLTV
                     LTVRSFNMRTYPGQAAFPGGRSDHPNENPWSTALREAQEEIGFDPASYKFHQLCSLPC
                     YLSRNFLVVRPCVCYIEPLHETSPPVSIEQIVAKMNGAEVQIAYGLELETFFLNDPST
                     LKASDPTEWAGQPWVYYEYEAHRNENSEWVFEDPTSRLAESYASNSVTGLTAQIALDC
                     ARVAYGRDPEGFPIIPSIGYDLAVADCIKLGTFNRKRM"
     gene            complement(<716670..>719402)
                     /locus_tag="AWJ20_225"
                     /db_xref="GeneID:30034140"
     mRNA            complement(<716670..>719402)
                     /locus_tag="AWJ20_225"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879182.1"
                     /db_xref="GeneID:30034140"
     CDS             complement(716670..719402)
                     /locus_tag="AWJ20_225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734474.1"
                     /db_xref="GeneID:30034140"
                     /translation="MKLSGLFQSSKPLVTALYILLVTIGPTSAGDVDPSPSTTIIDIL
                     SASPEYSILLHYLQKHGLVNLINQSRNSTLLAPVNSAFYQLEEDGATVTKDLLLYHFL
                     NGTVVSDNVTSDVVLQSHLSKRLYEAWDDDEDEHDREGEEELKDGIPVVISPDSSHDS
                     DDDGIGLKVNGQATVVELDQMAGYHRGVVQGVDSLLSIPPTLCEVIEAKSRKHSFFSE
                     LFSLEYNCDSSRKKQTKLRKNLVTLLVPNDNAFDKFIDVEKDYLLSASAKADREILIN
                     RHTIDHLLKPQAIQTSIEPRHRSERSSGEMTAVTADGTVLKFDRDYIINSTFNPDEVN
                     ILTRDGIIYTYDSLLSTRQDASSKVVEFNPEKYLHGLGADLFVEETYLRGLQSLIDGT
                     ETEPQSIFVYPIGTSETNSHPNIKYHIVKGANALEDLDTRGTYLLTSKLSSHRMGDYY
                     QKIKAIVSSEGTISLNSQLVLTSDYNVGNTSIYLLEGDLDVPPSLAFALGPFFQSSFS
                     VAFLESTGLISPPKNDPPRTYLVPSRRAWENQILLKLYLQSNHTALRAVFESLIFETP
                     VYSNEKPRVVESLDGTKSKLSVFSGGEGRHNGPYIARVNNTSYDIDAEDILFNSGVAH
                     SIDQLSIPKHVEVSPHDLIIAGDRKDFVDLLKARNMSHILDRNESYTILVPNMDQLAD
                     NGYYANSSKTDRLLSLHILPDNPINTLFAGEAIPTLDEDVQLSGRNVTENFHILSIVD
                     GTGQETYVVSRGDAQNHEFGKHSTVLFLDRYISPDWVHTPLIRPPYRLKTHVAILIGA
                     ALGLILAATSIVTCLYAFVGTRKATDPENDEHRPLLRDRTTSPSGRSTRSARSNRSRR
                     DSNNGASDVDGTSPNSTSNNFYSTISSNSSINPIATGHVNEHREFGRHLNLPSP"
     gene            <726023..>728335
                     /gene="SAT4"
                     /locus_tag="AWJ20_226"
                     /db_xref="GeneID:30034151"
     mRNA            <726023..>728335
                     /gene="SAT4"
                     /locus_tag="AWJ20_226"
                     /product="serine/threonine protein kinase SAT4"
                     /transcript_id="XM_018879193.1"
                     /db_xref="GeneID:30034151"
     CDS             726023..728335
                     /gene="SAT4"
                     /locus_tag="AWJ20_226"
                     /inference="similar to AA sequence:KEGG_Orthology:K08286"
                     /codon_start=1
                     /product="serine/threonine protein kinase SAT4"
                     /protein_id="XP_018734475.1"
                     /db_xref="GeneID:30034151"
                     /translation="MSVAFDLQQCSPNTGPNPSPLSDRETNSSTPTSPPSPKAIISRT
                     GKEELNLTSSTTTPVSNNNLSISPPISPLITNRTDGVKNVVSLTGVTENIPSLELNSA
                     ASERGAEAEAGIGKENDIVPALGERTVQTKSRSYSTSSTSPPKLSVVTGLSGPPGQKS
                     ASAAVVTNRSGTSRPRSNSVLHSTSSGGSGGSGFSSGFGSGSGFSQATPAPAPAPTPP
                     LRPRSNSKISGTMTKLRSFLFSGEKERPGVTPGHTPLGSTAQSGTATPANTLHTSVTP
                     STIGSHTESTLHIPEAGIGRSGGPKISSGGTSSPANGGGSANGSIGTQSPSSSTVSIP
                     SLHETSSPASTPQPAQTGNTTPNSSSASVGRSGSISKSSSSSAAGLPRFAVSEDGSTH
                     SHHLKTAKRQEKLSGMIKEFLGGKKLRDEAVSAVSAILNSGGNASNAAAQVPGNQPPS
                     LMAGFVHQIKKGDQDVESLFKTGVVPSQSSFVEKYGKCHEVIGKGAFGVVRVAHKTDP
                     KNQRDLLFAVKEFKKRPQESEQKYSKRLTSEFCISSSLHHPNIIQTLDLLQDAKGEYC
                     EVMEYCAGGDLYSLILVVGKLEYLEADCFFKQIIRGVNYMHEMGVAHRDLKPENILLT
                     SNGAVKITDFGNGECFRMAWEKVIHLSNGVCGSAPYIAPEEFTEPEFDPRALDIWAVG
                     VIYMAMRTGRHLWRMAKASEDEFYAKYLEGRKDEHGYEPIESLKRARCRNVIYSILDP
                     VPSRRITGKQILNSEWGREIHVCQAGDLGL"
     gene            <733058..>733846
                     /gene="RVS161"
                     /locus_tag="AWJ20_227"
                     /db_xref="GeneID:30034162"
     mRNA            <733058..>733846
                     /gene="RVS161"
                     /locus_tag="AWJ20_227"
                     /product="amphiphysin-like protein RVS161"
                     /transcript_id="XM_018879204.1"
                     /db_xref="GeneID:30034162"
     CDS             733058..733846
                     /gene="RVS161"
                     /locus_tag="AWJ20_227"
                     /inference="similar to AA sequence:KEGG_Orthology:K12562"
                     /note="Amphiphysin-like lipid raft protein; interacts with
                     Rvs167p and regulates polarization of the actin
                     cytoskeleton, endocytosis, cell polarity, cell fusion and
                     viability following starvation or osmotic stress;
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     IDA] [PMID 16239147]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005856 -
                     cytoskeleton [Evidence IEA,IEA]; GO_component: GO:0005937
                     - mating projection [Evidence IDA] [PMID 9566960];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_component: GO:0045121 - membrane
                     raft [Evidence IDA] [PMID 12477802]; GO_function:
                     GO:0008092 - cytoskeletal protein binding [Evidence
                     IPI,ISS] [PMID 10388809]; GO_function: GO:0008289 - lipid
                     binding [Evidence IDA] [PMID 20610658]; GO_process:
                     GO:0051666 - actin cortical patch localization [Evidence
                     IMP] [PMID 8590801]; GO_process: GO:0030036 - actin
                     cytoskeleton organization [Evidence IMP] [PMID 7891662];
                     GO_process: GO:0031532 - actin cytoskeleton reorganization
                     [Evidence IMP] [PMID 7891662]; GO_process: GO:0000747 -
                     conjugation with cellular fusion [Evidence IMP] [PMID
                     11096097]; GO_process: GO:0006897 - endocytosis [Evidence
                     IMP] [PMID 8590801]; GO_process: GO:0060988 - lipid tube
                     assembly [Evidence IDA] [PMID 20610658]; GO_process:
                     GO:0006970 - response to osmotic stress [Evidence IMP]
                     [PMID 1776363]; GO_process: GO:0042594 - response to
                     starvation [Evidence IMP] [PMID 1776363]"
                     /codon_start=1
                     /product="amphiphysin-like protein RVS161"
                     /protein_id="XP_018734476.1"
                     /db_xref="GeneID:30034162"
                     /translation="MSWNGFKKAVSRAGTSVMMKTGHVEKTVDKEFEVEERRYRTMET
                     ACMSLQKEAKGYLDSLRAMTASQTRIAETIDAFYGDAGTRDGVSKYYLTAVQELDSET
                     VKALDGPFRETVLEPVSRFCAYFTDINEAVKKRNHKLLDYDSLRAKVKRLTEKPSDDV
                     SKLPRLEKELSMAKEIYDQLNQQLINELPQLIDLRVPYLDPSFEALVKIQLRFCTESY
                     TRLAQVQQYLDASTREEYANGQLDSRVEQVLLEMRELSITSLGN"
     gene            complement(<735245..>735589)
                     /locus_tag="AWJ20_228"
                     /db_xref="GeneID:30034173"
     mRNA            complement(<735245..>735589)
                     /locus_tag="AWJ20_228"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879215.1"
                     /db_xref="GeneID:30034173"
     CDS             complement(735245..735589)
                     /locus_tag="AWJ20_228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734477.1"
                     /db_xref="GeneID:30034173"
                     /translation="MFGLFEDSHNQVYNGQQHESKFSHELVAGAASFAAAKIFEDKQR
                     KEGKPVSHQFAKEALAGIAGAEVDKLFESKGLNYLDKEKVKHQAQQNVQQGYDDHYGS
                     QAQWDPNHPPSV"
     gene            complement(<738444..>740516)
                     /locus_tag="AWJ20_229"
                     /db_xref="GeneID:30034184"
     mRNA            complement(<738444..>740516)
                     /locus_tag="AWJ20_229"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879226.1"
                     /db_xref="GeneID:30034184"
     CDS             complement(738444..740516)
                     /locus_tag="AWJ20_229"
                     /inference="similar to AA sequence:KEGG_Orthology:K01626"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734478.1"
                     /db_xref="GeneID:30034184"
                     /translation="MGAGKEFRVDVVGPERLIASEGAKSAAKLRTLSSDQAGSDRPTG
                     LTAVHPSGSAVDDGKAEWSPTSWQSHPIKQDVVYDDYSKVEKALEKLESLPPLVHPKE
                     IEDLKSKLRDAAEGRAFVLQGGDCAELFDYCNQDRIEAKLKVLLQMSLVLIWGTKLPI
                     VRIGRIAGQYAKPRSKQTEVVEGYGEIPSFRGDNINGYDPSDRTPDPSRLVSSYFHSA
                     ATLNFIRSTLASGFADLHHPFEWDLSHVRKDSIRNRYQQVVDNISEGLQFMSTVGGDN
                     PAWQSIDLFTSHEALLLEYEQSFTRLLRDPTVKSTNGTTDTNSNSTRSSSANSAKKYY
                     NTSAHFVWIGDRTRQLDGAHVEFFRGVANPIGIKVGPSTETDELVAVLDRVDPDFVPG
                     RVTLITRYGADKIKDKLGEQIRAVKKSGHKVVWISDPCHGNTKTSPVSKLKTRYFDDI
                     ISEIRLALEIHKDNDSTLNGLHLELTGDPVTECIGGSQDLEDEDLVVRYETFCDPRLS
                     LSQCKYHNLSPVPHTTTKLLLTHHSTGRRIPDRRLLPPGYPEGRLNKVFDKWYTVNKH
                     NFVRPLCLRRLGSAPDPGCSSRSARVITSHLLLRDNCEWPLCLRRLGLRPRPWLLRPR
                     PWLLLSLRSSRHAGSKTKTPAPPAKQEQPECEAEPQSPEATPASESIGSEQNRNYVNS
                     RSTHRGPQ"
     gene            <741135..>741216
                     /locus_tag="AWJ20_230"
                     /db_xref="GeneID:30034196"
     tRNA            <741135..>741216
                     /locus_tag="AWJ20_230"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30034196"
     gene            complement(<741283..>742779)
                     /gene="LYS14"
                     /locus_tag="AWJ20_231"
                     /db_xref="GeneID:30034207"
     mRNA            complement(<741283..>742779)
                     /gene="LYS14"
                     /locus_tag="AWJ20_231"
                     /product="Lys14p"
                     /transcript_id="XM_018879248.1"
                     /db_xref="GeneID:30034207"
     CDS             complement(741283..742779)
                     /gene="LYS14"
                     /locus_tag="AWJ20_231"
                     /note="Transcriptional activator involved in regulating
                     lysine biosynthesis; involved in the regulation of genes
                     of the lysine biosynthesis pathway; requires
                     2-aminoadipate semialdehyde as co-inducer; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 10975256];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0000978 - RNA polymerase II core promoter
                     proximal region sequence-specific DNA binding [Evidence
                     IDA] [PMID 9701810]; GO_function: GO:0001077 - RNA
                     polymerase II core promoter proximal region
                     sequence-specific DNA binding transcription factor
                     activity involved in positive regulation of transcription
                     [Evidence ISA] [PMID 7935367]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0043565
                     - sequence-specific DNA binding [Evidence IDA] [PMID
                     19111667]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19158363]; GO_function:
                     GO:0000981 - sequence-specific DNA binding RNA polymerase
                     II transcription factor activity [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0009085 - lysine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:2001196 - positive regulation of lysine biosynthetic
                     process via alpha-aminoadipate and saccharopine [Evidence
                     IMP] [PMID 3123231]; GO_process: GO:0045944 - positive
                     regulation of transcription from RNA polymerase II
                     promoter [Evidence IDA] [PMID 11952910]; GO_process:
                     GO:0045944 - positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 3123231];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 7935367]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA,IEA];
                     GO_process: GO:0006366 - transcription from RNA polymerase
                     II promoter [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Lys14p"
                     /protein_id="XP_018734479.1"
                     /db_xref="GeneID:30034207"
                     /translation="MTITEPPPFFDEALLHDEDWISHAGLLATNLNDLVSMRLGEMSI
                     DFSNSQNTIPPTELFMTEFVQDKSDIHHNVPVDYIKVSPKHQPYLNEFYHWFAKVILP
                     FSAHFNGVDLNPVRDVLLTYAARERYLLLALLACGATSSHKKTSLAADELAYGEYLTT
                     CIQSLEPIFNVETTLVSKIESILLTVLVLTSDHASSSNQNWRAHLQGAKELLLKYTSQ
                     SKQSHVLFLCKSWYSSIELLAALGAPNGGTLRSDRELELLISPDNPVEMKSLTQLHLY
                     GPNGFSLLHGYSKQLVTLIRDMVKLLHKTRPWNDDRKSLPSGADNRSMDLISYKEVLR
                     VLSGLYQQLDYTVGDPSPLNGLSSEAVEIVKQNNKQVSICWYDVSNKSYTLAALITMF
                     TSVQGLSKHSPIVQGAVKELLSLVNFLDGRVESYGTFMLQLPMFVAGYNVIDDSDAAK
                     IERFFKLLDELGAGSANHVLKKMKKVWGGAYSSEAATSGDDEKDILAY"
     gene            <743807..>743878
                     /locus_tag="AWJ20_232"
                     /db_xref="GeneID:30034218"
     tRNA            <743807..>743878
                     /locus_tag="AWJ20_232"
                     /product="tRNA-Met"
                     /db_xref="GeneID:30034218"
     gene            <743954..>744025
                     /locus_tag="AWJ20_233"
                     /db_xref="GeneID:30034229"
     tRNA            <743954..>744025
                     /locus_tag="AWJ20_233"
                     /product="tRNA-Met"
                     /db_xref="GeneID:30034229"
     gene            <745451..>748096
                     /gene="AVL9"
                     /locus_tag="AWJ20_234"
                     /db_xref="GeneID:30034240"
     mRNA            <745451..>748096
                     /gene="AVL9"
                     /locus_tag="AWJ20_234"
                     /product="Avl9p"
                     /transcript_id="XM_018879277.1"
                     /db_xref="GeneID:30034240"
     CDS             745451..748096
                     /gene="AVL9"
                     /locus_tag="AWJ20_234"
                     /note="Conserved protein involved in exocytic transport
                     from the Golgi; mutation is synthetically lethal with apl2
                     vps1 double mutation; member of a protein superfamily with
                     orthologs in diverse organisms; relocalizes from bud neck
                     to cytoplasm upon DNA replication stress; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006892 -
                     post-Golgi vesicle-mediated transport [Evidence IMP] [PMID
                     17229886]"
                     /codon_start=1
                     /product="Avl9p"
                     /protein_id="XP_018734480.1"
                     /db_xref="GeneID:30034240"
                     /translation="MDHAHERIEEDHPDNEGDLEITGSNQVEPTRTEEEMDSENHPQR
                     PTTIEEKNTNADEDINEQPEEDQEHSKSEELPENDVEPEEKDVENNGSLDTTDGVDND
                     GDNSEDNTDDADIQSDSHDDPSKRNSIPVPQTPSRSNKRENDNSPLSNVENIDTAPST
                     PNSRQDFQTPPSGDDGSPPDVIPGGFPLPKDEEESHTATSQSEEQDSTLIIEEAGSED
                     HSTFTDDHETIDLTGSPLSEKDRKDVNAADESNSNATYEPEEENNRHNETNGKIDGHE
                     DVQDTNGNVQDNGNEMTVENGEENGEENGDENGDEDDDGYDDDEEEAEIIEVSSTQIS
                     DPYKDRRELKADKQDGNVLQSPERTSPQRSIASESSFSFSEENSTPGKKAAGTIDYGS
                     YSKGPQDRLVSRLVSNFESQMDSATETPKVERRTFSKAKLKTIVSPISGSFPADVKEE
                     SRSILSGATALGPSALAANSSPPSAEPSDQSATKESETISQSASVNNDKPTQVELEHD
                     EPVGPPVPNLQPIPKPKRITSFQLKPIEAVKEESSSEENLIFGVCVVGFHHARGPEVE
                     YWVGPDGDKSSVWPYLAFQSLPDGSHVRDENFCYFTLLYDDEKKIAVNTTPKRDKDGH
                     IIEQSDFKNVTTLFGISCNRQIKTEELKHVTDDITRSTVQKSVVVVARKPIFGPIKEK
                     LAVVTRAYFIQGDFEDRQLIDNLYENLTQIFTYKLDDASMNIGMPLRELIYRLGPKVL
                     VILKALMLEKRVLFFASNTELLCASQFSIVSLVPNLINNLEDCGSPLLSSYETNLKKP
                     TSLRTSDRSSLLAFMGLPLQLFAGGGIFSPYVPLQQLSELHADETKYFLVGSTNSLVL
                     SQQNTIADIIVNVSIMRSALRMVSK"
     gene            <748317..>749018
                     /gene="AVL9"
                     /locus_tag="AWJ20_235"
                     /db_xref="GeneID:30034251"
     mRNA            <748317..>749018
                     /gene="AVL9"
                     /locus_tag="AWJ20_235"
                     /product="Avl9p"
                     /transcript_id="XM_018879288.1"
                     /db_xref="GeneID:30034251"
     CDS             748317..749018
                     /gene="AVL9"
                     /locus_tag="AWJ20_235"
                     /note="Conserved protein involved in exocytic transport
                     from the Golgi; mutation is synthetically lethal with apl2
                     vps1 double mutation; member of a protein superfamily with
                     orthologs in diverse organisms; relocalizes from bud neck
                     to cytoplasm upon DNA replication stress; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006892 -
                     post-Golgi vesicle-mediated transport [Evidence IMP] [PMID
                     17229886]"
                     /codon_start=1
                     /product="Avl9p"
                     /protein_id="XP_018734481.1"
                     /db_xref="GeneID:30034251"
                     /translation="MHLLASVKYDTYLTKIGSKPAPMLARDITGNPLTLYNNNWAKEW
                     KMSNNYRIFNKFTDEELFDIIEPKHLGESLSSNGANAREGIAKSVSKVFGNLWGTSPT
                     GTTQASRSPTPKNEDNTSITGETSDGSDSKSLAESVETTSHKSQKSMSSTVSSTAEQP
                     SQEGYFAGLARWAARRRQKVTSPQPNERAESIVEEQSTAEDESVSTPTDATATTSDPS
                     LETGTTNQSTNDRNA"
     gene            complement(<749142..>751544)
                     /gene="RGP1"
                     /locus_tag="AWJ20_236"
                     /db_xref="GeneID:30034262"
     mRNA            complement(<749142..>751544)
                     /gene="RGP1"
                     /locus_tag="AWJ20_236"
                     /product="Rgp1p"
                     /transcript_id="XM_018879299.1"
                     /db_xref="GeneID:30034262"
     CDS             complement(749142..751544)
                     /gene="RGP1"
                     /locus_tag="AWJ20_236"
                     /note="Subunit of a Golgi membrane exchange factor
                     (Ric1p-Rgp1p); this complex catalyzes nucleotide exchange
                     on Ypt6p; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IEA,IEA]; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence IDA] [PMID 10990452]; GO_component:
                     GO:0000139 - Golgi membrane [Evidence IPI] [PMID
                     10990452]; GO_component: GO:0034066 - RIC1-RGP1
                     guanyl-nucleotide exchange factor complex [Evidence IPI]
                     [PMID 10990452]; GO_component: GO:0032045 -
                     guanyl-nucleotide exchange factor complex [Evidence IDA]
                     [PMID 10990452]; GO_function: GO:0005085 -
                     guanyl-nucleotide exchange factor activity [Evidence IEA];
                     GO_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IDA,IPI] [PMID 10990452];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0007067 - mitotic nuclear division
                     [Evidence IEA]; GO_process: GO:0043087 - regulation of
                     GTPase activity [Evidence IEA]; GO_process: GO:0042147 -
                     retrograde transport, endosome to Golgi [Evidence IPI]
                     [PMID 10990452]; GO_process: GO:0042147 - retrograde
                     transport, endosome to Golgi [Evidence IMP] [PMID
                     11082047]"
                     /codon_start=1
                     /product="Rgp1p"
                     /protein_id="XP_018734482.1"
                     /db_xref="GeneID:30034262"
                     /translation="MPSSRSNIRVEVTFKNPVVFAGESLNAIVTFRNISVGESGLEEG
                     GSSGYRGNNGQQGGGHQRYKSTIDASLSQKPRPHRKLGRSADLSNGKDPILEADSDNN
                     HLNGNGTKNGLETDREAVSGSAHGSDGVPTEASSGIDSSVDSPVRENSRAALADDDDD
                     SSWLSGRRLSMQLANSFREFYNGGNNSSTAITRSSTGLGRSASTATRGGSKLTRSSTG
                     AGGRSGINASGDNGAISYQSSLAASRNNLALAGSQGLPPVNLLMGFAQLQGYFQVDDT
                     IVSAEVFEHVKTQGIVVGHNGLEYKSGRGDTGLLRGLTSGLGSFGGFGSFFKSDDNPN
                     SNPTARHGVSNSGSGANNGPSDIPIFSTPQSLLFVDLKLAPGESKSFSYQLNIPKTLP
                     PSCRAKAISIYYNLVIGTQKLSSRGTPEPKIILVPFRVFPFVDSSGNQPSHNLHDPIV
                     LKKDEAVITQLNERRPSVKSFEALEQKQRSPNTNQDSPAFKKCKEDFTNYLDDLLTNT
                     EPLSGDTSLSDIKLGQESSRLLRHRSSLPVVGGQEEYTARENIDFFIKYYQQIQAQQS
                     QASPQLALEMPNSDSQFDPPSISPPQLQPQLAPELKTSSMPQLTSHKVSFDINLHGHR
                     IAFIYLSRPIYRIGEDIILVFDFTSSVLNCHHITATLETTEKLGADISLKSPQEVVSI
                     TRRIFSHTAISTFASSRTCLQFTIPSTGTPQFSTSDISLGWSIRIDFITSSHRLPDDQ
                     QSLLKHASPPSASSTVLRAKSALASETFSCRIPIQVYPTNQDIRALLDHHSGMMSRRW
                     VI"
     gene            complement(<752076..>753038)
                     /gene="RRP45"
                     /locus_tag="AWJ20_237"
                     /db_xref="GeneID:30034273"
     mRNA            complement(<752076..>753038)
                     /gene="RRP45"
                     /locus_tag="AWJ20_237"
                     /product="exosome non-catalytic core subunit RRP45"
                     /transcript_id="XM_018879310.1"
                     /db_xref="GeneID:30034273"
     CDS             complement(752076..753038)
                     /gene="RRP45"
                     /locus_tag="AWJ20_237"
                     /inference="similar to AA sequence:KEGG_Orthology:K03678"
                     /note="Exosome non-catalytic core component; involved in
                     3'-5' RNA processing and degradation in both the nucleus
                     and the cytoplasm; has similarity to E. coli RNase PH and
                     to human hRrp45p (PM/SCL-75, EXOSC9); protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0000177 - cytoplasmic exosome (RNase
                     complex) [Evidence IDA] [PMID 10465791]; GO_component:
                     GO:0000177 - cytoplasmic exosome (RNase complex) [Evidence
                     IDA] [PMID 19046973]; GO_component: GO:0000178 - exosome
                     (RNase complex) [Evidence IEA]; GO_component: GO:0000176 -
                     nuclear exosome (RNase complex) [Evidence IDA] [PMID
                     10465791]; GO_component: GO:0000176 - nuclear exosome
                     (RNase complex) [Evidence IDA] [PMID 19046973];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     16541108]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0034473 - U1 snRNA 3'-end
                     processing [Evidence IGI,IMP] [PMID 10508172]; GO_process:
                     GO:0034475 - U4 snRNA 3'-end processing [Evidence IGI,IMP]
                     [PMID 10508172]; GO_process: GO:0034476 - U5 snRNA 3'-end
                     processing [Evidence IGI,IMP] [PMID 10508172]; GO_process:
                     GO:0000467 - exonucleolytic trimming to generate mature
                     3'-end of 5.8S rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     10465791]; GO_process: GO:0000467 - exonucleolytic
                     trimming to generate mature 3'-end of 5.8S rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 10508172]; GO_process:
                     GO:0070651 - nonfunctional rRNA decay [Evidence IC] [PMID
                     10465791]; GO_process: GO:0071042 - nuclear
                     polyadenylation-dependent mRNA catabolic process [Evidence
                     IC] [PMID 10465791]; GO_process: GO:0071035 - nuclear
                     polyadenylation-dependent rRNA catabolic process [Evidence
                     IMP] [PMID 10465791]; GO_process: GO:0071038 - nuclear
                     polyadenylation-dependent tRNA catabolic process [Evidence
                     IDA] [PMID 15828860]; GO_process: GO:0071038 - nuclear
                     polyadenylation-dependent tRNA catabolic process [Evidence
                     IDA] [PMID 17643380]; GO_process: GO:0070478 -
                     nuclear-transcribed mRNA catabolic process, 3'-5'
                     exonucleolytic nonsense-mediated decay [Evidence IC] [PMID
                     10465791]; GO_process: GO:0034427 - nuclear-transcribed
                     mRNA catabolic process, exonucleolytic, 3'-5' [Evidence
                     IC] [PMID 10465791]; GO_process: GO:0070481 -
                     nuclear-transcribed mRNA catabolic process, non-stop decay
                     [Evidence IC] [PMID 10465791]; GO_process: GO:0071051 -
                     polyadenylation-dependent snoRNA 3'-end processing
                     [Evidence IC] [PMID 10465791]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="exosome non-catalytic core subunit RRP45"
                     /protein_id="XP_018734483.1"
                     /db_xref="GeneID:30034273"
                     /translation="MPKRKDISLNERQFILSLLKDSQRLDGRAIDQFRKVDLKFGDSL
                     GHAEVQLGKTRLVVRVSAEVSKPYEDRPYEGTFIITTDVSSMASPLFENNRSSDDEML
                     MTRLIEKAIRRSNALDLESLCIVAGKSCWMIRADVHYLSYDGGLVDASCIGVIAALMH
                     FRRPDTSIDGDQTIIHSVEERVPVPLSILHVPICVTFSFFKVDEVPSSTENPVAAIPG
                     SGQSANGVPTADDSAILVIDATAQEEALRHSELTITINKNRDICQIAKPGGYSVEALT
                     ILECANKAYKIATNITDLIYRRLKEDESKRNAGNLVPLTAENER"
     gene            complement(<753396..>755045)
                     /gene="TPO1"
                     /locus_tag="AWJ20_238"
                     /db_xref="GeneID:30034284"
     mRNA            complement(<753396..>755045)
                     /gene="TPO1"
                     /locus_tag="AWJ20_238"
                     /product="Tpo1p"
                     /transcript_id="XM_018879321.1"
                     /db_xref="GeneID:30034284"
     CDS             complement(753396..755045)
                     /gene="TPO1"
                     /locus_tag="AWJ20_238"
                     /note="Polyamine transporter of the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; recognizes spermine, putrescine, and
                     spermidine; catalyzes uptake of polyamines at alkaline pH
                     and excretion at acidic pH; during oxidative stress
                     exports spermine, spermidine from the cell, which controls
                     timing of expression of stress-responsive genes;
                     phosphorylation enhances activity and sorting to the
                     plasma membrane; GO_component: GO:0033101 - cellular bud
                     membrane [Evidence IDA] [PMID 13679573]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IMP]
                     [PMID 11171066]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 12562762]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA,IMP] [PMID
                     15637075]; GO_function: GO:0015297 - antiporter activity
                     [Evidence IEA]; GO_function: GO:0015606 - spermidine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11171066]; GO_function: GO:0015606 - spermidine
                     transmembrane transporter activity [Evidence IDA,IMP]
                     [PMID 15637075]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11171066]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IDA,IMP]
                     [PMID 15637075]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     9920864]; GO_process: GO:1902047 - polyamine transmembrane
                     transport [Evidence IMP] [PMID 24136413]; GO_process:
                     GO:0015847 - putrescine transport [Evidence IMP] [PMID
                     9920864]; GO_process: GO:0015848 - spermidine transport
                     [Evidence IMP] [PMID 11171066]; GO_process: GO:0015848 -
                     spermidine transport [Evidence IDA,IMP] [PMID 15637075];
                     GO_process: GO:0015848 - spermidine transport [Evidence
                     IMP] [PMID 9920864]; GO_process: GO:0000296 - spermine
                     transport [Evidence IMP] [PMID 11171066]; GO_process:
                     GO:0000296 - spermine transport [Evidence IDA,IMP] [PMID
                     15637075]; GO_process: GO:0000296 - spermine transport
                     [Evidence IMP] [PMID 9920864]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tpo1p"
                     /protein_id="XP_018734484.1"
                     /db_xref="GeneID:30034284"
                     /translation="MKISEVARVQTEFSDVESGLAYADARGEAENKPGELPGELRVSH
                     SHRDNIFESFSGDHSEENNNTKSEFDVETFSTAPAEVTSESSTAEPTLLTAFERGDPD
                     DPHNYPIWRKVCHSLVLVCMCFITAMSSAMYTPALVDIETKYNISRELALLSTGMVLV
                     GYSFGPIIWSGVNEAFGRWYAWTVGFAIFLLFQIPTGLDPNFQTLLIGRFFQGFFGVS
                     TLVTFGGAMSDVWDYSTRSYAAAAAVFAIFAAPALGPVISSFFIKWVSFGWISWIIII
                     LGGVVLTLDILFIKETFPPVLLRNKAVKLRKEGHNVCAPLEAIPPTLKNLTTKYAIRP
                     FIMLVEDKALGFLCVYAGISYGLLYTVLAALPVTFSTYRKFSFIPTYLPSISLLVGVA
                     MTSTFISATNRNYVRALKMSGAMVLPDQRLKPMMLAAPLLPVGLFIFAWTAPFRHVHW
                     IAPVIGSAIVGFSTSTIFISSISYMIESYKQYATSAFALNAIIRSLVAVLLLLVFSRM
                     VEAMTLQGTFSFFGGVAILIAPGPFILHRNGDKWRKASKWA"
     gene            <759571..>760761
                     /gene="ERG10"
                     /locus_tag="AWJ20_239"
                     /db_xref="GeneID:30034295"
     mRNA            <759571..>760761
                     /gene="ERG10"
                     /locus_tag="AWJ20_239"
                     /product="acetyl-CoA C-acetyltransferase"
                     /transcript_id="XM_018879332.1"
                     /db_xref="GeneID:30034295"
     CDS             759571..760761
                     /gene="ERG10"
                     /locus_tag="AWJ20_239"
                     /inference="similar to AA sequence:KEGG_Orthology:K00626"
                     /note="Acetyl-CoA C-acetyltransferase (acetoacetyl-CoA
                     thiolase); cytosolic enzyme that transfers an acetyl group
                     from one acetyl-CoA molecule to another, forming
                     acetoacetyl-CoA; involved in the first step in mevalonate
                     biosynthesis; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 5571830]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0003985 - acetyl-CoA C-acetyltransferase activity
                     [Evidence IEA]; GO_function: GO:0003985 - acetyl-CoA
                     C-acetyltransferase activity [Evidence IDA] [PMID
                     7989303]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0016746 - transferase activity, transferring acyl
                     groups [Evidence IEA]; GO_function: GO:0016747 -
                     transferase activity, transferring acyl groups other than
                     amino-acyl groups [Evidence IEA]; GO_process: GO:0006696 -
                     ergosterol biosynthetic process [Evidence IMP] [PMID
                     200835]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="acetyl-CoA C-acetyltransferase"
                     /protein_id="XP_018734485.1"
                     /db_xref="GeneID:30034295"
                     /translation="MSRPAVYIVAASRTPIGSLLGSLASQTYVDLGAHAVKSALAKVP
                     EIEPSAVEEIVFGNVYSANVGQAPARQVALKAGLSEATVATTINKVCASGLKAVIIGA
                     QTILTGTADIVVAGGAESMSNVPHYLPSGRTGTKFGGATIVDGLQRDGLQDAYDGQAM
                     GMAGEDTAAEHKISREEQDEYAINSYKRAQKAHADGKFKAEISPVELPGARGKPGVTV
                     SVDEEVARLDEGRLKSARPVFKSDGSLTAPNSSPINDGAAAVILVSEQKVKELNLKPI
                     AKILGWGDAAQAPIKFPTSPSLAVPKALKHANVAIEDVDFFEFNEAFSVVGVANSKIL
                     QLDPSKVNIYGGAVAIGHPLGASGARILVTLTSVLAQENGKIGVAAICNGGGGASAIV
                     IERV"
     gene            complement(<760146..>760397)
                     /locus_tag="AWJ20_240"
                     /db_xref="GeneID:30034307"
     mRNA            complement(<760146..>760397)
                     /locus_tag="AWJ20_240"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879344.1"
                     /db_xref="GeneID:30034307"
     CDS             complement(760146..760397)
                     /locus_tag="AWJ20_240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734486.1"
                     /db_xref="GeneID:30034307"
                     /translation="MGLRFNSLTFCSETRITAAAPSLIGEELGAVREPSDLKTGLADL
                     SLPSSRRATSSSTETVTPGLPRAPGSSTGLISALNLPSA"
     gene            complement(<761087..>761872)
                     /gene="RPN10"
                     /locus_tag="AWJ20_241"
                     /db_xref="GeneID:30034318"
     mRNA            complement(<761087..>761872)
                     /gene="RPN10"
                     /locus_tag="AWJ20_241"
                     /product="proteasome regulatory particle base subunit
                     RPN10"
                     /transcript_id="XM_018879351.1"
                     /db_xref="GeneID:30034318"
     CDS             complement(761087..761872)
                     /gene="RPN10"
                     /locus_tag="AWJ20_241"
                     /inference="similar to AA sequence:KEGG_Orthology:K03029"
                     /note="Non-ATPase base subunit of the 19S RP of the 26S
                     proteasome; N-terminus plays a role in maintaining the
                     structural integrity of the regulatory particle (RP);
                     binds selectively to polyubiquitin chains; homolog of the
                     mammalian S5a protein; GO_component: GO:0000502 -
                     proteasome complex [Evidence IEA]; GO_component:
                     GO:0000502 - proteasome complex [Evidence IMP] [PMID
                     15242647]; GO_component: GO:0008540 - proteasome
                     regulatory particle, base subcomplex [Evidence IEA];
                     GO_component: GO:0008540 - proteasome regulatory particle,
                     base subcomplex [Evidence IPI] [PMID 15907469];
                     GO_component: GO:0008540 - proteasome regulatory particle,
                     base subcomplex [Evidence IDA] [PMID 9741626];
                     GO_function: GO:0031593 - polyubiquitin binding [Evidence
                     IDA] [PMID 8887631]; GO_function: GO:0005198 - structural
                     molecule activity [Evidence IMP] [PMID 9741626];
                     GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 15242647]"
                     /codon_start=1
                     /product="proteasome regulatory particle base subunit
                     RPN10"
                     /protein_id="XP_018734487.1"
                     /db_xref="GeneID:30034318"
                     /translation="MTLGGNGPEVKVTLCSEFGKILAGIHDTTVHGTNHLATSIQVAA
                     LALKHRQNKIQRQRVVVFVGSPIKEDSKELIKLAKKMKKNNVAVDFVNFGEEAENTEK
                     LESFIEQVNSSDNSHLVTIPPGPHLLSDVLASSPIINEDSVGGGIPGGLGAGSGGAGA
                     GSSSELFEFGVDPSVDPELALALRMSLEDEKARQEKEKEKAAASSSAAATIPEETASE
                     VATAEASSSASAAPAANTEATNASEEAKESEENKPSQMDTSND"
     gene            complement(<764320..>764739)
                     /gene="MRPL23"
                     /locus_tag="AWJ20_242"
                     /db_xref="GeneID:30034329"
     mRNA            complement(<764320..>764739)
                     /gene="MRPL23"
                     /locus_tag="AWJ20_242"
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /transcript_id="XM_018879362.1"
                     /db_xref="GeneID:30034329"
     CDS             complement(764320..764739)
                     /gene="MRPL23"
                     /locus_tag="AWJ20_242"
                     /inference="similar to AA sequence:KEGG_Orthology:K02871"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; localizes to vacuole in response to H2O2;
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IDA] [PMID 23509072]; GO_component: GO:0005762 -
                     mitochondrial large ribosomal subunit [Evidence IPI] [PMID
                     12392552]; GO_component: GO:0005762 - mitochondrial large
                     ribosomal subunit [Evidence IDA] [PMID 9151978];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IPI] [PMID 12392552]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IDA] [PMID 9151978]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 12392552];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IC] [PMID 9151978]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /protein_id="XP_018734488.1"
                     /db_xref="GeneID:30034329"
                     /translation="MAKDPRTLGRLASAIAVTLMGKHKPVYHPSDDCGDYVVVTNCKY
                     LNVTGEKMTQKLYRKHSGKPGHLKEWTMADLQNRKGGSEILRKAVSGMLPKNSLRKYR
                     LARLKTVEDSQNPYADNIVATWEEGVKIVENAKKTTS"
     gene            complement(<765304..>769746)
                     /gene="MET5"
                     /locus_tag="AWJ20_243"
                     /db_xref="GeneID:30034340"
     mRNA            complement(join(<765304..769658,769725..>769746))
                     /gene="MET5"
                     /locus_tag="AWJ20_243"
                     /product="sulfite reductase (NADPH) subunit beta"
                     /transcript_id="XM_018879372.1"
                     /db_xref="GeneID:30034340"
     CDS             complement(join(765304..769658,769725..769746))
                     /gene="MET5"
                     /locus_tag="AWJ20_243"
                     /inference="similar to AA sequence:KEGG_Orthology:K00381"
                     /note="Sulfite reductase beta subunit; involved in amino
                     acid biosynthesis, transcription repressed by methionine;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0009337 - sulfite reductase
                     complex (NADPH) [Evidence IDA] [PMID 6751400];
                     GO_component: GO:0009337 - sulfite reductase complex
                     (NADPH) [Evidence IDA] [PMID 9003798]; GO_function:
                     GO:0051539 - 4 iron, 4 sulfur cluster binding [Evidence
                     IEA]; GO_function: GO:0010181 - FMN binding [Evidence
                     IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0020037 - heme binding
                     [Evidence IEA]; GO_function: GO:0005506 - iron ion binding
                     [Evidence IEA]; GO_function: GO:0051536 - iron-sulfur
                     cluster binding [Evidence IEA,IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004783 - sulfite
                     reductase (NADPH) activity [Evidence IEA]; GO_function:
                     GO:0004783 - sulfite reductase (NADPH) activity [Evidence
                     IDA] [PMID 6751400]; GO_process: GO:0008652 - cellular
                     amino acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0019344 - cysteine biosynthetic process
                     [Evidence IEA]; GO_process: GO:0070814 - hydrogen sulfide
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0009086 - methionine biosynthetic process [Evidence
                     IEA]; GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0000103 - sulfate
                     assimilation [Evidence IMP] [PMID 19236486]; GO_process:
                     GO:0000097 - sulfur amino acid biosynthetic process
                     [Evidence IMP] [PMID 1479340]"
                     /codon_start=1
                     /product="sulfite reductase (NADPH) subunit beta"
                     /protein_id="XP_018734489.1"
                     /db_xref="GeneID:30034340"
                     /translation="MVTSYESETNKFVVANVLSSTGSKVFAIQPALAVKSKFSEDLEK
                     KVSDLTVLRVNNDPFQTVVDYLESQQSSDVVSVTSSLTGLFKSLPHLTTLKKSPVTVH
                     VDVSTESDYGLIAALRHSGFVFLQSFGPAEAQQTALISHLIAQKLSLPVVHFFYSNDD
                     EEKVRLLTGAEIQKASSNTSFQPTQQEQAEETTETDENSAAPTAITQADISSTIEEAF
                     KFTKTSYKPFEYIGSSKATSAIVLFAANADPFVQAINQDANLGVVLIRVYRPWSSEDL
                     IGTLPSSVKRVGLVEQIQKQTTAWSPLFQDFVSDGVEKLSRFDHLVSFQLGGVNYDNV
                     RTVLKSISSNLNAEVPIQKLFVGSKPESNDITYDAELKEAQTAAKKLEEAYTNVLHQL
                     FPSSLDIINASDKPNAGLEANPEYGFGAYLAKVQQKEELVSKARAAIKSNDFTSPLKQ
                     ELQTLLSQWIVANTSGKSNQSVDADKLIELLSKDGSSAAKQLLESKQYFKESSSWLIG
                     SDAWSYDLGSSGVHHVISSGKNINMLVIDSQPFSEVKANALRKKDIGLYAMNFGNVYV
                     ASVAVYASYTQLLQALIEAEKFDGPSVVVAYLPYYSEHENALQVLQETKKAVETGYWP
                     LYRYDPTLESESFKLDSFQIRKSLQDFLDRENKLTLLSKRHPTFARSLQSSYGADIKA
                     SQKKRAQAALASLLEGLSGPPLTVLFASDGGVAESVAKRLQRRAKGRGLKSIVMSFDD
                     YPVEEISNEENVVFVTSTAGQGELPQNGRAFWDAVKNATDIDLANVNFGVFGLGDSHY
                     WPRKEDKIYYNKPAKDLYNRLTILGGKELVPLGLGDDQDADGYSTAYNEWEPLLWKAL
                     GVDGVAGADEPPPITNEDIKIGSNFLRGTIAEGLQDKSTGAIAANDQQLTKFHGIYMQ
                     DDRDIRDERKAAGLEPAFSFMVRVRLPGCVASPAQWLKIDELSDKRGNGTFKITTRGT
                     FQLHGVIKENLKPAIRGINSSLIDTVAACGDVNRNVVTAALPGNAKIHDEIVKIGTEI
                     SEHLLPETTAYHEIWLEGEDEGDGSDYTKTFAERKTGPKKKKTLVSAGTLVDYEPLYG
                     PTYLPRKFKINIAVPPYNDVDVYGHDIGLIAIVEDNEVVGFNVLAGGGMGVTHNNKKT
                     YPRTGSLLGYVEKANIVNVCEKVMLVQRDNGDRGNRKHARLKYTVDDLGVDTFRSKVE
                     KLLGYKFEPGRDIHFDSNTDTFGWVTDETGKHHFTTFVENGRVEDTPELQFKTGLREV
                     AKIMKGDNEFRLTANQHILISNISDDQLDQFKELLAKYKLDNVTFSGLRLSSAACVAF
                     PTCGLAMAESERYLPVLVTKLEEALEEYGLRHDSIVLRMTGCPNGCARPWLAEVALVG
                     KAYDTYNLLLGGGFHGQRINKLYRSSIKEDEILAILKPLFKRWALERNDGEHFGDFLI
                     RVGVIAETTEGKNFWDNVPEEA"
     gene            <771439..>772680
                     /locus_tag="AWJ20_244"
                     /db_xref="GeneID:30034351"
     mRNA            <771439..>772680
                     /locus_tag="AWJ20_244"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879383.1"
                     /db_xref="GeneID:30034351"
     CDS             771439..772680
                     /locus_tag="AWJ20_244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734490.1"
                     /db_xref="GeneID:30034351"
                     /translation="MLDLVLPAGIVIVLFYFIYNGLRHTIKPKIKSKQVETEEKPDDV
                     CNLVPSPIGLTPEKLPFYNDRPWRPFRWPYHQTMSIRKLDINHWLDMDKWYVRYIKER
                     KDILSKYKEKVFGYLPESEAASRELLETVVAHMLARYPKLFKLDTENPNRFHNLITGE
                     VLDLKDEKLHPLEVAGRIAKEDFYIVQRRPDGRHYLTAMLVAFPGGFFANEENIGKHL
                     DQIHTSVPYYQTKLQPSMERFFGKLKVNEPVERASFIIAYDKGLYTTKMHEHDPGNRY
                     SHQSFDHVPHSKFGVRVERQALRRLPKTQAIIFTNHPIFYTFEEMKDEPMIPSILRNI
                     IKDGPEKILPYKLYNVLEPYLGPYLESLIQRQIDMGIIKESDPVRTIPTYPFAHWIDT
                     GPTEYGWTSPHQPDTAEPTAL"
     gene            <773653..>775821
                     /locus_tag="AWJ20_245"
                     /db_xref="GeneID:30034362"
     mRNA            <773653..>775821
                     /locus_tag="AWJ20_245"
                     /product="NADH:ubiquinone oxidoreductase 78kD subunit"
                     /transcript_id="XM_018879393.1"
                     /db_xref="GeneID:30034362"
     CDS             773653..775821
                     /locus_tag="AWJ20_245"
                     /inference="similar to AA sequence:KEGG_Orthology:K03934"
                     /note="Neurospora crassa e-Compendium ncu01765.3"
                     /codon_start=1
                     /product="NADH:ubiquinone oxidoreductase 78kD subunit"
                     /protein_id="XP_018734491.1"
                     /db_xref="GeneID:30034362"
                     /translation="MLSRVRLLGGRTGVSSSGIAGAGARRLLSSTAVRRAQVELTIDG
                     KKVSIEAGSALIQACEKAGVTVPRYCYHEKLAIAGNCRMCLVDVERAPKPVASCAFPV
                     APGMVVRTDTERVKKAREGVTEMILANHPLDCPVCDQGGECDLQDQSLRYGSDRGRFK
                     EIAGKRATEDKDIGPLVKTSMNRCIQCTRCIRFANDVAGAPELGSSGRGNEMQIGTYI
                     EQNLKSELSGNVIDLCPVGALTSKPYAFKARPWELKKTETIDVFDALGSNIRVDSRGT
                     AVMRVLPRLNDDINEEWISDKTRFAVDGLNTQRLTKPLIKVGDAFQDATWEDVLVTIQ
                     EKVKALNIKGDEFKAIAGDLVDVESLVALKDLTNKLGSENLALDHKGGNLPPAHGVDI
                     RSNYLFNSSIRGIDQADVILLVGTNPRHEAAVLNARIRKQFLNSEVEIGLIGEEFDST
                     FWVENFGNDHASLVKALEGEFGKKLANAKNPLIITGSGVVENSDASAIFKTIGDFVVK
                     HKNNFLTENWNGYNLLHRAASRAGAYEVGFAPPSAEIAKVTPKVVYLLGADEVQAQDI
                     PKDAFVIYQGHHGDVGASFADVILPGAAYTEKSATYVNTEGRAQTTRAAVAPPGAARE
                     DWKIIRAVADVLDVELPYDDIEQIRSRVADIAPNLVYYDVVEPSSLAEVGVKVQLVDN
                     NHSATATGAPLTKVIDNFYFTDAISRSSPTMAKSSVAFNN"
     gene            <778393..>779268
                     /gene="SPS19"
                     /locus_tag="AWJ20_246"
                     /db_xref="GeneID:30034373"
     mRNA            <778393..>779268
                     /gene="SPS19"
                     /locus_tag="AWJ20_246"
                     /product="Sps19p"
                     /transcript_id="XM_018879404.1"
                     /db_xref="GeneID:30034373"
     CDS             778393..779268
                     /gene="SPS19"
                     /locus_tag="AWJ20_246"
                     /inference="similar to AA sequence:KEGG_Orthology:K13237"
                     /note="Peroxisomal 2,4-dienoyl-CoA reductase; auxiliary
                     enzyme of fatty acid beta-oxidation; homodimeric enzyme
                     required for growth and sporulation on petroselineate
                     medium; expression induced during late sporulation and in
                     the presence of oleate; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 9268358];
                     GO_component: GO:0005777 - peroxisome [Evidence IEA,IEA];
                     GO_function: GO:0008670 - 2,4-dienoyl-CoA reductase
                     (NADPH) activity [Evidence IEA]; GO_function: GO:0008670 -
                     2,4-dienoyl-CoA reductase (NADPH) activity [Evidence
                     IDA,ISS] [PMID 9268358]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_process:
                     GO:0030437 - ascospore formation [Evidence IEP,IMP] [PMID
                     7969036]; GO_process: GO:0009062 - fatty acid catabolic
                     process [Evidence IDA,ISS] [PMID 9268358]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence IEA];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="Sps19p"
                     /protein_id="XP_018734492.1"
                     /db_xref="GeneID:30034373"
                     /translation="MPNTLGQSYLQTSPWKKNLFDGKVVFVTGGAGSICRVEVEALVL
                     LGANAAIIGRRKDVTEKAAEEIGQLRPGAKVIGIGGVDVRDVKSLASAVDTTVGQLGR
                     IDFVIAGAAGNFLANVANLSANAFKTVVDIDLLGSYNTFKATFDELRKNKGHIIFISA
                     TLHYTGLPMQVHASAAKAGVDSLMRTLAVELGPLGIRSNAIAPGPIAGTEGMDRLSGK
                     NDPNRFNRIPLQRYGTTTEIADATVYLFSDASSYITGTVTVVDGGSWQTGSVTASSAM
                     YPTKITELNSKTAKL"
     gene            <779566..>779639
                     /locus_tag="AWJ20_247"
                     /db_xref="GeneID:30034384"
     tRNA            <779566..>779639
                     /locus_tag="AWJ20_247"
                     /product="tRNA-Val"
                     /db_xref="GeneID:30034384"
     gene            <779945..>780619
                     /gene="POX1"
                     /locus_tag="AWJ20_248"
                     /db_xref="GeneID:30034395"
     mRNA            <779945..>780619
                     /gene="POX1"
                     /locus_tag="AWJ20_248"
                     /product="acyl-CoA oxidase"
                     /transcript_id="XM_018879425.1"
                     /db_xref="GeneID:30034395"
     CDS             779945..780619
                     /gene="POX1"
                     /locus_tag="AWJ20_248"
                     /inference="similar to AA sequence:KEGG_Orthology:K00232"
                     /note="Fatty-acyl coenzyme A oxidase; involved in the
                     fatty acid beta-oxidation pathway; localized to the
                     peroxisomal matrix; GO_component: GO:0005782 - peroxisomal
                     matrix [Evidence IDA] [PMID 11967269]; GO_component:
                     GO:0005777 - peroxisome [Evidence IEA,IEA,IEA];
                     GO_function: GO:0003995 - acyl-CoA dehydrogenase activity
                     [Evidence IEA]; GO_function: GO:0003997 - acyl-CoA oxidase
                     activity [Evidence IEA,IEA]; GO_function: GO:0003997 -
                     acyl-CoA oxidase activity [Evidence ISA] [PMID 2189786];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_function:
                     GO:0016627 - oxidoreductase activity, acting on the CH-CH
                     group of donors [Evidence IEA]; GO_process: GO:0006635 -
                     fatty acid beta-oxidation [Evidence IEA]; GO_process:
                     GO:0006635 - fatty acid beta-oxidation [Evidence IMP]
                     [PMID 12819196]; GO_process: GO:0033540 - fatty acid
                     beta-oxidation using acyl-CoA oxidase [Evidence IEA];
                     GO_process: GO:0033540 - fatty acid beta-oxidation using
                     acyl-CoA oxidase [Evidence ISA] [PMID 2189786];
                     GO_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA,IEA]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="acyl-CoA oxidase"
                     /protein_id="XP_018734493.1"
                     /db_xref="GeneID:30034395"
                     /translation="MALNSAVLPNATSNVVIGGIHYDTTTEPPRALAEERKNVTFNVR
                     DMSYFIDGSKEVTERFEDFMNQIERDPLFSNDAFYDLTLDKKRELTMARVAQAFKYMD
                     KYKTTKERADLLLVIGLADPSVNTRMFVHFNLFLSGVQGSGTDAQLKYWASRGAVTGH
                     KFYGCFAMTEAGHGSNVAGLETTAVFDEATDEFVINTPNQAAAKVSLYHDFIRNWSPR
                     YDLPPL"
     gene            <780800..>782134
                     /gene="POX1"
                     /locus_tag="AWJ20_249"
                     /db_xref="GeneID:30034406"
     mRNA            <780800..>782134
                     /gene="POX1"
                     /locus_tag="AWJ20_249"
                     /product="acyl-CoA oxidase"
                     /transcript_id="XM_018879436.1"
                     /db_xref="GeneID:30034406"
     CDS             780800..782134
                     /gene="POX1"
                     /locus_tag="AWJ20_249"
                     /inference="similar to AA sequence:KEGG_Orthology:K00232"
                     /note="Fatty-acyl coenzyme A oxidase; involved in the
                     fatty acid beta-oxidation pathway; localized to the
                     peroxisomal matrix; GO_component: GO:0005782 - peroxisomal
                     matrix [Evidence IDA] [PMID 11967269]; GO_component:
                     GO:0005777 - peroxisome [Evidence IEA,IEA,IEA];
                     GO_function: GO:0003995 - acyl-CoA dehydrogenase activity
                     [Evidence IEA]; GO_function: GO:0003997 - acyl-CoA oxidase
                     activity [Evidence IEA,IEA]; GO_function: GO:0003997 -
                     acyl-CoA oxidase activity [Evidence ISA] [PMID 2189786];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_function:
                     GO:0016627 - oxidoreductase activity, acting on the CH-CH
                     group of donors [Evidence IEA]; GO_process: GO:0006635 -
                     fatty acid beta-oxidation [Evidence IEA]; GO_process:
                     GO:0006635 - fatty acid beta-oxidation [Evidence IMP]
                     [PMID 12819196]; GO_process: GO:0033540 - fatty acid
                     beta-oxidation using acyl-CoA oxidase [Evidence IEA];
                     GO_process: GO:0033540 - fatty acid beta-oxidation using
                     acyl-CoA oxidase [Evidence ISA] [PMID 2189786];
                     GO_process: GO:0006631 - fatty acid metabolic process
                     [Evidence IEA,IEA]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="acyl-CoA oxidase"
                     /protein_id="XP_018734494.1"
                     /db_xref="GeneID:30034406"
                     /translation="MGRDGVDNGWITFSNVRIPRTFMMMRFARVDKNGNVTQPPLAQL
                     AYGALIGGRVSMAADSFQVAKKFITIAVRYGAARRQFSSEDGQPETKLLDYTYHQRRL
                     LPLLAYTYAMRTAADGLYDMYYNATEKLANTNVSDKQGLQSAIEDIKELFSLSAGLKA
                     FSTWGCGHIIDEARQSCGGHGYSSYNAFGPGYADWIVNTIWEGDNNVLTLSAGRALVQ
                     SGVALRKGKRLGGPVEYLSRSEELKNAGLGSNHDSALRDPATIIKSWESICSQAINST
                     VDKFLELTQKENLSLTQAFEQLSLQRFQIARIHTRLYVIRSFFERVEKTQDGPLKKAV
                     LDVALLFALWSIENESGIFLKYNFFTPDDLDTITELVNEYCRKVRVNAIGLTDAFNLS
                     DYYINSAIGNYNGDFYKSYFEKVTRRNPPEEIRPPYYDSLMRPFFDRTNDEA"
     gene            <782876..>783643
                     /locus_tag="AWJ20_250"
                     /db_xref="GeneID:30034418"
     mRNA            <782876..>783643
                     /locus_tag="AWJ20_250"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879448.1"
                     /db_xref="GeneID:30034418"
     CDS             782876..783643
                     /locus_tag="AWJ20_250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734495.1"
                     /db_xref="GeneID:30034418"
                     /translation="MRLHIKYLISLYRAINNPRLSILAIDYSLAPEVVFPAALTEIAT
                     VYSELVDHDGCNNIILSGDSAGGNLCIVLSAHLKHHYEDLSVPSRYVQPIAEVLISPW
                     VELDPVLQGSYVSNKDSDVLGGSFLKEVSKLYCPDNKLQQSPFVNPARSKPEFWEGVF
                     PEKTLVTFGQNEIMRDDIIKFARIASIEHRYGDIGGFHCSVLSAKNYDQNKLFNGIVS
                     FIQRSLQQTVGLAAGEATAVDIEALESRNKVMRTSKL"
     gene            complement(<783732..>784652)
                     /gene="HOL1"
                     /locus_tag="AWJ20_251"
                     /db_xref="GeneID:30034429"
     mRNA            complement(<783732..>784652)
                     /gene="HOL1"
                     /locus_tag="AWJ20_251"
                     /product="Hol1p"
                     /transcript_id="XM_018879458.1"
                     /db_xref="GeneID:30034429"
     CDS             complement(783732..784652)
                     /gene="HOL1"
                     /locus_tag="AWJ20_251"
                     /note="Putative transporter in the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; mutations in membrane-spanning domains permit
                     cation and histidinol uptake; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005886 - plasma
                     membrane [Evidence ISS] [PMID 8955402]; GO_function:
                     GO:0015665 - alcohol transmembrane transporter activity
                     [Evidence IMP] [PMID 2405251]; GO_function: GO:0022890 -
                     inorganic cation transmembrane transporter activity
                     [Evidence IMP] [PMID 8955402]; GO_process: GO:0006812 -
                     cation transport [Evidence IMP] [PMID 8955402];
                     GO_process: GO:0015850 - organic hydroxy compound
                     transport [Evidence IMP] [PMID 2405251]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Hol1p"
                     /protein_id="XP_018734496.1"
                     /db_xref="GeneID:30034429"
                     /translation="MPETKWERGRKADVIQVSNEKETTSTIEDSSSVSKPGAEVSDNQ
                     AGTYMLDDFLYKGRPHRRQFGLLFHNKEESIFSILKLFWIPVKLCSYPIIVWASIVYS
                     GCASLFLMINMTQSANFAAPPYNFSPSAVGYTNFAVLGGLVIGLFTAGPFSDWICKFS
                     TKRNGNVREPEMRLPALIPFAIIATVGTVIITVGYTQKWDWPVIVILGYGCIGLQTSS
                     IMGIVSTYAVDGYVNASGSIFVLASIFKDVYGYGVSKYLPPMIPEKGYTTSIMVVYAV
                     AIGPLALAVVMYFIGKPLRRLSRNSSVHHM"
     gene            complement(<785009..>785449)
                     /locus_tag="AWJ20_252"
                     /db_xref="GeneID:30034440"
     mRNA            complement(<785009..>785449)
                     /locus_tag="AWJ20_252"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879468.1"
                     /db_xref="GeneID:30034440"
     CDS             complement(785009..785449)
                     /locus_tag="AWJ20_252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734497.1"
                     /db_xref="GeneID:30034440"
                     /translation="MLRDVDLEHQLEEDVQNELHIDLPPGTELMHDVGHIHFAKKGNT
                     VLIPQPDNNPNDPLNWSKPWKYSILIGSSLLSFIHQIGGLSIAPQVPFYVEEFNRSAD
                     DVLLLTGVYILLMGLSTWFWIPISEKYGRRIVILSVSQNIFDIL"
     gene            <786833..>787966
                     /gene="CDC43"
                     /locus_tag="AWJ20_253"
                     /db_xref="GeneID:30034451"
     mRNA            <786833..>787966
                     /gene="CDC43"
                     /locus_tag="AWJ20_253"
                     /product="protein geranylgeranyltransferase type I subunit
                     CDC43"
                     /transcript_id="XM_018879479.1"
                     /db_xref="GeneID:30034451"
     CDS             786833..787966
                     /gene="CDC43"
                     /locus_tag="AWJ20_253"
                     /inference="similar to AA sequence:KEGG_Orthology:K11713"
                     /note="Beta subunit of geranylgeranyltransferase type I;
                     catalyzes geranylgeranylation to the cysteine residue in
                     proteins containing a C-terminal CaaX sequence ending in
                     Leu or Phe; has substrates important for morphogenesis;
                     GO_component: GO:0005953 - CAAX-protein
                     geranylgeranyltransferase complex [Evidence IDA] [PMID
                     1400380]; GO_component: GO:0005622 - intracellular
                     [Evidence TAS] [PMID 9891811]; GO_function: GO:0004662 -
                     CAAX-protein geranylgeranyltransferase activity [Evidence
                     IEA]; GO_function: GO:0004662 - CAAX-protein
                     geranylgeranyltransferase activity [Evidence IDA] [PMID
                     1400380]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0004659 -
                     prenyltransferase activity [Evidence IEA]; GO_function:
                     GO:0004661 - protein geranylgeranyltransferase activity
                     [Evidence IDA] [PMID 10066831]; GO_function: GO:0004661 -
                     protein geranylgeranyltransferase activity [Evidence IDA]
                     [PMID 2034682]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0006874 - cellular
                     calcium ion homeostasis [Evidence TAS] [PMID 9891811];
                     GO_process: GO:0030010 - establishment of cell polarity
                     [Evidence TAS] [PMID 9891811]; GO_process: GO:0018344 -
                     protein geranylgeranylation [Evidence IDA] [PMID 2034682];
                     GO_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence TAS] [PMID 9891811]"
                     /codon_start=1
                     /product="protein geranylgeranyltransferase type I subunit
                     CDC43"
                     /protein_id="XP_018734498.1"
                     /db_xref="GeneID:30034451"
                     /translation="MPSAYTSYDSSHVSLVYFCIAGLKLLNALTEVIPNETDRSNWIE
                     WVYLHLTPSGNGFRGSLSHDLQQSTTLDGDNINDPAHLASTFFCLSILAILQDRSMTT
                     RLDRVKILRYVKSCQRSTGQFSGLSHPSIGPVGDNDPRYTYVAAAIRRILKGDQLHET
                     LKAEVDFNVKKASDFIKSTKSYDGGLGDKQGSESHAGLVFCGIAALDLMNTLNCKDWV
                     DTAVWLSKRQLSEFTIDHSYSITADGDYDQHSRDNDTRHGASSFCCWNSWEAGGFNGR
                     LNKPADTCYAYWTCASLTVLNSANFVSSPAARTFLLENCMDPVLGGMVKVKGSYADPL
                     HSYLGLAALAMISPELGFCEFNPSLTLPVETVSFIDTLDWNPL"
     gene            complement(<788069..>788150)
                     /locus_tag="AWJ20_254"
                     /db_xref="GeneID:30034462"
     tRNA            complement(<788069..>788150)
                     /locus_tag="AWJ20_254"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30034462"
     gene            <790117..>791385
                     /gene="RNT1"
                     /locus_tag="AWJ20_255"
                     /db_xref="GeneID:30034473"
     mRNA            <790117..>791385
                     /gene="RNT1"
                     /locus_tag="AWJ20_255"
                     /product="Rnt1p"
                     /transcript_id="XM_018879498.1"
                     /db_xref="GeneID:30034473"
     CDS             790117..791385
                     /gene="RNT1"
                     /locus_tag="AWJ20_255"
                     /inference="similar to AA sequence:KEGG_Orthology:K03685"
                     /note="Nuclear dsRNA-specific ribonuclease (RNase III);
                     involved in rDNA transcription, rRNA processing and U2
                     snRNA 3' end formation by cleavage of a stem-loop
                     structure at the 3' end of U2 snRNA; involved in
                     polyadenylation-independent transcription termination;
                     involved in the cell wall stress response, regulating the
                     degradation of cell wall integrity and morphogenesis
                     checkpoint genes; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 15090619]; GO_component: GO:0005654 -
                     nucleoplasm [Evidence IDA] [PMID 15090619]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0004519 - endonuclease activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0004518 - nuclease activity
                     [Evidence IEA]; GO_function: GO:0004525 - ribonuclease III
                     activity [Evidence IEA,IEA]; GO_function: GO:0004525 -
                     ribonuclease III activity [Evidence IDA] [PMID 15766245];
                     GO_process: GO:0090501 - RNA phosphodiester bond
                     hydrolysis [Evidence IEA,IEA]; GO_process: GO:0090502 -
                     RNA phosphodiester bond hydrolysis, endonucleolytic
                     [Evidence IEA,IEA]; GO_process: GO:0006396 - RNA
                     processing [Evidence IEA]; GO_process: GO:0034473 - U1
                     snRNA 3'-end processing [Evidence IMP] [PMID 10508172];
                     GO_process: GO:0034475 - U4 snRNA 3'-end processing
                     [Evidence IMP] [PMID 10508172]; GO_process: GO:0034476 -
                     U5 snRNA 3'-end processing [Evidence IMP] [PMID 10508172];
                     GO_process: GO:0034963 - box C/D snoRNA processing
                     [Evidence IMP] [PMID 23201338]; GO_process: GO:0034964 -
                     box H/ACA snoRNA processing [Evidence IMP] [PMID
                     23201338]; GO_process: GO:0006325 - chromatin organization
                     [Evidence IMP] [PMID 17991894]; GO_process: GO:0006379 -
                     mRNA cleavage [Evidence IDA,IMP] [PMID 17158880];
                     GO_process: GO:0016075 - rRNA catabolic process [Evidence
                     IEA]; GO_process: GO:0006364 - rRNA processing [Evidence
                     IMP] [PMID 17991894]; GO_process: GO:0009303 - rRNA
                     transcription [Evidence IMP] [PMID 17991894]; GO_process:
                     GO:0060237 - regulation of fungal-type cell wall
                     organization [Evidence IGI,IMP] [PMID 22576366];
                     GO_process: GO:0030847 - termination of RNA polymerase II
                     transcription, exosome-dependent [Evidence IDA,IMP,IPI]
                     [PMID 19818713]"
                     /codon_start=1
                     /product="Rnt1p"
                     /protein_id="XP_018734499.1"
                     /db_xref="GeneID:30034473"
                     /translation="MSREFSTKNFFTSIALEIVLKLPENSAEEMLYWPPLTSAYPLKE
                     EEEYERESELVTNGSEVNGLFGDSSDHDGLKNVNGARKADEAGETYEALKIKSKRDKN
                     DRLEVFDKKTNQSKTIRRRGQSEKIRLCGLEKSDGVYDANDVHERAKELEEIVDNGMN
                     YSTQSRSKSTNNESTPTGNLSLRPSRVSDLPSMVTTPLEVLEHGISSNSSNEPKTMDY
                     DGYHIVTSHTNVPESPASPEWKWPPRLPLLSQERVERQVYAQKPLPDSNEFQSLVVSS
                     MFYKNNRRLKYLGKSILDFTMSALIFERFQKATSTEMRIFKKKLLNQRQIEKWSRIYE
                     FHHYVDVDHEFKLGQMEWQAPDYEADPSGNTWYSKPQDEDISPLQDAFEAYVGAIYLD
                     PCLGPEAIKSWLSLLAEPILSGKEEPSSWE"
     gene            <791751..>792131
                     /gene="IES6"
                     /locus_tag="AWJ20_256"
                     /db_xref="GeneID:30034484"
     mRNA            <791751..>792131
                     /gene="IES6"
                     /locus_tag="AWJ20_256"
                     /product="Ies6p"
                     /transcript_id="XM_018879509.1"
                     /db_xref="GeneID:30034484"
     CDS             791751..792131
                     /gene="IES6"
                     /locus_tag="AWJ20_256"
                     /inference="similar to AA sequence:KEGG_Orthology:K11667"
                     /note="Component of the INO80 chromatin remodeling
                     complex; critical for INO80 function; involved in
                     regulation of chromosome segregation and maintenance of
                     normal centromeric chromatin structure; human ortholog
                     INO80C is a member of the human INO80 complex; implicated
                     in DNA repair based on genetic interactions with RAD52
                     epistasis genes; GO_component: GO:0031011 - Ino80 complex
                     [Evidence IPI] [PMID 24034245]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0006338 - chromatin remodeling [Evidence IMP] [PMID
                     23207916]; GO_process: GO:0051983 - regulation of
                     chromosome segregation [Evidence IMP] [PMID 23207916];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Ies6p"
                     /protein_id="XP_018734500.1"
                     /db_xref="GeneID:30034484"
                     /translation="MSSASESPSLIEQADFSTVPKPFKSESWKQSNKRYKNLKALVTD
                     EQKRLASLPPSDDKATYFSIEAPPSLRPQKHWCDITGLPGRYKSARHGLRFYNVEIFK
                     AIDEMAPGADQQYLSLRNANVILR"
     gene            complement(<796540..>797376)
                     /gene="TAD3"
                     /locus_tag="AWJ20_257"
                     /db_xref="GeneID:30034495"
     mRNA            complement(<796540..>797376)
                     /gene="TAD3"
                     /locus_tag="AWJ20_257"
                     /product="Tad3p"
                     /transcript_id="XM_018879520.1"
                     /db_xref="GeneID:30034495"
     CDS             complement(796540..797376)
                     /gene="TAD3"
                     /locus_tag="AWJ20_257"
                     /note="Subunit of tRNA-specific adenosine-34 deaminase;
                     forms a heterodimer with Tad2p that converts adenosine to
                     inosine at the wobble position of several tRNAs;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0008251
                     - tRNA-specific adenosine deaminase activity [Evidence
                     IDA] [PMID 10550050]; GO_function: GO:0008270 - zinc ion
                     binding [Evidence IEA]; GO_process: GO:0006400 - tRNA
                     modification [Evidence IDA] [PMID 10550050]; GO_process:
                     GO:0008033 - tRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="Tad3p"
                     /protein_id="XP_018734501.1"
                     /db_xref="GeneID:30034495"
                     /translation="MWRGNPNAIRNEITSNEVEAMRKHLKSLVQLSKQHAPGELPIST
                     LIVDPETDTVVVSNSDARHSNGNPINHSIMVALYDAAILEAERRRQLSAERSSRSSSL
                     RPDEVNSRASTPSLNVNNINNSQSLNGTTTISCATTTTVTSTTIDNLHNTDLSPPGLM
                     TASSASVSSASTLNTLDQLSPDDKNYLCLNMHVYTTHEPCPMCAMALVHSRIARLIYI
                     KPSPKTGAIEPTSGASYGVHWNKLLNWKYEAWRWQADGYLATDDDKLISSVEDISPDI
                     NG"
     gene            complement(<803537..>804172)
                     /gene="SOD1"
                     /locus_tag="AWJ20_258"
                     /db_xref="GeneID:30034506"
     mRNA            complement(<803537..>804172)
                     /gene="SOD1"
                     /locus_tag="AWJ20_258"
                     /product="superoxide dismutase SOD1"
                     /transcript_id="XM_018879529.1"
                     /db_xref="GeneID:30034506"
     CDS             complement(803537..804172)
                     /gene="SOD1"
                     /locus_tag="AWJ20_258"
                     /inference="similar to AA sequence:KEGG_Orthology:K04565"
                     /note="Cytosolic copper-zinc superoxide dismutase;
                     detoxifies superoxide; stabilizes Yck1p and Yck2p kinases
                     in glucose to repress respiration; phosphorylated by Dun1p
                     and enters the nucleus under oxidative stress to promote
                     transcription of stress response genes; human ortholog
                     implicated in ALS; abundance increases under DNA
                     replication stress and during exposure to boric acid;
                     localization of a fraction to the mitochondrial
                     intermembrane space is modulated by the MICOS complex;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     11500508]; GO_component: GO:0005758 - mitochondrial
                     intermembrane space [Evidence IEA]; GO_component:
                     GO:0005758 - mitochondrial intermembrane space [Evidence
                     IDA] [PMID 11500508]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     18977757]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 24647101]; GO_function: GO:0016209 -
                     antioxidant activity [Evidence IEA]; GO_function:
                     GO:0005507 - copper ion binding [Evidence IBA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA,IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA]; GO_function: GO:0004784 -
                     superoxide dismutase activity [Evidence IEA,IEA];
                     GO_function: GO:0004784 - superoxide dismutase activity
                     [Evidence IDA] [PMID 3290902]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IBA]; GO_process: GO:0001320 -
                     age-dependent response to reactive oxygen species involved
                     in chronological cell aging [Evidence IMP] [PMID 8647826];
                     GO_process: GO:0006878 - cellular copper ion homeostasis
                     [Evidence IMP] [PMID 8530401]; GO_process: GO:0006882 -
                     cellular zinc ion homeostasis [Evidence IMP] [PMID
                     11581253]; GO_process: GO:0031505 - fungal-type cell wall
                     organization [Evidence IMP] [PMID 20176017]; GO_process:
                     GO:1901856 - negative regulation of cellular respiration
                     [Evidence IMP] [PMID 23332757]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0051091 - positive regulation of
                     sequence-specific DNA binding transcription factor
                     activity [Evidence IMP] [PMID 18977757]; GO_process:
                     GO:0036091 - positive regulation of transcription from RNA
                     polymerase II promoter in response to oxidative stress
                     [Evidence IMP] [PMID 24647101]; GO_process: GO:0050821 -
                     protein stabilization [Evidence IMP,IPI] [PMID 23332757];
                     GO_process: GO:0019430 - removal of superoxide radicals
                     [Evidence IBA]; GO_process: GO:0006801 - superoxide
                     metabolic process [Evidence IEA]; GO_process: GO:0006801 -
                     superoxide metabolic process [Evidence IMP] [PMID
                     3290902]"
                     /codon_start=1
                     /product="superoxide dismutase SOD1"
                     /protein_id="XP_018734502.1"
                     /db_xref="GeneID:30034506"
                     /translation="MLGVKWLCLPSSNRLEHPAETPADWTARHVDSSEARGATRSGAA
                     PQPPEAHPLQELNANRAVAVLRGDSDVKGVVHFEQTSEDEYATVSWEITGNDKNALRG
                     FHIHQFGDNTNGCTSAGPHFNPLKKEHGAPEDENRHVGDLGNITTDANGVSKGSKKDL
                     LIKLFGENSIIGRTVVVHAGTDDLGKGGHADSLTTGNAGGRNACGVIGVSN"
     gene            <807445..>808455
                     /locus_tag="AWJ20_259"
                     /db_xref="GeneID:30034517"
     mRNA            <807445..>808455
                     /locus_tag="AWJ20_259"
                     /product="Pc12g14970"
                     /transcript_id="XM_018879540.1"
                     /db_xref="GeneID:30034517"
     CDS             807445..808455
                     /locus_tag="AWJ20_259"
                     /codon_start=1
                     /product="Pc12g14970"
                     /protein_id="XP_018734503.1"
                     /db_xref="GeneID:30034517"
                     /translation="MGQVKTLEDLPSYNQLPNKQRFWEWGPPGSHEEGLGKQNLLTPE
                     HVAKSAKSEIKTGDRIGLGWEMHKLEYPAFGRKHFDLKIDARSEFSLDDIYEFNPQQS
                     SQWDGFRHYQQPVAFSGADEDKQKGKVDGLWFGGASRSEITEKGSTRIGVHHWAQQGI
                     VGRGVLIDYATYAEEKGIKYSCFEPNIITHADLQGAIKRFNVDIQPADIVFIRIGLPR
                     EWDKYSDEEKKAIQERPPEFMGLEPSQDNLSWIWDNHFPAVASDAIALEVLPKGGYPN
                     GLPMHQHLLAGWGVTIGEIFNLEPLAELCKKLNRYSFFVASVPLNAVGAVSTPPNAVA
                     IF"
     gene            complement(<809303..>809662)
                     /locus_tag="AWJ20_260"
                     /db_xref="GeneID:30034529"
     mRNA            complement(<809303..>809662)
                     /locus_tag="AWJ20_260"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879552.1"
                     /db_xref="GeneID:30034529"
     CDS             complement(809303..809662)
                     /locus_tag="AWJ20_260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734504.1"
                     /db_xref="GeneID:30034529"
                     /translation="MVLAEEVVHFRYHYHLQLPLSHLYIHIFDRHIPDSETVALDASV
                     PAEAVVVGIYQTHLAVDTDTLADTLADTLLDTPVDTAADTPVDTSVDTPVDTPVDTPA
                     VDAPAVDAAANAAVRTW"
     gene            <809308..>812684
                     /gene="TUS1"
                     /locus_tag="AWJ20_261"
                     /db_xref="GeneID:30034540"
     mRNA            join(<809308..812348,812447..>812684)
                     /gene="TUS1"
                     /locus_tag="AWJ20_261"
                     /product="Rho family guanine nucleotide exchange factor
                     TUS1"
                     /transcript_id="XM_018879563.1"
                     /db_xref="GeneID:30034540"
     CDS             join(809308..812348,812447..812684)
                     /gene="TUS1"
                     /locus_tag="AWJ20_261"
                     /codon_start=1
                     /product="Rho family guanine nucleotide exchange factor
                     TUS1"
                     /protein_id="XP_018734505.1"
                     /db_xref="GeneID:30034540"
                     /translation="MYGQQHSQQHPQQEHPQQGYQQGYQQGYQQRYPQEYQQQYQQEY
                     QEGYQQEYQQEYQYQQPNVSDRYQQPLPLPGQRHPELQSQSPGYGGQRYGYRGEKEAA
                     VNGNGIGNGPPLPPKPYQANDDGLVRLNQAMSGVRLVGPRQPTTGQGFGNYNDYTSNN
                     SNTDSGSSNIGRGKSYSDEYGGSGSANGFSAVTEFADRRPTFHPSGPRSPPRTGSPTR
                     NSYQTTPGNLYSTQTDGSTAATYGYSQPLAPQVPSQVPPLVPPVPVLQAPTTEFRHSN
                     PTNTFDLSTPSRYDIVGGTGSIRPRLHLDPQPSTPPSQHYSHPQQTPPSQGYVHPQQP
                     SHQSYSPLPFVPDQYNNQRSNWDEQPVQVPRLSPINAEAPRFGNDNLTRQAPVSDYSD
                     EEEYEEDSSSFVSGIREELNSLYPSSPYGQTAGRDTSITPQQYTYQSTSPTIDRYSYG
                     QDYQAQVQPDPRSEYQPHYEPDYQNQQQYTNHRQNQSDLVPKRLSLPSQSNVLYQESD
                     RQNRRLSNIVAGVSNTQFDNNVSTAVNAGSDMFRSTSDVSQGPSYGTVPQSSQSNPSP
                     QLRQWTQQQTANRVPVGSSDRIPSYGNQAIPEFNRSLTTSDVPPVSTLAPSSASVYSA
                     QTDMSSSLLSSTRSTDNDLMIKMGLPVIPDTVPVFDASRLSSRDYERCKEIWSLSSVS
                     QWIASLFRNDLQVTVKEVNRALVGLFTHYIPTLNWLHAEVMADDFIRTLRASGFITIK
                     EEENTKTNQENRTVPASVPKPTITGLKTGSSPCVQINSSVSVSGVFPILTGGGCYSKY
                     SHEIKRDQVQPYRCYSPKCSRTIPVRAALPTIDIANVDSAANKDWATCYSIDKAQQLE
                     IGKREVSRQSAIHELIAGEESYVSDLNILLSVYGESLSRIVPTIIDDQAEFCAAAFGL
                     VKGVMNCNSQYLLRGLRERQAQESPFITGVADIVLEWVKHAKEPYISYVNSYPQVDRR
                     IRKEKETNIPFSDWLDRTSRDVRTKGVPHSFYFQRVIPRFLRPRLQPATGRNPEIHGP
                     AGSGRAAQVGEQKHEARTATKRRQTANHPTRRGSPQRGPQRRLGSQPPDSARQLPPHR
                     QTPA"
     gene            <812875..>814602
                     /gene="ROM2"
                     /locus_tag="AWJ20_262"
                     /db_xref="GeneID:30034551"
     mRNA            <812875..>814602
                     /gene="ROM2"
                     /locus_tag="AWJ20_262"
                     /product="Rho family guanine nucleotide exchange factor
                     ROM2"
                     /transcript_id="XM_018879574.1"
                     /db_xref="GeneID:30034551"
     CDS             812875..814602
                     /gene="ROM2"
                     /locus_tag="AWJ20_262"
                     /codon_start=1
                     /product="Rho family guanine nucleotide exchange factor
                     ROM2"
                     /protein_id="XP_018734506.1"
                     /db_xref="GeneID:30034551"
                     /translation="MDLLVLESADDEPVVKSSSAKLLGSNVTPATDHRKIAVSRRFIG
                     GSGQTSPTKPGMSPTSLTSAGSASVTMLNDVDKDRDILFPFRITHAGLGANLTLYTFS
                     TPEKARRDRELWRDAIMNAKREYSSAATTLKSEPFRLRVLADQAFGYDSSSAPQIPVH
                     TAGTALDRAVREAESRTPVSLTRSNDSTSATSVSTLVDGGAGDGPRQVVNSLINSPVN
                     CGVSFVYADRNEYCMLGLDYGVYLHDKRVGSVWKRCLTLTHVTQIAVIQDMNVAIILA
                     GKTLAYYHLDVLINQATKPDTQKSTVVPKGYKLSEKNVGFFATGIMRDRILLFYKKTD
                     GLSSVFKVLEPVREKGSQQKRSKVLFSRDETLSSTEYFRDVDKFYIPTESYGISLFKS
                     TFAVHTTKGFELLSFDTKSTPLSLPLIAPQALQNVLRISRGFKFSSVDSFKKKIESSK
                     PLGMFRVTSESIILCYAEFALYTDNDGNLNDRNAVFSYLSKAKKVSFQMPHLIIFGDE
                     IIEVRRVDRSGQLRQVITGKHIRCIDSRDGQIKAAMVHPLIRTKQLVVELVENEFAVM
                     DDTSTLSGY"
     gene            complement(<816386..>816766)
                     /locus_tag="AWJ20_263"
                     /db_xref="GeneID:30034562"
     mRNA            complement(<816386..>816766)
                     /locus_tag="AWJ20_263"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879585.1"
                     /db_xref="GeneID:30034562"
     CDS             complement(816386..816766)
                     /locus_tag="AWJ20_263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734507.1"
                     /db_xref="GeneID:30034562"
                     /translation="MTGLVFYLERTKGFYAAYNEMAAGVAVYFVLALAYQFWISKVEK
                     NAKYLGQHPSTGSRIAIITSSPKATSEYNVTVYISDKSDKVVETQELKGNFTDWFNVN
                     GFIVYDKFATAIASVVPTVPKKDL"
     gene            <818272..>820653
                     /gene="MAG2"
                     /locus_tag="AWJ20_264"
                     /db_xref="GeneID:30034573"
     mRNA            <818272..>820653
                     /gene="MAG2"
                     /locus_tag="AWJ20_264"
                     /product="Mag2p"
                     /transcript_id="XM_018879595.1"
                     /db_xref="GeneID:30034573"
     CDS             818272..820653
                     /gene="MAG2"
                     /locus_tag="AWJ20_264"
                     /note="Cytoplasmic hypothetical protein; induced in
                     response to mycotoxin patulin; ubiquitinated protein
                     similar to the human ring finger motif protein RNF10;
                     predicted to be involved in repair of alkylated DNA due to
                     interaction with MAG1; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]"
                     /codon_start=1
                     /product="Mag2p"
                     /protein_id="XP_018734508.1"
                     /db_xref="GeneID:30034573"
                     /translation="MSQGYNFNANSFVPGSTQVVKSPGTGPGSSPDSSNLKVATLNAS
                     RTKSSDGADTPTGKRNGSRRNSNNGNDTGHGLKTGNMNANQHRTSRNNGRGNNNNNNN
                     SNDKGGANRKSKPNGGGGGSRKESRRGGNDLSLSDILQSENRNKRGEISISHLVDLSP
                     GPEHRQSQSGRRRVPGAGSTYSSSYYSDSYYSHSNSYLDKVSYINMTCRFVLDPRLEY
                     KFLLNDPDSHVPMERVLRVICQPATCPICLEAIPEAPRMLECGHLICYPCLFRYLDAD
                     KFEVNPSPPRPSAGAASTTGSSGRKNKECPLCFDRIRIEKVKPVTLADVGDDRFDAPK
                     VDGEAILRLMFRPNDSLLSIPRDTVGAKKSDFYDLPLVSEKDISQCSRLVRGSVEYAI
                     SEFQREIAELKKSREENRLMYQDDGYWHTEAIKMIQEMIRIYSSESGLEINDKDGITG
                     SAGTTAPTSSANSPISGPSQPSTAASAIHSGQSTPQIHQIGEWQIEGDVPMGSFDSDV
                     KEEVEESISEPIIEESVKNQLSSLSLNEEPVKDIQLANAQSEKFYGRYNDESAFFFYQ
                     TGSLESSTKYFLAPLDIRILKKAFGSYSEFPAIIVVKVENILNGTSVNDQLKKRMKYL
                     GHLPTQTPVAFLECDWRDVVPGEVLRSFSKELQLRKKRKQDKEKREDRDQKRIQKEQE
                     EQFRRDLLQESNSPFSYPVGSLGSPPMNAYDDSADPVLAPVPTLPVSPILGSSDSNDG
                     SSSPWGSKTSFAQAASISKAEQDGRIIDELLSEAEQRKGRGGRKKLVLMSNRH"
     gene            complement(<820839..>822593)
                     /gene="CRN1"
                     /locus_tag="AWJ20_265"
                     /db_xref="GeneID:30034584"
     mRNA            complement(<820839..>822593)
                     /gene="CRN1"
                     /locus_tag="AWJ20_265"
                     /product="Crn1p"
                     /transcript_id="XM_018879606.1"
                     /db_xref="GeneID:30034584"
     CDS             complement(820839..822593)
                     /gene="CRN1"
                     /locus_tag="AWJ20_265"
                     /inference="similar to AA sequence:KEGG_Orthology:K13886"
                     /note="Coronin; cortical actin cytoskeletal component that
                     associates with the Arp2p/Arp3p complex to regulate its
                     activity; plays a role in regulation of actin patch
                     assembly; GO_component: GO:0005885 - Arp2/3 protein
                     complex [Evidence IDA,IPI] [PMID 12499356]; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IDA] [PMID
                     9822583]; GO_component: GO:0005826 - actomyosin
                     contractile ring [Evidence IBA]; GO_function: GO:0003779 -
                     actin binding [Evidence IEA]; GO_function: GO:0051015 -
                     actin filament binding [Evidence IEA]; GO_function:
                     GO:0051015 - actin filament binding [Evidence IDA] [PMID
                     9885246]; GO_function: GO:0008017 - microtubule binding
                     [Evidence IDA] [PMID 9885246]; GO_function: GO:0030674 -
                     protein binding, bridging [Evidence IDA] [PMID 9885246];
                     GO_process: GO:0051666 - actin cortical patch localization
                     [Evidence IMP] [PMID 18177206]; GO_process: GO:0007015 -
                     actin filament organization [Evidence IMP,IPI] [PMID
                     9885246]; GO_process: GO:0007017 - microtubule-based
                     process [Evidence IPI] [PMID 9885246]; GO_process:
                     GO:0034316 - negative regulation of Arp2/3
                     complex-mediated actin nucleation [Evidence IDA,IMP] [PMID
                     12499356]; GO_process: GO:2000601 - positive regulation of
                     Arp2/3 complex-mediated actin nucleation [Evidence
                     IDA,IMP] [PMID 21454476]"
                     /codon_start=1
                     /product="Crn1p"
                     /protein_id="XP_018734509.1"
                     /db_xref="GeneID:30034584"
                     /translation="MSEVGKLPDKIPLFRGHTAAVLDTDWNPFDETMVASASDDGKIG
                     IWKVPEGFTLRPVGEDVDDIKDVEPVKFLTGHSKKVGHIQFHPVAENILASSSGDYTV
                     RIWDIEQGKALYTLPHKDLITSFAFNHDGSLLATASRDKKLRVWDIRQEKIISEGAGH
                     AGAKASRVVWLGDSDRLATTGFSRMSDRQLGVWNATDLASGPIGSFIVLDSSAGICMP
                     FYDEGTKCLYLAGKGDGNIRYFEFVNDEFIALSEYQSIEPQRGMGVLPRRALDVKQHE
                     VVRFYKMVNDSLIEPVQFFVPRRADTFQDDIYPEARAGEHALTAEEWASGKNSAPKVI
                     SLADVFDGKTGSSFIPEKKPEQPAPKSEPKSEPKSEAKEAPKEEPKEEPKPAAVKEEP
                     KTETKEVSTPATPSTPRSIKQDDTDIFASKDVQKFLAKDAEKEDEGEKEDEDSAWKDE
                     DDIVIVKDDKIPSSSTKSNAVAEETKPEPATPTSSTPVDDEPKPTETKEPETKEPETK
                     KPEPTEATTNGNVHTPLLPKSLHETLSQHGVDKTVEVLVDHVTKLTTTVQSLLADVEK
                     KHSHIQSLEAKLEQALKK"
     gene            <824006..>825157
                     /gene="ALD4"
                     /locus_tag="AWJ20_266"
                     /db_xref="GeneID:30034595"
     mRNA            <824006..>825157
                     /gene="ALD4"
                     /locus_tag="AWJ20_266"
                     /product="aldehyde dehydrogenase (NADP(+)) ALD4"
                     /transcript_id="XM_018879617.1"
                     /db_xref="GeneID:30034595"
     CDS             824006..825157
                     /gene="ALD4"
                     /locus_tag="AWJ20_266"
                     /inference="similar to AA sequence:KEGG_Orthology:K00128"
                     /note="Mitochondrial aldehyde dehydrogenase; required for
                     growth on ethanol and conversion of acetaldehyde to
                     acetate; phosphorylated; activity is K+ dependent;
                     utilizes NADP+ or NAD+ equally as coenzymes; expression is
                     glucose repressed; can substitute for cytosolic
                     NADP-dependent aldehyde dehydrogenase when directed to the
                     cytosol; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IEA]; GO_component: GO:0042645 - mitochondrial
                     nucleoid [Evidence IDA] [PMID 10869431]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 11502169];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0004029 -
                     aldehyde dehydrogenase (NAD) activity [Evidence IDA] [PMID
                     9473035]; GO_function: GO:0004029 - aldehyde dehydrogenase
                     (NAD) activity [Evidence IMP] [PMID 9675847]; GO_function:
                     GO:0004030 - aldehyde dehydrogenase [NAD(P)+] activity
                     [Evidence IEA]; GO_function: GO:0004030 - aldehyde
                     dehydrogenase [NAD(P)+] activity [Evidence IDA] [PMID
                     9473035]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016620 -
                     oxidoreductase activity, acting on the aldehyde or oxo
                     group of donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_process: GO:0006740 - NADPH regeneration [Evidence IGI]
                     [PMID 19158096]; GO_process: GO:0019413 - acetate
                     biosynthetic process [Evidence IGI] [PMID 10919763];
                     GO_process: GO:0006067 - ethanol metabolic process
                     [Evidence IMP] [PMID 9675847]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006090 - pyruvate metabolic process
                     [Evidence IMP] [PMID 10409655]"
                     /codon_start=1
                     /product="aldehyde dehydrogenase (NADP(+)) ALD4"
                     /protein_id="XP_018734510.1"
                     /db_xref="GeneID:30034595"
                     /translation="MSVLTTISPITSSAIITTPATSIEDIDNKILPTAVSAQKKWAST
                     SLAERKAIVAKYIELLKDDETATRLGKDITKQMGRPVRYTKGEISTAALRAEVLLGYA
                     DEALAPVNVDESTRPSFKKYLTKDPLGVILIIFPWNYPYLCLTNGLIPALLAGNSVLI
                     KPSPQTPNVANEVAKLFKTAGLPDGVLQVVHSGDVQVLEGLVQRKAVAGVVFTGSVEG
                     GLAVQKAAAGRTIPIALELGGNDPAYVRSDVKDIKATAEDIVDGAIFNSGQSCCSIER
                     VYVDEKVYDQFVDAAVEIVKGYKLGDPFDESTQIGPVISEKAARGIRAQIKDAVDRGA
                     KKLIPSETFAQAEKLNPTFVAPQILVNLDETSRKYLKYSWLGRYSGPSI"
     gene            <825275..>825508
                     /locus_tag="AWJ20_267"
                     /db_xref="GeneID:30034606"
     mRNA            <825275..>825508
                     /locus_tag="AWJ20_267"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879628.1"
                     /db_xref="GeneID:30034606"
     CDS             825275..825508
                     /locus_tag="AWJ20_267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734511.1"
                     /db_xref="GeneID:30034606"
                     /translation="MNDSDLGLTASVWTSDLEVGEELGNQLEAGTVFVNRSDYPDPHL
                     AWTGFKNSGRGVSLGPFGFTFFTKLKSHHIKAL"
     gene            <833710..>836196
                     /gene="GLN4"
                     /locus_tag="AWJ20_268"
                     /db_xref="GeneID:30034617"
     mRNA            <833710..>836196
                     /gene="GLN4"
                     /locus_tag="AWJ20_268"
                     /product="glutamine--tRNA ligase"
                     /transcript_id="XM_018879639.1"
                     /db_xref="GeneID:30034617"
     CDS             833710..836196
                     /gene="GLN4"
                     /locus_tag="AWJ20_268"
                     /inference="similar to AA sequence:KEGG_Orthology:K01886"
                     /note="Glutamine tRNA synthetase; monomeric class I tRNA
                     synthetase that catalyzes the specific glutaminylation of
                     tRNA(Glu); N-terminal domain proposed to be involved in
                     enzyme-tRNA interactions; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 15706032]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 15706032];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004819 -
                     glutamine-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004819 - glutamine-tRNA ligase activity
                     [Evidence IDA] [PMID 2991203]; GO_function: GO:0016874 -
                     ligase activity [Evidence IEA]; GO_function: GO:0016876 -
                     ligase activity, forming aminoacyl-tRNA and related
                     compounds [Evidence IEA]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA,IEA];
                     GO_process: GO:0006425 - glutaminyl-tRNA aminoacylation
                     [Evidence IEA]; GO_process: GO:0006425 - glutaminyl-tRNA
                     aminoacylation [Evidence IMP,ISS] [PMID 2991203];
                     GO_process: GO:0043039 - tRNA aminoacylation [Evidence
                     IEA]; GO_process: GO:0006418 - tRNA aminoacylation for
                     protein translation [Evidence IEA]; GO_process: GO:0006412
                     - translation [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="glutamine--tRNA ligase"
                     /protein_id="XP_018734512.1"
                     /db_xref="GeneID:30034617"
                     /translation="MSEVDELAVKFEKTLGFKETKVKEILKNTKVSGSLDEILAEAGV
                     DEAHPVEDASVATLLHSLAQLSKDADEQLKKGRKSLSDLIANSGGQIKTNVQLNGGWD
                     YIVRVVKDGKSVDREELEKESGVGIVVTDDQIKESVAKYIKEHEAELVEKRYKLAPTV
                     IVGVKQLPELKWANPAAFKPIIDEQILALLGPKDERDVVKKEKKKKADTKPGAAGTGS
                     DAKSDSGAGAGAGAGSARSMFTEGFLGSLHKPGENAQIYPERMKEHLKFTGGHVMTRF
                     PPEPNGYLHIGHSKAIAINFGFAQYYNGKCYLRFDDTNPEAEEEQYFTSIKEIVEWLG
                     FKPWAITYSSDYFDQLYELAEQLILKDLAYVCFCTAEEMKAHRGISEDGTRGGKRTPC
                     KHRSQSTEENLKLFREMRDGKYAKGEATLRMKQDLENPNPQMWDLVAYRVLNATHHRT
                     GDKWKIYPTYDFTHCLVDSIENISHSLCTLEFYLSRESYDWLCNALCVYRPQQRESGR
                     LNVTGTIMSKRKILKLVNDKIVRGWDDPRLFTLVAIRRRGVPPGAVLSFIAELGVTTT
                     NSTIQASRFENSVRKYLEDSTPRLMMIPDPVPVILDNLPEDHLEFVSVPFKPGNPDFG
                     EHTVPFTRTVYVDRSDFREEASKDYFRLAPGQSVGLLKVPHNIRVTSFKKDDNGLVTE
                     IHAHYENDIPFKKPKTFIQWVAHAPAHNSPVRIAETRLFNQLFKSENPDSNPDGYLAD
                     INPDSEIILRNSIIETGFFEVKERSPWTITKPGEEKDILAGHDKKGAPEAVRFQALRV
                     GYFCLDKDSTPDSIVLNRIVTLKEDTAKNN"
     gene            <839956..>842436
                     /gene="MET30"
                     /locus_tag="AWJ20_269"
                     /db_xref="GeneID:30034628"
     mRNA            <839956..>842436
                     /gene="MET30"
                     /locus_tag="AWJ20_269"
                     /product="Met30p"
                     /transcript_id="XM_018879650.1"
                     /db_xref="GeneID:30034628"
     CDS             839956..842436
                     /gene="MET30"
                     /locus_tag="AWJ20_269"
                     /inference="similar to AA sequence:KEGG_Orthology:K10259"
                     /note="F-box protein containing five copies of the WD40
                     motif; controls cell cycle function, sulfur metabolism,
                     and methionine biosynthesis as part of the ubiquitin
                     ligase complex; interacts with and regulates Met4p,
                     localizes within the nucleus; dissociation of Met30p from
                     SCF complex in response to cadmium stress is regulated by
                     Cdc48p; GO_component: GO:0019005 - SCF ubiquitin ligase
                     complex [Evidence IDA] [PMID 9716410]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0043224 - nuclear SCF ubiquitin ligase complex
                     [Evidence IDA] [PMID 10637232]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 10637232]; GO_function:
                     GO:0043130 - ubiquitin binding [Evidence IDA] [PMID
                     21070969]; GO_process: GO:0006270 - DNA replication
                     initiation [Evidence IMP] [PMID 15870262]; GO_process:
                     GO:0000082 - G1/S transition of mitotic cell cycle
                     [Evidence IMP] [PMID 15870262]; GO_process: GO:0031146 -
                     SCF-dependent proteasomal ubiquitin-dependent protein
                     catabolic process [Evidence IGI] [PMID 9716410];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0019344 - cysteine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0009086 - methionine biosynthetic process [Evidence
                     IEA]; GO_process: GO:0000209 - protein polyubiquitination
                     [Evidence IMP] [PMID 9716410]; GO_process: GO:0016567 -
                     protein ubiquitination [Evidence IEA]; GO_process:
                     GO:0016567 - protein ubiquitination [Evidence IGI,IPI]
                     [PMID 9499404]; GO_process: GO:0030174 - regulation of
                     DNA-dependent DNA replication initiation [Evidence IMP]
                     [PMID 15870262]; GO_process: GO:0000083 - regulation of
                     transcription involved in G1/S transition of mitotic cell
                     cycle [Evidence IMP] [PMID 15870262]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0046685 - response to
                     arsenic-containing substance [Evidence IDA] [PMID
                     15689486]; GO_process: GO:0046686 - response to cadmium
                     ion [Evidence IDA] [PMID 15689486]; GO_process: GO:0006351
                     - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Met30p"
                     /protein_id="XP_018734513.1"
                     /db_xref="GeneID:30034628"
                     /translation="MSIGSVPTPAAGTSPLDVVSSNTSLNMTGATTLSSPSTSTSKAS
                     CSTAGPASIQQQLYTKPQTLSSVSAFDSAPTPSSPPATPESENSRPPTTDVTNTTSNI
                     STPNNNAKQNSISSSGSSSSPDAGLLAPVSSVSSRESTPSTTSNSNIKSLLPTAVARS
                     SSEHKNYCYRHHPDVTCNRQADEKKMQELQEEMDRIQDPTEKEAINQIWATFSAAPSR
                     QRMLILQGILAQCCFPQLSTVSQLVKDLIRIDFLSALPTELSFQILSYLDSASLCRAA
                     AVSKHWKTLADDDVVWHRMCEQHIDKKCTKCGWGLPLLEKKRLQDAKRAIQARAAGRS
                     KDSSTSGTGSLTPVLTTSNKRPLESDDSRTPSASPAPNSSSNGLSVVPSKKRKTRPWK
                     DVYSERYKIERNWRDNRYQLKEYKDTSAVLSLQFDDQYLMTGTYDGDIKVWDVESGDL
                     IRTLSGHLQAVSGLKFDQTKLISGSWDRTVRVWNYRTGECVSTFRGHEQQVLCIDFHD
                     KWIASGSADCNVKVWNFEEKSCFTLRGHKEWVHSVKIHSASSTLYSSSEDITVRMWDL
                     TTKQCLKVFGGPDNTPIGHVAQIQQVIPLTLDHLEGQPERRRSVVTSSNSNNSNDTVG
                     SSTNPAGTAPINVNTNVSSTSAIDNQVHGNNTDENAGDDRADATGATTVAGTNRSSSF
                     STNNTVTTAIPGRLLTTSLTNSNTGFSANDSQTNIKNRPTHLLTSSLDNTIKLWDIET
                     GECVRTLFGHAEGVWCIAADTFRIVSGAHDKLVKIWDLQSGKCWHTFSGHSRPVCCVG
                     LSDTRFASGGDDGVVRIYCFDDIEANQP"
     gene            <853989..>856904
                     /gene="GAC1"
                     /locus_tag="AWJ20_270"
                     /db_xref="GeneID:30034640"
     mRNA            <853989..>856904
                     /gene="GAC1"
                     /locus_tag="AWJ20_270"
                     /product="protein phosphatase regulator GAC1"
                     /transcript_id="XM_018879662.1"
                     /db_xref="GeneID:30034640"
     CDS             853989..856904
                     /gene="GAC1"
                     /locus_tag="AWJ20_270"
                     /codon_start=1
                     /product="protein phosphatase regulator GAC1"
                     /protein_id="XP_018734514.1"
                     /db_xref="GeneID:30034640"
                     /translation="MIMLSRPSPVDSPASGSPSTSPSPASSSQQSGSASSTASANPRS
                     EISKLRSQSQSPLQKSQSGSALSSLIEQHNNHHHHHIPVYTPGQHSELSTAFLHKQKR
                     GGNVRKHGDVIAIDRPLASSTHSTSPPTSPNSITTSASISSPTGSITSPLGSPAAATS
                     TSAPSVTTTGVTTGATTSGPVGSVAAPASPISPTSQLASINSKPFMQLVPDYVTSSSP
                     GFSPVNDSNDSDNITIKASPSTSEDDDDDSPEANQRRQQKMIRKKSGELVKSSLKLPS
                     LLRTQSMPIKMVHFDSKLEHVRKFFRRERPTAVSSGSTTPVKEKVSFQWASGSSTSDS
                     ETDSDYSSDSEEEDDGLDGDASEDDDIETIRGAVASHRRSIAGSISGAPKKHLRHHQK
                     KIWQIALPNFNSENSNQSDKMVYLDSVFLSSDNNNLIGHICVKNVSYRKNVSVRYTVD
                     FWKSVTDVVADYNGDVRRKTLRSGYDRFTFSIRLADLPQAALTSNSMFFCVRYQSDDG
                     DFWDNNNSLNYEVLLTRVPKHAADHTSSGTVKPAKTHTKQQPTMLDDDMDEIDKTTFK
                     SAPRQASSYFMYQPNQPAATNAAPHHGRNGGLKHHHRRNKTDPSPDFLYDNDFDHHHS
                     VEDTADLFDGLTVGPKQDATRATGNVSKTGSYNSSGTGSFGNSGNSFGSSNNKPSISN
                     SFGGASNFSPTKKSNGLTSRYSFGASLNAALARNNMTGRRSSYDVDGEADEEVTTSES
                     TSDDESTDTTPVDSSNLSTPQLRSFIFPKTNPRNSMLIRPHSSTDVTDESSRPAWDSL
                     SYKDIINKYCFFQDTPVSNSSSITPTGTSAASNKNTAAATGQTGKKSSTMVHNHHHHS
                     HSMLPHHHQSHPRPAGSYIPSPMTTSPALIPQSFTPPIVPQSTSVYSAQNASSSPLLA
                     AAAATLALNSPPESSSSTPSGSFSPSPTDTPGSPGESSSDTLLDVSEPRKIWHSVEV"
     gene            <859190..>860950
                     /gene="DBP9"
                     /locus_tag="AWJ20_271"
                     /db_xref="GeneID:30034651"
     mRNA            <859190..>860950
                     /gene="DBP9"
                     /locus_tag="AWJ20_271"
                     /product="Dbp9p"
                     /transcript_id="XM_018879673.1"
                     /db_xref="GeneID:30034651"
     CDS             859190..860950
                     /gene="DBP9"
                     /locus_tag="AWJ20_271"
                     /inference="similar to AA sequence:KEGG_Orthology:K14810"
                     /note="DEAD-box protein required for 27S rRNA processing;
                     exhibits DNA, RNA and DNA/RNA helicase activities; ATPase
                     activity shows preference for DNA over RNA; DNA helicase
                     activity abolished by mutation in RNA-binding domain;
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     11565753]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0004003 - ATP-dependent DNA
                     helicase activity [Evidence IDA] [PMID 15028736];
                     GO_function: GO:0033680 - ATP-dependent DNA/RNA helicase
                     activity [Evidence IDA] [PMID 15028736]; GO_function:
                     GO:0004004 - ATP-dependent RNA helicase activity [Evidence
                     IDA] [PMID 15028736]; GO_function: GO:0008026 -
                     ATP-dependent helicase activity [Evidence IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA] [PMID 23222640]; GO_function: GO:0003676 -
                     nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0006200 - ATP catabolic process [Evidence
                     IEA]; GO_process: GO:0000463 - maturation of LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 11565753]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Dbp9p"
                     /protein_id="XP_018734515.1"
                     /db_xref="GeneID:30034651"
                     /translation="MSSSNGEMAGKNGFESFNLDPRLQQALVQAGFSEPTLIQENAIP
                     LALSEKKDIVARARTGSGKTAAYLIPIIESLLQAAGSGNAGTGVISTLILVPSKELAD
                     QVVKMTTMLTTYCTKLIQVVNISQATSEQVQTSLLSENPAIVVATPARALAHIKRKSL
                     DTKSLAYFVIDEADLILSYGHEDDLNELAELLPKSMQTWLMSATLSDEIDAIKGKFCR
                     NVAVLKLQDTVSSEQLLQYYVKCNELDKFLLAYVIFKLKLVKGKTIVFVNDIDRCYRL
                     KLFFEQFGIKSCVLNSELPVSSRLHIVDEFNKNVYNLLIATDESNEKIEDDEDDKDDA
                     TANSNGNDQEKQTDSQPTENTQETQETQKKNNNNNKSKDYGVSRGVDFQNVACVLNFD
                     LPTSTKSYTHRIGRTARASKTGMALSFVVSKESWGKHKPSMLASAKRDEKVLNRIIKT
                     QGKQDNELKPYSFDMKQVESFRYRMEDAFRAVTKVAIREARVKEIRQELLASDKLKRH
                     FEENPEDLANLRHDKELHPARVQGHLKRVPDYLLPKTGQKPAAFTGHVPFNKTNNKHR
                     VHKSKKSSKKRDPLKSFKRR"
     gene            complement(<861644..>862252)
                     /locus_tag="AWJ20_272"
                     /db_xref="GeneID:30034662"
     mRNA            complement(<861644..>862252)
                     /locus_tag="AWJ20_272"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879684.1"
                     /db_xref="GeneID:30034662"
     CDS             complement(861644..862252)
                     /locus_tag="AWJ20_272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734516.1"
                     /db_xref="GeneID:30034662"
                     /translation="MGIIFASPEYKKIINGKSAPSLCNVVNVGLSALRGANPLENGRP
                     ASNAFDRINRESAVTLAKAFASQQQTETTNPAPFVYISAHDWNPLAPRGYIQSKRAAE
                     TEISVIPHLRSVFLQPGFMYDSSSSSTVRDSLSKLLRTGEFISNATGLSSLNLLPNNP
                     SISVQVVARATIEALDDQSVSGVVSLEALQKFAHFQSDPKPV"
     gene            complement(<863178..>864119)
                     /gene="GCY1"
                     /locus_tag="AWJ20_273"
                     /db_xref="GeneID:30034673"
     mRNA            complement(<863178..>864119)
                     /gene="GCY1"
                     /locus_tag="AWJ20_273"
                     /product="glycerol 2-dehydrogenase (NADP(+)) GCY1"
                     /transcript_id="XM_018879695.1"
                     /db_xref="GeneID:30034673"
     CDS             complement(863178..864119)
                     /gene="GCY1"
                     /locus_tag="AWJ20_273"
                     /inference="similar to AA sequence:KEGG_Orthology:K18097"
                     /note="Glycerol dehydrogenase; involved in an alternative
                     pathway for glycerol catabolism used under microaerobic
                     conditions; also has mRNA binding activity; member of the
                     aldo-keto reductase (AKR) family; protein abundance
                     increases in response to DNA replication stress; GCY1 has
                     a paralog, YPR1, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0004032 - alditol:NADP+ 1-oxidoreductase activity
                     [Evidence IDA,ISS] [PMID 11306085]; GO_function:
                     GO:0004033 - aldo-keto reductase (NADP) activity [Evidence
                     IDA] [PMID 10818358]; GO_function: GO:0004033 - aldo-keto
                     reductase (NADP) activity [Evidence IDA] [PMID 17140678];
                     GO_function: GO:0047953 - glycerol 2-dehydrogenase (NADP+)
                     activity [Evidence IEA]; GO_function: GO:1990042 -
                     glycerol dehydrogenase [NAD(P)+] activity [Evidence IMP]
                     [PMID 22979944]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA] [PMID 20844764]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IDA] [PMID
                     17962934]; GO_process: GO:0042843 - D-xylose catabolic
                     process [Evidence IDA] [PMID 12271459]; GO_process:
                     GO:0019568 - arabinose catabolic process [Evidence IDA]
                     [PMID 12271459]; GO_process: GO:0034599 - cellular
                     response to oxidative stress [Evidence IGI] [PMID
                     17919749]; GO_process: GO:0006071 - glycerol metabolic
                     process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="glycerol 2-dehydrogenase (NADP(+)) GCY1"
                     /protein_id="XP_018734517.1"
                     /db_xref="GeneID:30034673"
                     /translation="MTSLDIKLNNGVTIPALGLGTWQSPKGAVESAVEYALTEAGLRH
                     IDAAFAYLNEEEVGNGIKKAIASGKVKREDIFITTKVFPTFHNRVEESLNRSLKNLQL
                     EYIDLLLVHWPVGLNPNGNHLLVPTKADGTRDVDPTFDLSATWKQFEKVYESGKVKAI
                     GVSNCSVPVLTDLLKTVKVVPAVNQIENHPLLPQTEIRDFCKEKGIVIEAYSPFGSTG
                     GPLFSNKTVLAIAEKHKTTPGTVLVSYHISSGRVVLPKTTTPSRIVENTKTVELTPEE
                     IKELDNVHVTEGKKRFAAPPWGVDLKFPDWNASTPKP"
     gene            complement(<868545..>869027)
                     /gene="RSB1"
                     /locus_tag="AWJ20_274"
                     /db_xref="GeneID:30034684"
     mRNA            complement(<868545..>869027)
                     /gene="RSB1"
                     /locus_tag="AWJ20_274"
                     /product="phospholipid-translocating ATPase RSB1"
                     /transcript_id="XM_018879705.1"
                     /db_xref="GeneID:30034684"
     CDS             complement(868545..869027)
                     /gene="RSB1"
                     /locus_tag="AWJ20_274"
                     /note="Suppressor of sphingoid LCB sensitivity of an
                     LCB-lyase mutation; putative integral membrane transporter
                     or flippase that may transport long chain bases (LCBs)
                     from the cytoplasmic side toward the extracytoplasmic side
                     of the membrane; GO_component: GO:0071944 - cell periphery
                     [Evidence IDA] [PMID 24146988]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 12034738];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IDA] [PMID 12034738];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 12034738];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 16407254]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence
                     IDA,ISS] [PMID 12034738]; GO_process: GO:0015908 - fatty
                     acid transport [Evidence IDA] [PMID 12034738]; GO_process:
                     GO:0006869 - lipid transport [Evidence IEA]; GO_process:
                     GO:0045332 - phospholipid translocation [Evidence IMP]
                     [PMID 15342785]; GO_process: GO:0006950 - response to
                     stress [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="phospholipid-translocating ATPase RSB1"
                     /protein_id="XP_018734518.1"
                     /db_xref="GeneID:30034684"
                     /translation="MSSTVPSSVASAVASAAIASASATGGGDQSLYGGLIPSHSANLA
                     GVILFAIVWAYHTITGVYFRQYWFSTAFFIGAGLETAGYIGRFSSSTDIDNENDFLVQ
                     IICLTLAPAFFMGGVYYLLAKLVTIYGQQYSMLKPMHYSLVFILCDLCSIVIQAVGKF
                     "
     gene            <872862..>876281
                     /gene="ARO80"
                     /locus_tag="AWJ20_275"
                     /db_xref="GeneID:30034695"
     mRNA            <872862..>876281
                     /gene="ARO80"
                     /locus_tag="AWJ20_275"
                     /product="Aro80p"
                     /transcript_id="XM_018879716.1"
                     /db_xref="GeneID:30034695"
     CDS             872862..876281
                     /gene="ARO80"
                     /locus_tag="AWJ20_275"
                     /note="Zinc finger transcriptional activator of the
                     Zn2Cys6 family; activates transcription of aromatic amino
                     acid catabolic genes in the presence of aromatic amino
                     acids; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 23651256]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0043565
                     - sequence-specific DNA binding [Evidence IDA] [PMID
                     19158363]; GO_function: GO:0000981 - sequence-specific DNA
                     binding RNA polymerase II transcription factor activity
                     [Evidence IEA]; GO_function: GO:0000981 -
                     sequence-specific DNA binding RNA polymerase II
                     transcription factor activity [Evidence ISS] [PMID
                     10207060]; GO_function: GO:0000981 - sequence-specific DNA
                     binding RNA polymerase II transcription factor activity
                     [Evidence IDA] [PMID 23651256]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IEA]; GO_process: GO:0006559 -
                     L-phenylalanine catabolic process [Evidence IEA];
                     GO_process: GO:0009074 - aromatic amino acid family
                     catabolic process [Evidence IMP] [PMID 10207060];
                     GO_process: GO:0009083 - branched-chain amino acid
                     catabolic process [Evidence IEA]; GO_process: GO:0045944 -
                     positive regulation of transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 10207060]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA,IEA]; GO_process: GO:0006366 - transcription
                     from RNA polymerase II promoter [Evidence IEA];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006569 - tryptophan
                     catabolic process [Evidence IEA]; GO_process: GO:0006572 -
                     tyrosine catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Aro80p"
                     /protein_id="XP_018734519.1"
                     /db_xref="GeneID:30034695"
                     /translation="MPPAAGALPQTPWLLSLRSSRVSGVPGAPLRGAQQGLGQSPSRR
                     RQVDQVDPGIGLGSTGYLPGQPGNVPFPVETRPQYSWDPPKPDSSEARGATGSGAKPQ
                     PPEAHGPPESCPNLRNCGGYPRLLKEKFMCSRRKPKTVFFANPGSTEKIVDCKDDWKK
                     NGAGNVLGRITGQSFNMASNLQDQAGGFTSVNSNQVVGPGGAPGAGVGPGGIVTGQPG
                     IRDRQQTSSPLESSITGGSSRSPSPPLQSSGGANHSNQQQQTFRRTYKACLNCRIRKV
                     KCDFGDLANPNKPPCARCRREGRECQLVQSRRGGIRNILAGRERRAAEAAALTLSSGS
                     GSGADGGVNGGNEINEVSGSMGSSTSVGGAGLGSGVYGGVGGRIGGGVVGSANGGFGG
                     LNDAGGIGPGQKSGSNAGTDVISKRELHNTSDALEILAHAARSFPKIGGAGGSGNSGT
                     ASPQGRFPPTALAPGLAGSGIGINITKNGNLGANNGAGNGGQSASSAPQPPKTLLKDS
                     DLIAVEKIVTEDEVRVLVDYFFNALHPFYPFIPDDLHSPDEIADMPLLLAAVTTLASR
                     YYVPEIEPHQTTKEVEEQCYAIHARLWEYTQKLISSSVWAEASTRSIGTVFAFLLFSE
                     WNPRAIHQRWKDYANNPTEKERANVASAGSDSTVGLGAARRSDRMAWMLIGLGIRLAQ
                     DLGLMDTDPKVYLATHLSEIVLALRMGRRSMLGQFLNDPIPELNFSTFEQARLELLQI
                     MSLAHETLYSSRNTTRELLKDGKFLNFLGLFSPHLDSWDQKYREILQDPANKTPSASS
                     PAAPPVMDNRKTLDRESLLFDFHYIRLYIYSLALQTNAENTSTLAVAEIIPSARYVAL
                     ATDAAKELLAVAIRVHGLGLLRRAPIRWVVRIVHATVFLVKTLMLSTSLVSLDSQKRT
                     ITLIKRISVVLLEASPDEIHLASRYGTILGFLGNQLSAKLDTNNKTTRRRGPKQRKID
                     TSAQNSGESSNASPTTTPAPSSNIGYNQPSQYPNNVEPVQGYKAEAETGDQIPAPEFD
                     PVQGRSLYQLQEQQQQQQQQQQQQQQQQAPQQFQQFNQVPQSIPDFDIPDDDSINLAT
                     MLNVDFDFLMEGTEGLGFVEPLMEGIEQQQWSQLQQQQWMQQQQQMAGPQM"
     gene            complement(<876451..>877122)
                     /gene="JEN1"
                     /locus_tag="AWJ20_276"
                     /db_xref="GeneID:30034706"
     mRNA            complement(<876451..>877122)
                     /gene="JEN1"
                     /locus_tag="AWJ20_276"
                     /product="Jen1p"
                     /transcript_id="XM_018879726.1"
                     /db_xref="GeneID:30034706"
     CDS             complement(876451..877122)
                     /gene="JEN1"
                     /locus_tag="AWJ20_276"
                     /inference="similar to AA sequence:KEGG_Orthology:K08178"
                     /note="Monocarboxylate/proton symporter of the plasma
                     membrane; transport activity is dependent on the pH
                     gradient across the membrane; mediates high-affinity
                     uptake of carbon sources lactate, pyuvate, and acetate,
                     and also of the micronutrient selenite, whose structure
                     mimics that of monocarboxylates; expression and
                     localization are tightly regulated, with transcription
                     repression, mRNA degradation, and protein endocytosis and
                     degradation all occurring in the presence of glucose;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 17710650];
                     GO_function: GO:0015144 - carbohydrate transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015355 - secondary active monocarboxylate
                     transmembrane transporter activity [Evidence IMP] [PMID
                     17710650]; GO_function: GO:0097079 - selenite:proton
                     symporter activity [Evidence IMP] [PMID 20861301];
                     GO_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA]; GO_process: GO:0034219 -
                     carbohydrate transmembrane transport [Evidence IEA];
                     GO_process: GO:0035879 - plasma membrane lactate transport
                     [Evidence IMP] [PMID 10198029]; GO_process: GO:0035879 -
                     plasma membrane lactate transport [Evidence IMP] [PMID
                     17710650]; GO_process: GO:0006849 - plasma membrane
                     pyruvate transport [Evidence IMP] [PMID 17710650];
                     GO_process: GO:0097080 - plasma membrane selenite
                     transport [Evidence IMP] [PMID 20861301]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Jen1p"
                     /protein_id="XP_018734520.1"
                     /db_xref="GeneID:30034706"
                     /translation="MALMNFNSHGSQDLYPTFLTAQLGFSKNASTVTNCVANIGALVG
                     GVVAGHLSHVIGRRLMILICCVLGGAMVYPWAFSTNNASVNAAVFFMQALGVQSSWGV
                     IPIHLSELSPPRFRAFIVGISYQLGNLASSASSTIESTIGERFPLTGPNGEHVPGKYN
                     YGKVMAIFMGCVFGVLFIVILVGPENRGANLLTRDPDEEIAAAQQAYFQEKNDHQHIE
                     GDAQP"
     gene            <877483..>877821
                     /locus_tag="AWJ20_277"
                     /db_xref="GeneID:30034717"
     mRNA            <877483..>877821
                     /locus_tag="AWJ20_277"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879737.1"
                     /db_xref="GeneID:30034717"
     CDS             877483..877821
                     /locus_tag="AWJ20_277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734521.1"
                     /db_xref="GeneID:30034717"
                     /translation="MPPAAGALPQTPWHLLRRRCWDRQRNDSSAARGATGSGAEPQPP
                     EAQYLRSVTIQTAHGDAEERSTCQESAVGLGESRADFQDNEQKQIGNERPFTAPFITG
                     KTKNEGANRS"
     gene            complement(<877627..>877983)
                     /gene="JEN1"
                     /locus_tag="AWJ20_278"
                     /db_xref="GeneID:30034728"
     mRNA            complement(<877627..>877983)
                     /gene="JEN1"
                     /locus_tag="AWJ20_278"
                     /product="Jen1p"
                     /transcript_id="XM_018879746.1"
                     /db_xref="GeneID:30034728"
     CDS             complement(877627..877983)
                     /gene="JEN1"
                     /locus_tag="AWJ20_278"
                     /inference="similar to AA sequence:KEGG_Orthology:K08178"
                     /note="Monocarboxylate/proton symporter of the plasma
                     membrane; transport activity is dependent on the pH
                     gradient across the membrane; mediates high-affinity
                     uptake of carbon sources lactate, pyuvate, and acetate,
                     and also of the micronutrient selenite, whose structure
                     mimics that of monocarboxylates; expression and
                     localization are tightly regulated, with transcription
                     repression, mRNA degradation, and protein endocytosis and
                     degradation all occurring in the presence of glucose;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 17710650];
                     GO_function: GO:0015144 - carbohydrate transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015355 - secondary active monocarboxylate
                     transmembrane transporter activity [Evidence IMP] [PMID
                     17710650]; GO_function: GO:0097079 - selenite:proton
                     symporter activity [Evidence IMP] [PMID 20861301];
                     GO_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA]; GO_process: GO:0034219 -
                     carbohydrate transmembrane transport [Evidence IEA];
                     GO_process: GO:0035879 - plasma membrane lactate transport
                     [Evidence IMP] [PMID 10198029]; GO_process: GO:0035879 -
                     plasma membrane lactate transport [Evidence IMP] [PMID
                     17710650]; GO_process: GO:0006849 - plasma membrane
                     pyruvate transport [Evidence IMP] [PMID 17710650];
                     GO_process: GO:0097080 - plasma membrane selenite
                     transport [Evidence IMP] [PMID 20861301]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Jen1p"
                     /protein_id="XP_018734522.1"
                     /db_xref="GeneID:30034728"
                     /translation="MMTAKQWNFFAVAFLGWTWDAVDFFTVSLTATDIAKTFDKEVSE
                     ITWGITLVLMLRSVGALIFGLAGDKWGRKWPFIANLFLFIVLEIGTGFAQTYSGFLAC
                     RALFGIAMGGLYGNAA"
     gene            complement(<879158..>881605)
                     /locus_tag="AWJ20_279"
                     /db_xref="GeneID:30034739"
     mRNA            complement(<879158..>881605)
                     /locus_tag="AWJ20_279"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879757.1"
                     /db_xref="GeneID:30034739"
     CDS             complement(879158..881605)
                     /locus_tag="AWJ20_279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734523.1"
                     /db_xref="GeneID:30034739"
                     /translation="MTKVTEQLTALGTTEEIVQPDNIKLVLHNNYANGSDVKAKELLL
                     FFRDAVEGLLVPITHPSKTLATSGSVMNYDQIAGADNLHGVTCYLDSLMFAMFARLEN
                     FEPILYKTFESDEKRENLAIFLRLYVNLLRSGKLITTDVTKCLLDTIFNAGWTPSSKR
                     YEQQDAAELFNFITEKLSMPLLTLRVDIAHAGKEVAEDDHKLVNERLLLVPIPGERTD
                     PPVTLEECLERYFANSVEVSRQLERFGSDFSDLARRSPSANHSGVRKGASSPNLAKPV
                     RKFSLETVEIPRFLKEIERKATENQSDAGSGTGRSSPAIASTEEGNDENDYPDHMVKK
                     LRTRASTSHSLPPSYDSLYKDRPPPTLPPQKVVDLWNQKNEITLPAWMFLQLLPFYSD
                     MRSQQQKKHDKKVLRNQFLNGNGTANEDKKDDDDENDEVDAPVEEHFANARPVLGICL
                     KRYSWTPEGQSIRNDRQVIVPQTIHLPSFVADDSEEGSLFGNFKLVLESAIFHRGTSI
                     NSGHFVAIAAEDAAIDYSAEEVLPSNNNSTGSFFNSRRRHHRRHHTHNDRDVLPVPKS
                     PLSQPVSGRNSESGPRPKRWVFFDDLQPVGKKTQIVDFDEVFARECPYLLFYRMVSAN
                     DDEALSTKSRGDIQPLPYVSSLDLSHSSSIESDTLDSVTDTFVNVPPFESQTTIQTMS
                     TVADQLSTTGDRGRGGNADTSSIDMNEFKNETKGERRSKLFRLTRGKSAQDINSRSRS
                     APPDKRNLSTPRMFEQGLDPSLPSLDVVPNPVYPGATHRQQPLASGVDASRMSSRSLR
                     RRANETQYNVDEKCVLM"
     gene            complement(<883138..>883896)
                     /locus_tag="AWJ20_280"
                     /db_xref="GeneID:30034751"
     mRNA            complement(<883138..>883896)
                     /locus_tag="AWJ20_280"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879769.1"
                     /db_xref="GeneID:30034751"
     CDS             complement(883138..883896)
                     /locus_tag="AWJ20_280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734524.1"
                     /db_xref="GeneID:30034751"
                     /translation="MLSRTLRSVSSAPNLRQRAAGSALSAVSTPPPPVPKLPSTYIRT
                     AHLHQSAKATKPSNLLTNNSKYMSLSVAALRAECKKRGVKVGGRKAELVDRLMSVDAS
                     QRVQTISTTAKKQAKGDDSSIDYYKVPHPEPEKYKPAFKVPVLPDSAGASSKEVPQPE
                     FNTSAPDHGVADHVEGKVSGTKDAPKVHVPGSTEEGIGEDESPLESSSGGTSSGSGEF
                     SSGDKTFLVGFAVAVTAWWFLPFGSKKKKKPTPE"
     gene            <885257..>886156
                     /gene="PLC2"
                     /locus_tag="AWJ20_281"
                     /db_xref="GeneID:30034762"
     mRNA            <885257..>886156
                     /gene="PLC2"
                     /locus_tag="AWJ20_281"
                     /product="1-phosphatidylinositol phosphodiesterase"
                     /transcript_id="XM_018879780.1"
                     /db_xref="GeneID:30034762"
     CDS             885257..886156
                     /gene="PLC2"
                     /locus_tag="AWJ20_281"
                     /inference="similar to AA sequence:KEGG_Orthology:K01771"
                     /codon_start=1
                     /product="1-phosphatidylinositol phosphodiesterase"
                     /protein_id="XP_018734525.1"
                     /db_xref="GeneID:30034762"
                     /translation="MVDYSNWLRDVSDDTKLSTLSIPGTHNSAAYHMALPSVQCQDAS
                     ITEQLENGVRFLDIRVSKNILHSDDQQYNLVVCHGKFPIKLLGNVELSEALDEVYKFL
                     DSHRSETVIVSIKQEGSGTWDNDHDEFGNCIWDRYVNKNKDKWYLGTDIPKVGDTRGK
                     AVLFRRFGVKDQQRKSQFGFEASWWTYNTSNDDRGNLQVQDWCEINKPEDIGTKANYV
                     KEHIKRAVDYNSTNTDSQKLFVNFCSGSNFFDHECWPQKIAEGLDQDKIDETFGKGSG
                     ILVLDYAKTNDWRIVREYVNKNF"
     gene            <886728..>887561
                     /gene="MET16"
                     /locus_tag="AWJ20_282"
                     /db_xref="GeneID:30034773"
     mRNA            <886728..>887561
                     /gene="MET16"
                     /locus_tag="AWJ20_282"
                     /product="phosphoadenylyl-sulfate reductase (thioredoxin)"
                     /transcript_id="XM_018879791.1"
                     /db_xref="GeneID:30034773"
     CDS             886728..887561
                     /gene="MET16"
                     /locus_tag="AWJ20_282"
                     /inference="similar to AA sequence:KEGG_Orthology:K00390"
                     /note="3'-phosphoadenylsulfate reductase; reduces
                     3'-phosphoadenylyl sulfate to adenosine-3',5'-bisphosphate
                     and free sulfite using reduced thioredoxin as cosubstrate,
                     involved in sulfate assimilation and methionine
                     metabolism; GO_component: GO:0005737 - cytoplasm [Evidence
                     IC] [PMID 3060034]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_function:
                     GO:0004604 - phosphoadenylyl-sulfate reductase
                     (thioredoxin) activity [Evidence IEA,IEA]; GO_function:
                     GO:0004604 - phosphoadenylyl-sulfate reductase
                     (thioredoxin) activity [Evidence IMP] [PMID 2203779];
                     GO_function: GO:0004604 - phosphoadenylyl-sulfate
                     reductase (thioredoxin) activity [Evidence IDA] [PMID
                     3060034]; GO_process: GO:0008652 - cellular amino acid
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0019344 - cysteine biosynthetic process [Evidence
                     IEA,IEA]; GO_process: GO:0070814 - hydrogen sulfide
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0009086 - methionine biosynthetic process [Evidence
                     IEA,IEA]; GO_process: GO:0055114 - oxidation-reduction
                     process [Evidence IEA,IEA]; GO_process: GO:0019379 -
                     sulfate assimilation, phosphoadenylyl sulfate reduction by
                     phosphoadenylyl-sulfate reductase (thioredoxin) [Evidence
                     IEA]; GO_process: GO:0019379 - sulfate assimilation,
                     phosphoadenylyl sulfate reduction by
                     phosphoadenylyl-sulfate reductase (thioredoxin) [Evidence
                     IMP] [PMID 197388]; GO_process: GO:0019379 - sulfate
                     assimilation, phosphoadenylyl sulfate reduction by
                     phosphoadenylyl-sulfate reductase (thioredoxin) [Evidence
                     IDA] [PMID 3060034]; GO_process: GO:0000096 - sulfur amino
                     acid metabolic process [Evidence IMP] [PMID 1101032]"
                     /codon_start=1
                     /product="phosphoadenylyl-sulfate reductase (thioredoxin)"
                     /protein_id="XP_018734526.1"
                     /db_xref="GeneID:30034773"
                     /translation="MSPSVVASIPAQNTGGQVSETQTVPKVTFTAKQLEHINKFAENM
                     SAEEIIRWSIMTIPGLYQTTAFGLTGLVTLDIISKLFPDTHPIDLVFVDTLHHFQETL
                     DLIERIKVRYPNVKLHIYKPDGCETREDFTKEFGPELWETNDTFYDYLVKVEPVQRAY
                     SELNISAVFTGRRKTQGGQRGSIPIIEVVENGLIKINPLANWSFDQVNEYIKKNDVPY
                     NALLDQGYRSVGDYHSTVPVKDGEDERAGRWKGKKKTECGIHETSRFSEFLKNKTATT
                     V"
     gene            <887930..>889669
                     /gene="DPH2"
                     /locus_tag="AWJ20_283"
                     /db_xref="GeneID:30034784"
     mRNA            <887930..>889669
                     /gene="DPH2"
                     /locus_tag="AWJ20_283"
                     /product="Dph2p"
                     /transcript_id="XM_018879802.1"
                     /db_xref="GeneID:30034784"
     CDS             887930..889669
                     /gene="DPH2"
                     /locus_tag="AWJ20_283"
                     /inference="similar to AA sequence:KEGG_Orthology:K17866"
                     /note="Protein required for synthesis of diphthamide;
                     required along with Dph1p, Kti11p, Jjj3p, and Dph5p;
                     diphthamide is a modified histidine residue of translation
                     elongation factor 2 (Eft1p or Eft2p); may act in a complex
                     with Dph1p and Kti11p; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0017183 - peptidyl-diphthamide biosynthetic process
                     from peptidyl-histidine [Evidence IEA,IEA]; GO_process:
                     GO:0017183 - peptidyl-diphthamide biosynthetic process
                     from peptidyl-histidine [Evidence IMP] [PMID 15485916];
                     GO_process: GO:0017183 - peptidyl-diphthamide biosynthetic
                     process from peptidyl-histidine [Evidence IMP] [PMID
                     8406038]"
                     /codon_start=1
                     /product="Dph2p"
                     /protein_id="XP_018734527.1"
                     /db_xref="GeneID:30034784"
                     /translation="MSEISIAAPVLSTESEFDKVALAARSRPSPSEDDLIKVYNLDQL
                     VNKIVENDYKSIALQFPDDLIQDSTYISRFLSQQFLKLEGQQTRNVYILADTSYSPCC
                     IDEVAAKHVNADVVVHFGNACLNPVRSFPVIYVFDSTVNVDMDLVETKFVEAFEEDPN
                     QHILLVAETNYSIILNDLYERVKAKFPNCLPSSVNALHDDTQSDETTSAPTASCQSCS
                     GSNGSSCCNATGNGSKDKSNCHSCSDKPSDTKTSPSVYFIPTLDIPALHTESTFLPTR
                     RHPSLKTDLSDYKAFFITSPSPSSSFVLHLSTLVSSVTLLDVDTLKLSTPRTTLQKRY
                     RYMNVARSASTIGLLINTLSLRNVNEVLARLKTWITQAGKKHYTFVVGKPNVPKLANF
                     DVVDIWVVLGCSMGGIIVDCDKFYKPIITPYELNLALQSEVAWTGQWLIDFEAVLKMS
                     SGEEDQVSSDISSDDDDAPVFDPISGKYVSTSKPLRRRAHIDIERDSSDTVNAPSDTS
                     NSTNALATRLSSQLAIRGTVSTAAEYLHNKTTWNGLGSDFDESVDSSEGATVKEGRGG
                     IARGYRVGETDRT"
     gene            complement(<889766..>897309)
                     /gene="SEN1"
                     /locus_tag="AWJ20_284"
                     /db_xref="GeneID:30034795"
     mRNA            complement(join(<889766..892799,893153..>897309))
                     /gene="SEN1"
                     /locus_tag="AWJ20_284"
                     /product="putative DNA/RNA helicase SEN1"
                     /transcript_id="XM_018879812.1"
                     /db_xref="GeneID:30034795"
     CDS             complement(join(889766..892799,893153..897309))
                     /gene="SEN1"
                     /locus_tag="AWJ20_284"
                     /inference="similar to AA sequence:KEGG_Orthology:K10706"
                     /note="Presumed helicase and subunit of the Nrd1 complex
                     (Nrd1p-Nab3p-Sen1p); complex interacts with the exosome to
                     mediate 3' end formation of some mRNAs, snRNAs, snoRNAs,
                     and CUTs; has a separate role in coordinating DNA
                     replication with transcription, by associating with moving
                     replication forks and preventing errors that occur when
                     forks encounter transcribed regions; homolog of Senataxin,
                     which is implicated in Ataxia-Oculomotor Apraxia 2 and a
                     dominant form of ALS; GO_component: GO:0035649 - Nrd1
                     complex [Evidence IDA] [PMID 16427013]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 23222640];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     23222640]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 8544822]; GO_component: GO:0005657 -
                     replication fork [Evidence IDA] [PMID 23141540];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0043141 - ATP-dependent 5'-3' DNA helicase
                     activity [Evidence ISS] [PMID 10545196]; GO_function:
                     GO:0032575 - ATP-dependent 5'-3' RNA helicase activity
                     [Evidence ISS] [PMID 10545196]; GO_function: GO:0008094 -
                     DNA-dependent ATPase activity [Evidence ISS] [PMID
                     10545196]; GO_function: GO:0008186 - RNA-dependent ATPase
                     activity [Evidence ISS] [PMID 10545196]; GO_function:
                     GO:0004386 - helicase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0003729 - mRNA binding [Evidence
                     IDA] [PMID 23222640]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0019904 - protein
                     domain specific binding [Evidence IDA,IMP] [PMID
                     22286094]; GO_process: GO:0006353 - DNA-templated
                     transcription, termination [Evidence IMP] [PMID 23748379];
                     GO_process: GO:0031124 - mRNA 3'-end processing [Evidence
                     IMP] [PMID 11565036]; GO_process: GO:0006378 - mRNA
                     polyadenylation [Evidence IMP] [PMID 22123738];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA];
                     GO_process: GO:0045005 - maintenance of fidelity involved
                     in DNA-dependent DNA replication [Evidence IMP] [PMID
                     23141540]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IMP] [PMID 9365256]; GO_process: GO:1990248 -
                     regulation of transcription from RNA polymerase II
                     promoter in response to DNA damage [Evidence IMP] [PMID
                     23741394]; GO_process: GO:0016180 - snRNA processing
                     [Evidence IMP] [PMID 9365256]; GO_process: GO:0031126 -
                     snoRNA 3'-end processing [Evidence IMP] [PMID 11565036];
                     GO_process: GO:0008033 - tRNA processing [Evidence IEA];
                     GO_process: GO:0008033 - tRNA processing [Evidence IMP]
                     [PMID 9365256]; GO_process: GO:0006369 - termination of
                     RNA polymerase II transcription [Evidence IMP] [PMID
                     17157256]"
                     /codon_start=1
                     /product="putative DNA/RNA helicase SEN1"
                     /protein_id="XP_018734528.1"
                     /db_xref="GeneID:30034795"
                     /translation="MAPTPTEIAQQAYEEALKLNQDWVENTSIQHLFLASVSSAKALL
                     AQTKLAEQSHVEWCHWFCDEKWRPLAANALFVLSMDGSKQAIGLYDKLGLVVSKCASC
                     GAFYHLEFEKTRIMLKQRLHIGDDKISIFERAVQAQDKDRLLSVFQDLSDWKKTFEQE
                     NVGVSIPIEKRASFFVPMVECLYCPWLFSPLNLACTSGDDDKLYTLFKEAFTLFEDAK
                     VYDPVIIKTRHSFCLGAEVLFFSMEPKIHQLAKSVIMRFTCISVNSDKSPEVCVLYPN
                     LTSNMVGLINDTALQVMEYMGPIKPGLAENPFSQLINVNNPSVLYLLNASYFVGMLYF
                     CRNKNYLKIELKDVLDPSDNFLNLLRNCLSYTPSDESTGRFSMALSALNTLLLWKPVD
                     LMYLTTKLAPLTFKDIAQSMLTQSNQLFSSGKARLISNLSSVAIFPSYDVTYEFGISD
                     WYNWLNAIFKADLPGHGPRSQGQNGSQENSQGRSTSPVTASESATGDSSLASQPSQPS
                     SALAVDENTKLNICNIILNVLDRHITSLPVQTEAAKRSSLIRRFLIVAISGLDFPKSV
                     ENGLPKISDVSRLMRATIRGIVDKGSRYILDSRSSRDLLPLVYQLIRQCLEFDIISSI
                     GAAVTKASTPNVGDKSASNSARPSNGLWQAINRMPRLFDVDFTTNILKGLKLAAFTFE
                     SPTLANNSPIQPDVLNQAADSLRIISELDPVVIRKVFKDRDALVSVFLSSFSGSIELS
                     DLAIDVICQTLDETSSRSEAFKQLLRDDPKLVVRSFNEAVDLVRSVGMFSPCAKLIKV
                     SQDFVDALYSPHGGVVDGRFKADLTKDIEENELLQYWLKTWSFLQFTFKNTRNWGETY
                     IMSTMKDFFREEAHYCQTLLDQFRLFEVDLPFEADPNISHGERLALPVASTIELMCDL
                     LRLRDTQLLDACFRNIISIIELMKSFNVKLPESLVEVFKRCSSGKITNKLSQDNIAQL
                     LAALNSMGVLSEAEIETIQMESQMRKKKSGSVSVTPAHTQSPPPGSGLTLANLPLRSG
                     STVKAPAISIKGVSSRQRTLLDMYQKTPDGRPPPVVIPPHSSSVQPSAPPRTSAMDLL
                     RESVKQNRMSSTGAAMLAATSSKPPAKEIHPPRPPGFNSRRTVLPSSSASSTPAPSSL
                     NSSDVSDQSDDESDDGLFTEKKAADTGPKMRNINRPGFRINTANMTRKGTPTVAQKQL
                     EKRLMQQRLNIDMGPLHKEVLSWDYFARNDYFQKSKGQLKPVQSEFKSVEDYQSTFTP
                     LLMLECWEGIQKVKEENVGRVPFKIQVGKRVKCDDFYDVYASVSMKEFQIIKLGESDL
                     IVLSYHTNLEVKALMPQHNVPHCYARIQQINLHQDYADLILRTYEPGKMIGYLSQNCV
                     ICGLKASSPPGTGKTKTILAIAGAYLTSAIPALSQFDDDVPNTRRILVCAPSNAAVDE
                     LVLRFKSGIIGSHGKVFEPSVVRLGRSDAVNIQVRDVTLEELLDKMVEKNSDENGRQD
                     DNSVREKQQAIIKERNELRRKIDNTQDISGEEYSKLSEEIRVLSKQIKDLSRQLDVQR
                     EQRTTAARMREAQRRKFQDQILRDAQVICCTLSGSSHKVLSSLKMRFDTVIIDEAAQS
                     VELSALIPLRYGCTRCIMVGDPNQLPPTVLSQAASNLKYEQSLFVRMFEKFPERVYLL
                     DTQFRMHPDISEFASREFYGGRLYNGDGMASLTARAWHSNPMLAPYKFFDVVGSQKKS
                     IDTKSMYNTEEAEAAYALYEMLFKTCSENGIHDLAGKVGIISPYKRQVKELRFVFRAH
                     LGEAASNQIDFNTIDGFQGQEKDVIILSCVRAQPDAQGVGFLGDTRRMNVAITRAKSS
                     MWILGNENNLVKNPVWKRLIGDARQRNMFVKLRADVQESLQEQIIARATQQARAQIEQ
                     RTPDVQAQSVAREAHADNLAKRLAEDQIIKEEGDKKLKIDAAPAVTEEPVLSKKERKR
                     LKNAEKKARKLKELELRQMNARDPRFRLYNVSDSSSPSDTSRFSSPSSLGDVDKHPPQ
                     RNSGPPVDGNIFNGTEKESTKEPKTSDSSKEELSTPNSIPNTPSSRDEFANKEFDAPP
                     KTLSNNIRSGINDKTSNSKSVDSDGLHSSDSMALARDQVVNSKMDMSDRSDDVSNVKG
                     PYIARLRVDTDSSTSDYGRNQELSNGGASSRQGQLPPNNEPEWLRPNVAERPYRPQTA
                     DEESRSRPSDDDRDPRQPRSRDNNESTRACPSDDKQPYRPHSSDNRDSYRPRPNDDRE
                     PYRSRSRDERDSYRPHSSEDYEHSRSRPRDDRSYNVQRSQADRDYRQGHQNERDYWSR
                     NSDDRGSYRSHPEDDRGPHRPRHLDDREPNQPRPGNDRETYRPRPSFRPAPEREPYNP
                     DSRKRFPTVPRKRNPPGDPFVRPRKKGPPPPK"
     gene            complement(<898447..>899124)
                     /gene="PRX1"
                     /locus_tag="AWJ20_285"
                     /db_xref="GeneID:30034806"
     mRNA            complement(<898447..>899124)
                     /gene="PRX1"
                     /locus_tag="AWJ20_285"
                     /product="Prx1p"
                     /transcript_id="XM_018879823.1"
                     /db_xref="GeneID:30034806"
     CDS             complement(898447..899124)
                     /gene="PRX1"
                     /locus_tag="AWJ20_285"
                     /note="Mitochondrial peroxiredoxin with thioredoxin
                     peroxidase activity; has a role in reduction of
                     hydroperoxides; reactivation requires Trr2p and
                     glutathione; induced during respiratory growth and
                     oxidative stress; phosphorylated; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA,ISS] [PMID 10681558]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 10821871];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0016209 -
                     antioxidant activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA,IEA];
                     GO_function: GO:0004601 - peroxidase activity [Evidence
                     IEA]; GO_function: GO:0051920 - peroxiredoxin activity
                     [Evidence IEA,IEA]; GO_function: GO:0008379 - thioredoxin
                     peroxidase activity [Evidence IDA,IMP,ISS] [PMID
                     10681558]; GO_function: GO:0008379 - thioredoxin
                     peroxidase activity [Evidence IDA] [PMID 10821871];
                     GO_process: GO:0045454 - cell redox homeostasis [Evidence
                     IDA,IMP] [PMID 10681558]; GO_process: GO:0034599 -
                     cellular response to oxidative stress [Evidence IGI] [PMID
                     15051715]; GO_process: GO:0055114 - oxidation-reduction
                     process [Evidence IEA,IEA]; GO_process: GO:0046686 -
                     response to cadmium ion [Evidence IMP] [PMID 19332553]"
                     /codon_start=1
                     /product="Prx1p"
                     /protein_id="XP_018734529.1"
                     /db_xref="GeneID:30034806"
                     /translation="MSAPPAGTLRLGSTAPNFQADTSNGPIDFHEYLGNSWGILFSHP
                     DDFTPVCTTELGAFAKLEPEFAKRDVKLIGLSANSTDSHKEWIKDIDEVSGSKLSFPI
                     IADPTRKISHLYDMVDYQDTTNVDSKGVAFTIRSVFIIDPKKTIRLILSYPASTGRNT
                     AEVLRVIDSLQTGDKHRITTPINWTPGDDVIVHPSVSNDEAKTLFPKFKIIKPYLRLT
                     PLEVNNN"
     gene            <900713..>900812
                     /locus_tag="AWJ20_286"
                     /db_xref="GeneID:30034817"
     tRNA            <900713..>900812
                     /locus_tag="AWJ20_286"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:30034817"
     gene            complement(<901232..>901323)
                     /locus_tag="AWJ20_287"
                     /db_xref="GeneID:30034828"
     tRNA            complement(<901232..>901323)
                     /locus_tag="AWJ20_287"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:30034828"
     gene            complement(<902782..>905577)
                     /gene="PCL6"
                     /locus_tag="AWJ20_288"
                     /db_xref="GeneID:30034839"
     mRNA            complement(<902782..>905577)
                     /gene="PCL6"
                     /locus_tag="AWJ20_288"
                     /product="Pcl6p"
                     /transcript_id="XM_018879853.1"
                     /db_xref="GeneID:30034839"
     CDS             complement(902782..905577)
                     /gene="PCL6"
                     /locus_tag="AWJ20_288"
                     /note="Pho85p cyclin of the Pho80p subfamily; forms the
                     major Glc8p kinase together with Pcl7p and Pho85p;
                     involved in the control of glycogen storage by Pho85p;
                     stabilized by Elongin C binding; PCL6 has a paralog, PCL7,
                     that arose from the whole genome duplication;
                     GO_component: GO:0000307 - cyclin-dependent protein kinase
                     holoenzyme complex [Evidence TAS] [PMID 11602261];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0016538 - cyclin-dependent protein
                     serine/threonine kinase regulator activity [Evidence TAS]
                     [PMID 11602261]; GO_function: GO:0019901 - protein kinase
                     binding [Evidence IEA]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0005977 - glycogen metabolic process [Evidence IEA];
                     GO_process: GO:0000079 - regulation of cyclin-dependent
                     protein serine/threonine kinase activity [Evidence IEA];
                     GO_process: GO:0005979 - regulation of glycogen
                     biosynthetic process [Evidence IGI] [PMID 11602261];
                     GO_process: GO:0005981 - regulation of glycogen catabolic
                     process [Evidence IGI] [PMID 11602261]"
                     /codon_start=1
                     /product="Pcl6p"
                     /protein_id="XP_018734530.1"
                     /db_xref="GeneID:30034839"
                     /translation="MDEDPHQPEITVIEGTAIDHGLPSGSSSGSGSGSGSVGSGAAAY
                     QYQYLQQQQLAQQAFARQLQNMQHARPVGIPGSGDSSSVPRDGLNMVDVDTGVQGLGQ
                     SSVSESPATQNTQNQDQQTQGQVQSQNSQLQSQPQVQVQSQSQFSNQIQGQTQYLAQS
                     HSAIDRERHLHQLQSLQKQQPLPMGSSGSGIGIGLNQFGQQQQQQQQQQQQPGIGPGS
                     SSSFVGSFGQNYPLGPSSRHNSTSNLVQAHALQGGAHSFRDDPSVTSIAAGLVPGSIG
                     TSPGTAATSAFFSPSSGSRLAPHTNLPSSVSSSYKSAQPSNSFSSYSSYPYNGGAASI
                     GASSVGGGGGGGGVVGSSAFNTNFTSFATANSSLNDRTGIYASSPITGDSASENANPA
                     VNSSSSFAGKLVQPGNVVRTSLLTSKLAASSNSGSSNNSTANNTPNNASPSRATVSRQ
                     SSFSASGNQQLTTSTSNFPYPNPRTNSRHNSLVASGQPGPFQQQQQPYSSDPVNFSSS
                     GPASSGFSRFTNITNNSGPGSYTPSSATGVSSTPGVPGQVPGQVPAGNNSSGQQNFLP
                     HPSSTTTNISREQVSAASSADTSADFGAVTTHNPSSSPMDTATDEFNTPADSFQPSYQ
                     SPSTTSSAVFGNQQQQQQTGSSIHGHTTGQTNELPPITNQGITSQRGTPGTTDDGSGV
                     NIAPGTGSATGDEFNRQYSAAHPGPHLDIANHPVPDVLVMLTVLLQKIIDANDALHPH
                     NYQASEIADTSDRFTANVLAFHGRNIPAISLHAYLSRILKYCPTTNEVFISLLVYFDR
                     IAQRANSGELSPSGVMAGSASGTTNHPGGSTDPDHPDQPQLFVMDSYNIHRLIIAGVT
                     VASKFFSDIFYKNSRYAKVGGLPVDELNHLELQFLLLTDFRLMISLEELQRYADLLLR
                     FWQKEAVHSSPHPMSTI"
     gene            <912132..>914804
                     /gene="HSP104"
                     /locus_tag="AWJ20_289"
                     /db_xref="GeneID:30034850"
     mRNA            <912132..>914804
                     /gene="HSP104"
                     /locus_tag="AWJ20_289"
                     /product="chaperone ATPase HSP104"
                     /transcript_id="XM_018879864.1"
                     /db_xref="GeneID:30034850"
     CDS             912132..914804
                     /gene="HSP104"
                     /locus_tag="AWJ20_289"
                     /note="Disaggregase; heat shock protein that cooperates
                     with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold and
                     reactivate previously denatured, aggregated proteins;
                     responsive to stresses including: heat, ethanol, and
                     sodium arsenite; involved in [PSI+] propagation; protein
                     becomes more abundant and forms cytoplasmic foci in
                     response to DNA replication stress; potentiated Hsp104p
                     variants decrease TDP-43 proteotoxicity by eliminating its
                     cytoplasmic aggregation; GO_component: GO:0072380 - TRC
                     complex [Evidence IDA] [PMID 20850366]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 10467108];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 10467108]; GO_function: GO:0043531 - ADP
                     binding [Evidence IMP] [PMID 11867765]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IMP] [PMID 11867765];
                     GO_function: GO:0042623 - ATPase activity, coupled
                     [Evidence IDA,IMP] [PMID 16135516]; GO_function:
                     GO:0042623 - ATPase activity, coupled [Evidence IMP] [PMID
                     9674429]; GO_function: GO:0051087 - chaperone binding
                     [Evidence IDA] [PMID 9674429]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_function: GO:0051082 - unfolded protein
                     binding [Evidence IDA] [PMID 16135516]; GO_process:
                     GO:0070370 - cellular heat acclimation [Evidence IMP]
                     [PMID 2188365]; GO_process: GO:0070389 - chaperone
                     cofactor-dependent protein refolding [Evidence IDA] [PMID
                     9674429]; GO_process: GO:0001319 - inheritance of
                     oxidatively modified proteins involved in replicative cell
                     aging [Evidence IGI,IMP] [PMID 17908928]; GO_process:
                     GO:0034975 - protein folding in endoplasmic reticulum
                     [Evidence IMP] [PMID 10931304]; GO_process: GO:0019538 -
                     protein metabolic process [Evidence IEA]; GO_process:
                     GO:0043335 - protein unfolding [Evidence IMP] [PMID
                     7984243]; GO_process: GO:0006950 - response to stress
                     [Evidence IEA]; GO_process: GO:0070414 - trehalose
                     metabolism in response to heat stress [Evidence IMP] [PMID
                     9797333]"
                     /codon_start=1
                     /product="chaperone ATPase HSP104"
                     /protein_id="XP_018734531.1"
                     /db_xref="GeneID:30034850"
                     /translation="MDQSEFTDRAIKIITDAVQIASDHGHAFVSPVHFLAAMTPDDQD
                     GTPSYLRTVTEKARYDWKPLERIINKHLVRIPSQSPAPPKPELTSQSANIIQSAANIR
                     AKQKDTFTAQDHILLALLDDTSIQAIFKEVSIDIKALQSQVQAIRGNRRIDSRMADSS
                     EQFEFLSKYALDLTTMAREGKIDPVIGREEEIRRCIRVLARRTKSNPCLIGDPGVGKT
                     SIVEGVAQRIIDGDVPNVLANTRLFSLDLGALKAGAKYQGDFEERVKGVLTEIEESKD
                     MIVLFIDEIHMLMGDGKSDAANLLKPMLARGALHCIGATTVEEYRKYIEKDGAFERRF
                     QKIDVPEPTIPETIAILRGLQGKYELHHGVRILDSALVTAAQLASRYLTYRKLPDSAV
                     DLIDETAASVAVARDSKPEELDTLERQLQLLQVEIKALERDSGTDATTGDRLSAARQK
                     AASLEEQLAPLRERFQEERKGHEELSSLKKKLDELETKAQDAERRRDTGASADLRYFA
                     IPDIKRRIDEIERTIDDKSDSTLLEDIVDSDKVAETAARLSGIPVSKLTQAENSKLIN
                     MEKTLSKQVVGQTEAVKAVSNAIRLSRSGLSNPNAPASFLFMGLSGSGKTELAKKVAG
                     FLFADEKAMIRIDCSELADKWSASKLLGAAPGYVGYEEGGILTEALARKPYSVVLFDE
                     LEKAAPEVLTILLQILDDGRVRSSSGKVVNAANCIIIMTSNLGAESINRSSSSKIDPI
                     TRDQVMEAVRAHFRPEFLNRISSMIIFNRLSKKAIRKIVELRISEIEKRFVSSNKNIH
                     LDLDDACYDYLVENGYSKDLGARPLNRLIQNEILNKLALLMLRGQVQDNETVKITLGD
                     RGLELIPNHEPATTDEEYMEVDSDSDMDDIPALD"
     gene            complement(<913598..>913825)
                     /locus_tag="AWJ20_290"
                     /db_xref="GeneID:30034862"
     mRNA            complement(<913598..>913825)
                     /locus_tag="AWJ20_290"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879876.1"
                     /db_xref="GeneID:30034862"
     CDS             complement(913598..913825)
                     /locus_tag="AWJ20_290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734532.1"
                     /db_xref="GeneID:30034862"
                     /translation="MSLEFSAWVSLDTGMPERRAAVSATLSESTISSNKVESDLSSIV
                     LSISSILRLISGIAKYLKSAEAPVSLRRSAS"
     gene            complement(<915066..>915644)
                     /gene="TIF6"
                     /locus_tag="AWJ20_291"
                     /db_xref="GeneID:30034873"
     mRNA            complement(<915066..>915644)
                     /gene="TIF6"
                     /locus_tag="AWJ20_291"
                     /product="translation initiation factor 6"
                     /transcript_id="XM_018879887.1"
                     /db_xref="GeneID:30034873"
     CDS             complement(915066..915644)
                     /gene="TIF6"
                     /locus_tag="AWJ20_291"
                     /inference="similar to AA sequence:KEGG_Orthology:K03264"
                     /note="Constituent of 66S pre-ribosomal particles; has
                     similarity to human translation initiation factor 6
                     (eIF6); may be involved in the biogenesis and or stability
                     of 60S ribosomal subunits; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 11238882]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA,IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 17353896];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11238882]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 11583614];
                     GO_component: GO:0030687 - preribosome, large subunit
                     precursor [Evidence IDA] [PMID 16188229]; GO_component:
                     GO:0030687 - preribosome, large subunit precursor
                     [Evidence IDA] [PMID 17443350]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     22735702]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 23212245];
                     GO_function: GO:0043023 - ribosomal large subunit binding
                     [Evidence IEA]; GO_function: GO:0043023 - ribosomal large
                     subunit binding [Evidence IDA] [PMID 9891075];
                     GO_function: GO:0043022 - ribosome binding [Evidence IEA];
                     GO_function: GO:0003743 - translation initiation factor
                     activity [Evidence IEA,IEA]; GO_process: GO:1902626 -
                     assembly of large subunit precursor of preribosome
                     [Evidence IMP] [PMID 22735702]; GO_process: GO:0000466 -
                     maturation of 5.8S rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     11238882]; GO_process: GO:0000463 - maturation of LSU-rRNA
                     from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 11238882]; GO_process:
                     GO:0042256 - mature ribosome assembly [Evidence IEA,IEA];
                     GO_process: GO:0006364 - rRNA processing [Evidence IGI]
                     [PMID 17353896]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IEA]; GO_process: GO:0042273
                     - ribosomal large subunit biogenesis [Evidence IMP] [PMID
                     10206977]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IMP] [PMID 11238882];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IPI] [PMID 15100437]; GO_process:
                     GO:0000054 - ribosomal subunit export from nucleus
                     [Evidence IEA]; GO_process: GO:0000054 - ribosomal subunit
                     export from nucleus [Evidence IGI] [PMID 17353896];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]; GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0006413 - translational initiation
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="translation initiation factor 6"
                     /protein_id="XP_018734533.1"
                     /db_xref="GeneID:30034873"
                     /translation="MCQTTIAGTRIVGRMTAGNRRGLLVPIQTTDQELQHLRNTLPDT
                     VRIQRVEERLSALGNVICCNDYVALVHPDIERETEELIADVLGVEVFRQTVAGNVLVG
                     SYASITNQGGLVHPQTSVQDQEELSSLLQIPLVAGTVNRGSAVIGGGMVANDWLAVVG
                     LDTTAPELHVVESIFGLNNETPEKDMLIEHYY"
     gene            complement(<917035..>918666)
                     /locus_tag="AWJ20_292"
                     /db_xref="GeneID:30034884"
     mRNA            complement(<917035..>918666)
                     /locus_tag="AWJ20_292"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879897.1"
                     /db_xref="GeneID:30034884"
     CDS             complement(917035..918666)
                     /locus_tag="AWJ20_292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734534.1"
                     /db_xref="GeneID:30034884"
                     /translation="MKAHKRQRQDSGDATNVLDVTGLLEGGVAGLLADKNENGQQGGI
                     ISGKVIDPALSGALETGNHRHQTGNTEKDLGGLESDANSRHGRDMENHDDEARLRIAL
                     EQHNAVAASVGVGVGADVDVVDTTGSDPASRILSSSHGTGVLGVPRTAALAVANAING
                     TNPAVGSRSNSGGSSIRTNLDHPQVADQSVGQRSEEAQTSDQNSQNELMVDFSFGPNG
                     EPIDPKKVCQFCGRMFSHPGSLGRHLDLKRGNRLHPAALVDRIRGDVKRRGDPVEVKN
                     RRAQRARLYNSREDVKQRAKLRRKEREKTESARAVARLNFIQRLGFPPQAGDDGAKVL
                     DPTMIDTHDSSSVLAAGNGTGTGSGSGSSGTGGLVVDRTDSNSLIGSVDILSKKYRSS
                     FAYFTLFFLQSNAWPYGNDLPSEEHYNQVSTVLATVVEPLDPETAAIYRVKLDVAYQE
                     WAKLGDADKRAIWTLCLRRILESTLGSFSPYNIATRDTWLALEEDRILDLSSAADSPS
                     ATAVTPTTQHDPSDASPQDMAVAFASAAVTSGSPL"
     gene            complement(<921323..>922939)
                     /locus_tag="AWJ20_293"
                     /db_xref="GeneID:30034895"
     mRNA            complement(<921323..>922939)
                     /locus_tag="AWJ20_293"
                     /product="E3 ubiquitin-protein ligase MARCH5"
                     /transcript_id="XM_018879908.1"
                     /db_xref="GeneID:30034895"
     CDS             complement(921323..922939)
                     /locus_tag="AWJ20_293"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase MARCH5"
                     /protein_id="XP_018734535.1"
                     /db_xref="GeneID:30034895"
                     /translation="MSDRLESVSPGLRPLNQEDYRCWICLGTADEPPPHNQKDHHWCR
                     PCRCNLVSHQTCLLEWAAEVASTNPRSLLYNSGPKTPQCPQCKSAIHIAKSKSLFIQL
                     RDRIEAANASGFQLFFVTVIGGSIASAVYTSLYALGAASIRCICPRDMALPLLGISVT
                     DQFVQIQPLSVRRMLLVPSIPIVLLLSGSRSTFADVVTLLMPLTLSDGDHLPWKLTGP
                     RLTMALLPLARIGYHVLYDSLVEPIIQLCAARIRPSFSQGLTGRGDGEGAGVELAFDD
                     DDNNGGPLRALGVNFEIVLHDENAGGAGDDPAGNIGDGIADEDGNNDNMNGLAGAGPD
                     QAGRRGGRVGQRRNILTLLLGRLGVLVANALDRAVLPAAAVDNAIPPVIQDDDAIPPV
                     GQDQVNGNLDDPLAGQLNNANQDNNNNNNNNIANGQAENNNGGPADARLVRRQRAADW
                     VFSSQGWSLRAGNTLLLPLFSGIMGSGLSLIPAFRRLVPDKFNRNIIGGMLIIVLRDL
                     VNIATALLRVRQENSRRVLDYVELAARGLD"
     gene            <924187..>925302
                     /locus_tag="AWJ20_294"
                     /db_xref="GeneID:30034906"
     mRNA            <924187..>925302
                     /locus_tag="AWJ20_294"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879919.1"
                     /db_xref="GeneID:30034906"
     CDS             924187..925302
                     /locus_tag="AWJ20_294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734536.1"
                     /db_xref="GeneID:30034906"
                     /translation="MVYTLKWGILATGGIATTFAKDILADPGLRNVSDVKHEIVAVAS
                     SSSAERAKKFAEEVGAPSAAAYGNYEQLVADKNVDVIYVATPHSHHYQNAKLALEAGK
                     NVLCEKPFTINAKQLKHLVKIAREKKLFLMEAVWTRYFPMTLELQKLLFKDRIIGKIL
                     RVSSDLAVPFNIPNDFDPKHRMKNPELGGGALLDLGIYSLTWIFITAFAEPENKRQAP
                     KVNGSILFTKDTKVDEHTTVNLIFPESHVSAVATTSMTGLSEHDNVCLIQGEKGYIKV
                     DFPTYRPEGFTINLYQDGIKGSGKNLKTEHKSYPIPGGHGMHWEADEVARCLRDGKLE
                     SSLMPLDESIIIAEAMDKVREVNDFKYPAALEAVDQY"
     gene            complement(<925546..>926142)
                     /locus_tag="AWJ20_295"
                     /db_xref="GeneID:30034917"
     mRNA            complement(<925546..>926142)
                     /locus_tag="AWJ20_295"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879930.1"
                     /db_xref="GeneID:30034917"
     CDS             complement(925546..926142)
                     /locus_tag="AWJ20_295"
                     /inference="similar to AA sequence:KEGG_Orthology:K06910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734537.1"
                     /db_xref="GeneID:30034917"
                     /translation="MHVFVEKIFGFVLPKIFTPPTEDMLLKNKPSLAKIPTELVVTSS
                     AFEDGQHMPWKYGGEGVGEDTSPPLTVENIPSDTGSLVFVLQDLDVPLPKPITHTVAY
                     NLPVQKEFPEGYFDSKESSDKLTCGKAFRGHTGYLGPRPIINHGPHRYYFTIYAIKQE
                     APRLNPLVEEPELIAYLEKWAVSTGTVIGTFERTDAKH"
     gene            <928388..>928954
                     /gene="HNT1"
                     /locus_tag="AWJ20_296"
                     /db_xref="GeneID:30034928"
     mRNA            <928388..>928954
                     /gene="HNT1"
                     /locus_tag="AWJ20_296"
                     /product="Hnt1p"
                     /transcript_id="XM_018879941.1"
                     /db_xref="GeneID:30034928"
     CDS             928388..928954
                     /gene="HNT1"
                     /locus_tag="AWJ20_296"
                     /note="Adenosine 5'-monophosphoramidase; interacts
                     physically and genetically with Kin28p, a CDK and TFIIK
                     subunit, and genetically with CAK1; member of the
                     histidine triad (HIT) superfamily of nucleotide-binding
                     proteins and similar to Hint; protein abundance increases
                     in response to DNA replication stress; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IDA] [PMID 11805111];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence ISS] [PMID 9164465]; GO_process: GO:0009117 -
                     nucleotide metabolic process [Evidence IDA] [PMID
                     11805111]"
                     /codon_start=1
                     /product="Hnt1p"
                     /protein_id="XP_018734538.1"
                     /db_xref="GeneID:30034928"
                     /translation="MFSEECPFCDIAASNRPGSLESTSTVFYSTEHVLAFLDIQPLVS
                     SAAHVLVTSRKHYKTLDELASDPDTSAALGIALAKVSKALKTQFGAEAFNIVQNNGSA
                     AGQVVPHVHFHVVIRKQQTNPPSTLPKSADLMKTLLSAPSYDSLDFKTKMAYSSLIFG
                     RGTRQDLDDSWAATLVPQLRTALSSPKL"
     gene            complement(<929217..>931241)
                     /gene="CLB2"
                     /locus_tag="AWJ20_297"
                     /db_xref="GeneID:30034939"
     mRNA            complement(<929217..>931241)
                     /gene="CLB2"
                     /locus_tag="AWJ20_297"
                     /product="B-type cyclin CLB2"
                     /transcript_id="XM_018879952.1"
                     /db_xref="GeneID:30034939"
     CDS             complement(929217..931241)
                     /gene="CLB2"
                     /locus_tag="AWJ20_297"
                     /inference="similar to AA sequence:KEGG_Orthology:K02220"
                     /codon_start=1
                     /product="B-type cyclin CLB2"
                     /protein_id="XP_018734539.1"
                     /db_xref="GeneID:30034939"
                     /translation="MSRQLRNRTRIGNENDENNNVGLVARARAKAVELDSNSNGINRL
                     DKKPLGNLSANNNVNGNIAVGGVQDNVTRMTTRRRAALGDVSNVSKKTDPAAAGAATK
                     GGLGIRAGSTVTNPTRASLLRSRNNGVTSNSSATAAGVASTTGNINTNGTARPGLTKT
                     GADGGVATRTALRTTSWTSAGAGTGAGNHARHALNNGLNNSNIHSNGASNGASNAAAY
                     RSASVGAASNTVANTASNAGEVDQITTKNIHLLDESSNSRASKRPKTSAMSGLVSSSS
                     SSLSNDSTTNSSRLARNNTDTAASTSTSTSTGSSTNTLSSRNHSRPLAEIPLLEVPVP
                     SRNSMARPSVLGKVAQTSTSRLSVASSASSSKQESETITSTHGTAEASSNSLVATTTT
                     SPVQDWDDLDAEDFDDPLMVSEYVVEIFEFLYKSQYTYMPDADYVRNQTYFTWSMRDI
                     LVDWLGEVHTRFRLLPETLFLAVNIFDRYMSSVDVPGDEIQTIGITSMFIAAKYEEVF
                     TPSVANFAYMVDNLAEEDILEAERGILRVLEFRNSYPNPMNFLRRISKADDYDINTRT
                     IGKYLLEISLFEHRLLKYTPAEHSAAAMFLARRMLKRPSWDANMKHYSGGYDEESLKP
                     ILAIIVDYLVSAVTHEAFFRKYAHKRFLKASIIARTWAKENRLHYQLPSS"
     gene            <934497..>937007
                     /locus_tag="AWJ20_298"
                     /db_xref="GeneID:30034950"
     mRNA            <934497..>937007
                     /locus_tag="AWJ20_298"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879963.1"
                     /db_xref="GeneID:30034950"
     CDS             934497..937007
                     /locus_tag="AWJ20_298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734540.1"
                     /db_xref="GeneID:30034950"
                     /translation="MKSRIPSRLRTFVGNTARSLSPGPSREPSSKDGLDQRRPLSVQE
                     DVEADVDDDDDESSFSTEEEDEDEDDLTEDLQDLRIKPSTSISSKQSRHFTINDADSI
                     IGGHSIGGGSRIDSDEELLPIDDEALIEEAVEEEEDDGPIEDVLEDDMVDAEETRQRE
                     REEKGLRRSYSEGSRSVDVGSSNNDSNVTFASTSVEGDGSINKEARHDSVLVAGVGSG
                     VGSGVGSGARAGPRSNLGIDTAAANSTTKARAAPKSASQAERGSFGTGYGVNKGRSRS
                     GTFQEAYRARARSFSSSKYISHIKQQKVFSFSLPFNNPLANLEMPSFTSSLDLPTINF
                     RSMIFNSNADSGSDIHKDSLSEYADLDSDEEDLKYSAIKRQDNTRVRAVRHTLSRNFS
                     LPLSPARQDTFPDIQGDVVIMGGYRGSILRDSKTKKRIWIPIKAGLNMRKIDLTVGIT
                     DQDEYDMPTEHIYPDGMLTHIGPIDISRRLIRKMTEQPGCRVHEFGYDWRLSSDINSQ
                     RLRQFLKKIKQKSKNHKPAIVIAHSMGGLIAHHAMQNEPELFRGLLYAGVPSSCPNIL
                     GPLRYGDSVLLSSRILTAKVNFLMRSSYVFLPLNGRCFVDKHDKTKRYDLDFFDVNTW
                     VEYGLSPCVSPIAEVRASACRQLQPSSSTTPSSTSVIQDRIQDKLRAAAKTTFPSLTN
                     SPDMPIPFDEAKEYLDRTLKRTKKFINELTEVHPDKSYPPLAVIYGCTLPTLRGARVD
                     GPEGIKEGDYDHLFFGAGDGVVYRKTLMPDYYGFPVVVKVPSDASHVTLLTDIDGVGR
                     ALAGILEEEALRNKTNSTTKHRSGAQHASTMPVQATTY"
     gene            complement(<937234..>937743)
                     /gene="JJJ3"
                     /locus_tag="AWJ20_299"
                     /db_xref="GeneID:30034961"
     mRNA            complement(<937234..>937743)
                     /gene="JJJ3"
                     /locus_tag="AWJ20_299"
                     /product="Jjj3p"
                     /transcript_id="XM_018879974.1"
                     /db_xref="GeneID:30034961"
     CDS             complement(937234..937743)
                     /gene="JJJ3"
                     /locus_tag="AWJ20_299"
                     /inference="similar to AA sequence:KEGG_Orthology:K17867"
                     /note="hypothetical protein; contains a CSL Zn finger and
                     a DnaJ-domain; involved in diphthamide biosynthesis;
                     ortholog human Dph4; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0008198 - ferrous iron binding [Evidence IDA] [PMID
                     22367199]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_process: GO:0017183 -
                     peptidyl-diphthamide biosynthetic process from
                     peptidyl-histidine [Evidence IMP] [PMID 15485916]"
                     /codon_start=1
                     /product="Jjj3p"
                     /protein_id="XP_018734541.1"
                     /db_xref="GeneID:30034961"
                     /translation="MSSGLNLYEILGIRQWHGRENEISDDEIKQAYREALLESHPDKR
                     QQRNEDHSTISIEEIRKAYTILSDPVARKEYLIRLQSGSHGTAPSGRGFVQLGDAVDL
                     DDMTIHEDILNSSGETTTKWTKACRCGHSQGYVVWESDLLNNGSADEIKVPCVGCSLW
                     ITVQYSVEE"
     gene            <938459..>939697
                     /gene="RPA49"
                     /locus_tag="AWJ20_300"
                     /db_xref="GeneID:30034974"
     mRNA            <938459..>939697
                     /gene="RPA49"
                     /locus_tag="AWJ20_300"
                     /product="DNA-directed RNA polymerase I subunit RPA49"
                     /transcript_id="XM_018879987.1"
                     /db_xref="GeneID:30034974"
     CDS             938459..939697
                     /gene="RPA49"
                     /locus_tag="AWJ20_300"
                     /inference="similar to AA sequence:KEGG_Orthology:K03005"
                     /note="RNA polymerase I subunit A49; essential for
                     nucleolar assembly and for high polymerase loading rate;
                     required for nucleolar localization of Rpa34p;
                     GO_component: GO:0005736 - DNA-directed RNA polymerase I
                     complex [Evidence IDA] [PMID 11486042]; GO_component:
                     GO:0005736 - DNA-directed RNA polymerase I complex
                     [Evidence IMP] [PMID 1409638]; GO_component: GO:0005736 -
                     DNA-directed RNA polymerase I complex [Evidence IDA] [PMID
                     9837969]; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 21263028]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_function: GO:0003677 - DNA binding
                     [Evidence IEA,IEA]; GO_function: GO:0003899 - DNA-directed
                     RNA polymerase activity [Evidence IEA,IEA]; GO_function:
                     GO:0001054 - RNA polymerase I activity [Evidence IDA]
                     [PMID 9837969]; GO_function: GO:0016779 -
                     nucleotidyltransferase activity [Evidence IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0008361 - regulation of cell size
                     [Evidence IMP] [PMID 12089449]; GO_process: GO:0042254 -
                     ribosome biogenesis [Evidence IEA]; GO_process: GO:0006362
                     - transcription elongation from RNA polymerase I promoter
                     [Evidence IDA] [PMID 18160037]; GO_process: GO:0006360 -
                     transcription from RNA polymerase I promoter [Evidence
                     IDA] [PMID 9837969]; GO_process: GO:0042790 -
                     transcription of nuclear large rRNA transcript from RNA
                     polymerase I promoter [Evidence IMP] [PMID 12374750];
                     GO_process: GO:0042790 - transcription of nuclear large
                     rRNA transcript from RNA polymerase I promoter [Evidence
                     IGI] [PMID 9121426]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase I subunit RPA49"
                     /protein_id="XP_018734542.1"
                     /db_xref="GeneID:30034974"
                     /translation="MASTKATEVVKLQTKLLIDDERESSAILGQFPGINVSETASFEL
                     YKSKSGKALVHGQSDKLEYDGVSEGKDGNKYCVAVYDPQTKSLQLVPTPLVALSTIVK
                     SKKRVRGPDIKQSNVRNSIQRTALGEAFGTKKAKKAITDLERNKIDADLLQDLETAIV
                     DTVKTSTENLPSHEKIQEALSSERPIPPYNLEATDTSLIYPLIDGVFSKQEYDAMKVA
                     SIILKEKDDAKRIAMFPQKTSTYIHTRVQNTILSEISSVDKIHKIKLLYYASLLIAVY
                     ENRRISSKTALLAKLGNPPEILVQGVINKFTVSKAGRFGRSKDMSFAIDPACENKLLC
                     YFLVLALHLDNFSVEIPPLVHELSLKPSKLADLFKALGCNIKVVGASKSNNNAGLKIA
                     VLKAPLRLPEVAKRKRAGGR"
     gene            complement(<940054..>941709)
                     /gene="MAL11"
                     /locus_tag="AWJ20_301"
                     /db_xref="GeneID:30034985"
     mRNA            complement(<940054..>941709)
                     /gene="MAL11"
                     /locus_tag="AWJ20_301"
                     /product="Mal11p"
                     /transcript_id="XM_018879998.1"
                     /db_xref="GeneID:30034985"
     CDS             complement(940054..941709)
                     /gene="MAL11"
                     /locus_tag="AWJ20_301"
                     /note="High-affinity maltose transporter (alpha-glucoside
                     transporter); inducible; encoded in the MAL1 complex
                     locus; broad substrate specificity that includes
                     maltotriose; required for isomaltose utilization;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence ISS] [PMID 16741702]; GO_component: GO:0005886 -
                     plasma membrane [Evidence ISS] [PMID 8594329];
                     GO_function: GO:0005352 - alpha-glucoside:proton symporter
                     activity [Evidence IDA] [PMID 12702465]; GO_function:
                     GO:0005364 - maltose:proton symporter activity [Evidence
                     IMP] [PMID 1999393]; GO_function: GO:0005364 -
                     maltose:proton symporter activity [Evidence IMP] [PMID
                     8594329]; GO_function: GO:0022891 - substrate-specific
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015293 - symporter activity [Evidence
                     IEA]; GO_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA]; GO_function: GO:0015574 -
                     trehalose transmembrane transporter activity [Evidence
                     IDA] [PMID 12702465]; GO_process: GO:0008643 -
                     carbohydrate transport [Evidence IEA]; GO_process:
                     GO:0046352 - disaccharide catabolic process [Evidence IMP]
                     [PMID 20562106]; GO_process: GO:0000023 - maltose
                     metabolic process [Evidence IEA]; GO_process: GO:0015768 -
                     maltose transport [Evidence IGI] [PMID 6371820];
                     GO_process: GO:0015768 - maltose transport [Evidence IMP]
                     [PMID 8594329]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0015771 -
                     trehalose transport [Evidence IDA] [PMID 12702465]"
                     /codon_start=1
                     /product="Mal11p"
                     /protein_id="XP_018734543.1"
                     /db_xref="GeneID:30034985"
                     /translation="MSKEGEFQDEVEVPGVTATEAEINARAAQMAAHKDGYRAAFKRY
                     PKIFFWIGVMLWMLILMGFDNSAGGQVLSIPKFRENFGGGLFVDGNFLLSASWQSAIQ
                     AGPTAMNVVGLYVGSYTADHLGKRIVLFAAICISFAAIGVEYSCKTIETFFAGKMVNG
                     FALGIMSALCVSYVAEISPLSIRGIATGCCNLSQTIGPFIGSILGNYVGTKNNDWSYK
                     SLFVAQWLFGGIAILVQPWMPESPAFYLKKGKEDKARKQLRRLCSNEEDAEDQLNVLK
                     ITLYEAEQLYNGGSYIQCFKGTNLRRTLLAGLVFFTHPMSGVSFNSSYGPFIYQLIGI
                     SAQESFRIGIGAQVLSMGGTIASFFIIDRFGRRPLILCGLTALMINLLCTGITGTQSQ
                     HSAAARTACVAFLTMFNFWYNGGIGAIAYAIASEIPTSVLRTKTVAIALSVNQGFGTM
                     WTFVLPFIINPNEGNLGPKVGFIFFALSMINLVLLYLFLPEIAHRTFEELDELFANHV
                     PAREFKKYITAAEVKAEQAFNQKGIADGTINEKQQDIEMVEHA"
     gene            <942926..>944233
                     /locus_tag="AWJ20_302"
                     /db_xref="GeneID:30034996"
     mRNA            <942926..>944233
                     /locus_tag="AWJ20_302"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880009.1"
                     /db_xref="GeneID:30034996"
     CDS             942926..944233
                     /locus_tag="AWJ20_302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734544.1"
                     /db_xref="GeneID:30034996"
                     /translation="MPSQNKTRYALIGTGGRAMFFYVSLVRDYSQTSELVAFCDTNQT
                     RMNYANKKVEELGGKAVPTYLAHDFEKMIAEVKPDHLIVTTMDRTHHKYIIRAMELGV
                     DVISEKPMTVDEVKCQEILDAVERTGRKLRVTFNYRYAPHNTKIRELIADDTIGQVNA
                     VHFEWFLNTKHGADYFRRWHRNKNNSGGLLVHKSTHHFDLVNFWMNTNPVTAFAFGDL
                     RFYGKENAEKRGVTQFYSRAHGSKVAKDDPFALHLEENEQLKEMYLDAEHEDDYFRDQ
                     SVFGDGISIEDTMAATVKYANGAVLSYALHAYSPLEGFRVVFNGSKGRIELNVIECSY
                     VNSGGEQAKEGAIEKLEITVYPMFGKSYNVDIDFKEGGHGGGDPVLLNDIFGVPVPDR
                     FNRAASHVDGALSILTGIACNKSIRTGLPVQVMDLVDFRGARK"
     gene            complement(<944475..>946499)
                     /locus_tag="AWJ20_303"
                     /db_xref="GeneID:30035007"
     mRNA            complement(<944475..>946499)
                     /locus_tag="AWJ20_303"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880020.1"
                     /db_xref="GeneID:30035007"
     CDS             complement(944475..946499)
                     /locus_tag="AWJ20_303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734545.1"
                     /db_xref="GeneID:30035007"
                     /translation="MAIDRLSLVRRHNPTRTSSNPISPLQVGNGHLAFGADITGLQTF
                     VPFSIMSDWGYKSDPLPSEKLSDFTGQTWSTHGRDVKYLMPNEQKELSQWLISNPNRM
                     NLGRIGLYFGEATVSESDLRDCHQELDLWTGSVRSSFEYKGEKVQIQTICDPENDTVS
                     FSIQSTLIEKKKLSIFLDFPYNCGKSKFQAPYVGDWDNPSAHTTKVSESSASNVSLVR
                     DIDGTKYFVTANWNSSGKLVRLKDHRFALELDEGSSVLEVGVTFSESNAKNEWSFQSS
                     LAKAESHWESFWKEGGAIDLSRSKDPRWKELERRFVVGQYAMAINATGKEPPQESGLV
                     NTGWYGKFHTEMVWWHLGYLALLNKWSVLRRPLSVYDKLLPEALKLASSQGYKGARWP
                     KMVDPSGRPSPGEINALLIWQNPHVMLFAELDYRAHPTSETLEKWKKAVFETAEFLED
                     YAHWNPETQTYDLGSPVHVVSENTDARETYNPSLELQYWRFGLSVAQQWRKRLGIAPN
                     EQWERVLTNLATPHIEDGLYVIWPGIKDMWTKYTWEHPALVGMYGWLPSNDALDINTM
                     KATSKKIWETWHFDECWGWDFGMLAMNAARLGEPEKAIDFLLDPNMPFDDAGLAPGGT
                     QVPFPYLPATGSLLLAVAFMAAGWDDDNGKPSPGFPTGWEVSCEGLHKAI"
     gene            <947045..>948394
                     /locus_tag="AWJ20_304"
                     /db_xref="GeneID:30035018"
     mRNA            <947045..>948394
                     /locus_tag="AWJ20_304"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880031.1"
                     /db_xref="GeneID:30035018"
     CDS             947045..948394
                     /locus_tag="AWJ20_304"
                     /inference="similar to AA sequence:KEGG_Orthology:K12661"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734546.1"
                     /db_xref="GeneID:30035018"
                     /translation="MVDDTKSVRRFPRIKEIRTFIPSGPGMGDYHDVERGHWLIDDKF
                     STPMSKYPDYRKSRVDWGINVLGSFFVEIEADDGTVGFATGFGGPPACWLVKNHFERF
                     LIGADPRNTNKLWDQMFKSSMYYGRKGLPVAVISVIDLALWDLLGKIRNEPVYQMIGG
                     CVLDKLKFYCTGCDPAAAKELGFWGGKVPLPYGPDEGHEGLKLNVEFLRKHREAVGPD
                     FPLMVDCWMSLNVPYLIDLVNATRDLNINWWEETLHPDDYDGYAQLKRALPFIKLTTG
                     EHEYTKYGFRKLIEGRNVDILQPDVMWVGGLTELLRVNAQAQAYDIPVVPHASGPYSY
                     HFMFSQPNTPFQEYLASSPDSKTILPVFGNLFVNEPMPHGGYMDISALDKPGFGLELN
                     PAANLIPADFILTPAPAKPLSNGTNGHVQKSITNGKSAELAHIELNGNAAVINGHAK"
     gene            <948662..>949303
                     /locus_tag="AWJ20_305"
                     /db_xref="GeneID:30035029"
     mRNA            <948662..>949303
                     /locus_tag="AWJ20_305"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880042.1"
                     /db_xref="GeneID:30035029"
     CDS             948662..949303
                     /locus_tag="AWJ20_305"
                     /inference="similar to AA sequence:KEGG_Orthology:K18338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734547.1"
                     /db_xref="GeneID:30035029"
                     /translation="MTRRTRRVIDSHVHLFDRSHLDKLAWMTADSPLNEGNDLVRYGE
                     ECHDKKPRNLNYSITGLIFIEADRKVLKPIDDPSGWDFVLDEYKYVDRIRRNELLSSE
                     NSAPLPSIPVKAVIPWAPVPSGRKVLEKYISELKKAGAQSSTSVKGFRYLVQDKPNGV
                     MLEEGFIEGVNYLGEEGYIFELGIDIRSGGLWQLEEAISLVKKIPNTVIIIGE"
     gene            complement(<949782..>952166)
                     /locus_tag="AWJ20_306"
                     /db_xref="GeneID:30035040"
     mRNA            complement(<949782..>952166)
                     /locus_tag="AWJ20_306"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880053.1"
                     /db_xref="GeneID:30035040"
     CDS             complement(949782..952166)
                     /locus_tag="AWJ20_306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734548.1"
                     /db_xref="GeneID:30035040"
                     /translation="MSERLSKVEADLSKLNQLELHSSTQPDRLNKLESEISSQSSAIM
                     ELSRELDYLRHQLMSQSPMSPRNHIRSSPNSNLMGHNAMSIGNPAVSKSSPGTGAGEI
                     VRRASATISNSNGNANSASSLHPQGNNTVSRPAAGSLSNSVAGELSLIEGVSDSSGSR
                     SASSLSDIKVTLLPPKALLRELVDLFFQRIHPCYPFLHPVKASGALHDIISQNLTDSP
                     NPHSTPLSDKRKEYPLVLYSIVVVTLRFVPQFKLNDRDKERYYRSCKETVMLRSFAIT
                     DLDCLQALVILAIDLVGISNGPETWSIIPLICSAATHLGLSREPALFLSNSDVASDSN
                     NESISAQSADILPAAENWQDLESRRRLFWVIYSLDRFSSVATAFSFKINSLEIDRLLP
                     VRADLWTDDSLLHSHVDTRTRWLKTIIRKDYSINFPSNIDTFGYMVENLQILSSIHVF
                     LKKPISIYSLQDVLDWQVQFRQLDIELDNWYKSLPPHLSSEVINDDLKDQLDPMVLML
                     QATYQTTVIRLNSAAGYSCLKSEFFTNSPSAAKRCLLAVSNVVALAKHVIIFGLGKYV
                     GPHYAWALWVSARLLVVDCVTNYKSFPEDLEILLTGLKKLGRVWKVAARYYGLLTMVI
                     DEELSLRSTARGSNALSRGDDDSPIDSMTGEHKRNGSSAQIMSDMRRNAYALDFLLSK
                     QKKEQKKEKPTSGEGPVLKSSPANDNESIKSDEMDQESIISSFELSELMDGSNMNDIF
                     DWFNWPRQSGKMGQKTPVQHSVGEYKNILSREEQIGLYQGESSNTNDRPDWMSM"
     gene            complement(<952947..>954305)
                     /gene="SES1"
                     /locus_tag="AWJ20_307"
                     /db_xref="GeneID:30035051"
     mRNA            complement(<952947..>954305)
                     /gene="SES1"
                     /locus_tag="AWJ20_307"
                     /product="serine--tRNA ligase SES1"
                     /transcript_id="XM_018880063.1"
                     /db_xref="GeneID:30035051"
     CDS             complement(952947..954305)
                     /gene="SES1"
                     /locus_tag="AWJ20_307"
                     /inference="similar to AA sequence:KEGG_Orthology:K01875"
                     /note="Cytosolic seryl-tRNA synthetase; class II
                     aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser),
                     displays tRNA-dependent amino acid recognition which
                     enhances discrimination of the serine substrate, interacts
                     with peroxin Pex21p; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016874 - ligase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0004828 - serine-tRNA ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004828 - serine-tRNA ligase
                     activity [Evidence IDA] [PMID 3031581]; GO_process:
                     GO:0097056 - selenocysteinyl-tRNA(Sec) biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006434 -
                     seryl-tRNA aminoacylation [Evidence IEA]; GO_process:
                     GO:0006434 - seryl-tRNA aminoacylation [Evidence IDA]
                     [PMID 3031581]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="serine--tRNA ligase SES1"
                     /protein_id="XP_018734549.1"
                     /db_xref="GeneID:30035051"
                     /translation="MLDIIQFLEEKGGNPEEIRKSQLARGDPVEIVDEIIADYKEWTK
                     IRFRVDELNKEQNKLQKAIGLKFKAKEDASELVKEKDAIVAKKQSLIAEEEEADKALR
                     AKVNLVGNIVHPSVPVSQDEANNELIRTWAPEGVVVDASVKAKLSHHEVLLRLDGYDP
                     DRGVKVSGHRGYFLRGNGLFLNQALINYGLDFLAKREYTPLQAPVMMNKDVMAKTAQL
                     SQFDEELYKIIDGTDEKYLIATSEQPISAYHSGEWFEQPSEQLPKRYAGYSNCFRREA
                     GSHGKDAWGIFRIHQFDKIEQFCLTEPEKSWEEFERMAGAAEDFYKSLNIPYRLVAIV
                     SGELNNAAAKKYDLEAWFPFQSEYKELVSCSNCTDYQSRNLEIRCGIKKLNDREKKYV
                     HCLNSTLCATQRALCCVLENYQTDDGLRVPEVLRKFIPGEPEFLPYVKDLPKDSTSNK
                     RK"
     gene            <957317..>960346
                     /gene="ESL1"
                     /locus_tag="AWJ20_308"
                     /db_xref="GeneID:30035062"
     mRNA            <957317..>960346
                     /gene="ESL1"
                     /locus_tag="AWJ20_308"
                     /product="Esl1p"
                     /transcript_id="XM_018880074.1"
                     /db_xref="GeneID:30035062"
     CDS             957317..960346
                     /gene="ESL1"
                     /locus_tag="AWJ20_308"
                     /note="hypothetical protein; predicted to contain a PINc
                     domain; ESL1 has a paralog, ESL2, that arose from the
                     whole genome duplication; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0005524
                     - ATP binding [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Esl1p"
                     /protein_id="XP_018734550.1"
                     /db_xref="GeneID:30035062"
                     /translation="MDPGAGESPLRIGSTRRARGSNPDPDFDRGPISNNEKNLRLFNA
                     RISGRSRGFVGSGSATSSGAGGLESSPNPTTYGVAGSIAGDGSPYHKDRVGTESDSRQ
                     YQDQNQQNQQNNQQHQQHHMQMLHQQQAQLQQQQQQQQQYQQQHQQQHQLLLQQQQQQ
                     QQQQQQQGQGQGQGQQSQQQQKSGGAGTEPARTNTAGGGGMENAAVGSGAGSSTRETS
                     SRGGQQQNMPPQQQHYHQSQPPSSSSRHHVQTAYELGVNLPTVEKLIGEIQSAYFDIS
                     RLEVKCLMLSKQIEDNQHIIQQSNLTGSNGNYGDNPTSSRLRNLGIDLSNPSSTGSFD
                     SSKIPPEYWAESYFLELYQNQANLIDKYFDFMFLAYHPCGNSVTRGLVKKYKIPIRMW
                     NKGIFKFLDILRAHMPKSQDLITKFIYHCFSLLTMLVDPPYESRYMWLEALGDLARFS
                     MALGNISHGEWRGVSQYWYSRAANRSPGVGRLFHHCAVVCIYRLDSLFYFCKSLTTTQ
                     QFEPSRETILSLFESNQEGEANTPIALFIKLHQVNFTQTNISDFPKILSDVTSSIMAR
                     DRDYNDLDLKNRGAILAYCNITSLLGYGSLKNPASAFFYELAKERSGAGAALGAASST
                     TNTANTANTANTTNTTGNTTGSTTGSTTGSNASGNNGSGNNNTAGSGNHSTSANSSSN
                     PTTSSVTASAGSLFMAQQISFEMLKQFLTLPRHIALLHVIVWLHFFNALTDNPDVCHH
                     LLLSDFFPASKLVRFLNEGLKTVDLILKDTNTSKQHWTSTTSNSTSNTASGNATNKSN
                     SVGSFHSIHGSAASGSVSGSGAAPPVGTSSGTSGSNKSDNTFSPPGSPSLQCQQCTES
                     ESLIDRIASWKKSYNSRSPAAEDSIELISSKLPNPEERGHFPMLRERPLPEELLLLGF
                     VWSYKTAKTELYNEYESSTTDEPFPGPPGKEVLRPIREVRAIELALSLADSNSWLAYH
                     NGYFELQGPLRVHSEDHMSDSEYVPSPMTTANTGVLD"
     gene            <961559..>962311
                     /locus_tag="AWJ20_309"
                     /db_xref="GeneID:30035073"
     mRNA            <961559..>962311
                     /locus_tag="AWJ20_309"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880085.1"
                     /db_xref="GeneID:30035073"
     CDS             961559..962311
                     /locus_tag="AWJ20_309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734551.1"
                     /db_xref="GeneID:30035073"
                     /translation="MIERSALPSSAATSVSSSSASSLLPKHLAHHKPGQIPEVTTSGS
                     GAGAGAGAASGSGSGATGEAKKRVIRPKASPSAAVNPRPYANMLYEVNPAVHGFFGNI
                     KDMYVVRGPRAFVQGFMPTIFRQVMNSTVRFTTFNFLKQFFHPHDNEPMPGLMAFGIG
                     CVAGAVEVLATQPIDVVKTRMQTVNGIKLYGSSLMCSYKIFVHEGPKHLWAGMLPRFV
                     KVTFSGGIVFGVYEFANSLVMRAMQENPFSWE"
     gene            <963887..>966256
                     /gene="ADE5,7"
                     /locus_tag="AWJ20_310"
                     /db_xref="GeneID:30035085"
     mRNA            <963887..>966256
                     /gene="ADE5,7"
                     /locus_tag="AWJ20_310"
                     /product="bifunctional aminoimidazole ribotide
                     synthase/glycinamide ribotide synthase"
                     /transcript_id="XM_018880096.1"
                     /db_xref="GeneID:30035085"
     CDS             963887..966256
                     /gene="ADE5,7"
                     /locus_tag="AWJ20_310"
                     /inference="similar to AA sequence:KEGG_Orthology:K11788"
                     /note="Enzyme of the 'de novo' purine nucleotide
                     biosynthetic pathway; contains aminoimidazole ribotide
                     synthetase and glycinamide ribotide synthetase activities;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA,IEA]; GO_function:
                     GO:0016874 - ligase activity [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA,IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004637 -
                     phosphoribosylamine-glycine ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004637 -
                     phosphoribosylamine-glycine ligase activity [Evidence ISS]
                     [PMID 3097325]; GO_function: GO:0004641 -
                     phosphoribosylformylglycinamidine cyclo-ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004641 -
                     phosphoribosylformylglycinamidine cyclo-ligase activity
                     [Evidence ISS] [PMID 3097325]; GO_process: GO:0006189 -
                     'de novo' IMP biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0009113 - purine nucleobase biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006144 - purine
                     nucleobase metabolic process [Evidence TAS] [PMID
                     9148957]; GO_process: GO:0006164 - purine nucleotide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional aminoimidazole ribotide
                     synthase/glycinamide ribotide synthase"
                     /protein_id="XP_018734552.1"
                     /db_xref="GeneID:30035085"
                     /translation="MASLNILLIGNGGREHALAWKLNQSKLVNKIYVAPGNGGTGNGQ
                     LSKVENIAIGSSKQDFEKLVEFAVKNDVNLVVPGPEQPLVEGIEGYFRKVGIPVFGPS
                     EKAARMEGSKTFSKDFMAKHKIPTAEFENFTDFDKAKAYVESVNHNVVIKASGLAAGK
                     GVLMPTTKEEAYKALEQVMKDKEFGDAGDEVVVEECLEGDELSILAFSDGYTVIDLPA
                     AQDHKRIGEADTGLNTGGMGAYSPTPIATPELIDEIRETILKPTVTGMRRDGIPFVGM
                     LFTGIMLTKTGPKVLEYNVRFGDPETQTVLPLLSEDTDLAEVFLACAEHRLDSVTLKV
                     NPGFATTVVLSAGGYPSSYEKGDEITVGEVAKDTFVFHAGTSTKDGKIVTSGGRVIAS
                     SAVAPTLKEAVQKAYEGVEKIQFKNRYFRRDIAHRAFRDASKSSAANSTSITYEQAGV
                     SVDQGNKFVEEIKAKVKSTRRPGADADIGGFGGLFDLKATGFRDPLLVGATDGVGTKL
                     KIAQTLGIHDTVGIDLVGMNVNDLVVQGAEPLIFLDYFASGKLNIETAAAFVSGVAEG
                     CIQAGCALVGGETAEMPGLYHGDDYDVNGTSIGAVERDAILPRLDDLAVGDVVLGIAS
                     HGPHSNGFSLIRKILEVSKLQYTDKAPWDPSTTVGKSLLTPTRIYVKSLLPIIKQKKI
                     IALAHITGGGLVENVPRVLPKHLNAEIDGSSWEIPAVFQWLGKAGNVPVSDISKTLNM
                     GIGMVVIVKKEDAASVLSQLNEAGEKAYSIGSIVSGEQKCVLKNTSNWY"
     gene            complement(<969152..>970762)
                     /gene="DHH1"
                     /locus_tag="AWJ20_311"
                     /db_xref="GeneID:30035096"
     mRNA            complement(<969152..>970762)
                     /gene="DHH1"
                     /locus_tag="AWJ20_311"
                     /product="DExD/H-box ATP-dependent RNA helicase DHH1"
                     /transcript_id="XM_018880107.1"
                     /db_xref="GeneID:30035096"
     CDS             complement(969152..970762)
                     /gene="DHH1"
                     /locus_tag="AWJ20_311"
                     /inference="similar to AA sequence:KEGG_Orthology:K12614"
                     /note="Cytoplasmic DExD/H-box helicase, stimulates mRNA
                     decapping; coordinates distinct steps in mRNA function and
                     decay, interacts with both the decapping and deadenylase
                     complexes, role in translational repression, mRNA decay,
                     and processing body dynamics; may have a role in mRNA
                     export; C-terminus of Dhh1p interacts with Ngr1p and
                     promotes POR1, but not EDC1 mRNA decay; forms cytoplasmic
                     foci upon DNA replication stress; GO_component: GO:0005737
                     - cytoplasm [Evidence IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 12032091]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 22842922];
                     GO_component: GO:0000932 - cytoplasmic mRNA processing
                     body [Evidence IEA]; GO_component: GO:0000932 -
                     cytoplasmic mRNA processing body [Evidence IDA] [PMID
                     12730603]; GO_component: GO:0000932 - cytoplasmic mRNA
                     processing body [Evidence IDA] [PMID 18611963];
                     GO_component: GO:0010494 - cytoplasmic stress granule
                     [Evidence IDA] [PMID 20368989]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0004004 -
                     ATP-dependent RNA helicase activity [Evidence ISS] [PMID
                     12930949]; GO_function: GO:0008026 - ATP-dependent
                     helicase activity [Evidence IEA]; GO_function: GO:0003723
                     - RNA binding [Evidence IEA]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IDA] [PMID 23706738];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA,IDA] [PMID 23222640]; GO_function:
                     GO:0003676 - nucleic acid binding [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0005515 - protein binding [Evidence
                     IPI] [PMID 11780629]; GO_function: GO:0090079 -
                     translation regulator activity, nucleic acid binding
                     [Evidence IGI,IMP] [PMID 22719226]; GO_process: GO:0006200
                     - ATP catabolic process [Evidence IEA]; GO_process:
                     GO:0033962 - cytoplasmic mRNA processing body assembly
                     [Evidence IMP] [PMID 18182159]; GO_process: GO:0033962 -
                     cytoplasmic mRNA processing body assembly [Evidence IGI]
                     [PMID 18981231]; GO_process: GO:0000290 -
                     deadenylation-dependent decapping of nuclear-transcribed
                     mRNA [Evidence IMP] [PMID 11780629]; GO_process:
                     GO:0006397 - mRNA processing [Evidence IEA]; GO_process:
                     GO:0051028 - mRNA transport [Evidence IEA]; GO_process:
                     GO:0017148 - negative regulation of translation [Evidence
                     IMP] [PMID 21844211]; GO_process: GO:0045900 - negative
                     regulation of translational elongation [Evidence IGI,IMP]
                     [PMID 22719226]; GO_process: GO:0006417 - regulation of
                     translation [Evidence IEA]; GO_process: GO:0034063 -
                     stress granule assembly [Evidence IMP] [PMID 18981231];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="DExD/H-box ATP-dependent RNA helicase DHH1"
                     /protein_id="XP_018734553.1"
                     /db_xref="GeneID:30035096"
                     /translation="MSDAWKSQLNIPEKDHRPQTEDVTATKGNGFEDFYLKRELLMGI
                     FEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFTIPALQQVNPKLGKIQALI
                     LVPTRELALQTSQVCRTLGKHLGINVMVTTGGTTLKDDIIRLNESVHVLVGTPGRVLD
                     LAGKNVVDFSECPMFIMDEADKLLSPDFTPIIEQLLAHFPPDRQILLFSATFPLLVKS
                     FMDKHLNKPYEINLMDELTLRGITQYYAFVEEKQKLHCLNTLFSKLSINQSIIFCNST
                     NRVELLARKITELGYSCYYSHAKMIQAHRNRVFHEFRNGTCRNLVCSDLLTRGIDIQA
                     VNVVINFDFPKNAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYQIEQELGTEIKPI
                     PSHIDRSLYVAQNTDAIPKPFPLKELPKSNQRSHEKYQQQTDLNFQPRPQHHNQHHHH
                     QQQQGQQHLQQNQNQNPNQIPTQNQHPSQAFSGQPQPPQGVPPQGYPQFPQGYPPQPG
                     YPPQGFPQQPPVPPNGQFYAQPPPALPQ"
     gene            <972230..>974227
                     /gene="STE7"
                     /locus_tag="AWJ20_312"
                     /db_xref="GeneID:30035107"
     mRNA            <972230..>974227
                     /gene="STE7"
                     /locus_tag="AWJ20_312"
                     /product="mitogen-activated protein kinase kinase STE7"
                     /transcript_id="XM_018880118.1"
                     /db_xref="GeneID:30035107"
     CDS             972230..974227
                     /gene="STE7"
                     /locus_tag="AWJ20_312"
                     /inference="similar to AA sequence:KEGG_Orthology:K11226"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase STE7"
                     /protein_id="XP_018734554.1"
                     /db_xref="GeneID:30035107"
                     /translation="MSGSAEFTRQKLSLGDDSDTSSRASIQVGIGNGSSIVNNGLGSG
                     SGSGSNTLDTDLGAGTVPAAVTTAAGATATTAVSAIADIVSTAPAAADSRPVTDNFAS
                     PIDTASSVFGAGISTGVGSVGGIAIALPDSQDSVHSPVRSTISSASSSPLTANTADTA
                     TASPNSSFNSVNSSSVDDVPRILPVKTLKRKNFKALSLPVSSPGSGNINTNGLGNGLG
                     NGVGNGNGNGNGTSNDFMSAGSNGGHVPSLLAPSTAASARQSTQRVAPVPLGSINGNN
                     NSNNNNGNPNNSNSSINNNSNSINNFNNNSNNSNSNDNINSNISSNSSNNGSNGSYDT
                     SYGASGPVDSSINNYSSNSIGVSTYTGGGNIVTQLASLELGVEFKLDLREEDFENITD
                     LGHGNGGTVSKVVHVPTKTVMAKKVIHLETKPAVRKQIARELHIMHECESDYIVGYYG
                     GFVTESSVIICMEYMDCGSLDRISKLKGSINEGIISKITYAVVQGLTYLYDEHRIVHR
                     DVKPSNVLVNSRGQVKLCDFGVSGELINSLAETFVGTSTYMSPERIQGAAYSVKGDVW
                     SLGLTVLELAIGKFPFSSNNGGNPGSILDLLQRIVNEDPPALPDNGQFSPQFRKFVDK
                     CLYKEPQRPTPHELLDHDAFILTAKHSAISVENWACDLCID"
     gene            complement(<974469..>974762)
                     /locus_tag="AWJ20_313"
                     /db_xref="GeneID:30035118"
     mRNA            complement(<974469..>974762)
                     /locus_tag="AWJ20_313"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880129.1"
                     /db_xref="GeneID:30035118"
     CDS             complement(974469..974762)
                     /locus_tag="AWJ20_313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734555.1"
                     /db_xref="GeneID:30035118"
                     /translation="MSNILDVFNPKTPPNGQQPQEPCFPCLLTSAAVMIAGGGYMASG
                     AVFMAKEGQPLPQAATPAWRATVRLGGVGVLALGLYRAYDTLMLSKEADSKLH"
     gene            <987840..>989351
                     /gene="CMR1"
                     /locus_tag="AWJ20_314"
                     /db_xref="GeneID:30035129"
     mRNA            <987840..>989351
                     /gene="CMR1"
                     /locus_tag="AWJ20_314"
                     /product="Cmr1p"
                     /transcript_id="XM_018880140.1"
                     /db_xref="GeneID:30035129"
     CDS             987840..989351
                     /gene="CMR1"
                     /locus_tag="AWJ20_314"
                     /note="DNA-binding protein with preference for UV-damaged
                     DNA; protein sequence contains three WD domains (WD-40
                     repeat); green fluorescent protein (GFP)-fusion protein
                     localizes to the cytoplasm and nucleus; potential
                     regulatory target of Mbp1p, which binds to the promoter
                     region; co-localizes with Hos2p in nuclear foci in
                     response to DNA damage by MMS; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 22367945];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0000790 - nuclear chromatin
                     [Evidence IDA] [PMID 22367945]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 22842922];
                     GO_function: GO:0003677 - DNA binding [Evidence IDA] [PMID
                     22367945]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]"
                     /codon_start=1
                     /product="Cmr1p"
                     /protein_id="XP_018734556.1"
                     /db_xref="GeneID:30035129"
                     /translation="MFSDVRQKSAKTARSSSNSSSRTRRAPRVKQEVDLGPRRKSRRL
                     EGKKAEFDIERETAERLLVIEKQAAQEDKARKEGELKLADVIKNGEWDQALGLLSSLG
                     KVSQGDYFEKIKKEEEQEENDGGTRDSDNSGLSSGKKKELVSARKELSNLSLHTKISP
                     NDIKVTSERIFSVAFHPSETKRIVLAGDKMGELGLWDIDSTNKIKDEGDYEYETPNIL
                     SFKVHTRAIATILMPQFAPDKAYTASYDGSVRCLDLGSGTSTEAFVYDSDPRNPVGVS
                     DCAMPDANTLYYTTLEGEFGIHDLRENQRKPKSQLLRLHDKKIGGFSFNPNAIHQIAT
                     GSLDRTLKVWDLRATSVIAESEDNEKAPHMYGEYQSRLSISATDWNSAGQIVCNGYDD
                     TINVFDLSTSKSWTKSETHDIVPSVRLKHNCQTGRWVSILKSRWQPRPADSVQKFVIA
                     NMKRYLDIYSADGQQLAHLGHELMSAVPAVVQFHPSQNWLVGGSASGKLYLWE"
     gene            <991873..>993621
                     /locus_tag="AWJ20_315"
                     /db_xref="GeneID:30035140"
     mRNA            <991873..>993621
                     /locus_tag="AWJ20_315"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880151.1"
                     /db_xref="GeneID:30035140"
     CDS             991873..993621
                     /locus_tag="AWJ20_315"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734557.1"
                     /db_xref="GeneID:30035140"
                     /translation="MPRVTLNRPQGIVLTACILLFVGYELFIIYNRNEVDPAWSKISS
                     PFSKTPKTPQYVTEFKEQMDKGGYIPSLDSYDLYESVDVWRSPESFSHAYDDNPNSRH
                     KSSMHFDNVHGRPKNPDPASYGSTGEYLKIPLVADYPPNADKIFLMIKTGASVLWDRL
                     PVHLFTTLTRVPNFAIYSDAPGSVGGYEVIDVLANMTAKSRLRNEFKMYRDQRTLHDT
                     HGNMPLTDVMGKDGWVLDKFKNIPMLAHAWTVSPDSDWYVFMDADSFYFIDNLVEVLS
                     HFDPNQPLYMGSPAGAGRYTFAHGGSGVVLSHRTMQDTVGVDPIQVPKDYEDRTFKEC
                     CGDLMVAYMVVDRANTLITPNPSFKGEPYYSMELKESLWCKPPVSFHHLFPHDIEVLW
                     EYERIKRLQGKQILFADMYRDFVMPYIDHQIEDWDNESWTTIVTLAKDRQNNILPSTE
                     GGDEVRPYESLDACLKFCEGLPDCLMYSYHKKKQQCAVAPLVKLGKPAHDFQKSAIKD
                     SNQGMVSGWMIERIQQMRNRTECDVAYKSSDAVYKTGIDRTEGWLRREDRTIITGKPY
                     LDRDTDYASDTDAGIA"
     gene            complement(<993802..>994497)
                     /gene="PRC1"
                     /locus_tag="AWJ20_316"
                     /db_xref="GeneID:30035151"
     mRNA            complement(<993802..>994497)
                     /gene="PRC1"
                     /locus_tag="AWJ20_316"
                     /product="carboxypeptidase C PRC1"
                     /transcript_id="XM_018880162.1"
                     /db_xref="GeneID:30035151"
     CDS             complement(993802..994497)
                     /gene="PRC1"
                     /locus_tag="AWJ20_316"
                     /inference="similar to AA sequence:KEGG_Orthology:K13289"
                     /note="Vacuolar carboxypeptidase Y (proteinase C, CPY);
                     broad-specificity C-terminal exopeptidase involved in
                     non-specific protein degradation in the vacuole; member of
                     the serine carboxypeptidase family; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 11914276]; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IDA] [PMID 23708375]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0004180 -
                     carboxypeptidase activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0004185 - serine-type
                     carboxypeptidase activity [Evidence IEA]; GO_function:
                     GO:0004185 - serine-type carboxypeptidase activity
                     [Evidence IDA,IMP] [PMID 8679540]; GO_process: GO:0046938
                     - phytochelatin biosynthetic process [Evidence IDA,IMP]
                     [PMID 17408619]; GO_process: GO:0006508 - proteolysis
                     [Evidence IEA,IEA]; GO_process: GO:0007039 - vacuolar
                     protein catabolic process [Evidence TAS] [PMID 8789256]"
                     /codon_start=1
                     /product="carboxypeptidase C PRC1"
                     /protein_id="XP_018734558.1"
                     /db_xref="GeneID:30035151"
                     /translation="MACGQGGYQAVLSNSVCSAMKSEIPSCLSSISQCYSSNSQLQCV
                     QATNQCNEDEYEPLAETGLNVYDLRTQCQGELCYAGLNDVSTYLNQASVKQALGANPQ
                     ITFQDCNDDINEAFSTAGDYIHSFAPDVAQILEANIPILIYAGDKDFICNWLGCRAWT
                     RALEWPGQSEYNNASSVPWMSGQTHAGDVTNYQHFTFLRIYNAGHMVPHDQPQAALTM
                     LNQWLQGDYSLQG"
     gene            complement(<994984..>995475)
                     /locus_tag="AWJ20_317"
                     /db_xref="GeneID:30035162"
     mRNA            complement(<994984..>995475)
                     /locus_tag="AWJ20_317"
                     /product="carboxypeptidase C"
                     /transcript_id="XM_018880173.1"
                     /db_xref="GeneID:30035162"
     CDS             complement(994984..995475)
                     /locus_tag="AWJ20_317"
                     /note="Putative serine type carboxypeptidase; role in
                     phytochelatin synthesis; green fluorescent protein
                     (GFP)-fusion protein localizes to the vacuole; expression
                     induced by nitrogen limitation in a GLN3, GAT1-independent
                     manner; GO_component: GO:0000324 - fungal-type vacuole
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0004180 -
                     carboxypeptidase activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0017171 - serine hydrolase activity
                     [Evidence IDA,ISM] [PMID 14645503]; GO_function:
                     GO:0004185 - serine-type carboxypeptidase activity
                     [Evidence IEA]; GO_function: GO:0004185 - serine-type
                     carboxypeptidase activity [Evidence ISA] [PMID 17408619];
                     GO_process: GO:0046938 - phytochelatin biosynthetic
                     process [Evidence IGI] [PMID 17408619]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="carboxypeptidase C"
                     /protein_id="XP_018734559.1"
                     /db_xref="GeneID:30035162"
                     /translation="MKTSVLISFIVCCTLSQALLNKPLLWKLNSKVIDANPVKLVARQ
                     NNPFAALIQGINNFFSGLGFGGSSSSSSSSSNGSSTTSGSDYSTVPAGNPASLGVDSV
                     KQYSGYINVGPSNEDHMFYWFFESRNKPQTDPVVLWLTGGPGCSSLEALFFENGPCKL
                     TNV"
     gene            <996453..>997715
                     /locus_tag="AWJ20_318"
                     /db_xref="GeneID:30035173"
     mRNA            <996453..>997715
                     /locus_tag="AWJ20_318"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880184.1"
                     /db_xref="GeneID:30035173"
     CDS             996453..997715
                     /locus_tag="AWJ20_318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734560.1"
                     /db_xref="GeneID:30035173"
                     /translation="MESVLSLFTPSWAVPGTGLKQVIALAEEEFGADALTPQLIDASV
                     SAMPGIFGDYPQPSDKAPCGIFIAVYSILALAHLFIFVKNKSRGHNFYMSFGLMWYCL
                     FRMIGFALRVRWISDLLNFNMGIASVTFSQLPPLYLNVLCMILGHRIFTWRHPETGNS
                     KYFNVAIILIYIFSAPLVAMAIVGQVIPNIYFLTEKHLRICHQVTQAAAVLNLSYATS
                     GIFLVQLAYFFKPGTIDHRMLRMPKAKLVPHLPPVVQPTWIRSAALTYYPRKGEQIPL
                     YRDGPTGKAIRIIPSRETPAGGLCRPYSNDSSSPNNRVPSIRTAVLIVIVVSAIMTMN
                     IVFRTASTFILKPRGGFPGPLNSWIYHNYVYYIWYGAFEAIANVILLLGRVDLRFYIP
                     DMPIKGTGNELEVHQEKQSASVESFQEV"
     gene            complement(<998912..>1001152)
                     /gene="APL2"
                     /locus_tag="AWJ20_319"
                     /db_xref="GeneID:30035184"
     mRNA            complement(<998912..>1001152)
                     /gene="APL2"
                     /locus_tag="AWJ20_319"
                     /product="Apl2p"
                     /transcript_id="XM_018880195.1"
                     /db_xref="GeneID:30035184"
     CDS             complement(998912..1001152)
                     /gene="APL2"
                     /locus_tag="AWJ20_319"
                     /note="Beta-adaptin subunit of the clathrin-associated
                     protein (AP-1) complex; binds clathrin; involved in
                     clathrin-dependent Golgi protein sorting; protein
                     abundance increases in response to DNA replication stress;
                     GO_component: GO:0030121 - AP-1 adaptor complex [Evidence
                     IPI,ISS] [PMID 10564262]; GO_component: GO:0005905 -
                     coated pit [Evidence IEA,IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0030117 -
                     membrane coat [Evidence IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IEA,IEA]; GO_function:
                     GO:0030276 - clathrin binding [Evidence IPI,ISS] [PMID
                     10564262]; GO_function: GO:0008565 - protein transporter
                     activity [Evidence IEA]; GO_process: GO:0006896 - Golgi to
                     vacuole transport [Evidence IMP] [PMID 17003107];
                     GO_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA,IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IPI,ISS] [PMID
                     10564262]"
                     /codon_start=1
                     /product="Apl2p"
                     /protein_id="XP_018734561.1"
                     /db_xref="GeneID:30035184"
                     /translation="MSLEKRLRKVFQTPRKGETFELRSGLVSQYAHERKDAIQRTIAA
                     MTLGKDVSSLFPDILKNLATHDLDQKKLVYLYLMNYAKSHPELCILAVNTFVQDSEDP
                     NPLVRALAIRTMGCIRVDKMVDYLSIPLRKTLRDDNPYVRKTAAICVAKLFDLNPNMA
                     IEEGFLTDLQSLVDDSNPMVVANAVSALSEIQESAPEVKTFEISPVTLNKLLVALNEC
                     TEWGRIAILTALSQYETSDVKEAEHICERVVPQFQHANPSVVLASIKAVITHLPIQST
                     NAQNVLLRKMSSPLVTLVSCAPEVQYVALRNIRIILQKYPQILSRELRVFFCRYNDPL
                     YLKFEKLEIMVSLANSQNVDQLLAELKEYSMEVDMEFVRRAIKAIGQCAVKIESAAEK
                     AVNVLLDLLDDNNKTNNYVIQEVVIEIRDILRRYKNAFEGAIPVLCQNIDDIEEPEAR
                     AAMIWILGEYAHKIDNAGTILENYVSTFLEEATQVQLQLLTACVKLYIKKPNSGNNLI
                     HSILQDATTKSDNADIRDRAYIYWRLLSSDASVSKDVVLADKPPIKTTIETIPPTILD
                     ELLAELSTLASVYHKPASSFMGTGQFGSDEVQKRAIEEQRQLAKEDAISNIDSQTVVN
                     GENLLDLDFDAPASDAASTGSGANSGALGDLGDIFSNSPSPTISSPAIGATATKTNGN
                     QDILSLFGSTSTPVPAAPASSSLNQLTDGFGGLNLQSQTQSQPTTQASSQTQSKSTNE
                     DLLGLF"
     gene            <1002574..>1003158
                     /gene="ASC1"
                     /locus_tag="AWJ20_320"
                     /db_xref="GeneID:30035196"
     mRNA            <1002574..>1003158
                     /gene="ASC1"
                     /locus_tag="AWJ20_320"
                     /product="guanine nucleotide-binding protein subunit beta"
                     /transcript_id="XM_018880207.1"
                     /db_xref="GeneID:30035196"
     CDS             1002574..1003158
                     /gene="ASC1"
                     /locus_tag="AWJ20_320"
                     /inference="similar to AA sequence:KEGG_Orthology:K14753"
                     /note="G-protein beta subunit and guanine dissociation
                     inhibitor for Gpa2p; ortholog of RACK1 that inhibits
                     translation; core component of the small (40S) ribosomal
                     subunit; regulates P-body formation induced by replication
                     stress; represses Gcn4p in the absence of amino acid
                     starvation; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 11914276]; GO_component: GO:0022627 - cytosolic
                     small ribosomal subunit [Evidence IDA] [PMID 15340087];
                     GO_function: GO:0001965 - G-protein alpha-subunit binding
                     [Evidence IPI] [PMID 17591772]; GO_function: GO:0005092 -
                     GDP-dissociation inhibitor activity [Evidence IDA] [PMID
                     17591772]; GO_function: GO:0004871 - signal transducer
                     activity [Evidence IMP,IPI] [PMID 17591772]; GO_process:
                     GO:0007186 - G-protein coupled receptor signaling pathway
                     [Evidence IMP,IPI] [PMID 17591772]; GO_process: GO:0010255
                     - glucose mediated signaling pathway [Evidence IMP,IPI]
                     [PMID 17591772]; GO_process: GO:0001403 - invasive growth
                     in response to glucose limitation [Evidence IMP] [PMID
                     17591772]; GO_process: GO:0017148 - negative regulation of
                     translation [Evidence IMP] [PMID 15340087]"
                     /codon_start=1
                     /product="guanine nucleotide-binding protein subunit beta"
                     /protein_id="XP_018734562.1"
                     /db_xref="GeneID:30035196"
                     /translation="MSQNEVLVLRGTLEGHNGWVTALATSASNPDILLSASRDKSLII
                     WNLTRDEQAYGVPKRSLHGHAHIVQDVTISQDGSYAISASWDKTLRLWDLNDGTTLRR
                     FVGHTGDVLSVSFSPDNRQIVSAGRDRTIKVWNTIGDCKYTYDGQKSHSDWVSTVRFS
                     PATDDKSHTIISAGWDKLVKVSFNISTIFRYCIF"
     gene            complement(<1004747..>1007161)
                     /gene="OCT1"
                     /locus_tag="AWJ20_321"
                     /db_xref="GeneID:30035207"
     mRNA            complement(<1004747..>1007161)
                     /gene="OCT1"
                     /locus_tag="AWJ20_321"
                     /product="Oct1p"
                     /transcript_id="XM_018880218.1"
                     /db_xref="GeneID:30035207"
     CDS             complement(1004747..1007161)
                     /gene="OCT1"
                     /locus_tag="AWJ20_321"
                     /inference="similar to AA sequence:KEGG_Orthology:K01410"
                     /note="Mitochondrial intermediate peptidase; cleaves
                     destabilizing N-terminal residues of a subset of proteins
                     upon import, after their cleavage by mitochondrial
                     processing peptidase (Mas1p-Mas2p); may contribute to
                     mitochondrial iron homeostasis; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IEA]; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IDA] [PMID
                     8035833]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0004222 - metalloendopeptidase activity [Evidence IEA];
                     GO_function: GO:0004222 - metalloendopeptidase activity
                     [Evidence IDA,IMP] [PMID 8831696]; GO_function: GO:0008237
                     - metallopeptidase activity [Evidence IEA,IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_process: GO:0006879 - cellular iron ion
                     homeostasis [Evidence IGI,IMP] [PMID 10332043];
                     GO_process: GO:0006627 - protein processing involved in
                     protein targeting to mitochondrion [Evidence IMP] [PMID
                     8035833]; GO_process: GO:0050821 - protein stabilization
                     [Evidence IMP] [PMID 21525245]; GO_process: GO:0006508 -
                     proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Oct1p"
                     /protein_id="XP_018734563.1"
                     /db_xref="GeneID:30035207"
                     /translation="MLRSWSSARKTLPRWSGGLGHGESVLVRRISGLTGPVGPVGPVG
                     VVETRLEARSGKPFLNGGFVLGNRLRRVDGSRQLTTKSTTGLENSTDQSIRDVFDSVE
                     FWKKDFAPGHTNALEPTGLFENRYLTTPQGMVEFTQESLRQAQELTLKIINAGDDPEA
                     LHNAIRNFDILSDIICKVIDMVAFVRISHPNKEFINVAQECHELMYDYMNMLNTSVEL
                     HDILDKVLGNNDIRNGLSSEEITVGEILLADFKKSGVNLAPHDREKFVRLSSKVSILG
                     QQFLNNIGPAKHHLTFSKSQVWGLDPVLANRLRSFGGRFKIPTYGPVADMALQTISNE
                     NTRRDIWLAQRSATDEQVGLLGDFLTARAELARMMGCNSFAEYELKDKMAKTPVNVQR
                     FLDELAQQTNPRAAKELLDLKKLKSDEKATPLAETLLKAWDRDYYAAKHTHSKRSKSK
                     SSDFISAYFSLGTVMQGLSRLFTRIYGISFVPIETKPGEVWDDEVRRLDVVSETEGKI
                     GVIYCDLFQRDGKSPHPAHFTVQCSREITPGEPSYYHQGSSVIRDSTNRCYQLPIIAL
                     VCDFVKDPALSKCLLSYSEVQTLFHEMGHAIHSMLGRTSLHNVSGTRCATDFVELPSV
                     LMERFAASPEVMKLFARHHLTDEPLPLSVFNCQLSLQSLYDQTETYHQILISMLDQQV
                     HSELANTPTFDPNAIYYELEKSRGLFEAHPDSRWPAQFGHLFSYGANYYCYLFDRAIA
                     DRIWQKLFVNDPTSREAGEHFRREVLSWGGSRDPWQCVSAVLREPSLANGDETAMLEI
                     GRSLKA"
     gene            complement(<1007892..>1008998)
                     /gene="GLN1"
                     /locus_tag="AWJ20_322"
                     /db_xref="GeneID:30035218"
     mRNA            complement(<1007892..>1008998)
                     /gene="GLN1"
                     /locus_tag="AWJ20_322"
                     /product="glutamate--ammonia ligase"
                     /transcript_id="XM_018880228.1"
                     /db_xref="GeneID:30035218"
     CDS             complement(1007892..1008998)
                     /gene="GLN1"
                     /locus_tag="AWJ20_322"
                     /inference="similar to AA sequence:KEGG_Orthology:K01915"
                     /note="Glutamine synthetase (GS); synthesizes glutamine
                     from glutamate and ammonia; with Glt1p, forms the
                     secondary pathway for glutamate biosynthesis from ammonia;
                     expression regulated by nitrogen source and by amino acid
                     limitation; forms filaments of back-to-back stacks of
                     cylindrical homo-decamers at low pH, leading to enzymatic
                     inactivation and storage during states of advanced
                     cellular starvation; relocalizes from nucleus to
                     cytoplasmic foci upon DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 22842922]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0004356 - glutamate-ammonia ligase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004356 -
                     glutamate-ammonia ligase activity [Evidence IMP] [PMID
                     1347768]; GO_function: GO:0004356 - glutamate-ammonia
                     ligase activity [Evidence IDA] [PMID 4156034];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0006542 - glutamine biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006542 - glutamine
                     biosynthetic process [Evidence IDA] [PMID 6129248];
                     GO_process: GO:0006807 - nitrogen compound metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="glutamate--ammonia ligase"
                     /protein_id="XP_018734564.1"
                     /db_xref="GeneID:30035218"
                     /translation="MSSAVVSNTATLQKYLDLPQNGAVLAEYIWIDGTNGIRSKCKTL
                     SKSPESIDDLPEWNFDGSSTEQAPGHDSDIYLRPAAIFKDPFRKGDNIIVLAECWNND
                     GTPNKTNYRHECAKLMEAHKDSKIWFGIEQEYTLFDQYDNVYGWPKGGFPGPQGPYYC
                     GVGTGKVFCRDIVEAHYRACLYAGVDISGINAEVMPSQWEFQVGPCEGIKMGDELTVA
                     RYLLTRVAEDFGVKISFHPKPLQGDWNGAGCHTNVSTEQMRNPGGMKYIEEAIEKLSK
                     RHKEHIAVYGEDNDLRLTGRHETASVANFSSGVANRGASVRIPRSVAKEGFGYFEDRR
                     PASNIDPYLVTGIIAETILGSIPEADIVKQVQKE"
     gene            <1022434..>1024257
                     /gene="TOD6"
                     /locus_tag="AWJ20_323"
                     /db_xref="GeneID:30035229"
     mRNA            <1022434..>1024257
                     /gene="TOD6"
                     /locus_tag="AWJ20_323"
                     /product="Tod6p"
                     /transcript_id="XM_018880235.1"
                     /db_xref="GeneID:30035229"
     CDS             1022434..1024257
                     /gene="TOD6"
                     /locus_tag="AWJ20_323"
                     /note="PAC motif binding protein involved in rRNA and
                     ribosome biogenesis; subunit of the RPD3L histone
                     deacetylase complex; Myb-like HTH transcription factor;
                     hypophosphorylated by rapamycin treatment in a
                     Sch9p-dependent manner; TOD6 has a paralog, DOT6, that
                     arose from the whole genome duplication; GO_component:
                     GO:0070210 - Rpd3L-Expanded complex [Evidence IDA] [PMID
                     19040720]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA,IEA]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IEA]; GO_function: GO:0043565
                     - sequence-specific DNA binding [Evidence IDA] [PMID
                     19111667]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA,IDA] [PMID 19158363]; GO_process:
                     GO:0006357 - regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 19158363]"
                     /codon_start=1
                     /product="Tod6p"
                     /protein_id="XP_018734565.1"
                     /db_xref="GeneID:30035229"
                     /translation="MSSQPHHAHAPHASITSGTTPGALTTNTSGSAAGSAGSATATAT
                     ATTPGNSSSSSISTNTSTTHSSGNTGTPTSTVTATSTVTTNSGSSSGVSGTHSYSQHH
                     PQSLPQPPLSHSQSQLLPQVHPQLQHHHSYEHSQQPHIATSPYHQQMTAPQTYHQQHQ
                     QLQQHPLPHHQLQQHPHPHQHHQHPQHPQHPQHPQLQQHHHQQQQHHLHHPYGAAVSH
                     NTDPSLGVGGPIHSHGQHHGHAGHHGQVTPIYSPQGEGRRKTPSSWDPHDDLLLRHLK
                     EQLKLGWKEIAAYFPNRTTNACQFRWRRLVSGTLRSSTGGVATPNGGGPLSPGGSTSP
                     THSDNGMPDASSDLNRRSSSISSTLSNPTNALQTYQASYEQQQLQHPHIHGHHHSQPT
                     LPSFQYRQPSQGQVNAAPAQITSSTQSSVNWTKEQDDLVRSRQDLRPDELSLLLGVSE
                     QDIKTRLSQLDIKSTTPTTTGTTTPSSVTAADSVVAKSLANYQLSTPTSEPISEHPDN
                     VTIVEHDIDGDSGAEDGVPRTLVGRNRSGSHPRPLLPRKMSGSHFNSLKLPVPILQRP
                     PSFSEASPAASSTAPANPSSAATPTPTTPVTPAGSYFTAQS"
     gene            complement(<1025407..>1027704)
                     /gene="SAS3"
                     /locus_tag="AWJ20_324"
                     /db_xref="GeneID:30035240"
     mRNA            complement(<1025407..>1027704)
                     /gene="SAS3"
                     /locus_tag="AWJ20_324"
                     /product="Sas3p"
                     /transcript_id="XM_018880244.1"
                     /db_xref="GeneID:30035240"
     CDS             complement(1025407..1027704)
                     /gene="SAS3"
                     /locus_tag="AWJ20_324"
                     /inference="similar to AA sequence:KEGG_Orthology:K11378"
                     /note="Histone acetyltransferase catalytic subunit of NuA3
                     complex; acetylates histone H3, involved in
                     transcriptional silencing; homolog of the mammalian MOZ
                     proto-oncogene; mutant has aneuploidy tolerance; sas3gcn5
                     double mutation is lethal; GO_component: GO:0033100 - NuA3
                     histone acetyltransferase complex [Evidence IDA] [PMID
                     10817755]; GO_component: GO:0033100 - NuA3 histone
                     acetyltransferase complex [Evidence IDA] [PMID 17157260];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_function: GO:0004402 - histone acetyltransferase
                     activity [Evidence IEA]; GO_function: GO:0004402 - histone
                     acetyltransferase activity [Evidence IDA,IMP] [PMID
                     10817755]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016746 -
                     transferase activity, transferring acyl groups [Evidence
                     IEA]; GO_function: GO:0016747 - transferase activity,
                     transferring acyl groups other than amino-acyl groups
                     [Evidence IEA]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IEA]; GO_process: GO:0016568 -
                     chromatin modification [Evidence IMP] [PMID 11731478];
                     GO_process: GO:0030466 - chromatin silencing at silent
                     mating-type cassette [Evidence IMP] [PMID 11731479];
                     GO_process: GO:0006348 - chromatin silencing at telomere
                     [Evidence IMP] [PMID 11731479]; GO_process: GO:0016573 -
                     histone acetylation [Evidence IDA,IMP] [PMID 10817755];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA,IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Sas3p"
                     /protein_id="XP_018734566.1"
                     /db_xref="GeneID:30035240"
                     /translation="MPPVNRRTNAVQAAPKGSLIDPLKDRKYWTTLLREGGLDERRSP
                     TNSPKKAVKNEIQGLKRARGTDTPPRSPNGGHKSPVTKQGRTANGQFAPKERPLLAGG
                     ELWPVSRAGSRSSRPARDREVEKARKPERRNRPVERASRPSGLEKVPVIAPELVVDTP
                     ETTVPTPASRNRARRSRTVIDDEDVDEDDDLIRPVGRLRQRKAAEKETKLVTTLRRGL
                     LVIRLPEWKLRPLKQTSRLKKLIPAREVLAASSLYDHNNNSSSRSINNHSRSINNNNS
                     SKSRIKDNSSHKKLKIRFHLSSPAGGGSPVGITNGTLTRTDGLSSATGSTPFFFEEEE
                     YVDDSDVQPYRGVITGDDADTSLTYPTDQDREWFEDALAMVETKQSWLNNDDVENYGN
                     EIEYTDDGGVTSRKKKRRTDSVPPPTTTSTMGITRVSNIRKIHMANYEIDTWYISPYP
                     EEYSRHRILCICEFCLKYMSSDYVAQRHALKCQYRHPPGTEIYRHEGNSIFEVDGAKS
                     PLYCQNLCLMAKLFLDSKTLYYDVEPFMFYVLTENDDKGCHFVGYFSKQKVASATTPP
                     VAPAITDSPGSSTSHETISTTDPITNGSAHDGTNGTATTATSSSAPAEPIPAVRNNVS
                     CIVTLPTAQRKGYGNFLIDFSYLLTRCEKTVGTPEKPLSDLGLASYTNYWKHTLCYEL
                     RKLRNSADPATEISIDTISQTTGMTLDDVVFGLETLGFLVQTPQKSYTLQIDDRVLDD
                     IIAKWESKNYRRVHPEKLLWVPLTL"
     gene            <1028930..>1030585
                     /gene="AIM10"
                     /locus_tag="AWJ20_325"
                     /db_xref="GeneID:30035251"
     mRNA            <1028930..>1030585
                     /gene="AIM10"
                     /locus_tag="AWJ20_325"
                     /product="putative proline--tRNA ligase AIM10"
                     /transcript_id="XM_018880253.1"
                     /db_xref="GeneID:30035251"
     CDS             1028930..1030585
                     /gene="AIM10"
                     /locus_tag="AWJ20_325"
                     /inference="similar to AA sequence:KEGG_Orthology:K01881"
                     /note="Protein with similarity to tRNA synthetases;
                     non-tagged protein is detected in purified mitochondria;
                     null mutant is viable and displays elevated frequency of
                     mitochondrial genome loss; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016874 - ligase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0004827 - proline-tRNA ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004827 - proline-tRNA ligase
                     activity [Evidence ISS] [PMID 10592175]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0006433 - prolyl-tRNA aminoacylation [Evidence IEA];
                     GO_process: GO:0006418 - tRNA aminoacylation for protein
                     translation [Evidence IEA]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="putative proline--tRNA ligase AIM10"
                     /protein_id="XP_018734567.1"
                     /db_xref="GeneID:30035251"
                     /translation="MASGLKRLSRFFAPLRKFKPNAETSSSELLTNYGYLRQSSSGVY
                     NMLPLGNLVQSRIESIIRNRLDEVDCAETSLCTLASTKIWKASGRLQTGTEFFMLEDG
                     KYLLAPTNEEEVTSMVAELSSYKQVPLRLYQISRKYRNEKRPRGGLLRGREFTMKDLY
                     SFDETMNDAMTTYRDIQGAYNRIFEDIGIDFEVAEADSGSIGGSLSHEYHYESDAGED
                     LVVKCTSSSCDYTANTERAVSTAADTSVKIGLADAAVKFYALDETLPSKSEKSLTVYA
                     AIFPAGRSINPHLLKGHSAVQGSELAEISADSVSKMSATILPLIDTRVEYELSKNREQ
                     LTTIITSLIEPDNSNHSKYSVVEAVQAPIVEVQTGETCPSCHSAPLKIVPAIEVGHTF
                     YLGTKYSEPLNARITTQSTGKMEPLYMGCYGIGVSRLISAIAEKTRDSDGLAWPKSVT
                     PFDAVIVANSEADALKIHQHLSTHNIRAVWDDRSTQFGVLLANARATGFPLAIIAGRS
                     YTQTGQLEIQLRNKPAKSHPPTLVSLDDLGPTAHHMLQTYSPA"
     gene            complement(<1031592..>1034678)
                     /gene="PIN4"
                     /locus_tag="AWJ20_326"
                     /db_xref="GeneID:30035262"
     mRNA            complement(<1031592..>1034678)
                     /gene="PIN4"
                     /locus_tag="AWJ20_326"
                     /product="Pin4p"
                     /transcript_id="XM_018880264.1"
                     /db_xref="GeneID:30035262"
     CDS             complement(1031592..1034678)
                     /gene="PIN4"
                     /locus_tag="AWJ20_326"
                     /note="Protein involved in G2/M phase progression and
                     response to DNA damage; interacts with Rad53p; contains an
                     RNA recognition motif, a nuclear localization signal, and
                     several SQ/TQ cluster domains; hyperphosphorylated in
                     response to DNA damage; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 23222640];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0000077
                     - DNA damage checkpoint [Evidence IGI,IPI] [PMID
                     15024067]; GO_process: GO:0000086 - G2/M transition of
                     mitotic cell cycle [Evidence IMP] [PMID 15024067]"
                     /codon_start=1
                     /product="Pin4p"
                     /protein_id="XP_018734568.1"
                     /db_xref="GeneID:30035262"
                     /translation="MAESSLFGRSAMYQQQHQQHQSSQLSGTGGGDSFLKASPGPGSL
                     LGSGSGSSSGPGSAGSPGSGPPGASSSSANSASASAVRRIQSRHFDFLAGASGSATGS
                     GAGSGTGSGSSGSSGNNNNNNSGSGNSGSGSELPGFEGLGHAHGVHGHGSGGSAAAGW
                     GTNGQQTQLTAQLNGGSGLPGQLSGQMPPPGQFHGQLPGHLSGQLPVQLPGQGLGPGL
                     GQGLSQLPGQGLNQGLNQGLGQSLNQGLNQGLGQGLGQGLSQGLNQGLNQGLGQGLGQ
                     GMSQALGQRSNAASLSPLPRATSPLPPFPGQSVWLDQSSASLRSISPHPKPASSNSSI
                     NEVQLQQQAPLQPLQPNGSGGNGGNGGPVNVGLIPPPSTSPSAVSVSSSSNLVGDDEL
                     IPTAIVIKNIPFAIKKEQLLDVMTSMGLPLPYAFNYHFDSGVFRGLAFANFTSPEETG
                     AVISNLNGREIGGRKLRVEYKKMLPLVERERIEREKRERRGQLEEQHRSSSGPKGLNN
                     SGLGGNSGGNGNSGGNAGGNGGAGNGGGNGAGNSGSMGSGNGGGGSGSGNGGGSGHHH
                     GHNHHHNHHGGNNHQQMNHVGNSHHHGGNQHHGPSNHSPKMVDLNDPETLDFYSQILL
                     FRDDKNRSELIFPATLLPHQRKIVAVLSGQLGLMFSGDRVNGGPVAVLKPQQQPQLQQ
                     QQQQQHQQQHQQHPQHPQQHQQQLHQQQQQQHHLQQPPMPQFQGQQSFQQQPQQNQPQ
                     PPQQQPQQYQQPPPPGLFDYNGSSSGQIHHPQPQYVGGVGGMGVGIGSGAAGSGQFSS
                     QGPPPPQQGLFQPQPQQPVPPLVQQQSGGSGSGGQLRGTKSFADIRAPASYPYNISAP
                     GTPSGSPFFPSQTPPPGSKQQQQQQQQQQQQQPQGHQQQPPQQFLPLMSLQQQQRGYP
                     YLGQTGQPQIGFPSQQQQQQSQGQSQAQSQTAGKHQSSQSFDLSNSVGSLSDSFSSAL
                     SLSGSSSGRQHAAVGSVGSASPTASINSIHDSVASSSGGNSSAGVIGSKSGVHDDN"
     gene            <1036396..>1037850
                     /gene="IBA57"
                     /locus_tag="AWJ20_327"
                     /db_xref="GeneID:30035273"
     mRNA            <1036396..>1037850
                     /gene="IBA57"
                     /locus_tag="AWJ20_327"
                     /product="Iba57p"
                     /transcript_id="XM_018880275.1"
                     /db_xref="GeneID:30035273"
     CDS             1036396..1037850
                     /gene="IBA57"
                     /locus_tag="AWJ20_327"
                     /note="Protein involved in incorporating iron-sulfur
                     clusters into proteins; mitochondrial matrix protein;
                     involved in the incorporation of iron-sulfur clusters into
                     mitochondrial aconitase-type proteins; activates the
                     radical-SAM family members Bio2p and Lip5p; interacts with
                     Ccr4p in the two-hybrid system; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IEA]; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IDA] [PMID
                     18086897]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0016226 - iron-sulfur cluster
                     assembly [Evidence IMP] [PMID 18086897]"
                     /codon_start=1
                     /product="Iba57p"
                     /protein_id="XP_018734569.1"
                     /db_xref="GeneID:30035273"
                     /translation="MVGGHVRSSQGVRTVAGSITPGLMRGLSYYTPQSPPPEPPLRGY
                     TKLNRRLVYVRGQDAPKFLNGLITNHLTGPDDHGAFGFYAAFLNSKGRIISDSFIYPT
                     HYSTLMSDTANAVGVGSRSTTGDGSSSSEVPGYLVECDSSLASSLVSMLKLHKLRSRV
                     EISLVEDTGSSPKVWQVWDDSTVTDSLPLDITNQSILVPYCPSLVGASDSRAPGFGLR
                     LVLPGNQTPLDVLSEAFVSADEFPECSPDAYHIRRLVYGIPEGASELPPNSSLPLDSC
                     MDYMGGVDFNKGCYQGQELTIRSHHHGIVRKRIIPVVLSPPLTSDSNPDPATHSLDQS
                     ESSSQPSNKSSDELVQQEYELESEPALEYNPSSPVATSINSASLAGSSILDISASLGD
                     SSRLARVTDNPSPFGVSKKSKPSSSSSSSPSLRPSGTLLSAIGNVGLALVRLEHFGSS
                     TAQFAIQTPAGNIRVHGFQPYWWPSPDDNTDSSA"
     gene            <1039143..>1040264
                     /gene="ARO4"
                     /locus_tag="AWJ20_328"
                     /db_xref="GeneID:30035284"
     mRNA            <1039143..>1040264
                     /gene="ARO4"
                     /locus_tag="AWJ20_328"
                     /product="3-deoxy-7-phosphoheptulonate synthase ARO4"
                     /transcript_id="XM_018880286.1"
                     /db_xref="GeneID:30035284"
     CDS             1039143..1040264
                     /gene="ARO4"
                     /locus_tag="AWJ20_328"
                     /inference="similar to AA sequence:KEGG_Orthology:K01626"
                     /note="3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP)
                     synthase; catalyzes the first step in aromatic amino acid
                     biosynthesis and is feedback-inhibited by tyrosine or high
                     concentrations of phenylalanine or tryptophan; relative
                     distribution to the nucleus increases upon DNA replication
                     stress; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 22842922];
                     GO_function: GO:0003849 - 3-deoxy-7-phosphoheptulonate
                     synthase activity [Evidence IEA,IEA]; GO_function:
                     GO:0003849 - 3-deoxy-7-phosphoheptulonate synthase
                     activity [Evidence IDA] [PMID 2880280]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0009073 - aromatic amino acid family
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0009058 - biosynthetic process [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0009423 -
                     chorismate biosynthetic process [Evidence IEA];
                     GO_process: GO:0009423 - chorismate biosynthetic process
                     [Evidence TAS] [PMID 1943992]; GO_process: GO:0006950 -
                     response to stress [Evidence IEA]"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase ARO4"
                     /protein_id="XP_018734570.1"
                     /db_xref="GeneID:30035284"
                     /translation="MSATNSPMFGPDGVSRSGSPVEQSEDVRILGYDPLIAPALLQNE
                     IPASAKSVATVSKGRKEAIKVLNRASDKLVCIVGPCSIHDPEAALEYASRLKKLSDEL
                     DGELVVIMRAYLEKPRTTVGWKGLINDPDVNESFNINKGLRVARKLFVDLTDLGVPIA
                     SEMLDTISPQFLADQLSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGSAGVAIDA
                     VKAASVSHHFMGVTKQGLAAITTTKGNENCFIILRGGTKGTNYDEASVKAIKEKLAGS
                     STTIMVDCSHGNSNKDYRNQPKVNSEVARQIANGEDTLVGVMIESHINEGKQSVGPEG
                     KAGLKYGVSITDACVNWETTEVMLRELADAVKARRALKN"
     gene            <1042234..>1043904
                     /gene="HIS7"
                     /locus_tag="AWJ20_329"
                     /db_xref="GeneID:30035295"
     mRNA            <1042234..>1043904
                     /gene="HIS7"
                     /locus_tag="AWJ20_329"
                     /product="imidazoleglycerol-phosphate synthase"
                     /transcript_id="XM_018880296.1"
                     /db_xref="GeneID:30035295"
     CDS             1042234..1043904
                     /gene="HIS7"
                     /locus_tag="AWJ20_329"
                     /inference="similar to AA sequence:KEGG_Orthology:K01663"
                     /note="Imidazole glycerol phosphate synthase; glutamine
                     amidotransferase:cyclase that catalyzes the fifth step of
                     histidine biosynthesis and also produces
                     5-aminoimidazole-4-carboxamide ribotide (AICAR), a purine
                     precursor; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA]; GO_component: GO:0005622 - intracellular [Evidence
                     TAS] [PMID 8852895]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA,IEA]; GO_function: GO:0004359 -
                     glutaminase activity [Evidence IDA] [PMID 10733892];
                     GO_function: GO:0000107 - imidazoleglycerol-phosphate
                     synthase activity [Evidence IEA]; GO_function: GO:0000107
                     - imidazoleglycerol-phosphate synthase activity [Evidence
                     IDA] [PMID 10733892]; GO_function: GO:0016829 - lyase
                     activity [Evidence IEA]; GO_function: GO:0016833 -
                     oxo-acid-lyase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_function: GO:0016763 - transferase activity,
                     transferring pentosyl groups [Evidence IEA]; GO_process:
                     GO:0008652 - cellular amino acid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0006541 - glutamine
                     metabolic process [Evidence IEA]; GO_process: GO:0000105 -
                     histidine biosynthetic process [Evidence IEA,IEA,IEA];
                     GO_process: GO:0000105 - histidine biosynthetic process
                     [Evidence IMP] [PMID 14190241]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0006950 - response to stress [Evidence IEA]"
                     /codon_start=1
                     /product="imidazoleglycerol-phosphate synthase"
                     /protein_id="XP_018734571.1"
                     /db_xref="GeneID:30035295"
                     /translation="MSDLVYVIDVESGNLQSLQNAVEKLGYRVKWVKNREQGLEAVDK
                     AQRMILPGVGNFGHFMDELHGRGLADTVLEYIKSGKPLMGICVGLQSIFKGSVESPTA
                     QGLGLIDIRLSRFDDSEKSVPHIGWNGTVLKGQEGDDITKSTPSLYGIDPSQKYYFVH
                     SFAAVLSNETQIQALQGWEYAQAQYGSEKFVAAVAKDNVFLTQFHPEKSGEAGLFVID
                     SFLKGNKHARISTELASHKTAPGLTKRVIACLDVRTNDAGDIVVTKGDQYDVREKEGS
                     AVRNLGKPVQVAEKYYKQGADEVTFLNITSFRNSPLKDLPMLEILRLTSKTVFVPLTI
                     GGGIRDTVDPATGKVVPALEVADMYFRSGADKVSIGSDAVDAAEKYYANGRKGDGTSP
                     LETISKPYGVQAVVVSIDPKRVYVQSPSDVKHHTFKTKYPGPNGEEYVWYQTTVKGGR
                     ETRDLGAYELAQASEALGAGELLLNCIDKDGTNSGFDLELINDIKSAVKIPVIASSGA
                     GRPEHFEEVFTKTTTDAALGAGMFHRDEYTVSDVKKCLQTAGFPTRLT"
     gene            complement(<1044129..>1044782)
                     /gene="VPS75"
                     /locus_tag="AWJ20_330"
                     /db_xref="GeneID:30035307"
     mRNA            complement(<1044129..>1044782)
                     /gene="VPS75"
                     /locus_tag="AWJ20_330"
                     /product="Vps75p"
                     /transcript_id="XM_018880308.1"
                     /db_xref="GeneID:30035307"
     CDS             complement(1044129..1044782)
                     /gene="VPS75"
                     /locus_tag="AWJ20_330"
                     /note="NAP family histone chaperone; binds to histones and
                     Rtt109p, stimulating histone acetyltransferase activity;
                     possesses nucleosome assembly activity in vitro; proposed
                     role in vacuolar protein sorting and in double-strand
                     break repair; protein abundance increases in response to
                     DNA replication stress; relocalizes to the cytosol in
                     response to hypoxia; GO_component: GO:0000785 - chromatin
                     [Evidence IDA] [PMID 17344218]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 22932476]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22932476]; GO_function: GO:0010698 - acetyltransferase
                     activator activity [Evidence IDA,IMP] [PMID 19172749];
                     GO_function: GO:0042393 - histone binding [Evidence
                     IDA,IPI] [PMID 17344218]; GO_process: GO:0006303 -
                     double-strand break repair via nonhomologous end joining
                     [Evidence IMP,IPI] [PMID 18036332]; GO_process: GO:0006334
                     - nucleosome assembly [Evidence IEA]; GO_process:
                     GO:0006334 - nucleosome assembly [Evidence IDA] [PMID
                     17344218]; GO_process: GO:0035066 - positive regulation of
                     histone acetylation [Evidence IDA,IGI,IMP] [PMID
                     18458063]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Vps75p"
                     /protein_id="XP_018734572.1"
                     /db_xref="GeneID:30035307"
                     /translation="MAVKYSTKVLKPVYEERREATRNVPKFWPTVLDSSELLAEYITY
                     EDTEVLDHLVDLYVEWDEDNVKNFTIHWEFSENDFLETNKVSKRFELVEAEKSGEGDD
                     EDDEDAEDSYTSTPVALKWKKGKNLTKPKDGRDTSFFNWFSFSGEGPGDYKGGENIAV
                     IIAEELFPHALKFFADAFSEGDLAEYELDDEEDDDEDDEVEGDAEHEDAPPRKKSKN"
     gene            complement(<1045507..>1046907)
                     /locus_tag="AWJ20_331"
                     /db_xref="GeneID:30035318"
     mRNA            complement(<1045507..>1046907)
                     /locus_tag="AWJ20_331"
                     /product="membrane transporter"
                     /transcript_id="XM_018880319.1"
                     /db_xref="GeneID:30035318"
     CDS             complement(1045507..1046907)
                     /locus_tag="AWJ20_331"
                     /note="top hit is XP_007844384.1 originated in
                     Moniliophthora roreri MCA 2997"
                     /codon_start=1
                     /product="membrane transporter"
                     /protein_id="XP_018734573.1"
                     /db_xref="GeneID:30035318"
                     /translation="MPFAFQTRLGIAEDQVQTWVSTSLAIYAAGVIVGSLVVGAISDK
                     LGQRRAFMISGFVVMEGATCMLCFPKSLALYMVGRTLQGVSAAIAWGIGFAIISDSAE
                     PDQVALLMSYPSMGLSLGIFLGPLLGGVMYDRAGYYSVFYLCFGVFGLDILVRFLMTE
                     KSTLEQKLKKYELYEKKRQEAFGEIMMTTTSHSGSINPGHASQSESTMSSDSTIEQSE
                     EEERQNFSLRHSFRKMTLIQLLQSPRVLNNLFLTFILVWFSGNLDATMTIHLADIFNF
                     NSLYSGLMFLAIVAPMVLEPVCGYVSDKYGGRYLVTAGFIWICPSLMLMWIPHENTTG
                     HIVMFIAFLVMVGIGFTLVFTPLMAEMTNAVNEIDRANPGTLGGGKGFAQAYGLVNIA
                     SSLGQIVGPYQGGAVMSRYGWGINVLIMGLLALVAAVPGFLLTGGKEPPSHSSNSLTP
                     ENSDPQIPLQSESIDD"
     gene            complement(<1048177..>1048953)
                     /locus_tag="AWJ20_332"
                     /db_xref="GeneID:30035329"
     mRNA            complement(<1048177..>1048953)
                     /locus_tag="AWJ20_332"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880330.1"
                     /db_xref="GeneID:30035329"
     CDS             complement(1048177..1048953)
                     /locus_tag="AWJ20_332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734574.1"
                     /db_xref="GeneID:30035329"
                     /translation="MTATTTVSLEEHPKYVILDESKWTLKAESTHKGPSPWATTPNEG
                     ASVQRTEAPLKPSGALDQYKYTDLTPVIGREYHDIQLAEILDDDDKIRDLAINIAYRG
                     VAFFRGQKITVEQQKVLAQKLTSLTFQPKTSSLHIHPITPGGGFLRPDGSIDPEVTLI
                     SSEYGKKVYHKDYKENKALASKGIHQDFAFETIPSAFSILKIIEPLETGGDTLWWSGA
                     GLYDKLSDPFKRYLETLTGTFSGNQIGTWQEKFKLFNGPR"
     gene            complement(<1051165..>1051236)
                     /locus_tag="AWJ20_333"
                     /db_xref="GeneID:30035340"
     tRNA            complement(<1051165..>1051236)
                     /locus_tag="AWJ20_333"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:30035340"
     gene            <1052311..>1053867
                     /gene="CCT3"
                     /locus_tag="AWJ20_334"
                     /db_xref="GeneID:30035351"
     mRNA            <1052311..>1053867
                     /gene="CCT3"
                     /locus_tag="AWJ20_334"
                     /product="Cct3p"
                     /transcript_id="XM_018880350.1"
                     /db_xref="GeneID:30035351"
     CDS             1052311..1053867
                     /gene="CCT3"
                     /locus_tag="AWJ20_334"
                     /inference="similar to AA sequence:KEGG_Orthology:K09495"
                     /note="Subunit of the cytosolic chaperonin Cct ring
                     complex; related to Tcp1p, required for the assembly of
                     actin and tubulins in vivo; capable of binding Q/N rich
                     proteins and mediating their folding; GO_component:
                     GO:0005832 - chaperonin-containing T-complex [Evidence
                     IPI] [PMID 15704212]; GO_component: GO:0005832 -
                     chaperonin-containing T-complex [Evidence IDA] [PMID
                     16762366]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0051082 - unfolded protein
                     binding [Evidence IEA]; GO_function: GO:0051082 - unfolded
                     protein binding [Evidence IDA] [PMID 16762366];
                     GO_process: GO:0044267 - cellular protein metabolic
                     process [Evidence IEA]; GO_process: GO:0006457 - protein
                     folding [Evidence IEA]; GO_process: GO:0006457 - protein
                     folding [Evidence IDA] [PMID 16762366]"
                     /codon_start=1
                     /product="Cct3p"
                     /protein_id="XP_018734575.1"
                     /db_xref="GeneID:30035351"
                     /translation="MCRVADIVRTCLGPKAMLKMLLDPMGGIVLTNDGHAILREIEVT
                     HPAAKSMIELSRTQDEEVGDGTTTVIILAGEILAQAYGPLERNIHPVVIISALKEALK
                     DALEVIHEISRPIDVENDAAMVKLISASIGTKFVARWSTLMCKLALQAVKTVMRTDTN
                     GRKEIDIKRYARIEKIPGGEIEDSRVLDGVMLNKDITHPKMRRRIENPRVLLLDCPLE
                     YKKGESQTNIEITKEEEWNRVLQIEEEQIKAMCEIIASFKPDLVITEKGVSDLAQHYL
                     LKANISALRRVRKGDNNRIARATGATIVNRVEDIRESDIGTQCGLFNIELIGDEYFTF
                     LTECEDPGACTILLRGPSKDILSEIDRNLQDAMSVARNVCFEPRLSPGGGATEMALSV
                     RLAERAKAIEGVSQWPYKAVADALEVIPRTLIQNCGGNPIRVLTQLRAKHAEGLYTYG
                     IDGENGKVVDMNEYGIWEPEAIKLQSIKTAIESACLLLRVDDIVSGVRKQGEKTGRLQ
                     GPEDVPASQE"
     gene            complement(<1053132..>1053512)
                     /locus_tag="AWJ20_335"
                     /db_xref="GeneID:30035362"
     mRNA            complement(<1053132..>1053512)
                     /locus_tag="AWJ20_335"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880361.1"
                     /db_xref="GeneID:30035362"
     CDS             complement(1053132..1053512)
                     /locus_tag="AWJ20_335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734576.1"
                     /db_xref="GeneID:30035362"
                     /translation="MALALSASRTERAISVAPPPGDSLGSKHTLRATDMASCKLRSIS
                     DKISLEGPRNRIVQAPGSSHSVKNVKYSSPMSSILNKPHWVPMSDSRISSTRFTIVAP
                     VALAIRLLSPLRTLRRAEILAFNR"
     gene            complement(<1054782..>1055975)
                     /gene="SSU1"
                     /locus_tag="AWJ20_336"
                     /db_xref="GeneID:30035373"
     mRNA            complement(<1054782..>1055975)
                     /gene="SSU1"
                     /locus_tag="AWJ20_336"
                     /product="Ssu1p"
                     /transcript_id="XM_018880371.1"
                     /db_xref="GeneID:30035373"
     CDS             complement(1054782..1055975)
                     /gene="SSU1"
                     /locus_tag="AWJ20_336"
                     /note="Plasma membrane sulfite pump involved in sulfite
                     metabolism; required for efficient sulfite efflux; major
                     facilitator superfamily protein; GO_component: GO:0016021
                     - integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 9294463];
                     GO_function: GO:0000319 - sulfite transmembrane
                     transporter activity [Evidence IDA] [PMID 10870099];
                     GO_process: GO:0000316 - sulfite transport [Evidence IDA]
                     [PMID 10870099]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ssu1p"
                     /protein_id="XP_018734577.1"
                     /db_xref="GeneID:30035373"
                     /translation="MFGRVNSNASSETVVNHLTMTAGIKSYLLARVNYFTPAWFAAVM
                     GVGISSIILYTFPFNARWLRILGVIIWGFNMGLFGIANILFVSRFLLHPAAFAQLLRD
                     PTQSVFLGCWPMGFATIINMTDLQFGRDAWKATYAMWWIDVFVSLFTAWYVVFCMYSK
                     HDRKSTESINATILLPVVAVVVASSTGALITANLPKQLQESTIIITALLWGNGELLGF
                     TCTAIYIHRLLRSNLPPSQLAISNFLPVGPLGQGSFGIIIITSNLATLLAERQVLTVP
                     ESALVRYAGIGIAMAMMGYACFWVSIAFLAILTDPPKSFNPGWWGLTFPLGTFVLGWY
                     RLADETGLLAFKVLGAIFGGIEVLLALTCTIQSINHAVIHDTLFRAPTVAPAPNSQTV
                     DKETV"
     gene            complement(<1057475..>1057545)
                     /locus_tag="AWJ20_337"
                     /db_xref="GeneID:30035384"
     tRNA            complement(<1057475..>1057545)
                     /locus_tag="AWJ20_337"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:30035384"
     gene            <1060633..>1062288
                     /locus_tag="AWJ20_338"
                     /db_xref="GeneID:30035395"
     mRNA            <1060633..>1062288
                     /locus_tag="AWJ20_338"
                     /product="gag-pol fusion protein"
                     /transcript_id="XM_018880391.1"
                     /db_xref="GeneID:30035395"
     CDS             1060633..1062288
                     /locus_tag="AWJ20_338"
                     /note="Retrotransposon TYA Gag and TYB Pol genes;
                     transcribed/translated as one unit; polyprotein is
                     processed to make a nucleocapsid-like protein (Gag),
                     reverse transcriptase (RT), protease (PR), and integrase
                     (IN); similar to retroviral genes; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     9448009]; GO_component: GO:0000943 - retrotransposon
                     nucleocapsid [Evidence ISS] [PMID 9582191]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA]; GO_function:
                     GO:0003887 - DNA-directed DNA polymerase activity
                     [Evidence IEA,IEA]; GO_function: GO:0003887 - DNA-directed
                     DNA polymerase activity [Evidence ISS] [PMID 9582191];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA,IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence ISS] [PMID
                     9582191]; GO_function: GO:0004523 - RNA-DNA hybrid
                     ribonuclease activity [Evidence IEA]; GO_function:
                     GO:0003964 - RNA-directed DNA polymerase activity
                     [Evidence IEA,IEA]; GO_function: GO:0003964 - RNA-directed
                     DNA polymerase activity [Evidence ISS] [PMID 9582191];
                     GO_function: GO:0004190 - aspartic-type endopeptidase
                     activity [Evidence IEA]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0004519
                     - endonuclease activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0004518 - nuclease activity
                     [Evidence IEA]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016779
                     - nucleotidyltransferase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0008233 - peptidase activity
                     [Evidence ISS] [PMID 9582191]; GO_function: GO:0004540 -
                     ribonuclease activity [Evidence ISS] [PMID 9582191];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0015074 - DNA integration [Evidence
                     IEA,IEA]; GO_process: GO:0006310 - DNA recombination
                     [Evidence IEA]; GO_process: GO:0006261 - DNA-dependent DNA
                     replication [Evidence IEA,IEA]; GO_process: GO:0090502 -
                     RNA phosphodiester bond hydrolysis, endonucleolytic
                     [Evidence IEA]; GO_process: GO:0006278 - RNA-dependent DNA
                     replication [Evidence IEA,IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0090305 -
                     nucleic acid phosphodiester bond hydrolysis [Evidence
                     IEA]; GO_process: GO:0006508 - proteolysis [Evidence IEA];
                     GO_process: GO:0032196 - transposition [Evidence IEA];
                     GO_process: GO:0032197 - transposition, RNA-mediated
                     [Evidence ISS] [PMID 9582191]; GO_process: GO:0019076 -
                     viral release from host cell [Evidence IEA]"
                     /codon_start=1
                     /product="gag-pol fusion protein"
                     /protein_id="XP_018734578.1"
                     /db_xref="GeneID:30035395"
                     /translation="MDEYKTPKERGPLVPSSSQSLPTIRPVEPTATSQESVQSVTFSR
                     DTEMLKRINQSLEKDPKYSKILQHFRNPQHSPFPGDKKEKLRYSYKNEILRYLGKIVV
                     GVDEELHEDLIKLFHDHWIGGHHGIRRTRRALTKVFTWPNISEYVEKYVKSCLTCQKF
                     RIRNHAPYGLLKPLPIPDRPFQSISLDFVTTLPESGPRKSTQILVIVDRFSKYVQCYP
                     CSTNTNAIELATCMKDYFDRFGPPDTIISDRGTQFTSNFWRSFTASRDIKLQFSTAYH
                     PQTDGQTERMNREVIRHIAKYINPQHNNWSELLSEATFAINTTYNESIKNSPYKVVFG
                     FEPNIHFNFEAAEAYPTMEAKLAHQADLHNSTKDIIRHSQQQQAKYHNKHRVHKVFKL
                     TDRVLLSTDKLNHDRGPKRKFDRKWIGPFTIAAKVNDNAYRLLLPKSWRNNPVFNVDQ
                     LELYQENLVHRKKYDPHIEEDIDYYDNNPLGITDLIRTEHFGKQIKYLASVRTKYATE
                     SQYFTLEQLKDYKDLVWLLHNRSPTDPKPPHLDKFLNHLEGGS"
     gene            <1065284..>1065661
                     /gene="RPS18B"
                     /locus_tag="AWJ20_339"
                     /db_xref="GeneID:30035406"
     mRNA            <1065284..>1065661
                     /gene="RPS18B"
                     /locus_tag="AWJ20_339"
                     /product="ribosomal 40S subunit protein S18B"
                     /transcript_id="XM_018880399.1"
                     /db_xref="GeneID:30035406"
     CDS             1065284..1065661
                     /gene="RPS18B"
                     /locus_tag="AWJ20_339"
                     /inference="similar to AA sequence:KEGG_Orthology:K02964"
                     /note="Protein component of the small (40S) ribosomal
                     subunit; homologous to mammalian ribosomal protein S18 and
                     bacterial S13; RPS18B has a paralog, RPS18A, that arose
                     from the whole genome duplication; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0022627 - cytosolic small ribosomal
                     subunit [Evidence IBA]; GO_component: GO:0022627 -
                     cytosolic small ribosomal subunit [Evidence NAS] [PMID
                     9559554]; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0003676 - nucleic acid binding [Evidence IEA];
                     GO_function: GO:0019843 - rRNA binding [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA]; GO_function: GO:0003735 -
                     structural constituent of ribosome [Evidence NAS] [PMID
                     9559554]; GO_process: GO:0002181 - cytoplasmic translation
                     [Evidence NAS] [PMID 9559554]; GO_process: GO:0000447 -
                     endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
                     5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     14627813]; GO_process: GO:0006407 - rRNA export from
                     nucleus [Evidence IGI] [PMID 16246728]; GO_process:
                     GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S18B"
                     /protein_id="XP_018734579.1"
                     /db_xref="GeneID:30035406"
                     /translation="MYALTTIRGVGRRYANLICKKADVDLSKRAGELTVEELERIVTI
                     IQNPTQYKVPAWFLNRQRDVVDGKDSHLLVNQLDNKLREDLERLKRMRAHRGLRHYWG
                     LRVRGQHTKTTGRRGRSAPTGKK"
     gene            complement(<1068017..>1069060)
                     /gene="ADO1"
                     /locus_tag="AWJ20_340"
                     /db_xref="GeneID:30035418"
     mRNA            complement(<1068017..>1069060)
                     /gene="ADO1"
                     /locus_tag="AWJ20_340"
                     /product="adenosine kinase"
                     /transcript_id="XM_018880411.1"
                     /db_xref="GeneID:30035418"
     CDS             complement(1068017..1069060)
                     /gene="ADO1"
                     /locus_tag="AWJ20_340"
                     /inference="similar to AA sequence:KEGG_Orthology:K00856"
                     /note="Adenosine kinase; required for the utilization of
                     S-adenosylmethionine (AdoMet); may be involved in
                     recycling adenosine produced through the methyl cycle;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0004001 -
                     adenosine kinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004001 - adenosine kinase activity [Evidence IDA,IMP]
                     [PMID 11223943]; GO_function: GO:0016301 - kinase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0016773 -
                     phosphotransferase activity, alcohol group as acceptor
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0044209 - AMP
                     salvage [Evidence IEA]; GO_process: GO:0016310 -
                     phosphorylation [Evidence IEA]; GO_process: GO:0006144 -
                     purine nucleobase metabolic process [Evidence IMP] [PMID
                     11223943]; GO_process: GO:0006166 - purine ribonucleoside
                     salvage [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="adenosine kinase"
                     /protein_id="XP_018734580.1"
                     /db_xref="GeneID:30035418"
                     /translation="MTFDLLALGNPLLDLQADVDAEYLAKYDLKANDAILIEDKHKPI
                     FDEVMAQPKVHILAGGAAQNAARGAQYLLPANSVIYFGSVGQDKYAELLTKANDEAGV
                     YSNYMVQKDIPTGKCAALITGNDRSLVTDLAAANHYKLDHLKAPENWKYVEEAKAFYV
                     GGFHLTVCPPAINALGEHAAETNKIFSINLSAPFLPQFFKEPLDASSPYWDYLIGNES
                     EALAYAESHGLDTKDITEIAKHIALLPKKNTKRDRVVVITQGLDDTIVVIGDVNNKTT
                     TVHTFPVHPISSEDIVDSNGAGDAFAGGFLAGLVSGKPLAESVDMGQWLAAQSLREIG
                     PSFPSPKKAYTSA"
     gene            complement(<1072257..>1072868)
                     /gene="FMN1"
                     /locus_tag="AWJ20_341"
                     /db_xref="GeneID:30035429"
     mRNA            complement(<1072257..>1072868)
                     /gene="FMN1"
                     /locus_tag="AWJ20_341"
                     /product="riboflavin kinase"
                     /transcript_id="XM_018880422.1"
                     /db_xref="GeneID:30035429"
     CDS             complement(1072257..1072868)
                     /gene="FMN1"
                     /locus_tag="AWJ20_341"
                     /inference="similar to AA sequence:KEGG_Orthology:K00861"
                     /note="Riboflavin kinase, produces riboflavin
                     monophosphate (FMN); FMN is a necessary cofactor for many
                     enzymes; predominantly localizes to the microsomal
                     fraction and also found in the mitochondrial inner
                     membrane; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IEA,IEA]; GO_component: GO:0043231 -
                     intracellular membrane-bounded organelle [Evidence
                     IEA,IEA]; GO_component: GO:0043231 - intracellular
                     membrane-bounded organelle [Evidence IDA] [PMID 10887197];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     10887197]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA]; GO_function: GO:0003919 - FMN
                     adenylyltransferase activity [Evidence IDA] [PMID
                     10887197]; GO_function: GO:0016301 - kinase activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0008531
                     - riboflavin kinase activity [Evidence IEA,IEA];
                     GO_function: GO:0008531 - riboflavin kinase activity
                     [Evidence IDA,IMP] [PMID 10887197]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0009398 - FMN biosynthetic process
                     [Evidence IEA]; GO_process: GO:0009398 - FMN biosynthetic
                     process [Evidence IDA,IMP] [PMID 10887197]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]; GO_process:
                     GO:0009231 - riboflavin biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="riboflavin kinase"
                     /protein_id="XP_018734581.1"
                     /db_xref="GeneID:30035429"
                     /translation="MTTSTATAMSRENRPQVVGPESPEPPYPLRVNTRVIAGYGRGSS
                     DLGIPTANIPQDAFDALDIGDTGIYYGWASVHKSSQHPHTIETCPEGTDGTRKVEFSY
                     GETLECGKDSDVVFPMVMSVGWNPFYGNKKRSAEIHIIHKFSDAFYGAAIKFMILGYI
                     RPELNYVSKEALIADINTDIQVALNSLNRPGYASYRTDAFFSQ"
     gene            complement(<1075092..>1077197)
                     /gene="GLE1"
                     /locus_tag="AWJ20_342"
                     /db_xref="GeneID:30035440"
     mRNA            complement(<1075092..>1077197)
                     /gene="GLE1"
                     /locus_tag="AWJ20_342"
                     /product="nucleoporin GLE1"
                     /transcript_id="XM_018880433.1"
                     /db_xref="GeneID:30035440"
     CDS             complement(1075092..1077197)
                     /gene="GLE1"
                     /locus_tag="AWJ20_342"
                     /inference="similar to AA sequence:KEGG_Orthology:K18723"
                     /codon_start=1
                     /product="nucleoporin GLE1"
                     /protein_id="XP_018734582.1"
                     /db_xref="GeneID:30035440"
                     /translation="MRFTPHRSSSYSDSDVDSLWSQDSEEEEFPVGPRDGDSEDDDEF
                     IEVTYEDALGQEAGGEDATSDWSEDESFRLFTEQRSELLKDLEKSSLPTGVSGLHDQK
                     KLNTATFTSSSPGDSFLNRSATGSMSMNIPLKTQTQQPSQLSFQRNTSTPLKTPGQNQ
                     RSTTPAATKSFPHVGSVTSDSGNRSFSNKGAISSPVNGSASASRYQTTVLDSDRSFGS
                     EVNISPSLRRTSRIMNQMQVTADINKLDAMVNKWSISNIEKYADLVKDDEQTIQDKLD
                     QLTDQFNLQIISTNENANNIVARRKKRVSDLINERIRYEEEIKEQKRREAEAEKERLR
                     KQQEEQARIQRELEEARKKQEEERKKQEAIDVANAEARKEAEKKAAEEAKAKAAAEAA
                     AAKAAAEEAAKSRQYTDWTKVDKEFAQRKAKIVEIKEKILAPVSADANLRKYCFQNKR
                     HIKVKLGQLTDSRGQLQTILRELFDVFEQAKKFNHLTYLWLLNFFAKGVVAQAETETI
                     VAVQSAVPLGTLATFCMAQFPELVDLLLARFVKKCPQVIGYSCNIDTEEGRIRMGYKR
                     KNEKWEDDAVYSERVSGMCSVWTVITMTEQLKGTPFNHPYPFSNTWRFLARQLNKDPE
                     LVQNGDFAAVAAWWDIASERFVQVYGRQAIKALQLASGPWAMLKPDQRFPAALRLQLL
                     GEEWRKKGKLSVVVKPMLP"
     gene            <1078066..>1078944
                     /gene="MRPL7"
                     /locus_tag="AWJ20_343"
                     /db_xref="GeneID:30035451"
     mRNA            <1078066..>1078944
                     /gene="MRPL7"
                     /locus_tag="AWJ20_343"
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /transcript_id="XM_018880444.1"
                     /db_xref="GeneID:30035451"
     CDS             1078066..1078944
                     /gene="MRPL7"
                     /locus_tag="AWJ20_343"
                     /inference="similar to AA sequence:KEGG_Orthology:K02931"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; MRPL7 produces both YmL5 and YmL7, which are two
                     different modified forms of the same protein;
                     GO_component: GO:0005762 - mitochondrial large ribosomal
                     subunit [Evidence IDA] [PMID 9151978]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IDA] [PMID 9151978]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence IC] [PMID
                     9151978]; GO_process: GO:0006412 - translation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /protein_id="XP_018734583.1"
                     /db_xref="GeneID:30035451"
                     /translation="MFKRAFHTTVPTAGKPGVSIVHPVHHTVKFKKAQVSERYRELLT
                     PKSSILSAGFRPLVVSPDRVRDHHYNTIQSDLLLINYMHGAEDKKGIKMREWDGSSPY
                     HLNRAPRPPRGRSRATKDIKVRDWSNVPEIVGVSLNCFVPEAKEVSDIAVAAKLQLQQ
                     ITGVKARTVYSRSNVPTWRLRPGMAMGAKVHLVGRPMNQFLYTLTEIVLPRSKTFTGV
                     SNSAGDTTGNITVGISADDARSFPEIEGNIEQWATTFGFDITIHTTAQVDPDARTLLS
                     AYGFLFKGEEKFPSRM"
     gene            complement(<1079060..>1081912)
                     /gene="SEC26"
                     /locus_tag="AWJ20_344"
                     /db_xref="GeneID:30035462"
     mRNA            complement(<1079060..>1081912)
                     /gene="SEC26"
                     /locus_tag="AWJ20_344"
                     /product="Sec26p"
                     /transcript_id="XM_018880455.1"
                     /db_xref="GeneID:30035462"
     CDS             complement(1079060..1081912)
                     /gene="SEC26"
                     /locus_tag="AWJ20_344"
                     /inference="similar to AA sequence:KEGG_Orthology:K17301"
                     /note="Essential beta-coat protein of the COPI coatomer;
                     involved in ER-to-Golgi protein trafficking and
                     maintenance of normal ER morphology; shares 43% sequence
                     identity with mammalian beta-coat protein (beta-COP);
                     GO_component: GO:0030126 - COPI vesicle coat [Evidence
                     IEA]; GO_component: GO:0030126 - COPI vesicle coat
                     [Evidence IGI,ISS] [PMID 7929113]; GO_component:
                     GO:0030663 - COPI-coated vesicle membrane [Evidence IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0030135 - coated vesicle [Evidence ISS]
                     [PMID 7929113]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0031410 -
                     cytoplasmic vesicle [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0030117 - membrane coat [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND];
                     GO_function: GO:0005198 - structural molecule activity
                     [Evidence IEA]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IMP] [PMID 7929113];
                     GO_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Sec26p"
                     /protein_id="XP_018734584.1"
                     /db_xref="GeneID:30035462"
                     /translation="MNLLEKGSDEKKIDAMKRILTIMLNGDPMPQLLMQIIRFVMPSR
                     NKQLKKLLHFYWEICPKLGADGKLKQEMILVCNAIRNDLQHPNEYIRGATLRFLCKLR
                     EPDLLEPLIPSIRACLDHRHAYVRKNAVFTVYSIASHSADHLIPDATELIKIFLDNET
                     DATCKRNAFIALSNLSRDDAFEFVQKNHTNISGLEELLQLAFIEFIRKDAQTHPELKN
                     SYIKIIGEILESSSNTVVYDAANALTSLTSNASAIKTAASKFIDLAVKESDNNIKLIV
                     LSIVDKLRIKNPGVLNDLTMDILLVLSSPDLDVRRKALELALSMVTSKNVDDVVRLFK
                     KDLAKTVNNSGDFDKNTEYRQLLIQSIHTCAVKFGEVATSVVDLLLDFIGDFNSSSAV
                     DVIAFVKEVVELYPKLRKSIVKRLLTTLNSDEVRSGSVYRGALWILGEYCLEETDIHD
                     SWVHIRKSLGEIPILSTERNKLNGGNDGEEAADNAESGATTNGGTTHKKGPKVLADGT
                     YASESAFTATDAKNLEKVKSSRPPLRALILDGNYFVAAVLAVTITKLVLRFNKVSNND
                     SHKNALRAEALLILTSILRVGESEIVSQKIDEDSADRVYSCIQALLDTNDAIDLAFLQ
                     DSHSAFKVLIDKQKKKQDEKNANEREKTATRVDSPVKFRQFARLEANNVSSENADASD
                     EAALSAANDASSDKIASRLNRIVQLTGFSDPVYAEAYVIVHQFDIVLDVLLFNQTTET
                     LQNLSVEFATLGDLKVVERPTTQNVGPQSFHSVQTTIKVSSADAGVIFGNIIYEGHTG
                     SVNNVVIINDIHVDIMDYIKPGHCSETEFRTMWSEFEWENKVNISVTYPSLRGFLAYL
                     LKNTNMTCLTTGALSDETDADGNYKDECQFLSANLHARSSFGEDALANLSIEKDASGK
                     VTGHVRIRSKGQGLALSLGDRVAELQRKIKPSPLSK"
     gene            complement(<1083658..>1084407)
                     /gene="LUC7"
                     /locus_tag="AWJ20_345"
                     /db_xref="GeneID:30035473"
     mRNA            complement(<1083658..>1084407)
                     /gene="LUC7"
                     /locus_tag="AWJ20_345"
                     /product="Luc7p"
                     /transcript_id="XM_018880466.1"
                     /db_xref="GeneID:30035473"
     CDS             complement(1083658..1084407)
                     /gene="LUC7"
                     /locus_tag="AWJ20_345"
                     /note="Essential protein associated with the U1 snRNP
                     complex; splicing factor involved in recognition of 5'
                     splice site; contains two zinc finger motifs; N-terminal
                     zinc finger binds pre-mRNA; relocalizes to the cytosol in
                     response to hypoxia; GO_component: GO:0005685 - U1 snRNP
                     [Evidence IEA]; GO_component: GO:0005685 - U1 snRNP
                     [Evidence IGI,IMP] [PMID 10500099]; GO_component:
                     GO:0071004 - U2-type prespliceosome [Evidence IDA] [PMID
                     16618970]; GO_component: GO:0005829 - cytosol [Evidence
                     IDA] [PMID 22932476]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22932476]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005681 - spliceosomal complex [Evidence IEA];
                     GO_function: GO:0003729 - mRNA binding [Evidence IEA];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA,IMP]
                     [PMID 17726058]; GO_process: GO:0008380 - RNA splicing
                     [Evidence IEA]; GO_process: GO:0006397 - mRNA processing
                     [Evidence IEA]; GO_process: GO:0006376 - mRNA splice site
                     selection [Evidence IEA]; GO_process: GO:0006376 - mRNA
                     splice site selection [Evidence IGI,IMP] [PMID 10500099]"
                     /codon_start=1
                     /product="Luc7p"
                     /protein_id="XP_018734585.1"
                     /db_xref="GeneID:30035473"
                     /translation="MAAEQRKLLEQLMGRDALDSRRPVRAERIDLYDPKICKSFLLGG
                     CFYDFFPGVKQIGRCPRMHAEKYRLEYLNQVKNGVKFPDFDLEHERTLEHHINELQQR
                     IDVANKRLDKTPEDMEKINQATRDLETLTTAITMSLQEIELLAEQGHITKALQELNNL
                     ERLRMEKNNINTEIKALSDVSGFSGFQKLQVCEICSAYLSRLDNDKRLADHFLGKTHR
                     GYALLLDTYNEYKTKNAPLHASSRKRGYSHY"
     gene            <1085508..>1086065
                     /gene="SWP1"
                     /locus_tag="AWJ20_346"
                     /db_xref="GeneID:30035484"
     mRNA            <1085508..>1086065
                     /gene="SWP1"
                     /locus_tag="AWJ20_346"
                     /product="Swp1p"
                     /transcript_id="XM_018880477.1"
                     /db_xref="GeneID:30035484"
     CDS             1085508..1086065
                     /gene="SWP1"
                     /locus_tag="AWJ20_346"
                     /inference="similar to AA sequence:KEGG_Orthology:K12667"
                     /note="Delta subunit of the oligosaccharyl transferase
                     glycoprotein complex; complex is required for N-linked
                     glycosylation of proteins in the endoplasmic reticulum;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0008250 -
                     oligosaccharyltransferase complex [Evidence IEA];
                     GO_component: GO:0008250 - oligosaccharyltransferase
                     complex [Evidence IPI] [PMID 10358084]; GO_component:
                     GO:0008250 - oligosaccharyltransferase complex [Evidence
                     IPI] [PMID 16297388]; GO_component: GO:0008250 -
                     oligosaccharyltransferase complex [Evidence IPI] [PMID
                     9405463]; GO_function: GO:0004579 -
                     dolichyl-diphosphooligosaccharide-protein glycotransferase
                     activity [Evidence IMP] [PMID 9405463]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_process:
                     GO:0006487 - protein N-linked glycosylation [Evidence
                     IEA]; GO_process: GO:0006487 - protein N-linked
                     glycosylation [Evidence IPI] [PMID 9405463]; GO_process:
                     GO:0006486 - protein glycosylation [Evidence IEA]"
                     /codon_start=1
                     /product="Swp1p"
                     /protein_id="XP_018734586.1"
                     /db_xref="GeneID:30035484"
                     /translation="MFTGSVRPNGKADISIAHKSVPLALQGKKLKLTVLVGSFGSDKP
                     VAVEVTDSFIVAQTQQLTEPARLKALPELHHTFRAPPKTVAKPIALAFVGIVTSLLVI
                     LLGFWLGTADLAALGSAVSKAPLGHIGLLSSLLAFELVFVRYFQGTSIFDTLFAVAFI
                     APVAIFTGSRALREVRERRLNGQFN"
     gene            complement(<1086329..>1088482)
                     /locus_tag="AWJ20_347"
                     /db_xref="GeneID:30035495"
     mRNA            complement(<1086329..>1088482)
                     /locus_tag="AWJ20_347"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880488.1"
                     /db_xref="GeneID:30035495"
     CDS             complement(1086329..1088482)
                     /locus_tag="AWJ20_347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734587.1"
                     /db_xref="GeneID:30035495"
                     /translation="MNGYFNGKRISLGPPEDAHSGDGDSSSPGISPVPSPVPGNMNSS
                     IPGAFPMGRSIPPIPPPHAGPPKRKPVRRIPVSVDSHPGGVAAGSGTGPITATQRNSM
                     YEGLAPSRSSGSNNSSNSAYQTSFTAASTRPLSGPPGSVPLPPGPIPYLDQGVSDNIS
                     PKTSSSNLSNAPSPAFRSYSPSPSFYNSEENNYSNERISGTVASASASTTGPATATTT
                     AGTVHRYQAQPQVLEGSATALYQSPSQMYAQTQARLQSQQNQNQSQNQHPQQQYHQQQ
                     QPGQGFNQGQAIYQSHPTSQSQDYQAYQTQSPSNLQYNYTNPDHSSGPSSPEYVQATA
                     ESVPQPPIPHSSANAYPYSYPYPSQSQSKPSLTQQLPPVLVPTNNAYDSDNTSPVSRS
                     SQQFSHRRSGSTHSASSGASFSQPLYISASSNSAAAAAAAVVAANQGTGGMLRNNAAN
                     FANPYSSQTSLQQSISNHSRGNSISSRVSNNGTSTGTSNTTNTISPAVSSATRSATTA
                     SSTSGGGASAASAAPVKQEIPGLGVVSAYVRQLRVNSASAWSDKPASVWGLPIGISTN
                     ANGSALYKPTPTYAKSLLRRTVDPRHSHLTPRLLASEIDDEDDDMPMVRSQASSQTLG
                     HSPQPSNATSDSILTATGTSTTPSSGSGSGPASSSYKYNPSLAQQHEESASIKSSDAN
                     TPYGGLSRAQSVSSTKSVEEDIGKIRLFVANPDDS"
     gene            complement(<1093402..>1095510)
                     /gene="LYS4"
                     /locus_tag="AWJ20_348"
                     /db_xref="GeneID:30035506"
     mRNA            complement(<1093402..>1095510)
                     /gene="LYS4"
                     /locus_tag="AWJ20_348"
                     /product="homoaconitate hydratase LYS4"
                     /transcript_id="XM_018880499.1"
                     /db_xref="GeneID:30035506"
     CDS             complement(1093402..1095510)
                     /gene="LYS4"
                     /locus_tag="AWJ20_348"
                     /inference="similar to AA sequence:KEGG_Orthology:K01705"
                     /note="Homoaconitase; catalyzes the conversion of
                     homocitrate to homoisocitrate, which is a step in the
                     lysine biosynthesis pathway; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0051539 -
                     4 iron, 4 sulfur cluster binding [Evidence IEA];
                     GO_function: GO:0004409 - homoaconitate hydratase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004409 -
                     homoaconitate hydratase activity [Evidence ISA] [PMID
                     9268014]; GO_function: GO:0051536 - iron-sulfur cluster
                     binding [Evidence IEA]; GO_function: GO:0016829 - lyase
                     activity [Evidence IEA]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA]; GO_process: GO:0008652 -
                     cellular amino acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0009085 - lysine biosynthetic process
                     [Evidence IEA,IEA]; GO_process: GO:0019878 - lysine
                     biosynthetic process via aminoadipic acid [Evidence IEA];
                     GO_process: GO:0019878 - lysine biosynthetic process via
                     aminoadipic acid [Evidence IMP] [PMID 2507177];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="homoaconitate hydratase LYS4"
                     /protein_id="XP_018734588.1"
                     /db_xref="GeneID:30035506"
                     /translation="MLRLAQSLNGKTQSRNWGRLFSTSRFVSAQTLTEKIVQKYAVGI
                     APGKEVRSGDYVSIRPSHCMSHDNSWPVALKFKGLGASKVADNRQVVCTLDHDVQNKS
                     DKNLEKYRNIENFAKEQGVDFYPAGRGIGHQILVEEGYAFPYNLTVASDSHSNTYGGV
                     GCLGTPIVRTDAASIWATGMTWWQIPPVARVELKGQLQPGVTGKDVIVALCGVFNNDE
                     VLNHAIEFVGEGVDKLSVDERLTIANMTTEWGALSGLFPVDQVLIDWYEDRLKNYIKK
                     DNHPRISRASIDNVKNNVITADGDAKFAKYLTLDLSTLSPYVSGPNSVKVATPLSELS
                     SQDIKINKAYLVSCTNSRLSDIVAAAKVIKGRKVKEGVEFYVAAASSIVQKDAEQIGA
                     WNDLLEAGAKPLPAGCGPCIGLGTGLLKDGEVGISATNRNFKGRMGSRDALAYLASPE
                     VVAASAVLGKIGFPEEMDGKTPQAAQGIKSTISDPSEVGETTDGGAAGVEATGSTATV
                     SILPGFPESIQGELVLCDADNINTDAIYPGKYTYQDDVPREKMAEVCMENYDSDFGSK
                     TKAGDIIVSGFNFGTGSSREQAATAILARDIKLVIAGSFGNIFSRNSINNALLTLEIP
                     ALIKLLRERFAEQKQSELTIRTGLFAQWDVKTATVTVRDGSTTGPVLLTSKVGELGES
                     MQEIIVKGGLEGWVRSKIAN"
     gene            <1098352..>1100556
                     /gene="PRP22"
                     /locus_tag="AWJ20_349"
                     /db_xref="GeneID:30035517"
     mRNA            <1098352..>1100556
                     /gene="PRP22"
                     /locus_tag="AWJ20_349"
                     /product="DEAH-box ATP-dependent RNA helicase PRP22"
                     /transcript_id="XM_018880510.1"
                     /db_xref="GeneID:30035517"
     CDS             1098352..1100556
                     /gene="PRP22"
                     /locus_tag="AWJ20_349"
                     /inference="similar to AA sequence:KEGG_Orthology:K13117"
                     /note="DEAH-box RNA-dependent ATPase/ATP-dependent RNA
                     helicase; associates with lariat intermediates before the
                     second catalytic step of splicing; mediates ATP-dependent
                     mRNA release from the spliceosome and unwinds RNA
                     duplexes; required for proofreading the exon ligation
                     reaction; GO_component: GO:0071007 - U2-type catalytic
                     step 2 spliceosome [Evidence IMP] [PMID 9524130];
                     GO_component: GO:0071021 - U2-type post-spliceosomal
                     complex [Evidence IMP] [PMID 12212850]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0004004 - ATP-dependent RNA helicase activity [Evidence
                     IDA] [PMID 9582286]; GO_function: GO:0008026 -
                     ATP-dependent helicase activity [Evidence IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0000386
                     - second spliceosomal transesterification activity
                     [Evidence IDA] [PMID 12212850]; GO_function: GO:0000386 -
                     second spliceosomal transesterification activity [Evidence
                     IMP] [PMID 9524130]; GO_process: GO:0006200 - ATP
                     catabolic process [Evidence IEA]; GO_process: GO:0008380 -
                     RNA splicing [Evidence IEA]; GO_process: GO:0000350 -
                     generation of catalytic spliceosome for second
                     transesterification step [Evidence IDA] [PMID 12212850];
                     GO_process: GO:0000350 - generation of catalytic
                     spliceosome for second transesterification step [Evidence
                     IMP] [PMID 22408182]; GO_process: GO:0006397 - mRNA
                     processing [Evidence IEA]; GO_process: GO:0000390 -
                     spliceosomal complex disassembly [Evidence IMP] [PMID
                     9524130]"
                     /codon_start=1
                     /product="DEAH-box ATP-dependent RNA helicase PRP22"
                     /protein_id="XP_018734589.1"
                     /db_xref="GeneID:30035517"
                     /translation="MVSRGVPPAAGALPQTPLLLLRRRICLDCGEGGGSILTEVEQVI
                     RKSSAVSPSHVSIVVASSLSGVYTEVPQYLYQELTDGKILAVVVEDPERSANRLVSAI
                     ATESHSVTPDARLERSERSRGVWGAAPAAGGRQPTQLEAGSVGYTSLFSDFVGAQTRV
                     KYVTAEMLLREALVDPLLRSYGIVYVEDFHERAAWTDILLGVTKKVLKVRPDDLRVVV
                     HSVTDDVVELLRRFFSPGEDEKTRPFVVQVKEGEEKSSLVNHVDVLYSTQSYGDYVKA
                     AVDTVTSLYSGESRRLVETATVVVFLASKGDVSRASQLLKYHSGLPQGIGIATEVETL
                     DMKDLSQGGLIVLTCENGAETNFKMLSCGTVQFVVDCGYRGYKWFQGASDGRGNADIN
                     DTVNFPVAKSQAELRKLLASHADGPGKCFRLYTEAAAFNVLTDGYIPQIQGSSQLPEI
                     ILRLKALGIDNIARSFPFLTAPSVDVISRTLSLLWWHKIIDDYGKLTAMGEKLALLPL
                     DIRLGRAVYLAAQTGCLSEMITIAAMVAVGGLSAVLMKSEQAMADHKQFYTVEGDYLT
                     LLNIYALYISTRKRDGVSFINKWAKNHGIHGDVLEGARNIRSQLQTAVNRTGLRQLDT
                     TGKSTSSAPSNPSELANTISNCITQAFFLQVAKRISHNTYELVGPHSNSSSTALPDTF
                     CVYSDLTKPLTSPWVVYEKLTQGTDGNIYLTGVNMADRATLELTNYYKSIRR"
     gene            <1101974..>1102306
                     /gene="SUI1"
                     /locus_tag="AWJ20_350"
                     /db_xref="GeneID:30035529"
     mRNA            <1101974..>1102306
                     /gene="SUI1"
                     /locus_tag="AWJ20_350"
                     /product="translation initiation factor eIF1"
                     /transcript_id="XM_018880522.1"
                     /db_xref="GeneID:30035529"
     CDS             1101974..1102306
                     /gene="SUI1"
                     /locus_tag="AWJ20_350"
                     /inference="similar to AA sequence:KEGG_Orthology:K03113"
                     /note="Translation initiation factor eIF1; component of a
                     complex involved in recognition of the initiator codon;
                     modulates translation accuracy at the initiation phase;
                     GO_component: GO:0016282 - eukaryotic 43S preinitiation
                     complex [Evidence IDA] [PMID 12008673]; GO_component:
                     GO:0043614 - multi-eIF complex [Evidence IDA] [PMID
                     11018020]; GO_component: GO:0043614 - multi-eIF complex
                     [Evidence IDA] [PMID 15838098]; GO_function: GO:0043024 -
                     ribosomal small subunit binding [Evidence IDA] [PMID
                     17434125]; GO_function: GO:0003743 - translation
                     initiation factor activity [Evidence IEA]; GO_function:
                     GO:0003743 - translation initiation factor activity
                     [Evidence IDA] [PMID 12008673]; GO_function: GO:0031369 -
                     translation initiation factor binding [Evidence IDA,IPI]
                     [PMID 12861028]; GO_function: GO:0031369 - translation
                     initiation factor binding [Evidence IDA,IPI] [PMID
                     15145951]; GO_function: GO:0031369 - translation
                     initiation factor binding [Evidence IPI] [PMID 22851688];
                     GO_process: GO:0001731 - formation of translation
                     preinitiation complex [Evidence IDA] [PMID 12008673];
                     GO_process: GO:0001731 - formation of translation
                     preinitiation complex [Evidence IDA] [PMID 15664195];
                     GO_process: GO:0001731 - formation of translation
                     preinitiation complex [Evidence IDA] [PMID 17434125];
                     GO_process: GO:1990145 - maintenance of translational
                     fidelity [Evidence IMP] [PMID 9488467]; GO_process:
                     GO:0006417 - regulation of translation [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0006413 - translational initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="translation initiation factor eIF1"
                     /protein_id="XP_018734590.1"
                     /db_xref="GeneID:30035529"
                     /translation="MSTSIENLKSFDPFADTGDDDTQSTNYIHIRCQQRNGRKTITTV
                     QGVPAEYDLKRILKTLKKDFGCNGHINKDEELGDILQLQGDQRGKVMEFLTSALQIDK
                     KTIQVHGF"
     gene            complement(<1102853..>1105813)
                     /gene="NVJ2"
                     /locus_tag="AWJ20_351"
                     /db_xref="GeneID:30035540"
     mRNA            complement(<1102853..>1105813)
                     /gene="NVJ2"
                     /locus_tag="AWJ20_351"
                     /product="Nvj2p"
                     /transcript_id="XM_018880533.1"
                     /db_xref="GeneID:30035540"
     CDS             complement(1102853..1105813)
                     /gene="NVJ2"
                     /locus_tag="AWJ20_351"
                     /note="Lipid-binding ER protein, enriched at
                     nucleus-vacuolar junctions (NVJ); may be involved in
                     sterol metabolism or signaling at the NVJ; contains a
                     synaptotagmin-like-mitochondrial- lipid binding protein
                     (SMP) domain; binds phosphatidylinositols and other lipids
                     in a large-scale study; may interact with ribosomes, based
                     on co-purification experiments; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0071561 - nucleus-vacuole junction
                     [Evidence IDA] [PMID 22250200]; GO_component: GO:0005840 -
                     ribosome [Evidence IDA] [PMID 16702403]; GO_function:
                     GO:0008289 - lipid binding [Evidence IDA] [PMID 22250200];
                     GO_process: GO:0008150 - biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Nvj2p"
                     /protein_id="XP_018734591.1"
                     /db_xref="GeneID:30035540"
                     /translation="MRLYDPSVMAVPFKLNNDGFSKVFFNSDIPGDSSAQWFNALTGR
                     LFLAIKDTARLETYFRNKIINKLARVKKPGFLSEIDVQKIDCGNSVPFISNPKLGTFN
                     QEGEVSMTANVKYNGGFSIIIGTKANLNVMKIKQSFSLVLGLKVTKLEGSIKLLIKPP
                     PSNRIWYGFESVPQLEFETEPQLRFRNKNFAYNYVASIIESKIRDLIKESLVLPAMDD
                     MTFFPSEDDFYRGGIWDYSKLKDISANDKQQTDESAGQEVEDDLDSRERVSGLGRSKT
                     VPVLSVSSATELIEGEENLRHRTARSHTAVAGTTASSIDDSDVVSELDLDTGVLRGRA
                     NSLNPSISSTDSEYNPAEHIGELKGFGYSPDGKIQPQAMLSSAASTNTAGSSQKDTLG
                     GAGLATKKFLTKTWNSWYSKDKQGTTSTGSTSNGTGIGSNGDVIGSNGSDNSLGKNSP
                     KPQVIKQAPAPHEFPREFLSSIENNNSSNPYGPAPEMRLPATYPVPQAQMRADYQELA
                     KKTPKRKPVGGSSSKDSASENGKATTDEKETEAGTDEMGQEEGQQSERSRRDSFGRRL
                     SLRISRSRSRSRSRSRSRSRSESKESISFGNDYDHDDSFDNEDHSGSHSSDKPRKSLS
                     DSISTLKDINTSRNSNYSNNNNSSSSDINRPVQSPTFGPRSPTTPFSYPSSPRVVVSS
                     ASSLQRTGSAVSVTSSSSDMSTGTGYSESMSSRRMSSVAVKLNENRPNVNSGTNGAAS
                     SLPGPGDAITFHPSPPTTTTTTVSAITSNSSTTSSPHMGSSSPRLQDYSMPILQPTAI
                     MTTGTTTATSTSSATSTSTSTSTSTAGNISTSTSTSTTDNTTGTNTATTTSAGLINSN
                     GSSSFDTISDSRPSSPARRSNTVKRKAVGSGTSSTTATSNNSVPPLPSSAIPPLPPRT
                     LPTTATTNTTTTAMPPLPPRDLTLTTAVSSSAPPPPPLPPRTDSAQSTSSTASSSSSD
                     EVTLTVLKSESLPT"
     gene            <1109925..>1110024
                     /locus_tag="AWJ20_352"
                     /db_xref="GeneID:30035551"
     tRNA            <1109925..>1110024
                     /locus_tag="AWJ20_352"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:30035551"
     gene            complement(<1116191..>1117870)
                     /gene="AGP2"
                     /locus_tag="AWJ20_353"
                     /db_xref="GeneID:30035562"
     mRNA            complement(<1116191..>1117870)
                     /gene="AGP2"
                     /locus_tag="AWJ20_353"
                     /product="Agp2p"
                     /transcript_id="XM_018880554.1"
                     /db_xref="GeneID:30035562"
     CDS             complement(1116191..1117870)
                     /gene="AGP2"
                     /locus_tag="AWJ20_353"
                     /inference="similar to AA sequence:KEGG_Orthology:K16261"
                     /note="Plasma membrane regulator of polyamine and
                     carnitine transport; has similarity to transporters but
                     lacks transport activity; may act as a sensor that
                     transduces environmental signals; has a positive or
                     negative regulatory effect on transcription of many
                     transporter genes; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IDA] [PMID 10545096];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 10545096]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005887 -
                     integral component of plasma membrane [Evidence IDA] [PMID
                     10545096]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0015171 - amino acid
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0015203 - polyamine transmembrane
                     transporter activity [Evidence IMP] [PMID 23755272];
                     GO_process: GO:0003333 - amino acid transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA,IEA]; GO_process: GO:1902274
                     - positive regulation of (R)-carnitine transmembrane
                     transport [Evidence IMP] [PMID 23755272]; GO_process:
                     GO:1902269 - positive regulation of polyamine
                     transmembrane transport [Evidence IMP] [PMID 23755272];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Agp2p"
                     /protein_id="XP_018734592.1"
                     /db_xref="GeneID:30035562"
                     /translation="MIASEEKSVGVTTAIDQGPSGSQLEETLPGYPESISSETPPPSY
                     HSTHRKLKSRHIQLIGIGGTIGTVLFVQLGSALSKGGPGSLFLAFFIWCFPILCITNS
                     TAEMVTYLPLPSPFIRLAGRCVDPALEVMAGWNFFILEATLVPFEITAVNIIIHFWAD
                     GFSPAIPIVVQIFLYVLINFFAVRYYGESEFWLSFGKVLLAVGLIVFTFVTMVGGNPK
                     HDAYGFRYWQNPGAFAEYQETGSLGRFLGFFTCLVQACYTISGPEYVSMAAGEAENPR
                     GVMPRAYRGVIVRLVCFFVFGALSMGIVCPYNDPELLTAINTGAPGAAASPYIIAMQR
                     LGIPVLPHIVNVLVLTASFSAGNSYVYCASRSLYGMALDGHAPKIFSKCTKNGVPIYA
                     VTVVLAFGLLSFLQLGNTAETVLNWIVNISTASELINFAIMSLTYLRFYYAMKAQNMS
                     RDNLPYKGPFQPYCGYIGLICAGVMTFLSGYSVFVHGYWSLSTFICSYIMIAVDLVIY
                     VSWKLVKRTKIRSATEIDLLSDVKEIEDYTSSFVDEPPKTLLGRISRALIG"
     gene            <1129517..>1131691
                     /gene="ETP1"
                     /locus_tag="AWJ20_354"
                     /db_xref="GeneID:30035573"
     mRNA            <1129517..>1131691
                     /gene="ETP1"
                     /locus_tag="AWJ20_354"
                     /product="Etp1p"
                     /transcript_id="XM_018880565.1"
                     /db_xref="GeneID:30035573"
     CDS             1129517..1131691
                     /gene="ETP1"
                     /locus_tag="AWJ20_354"
                     /inference="similar to AA sequence:KEGG_Orthology:K10632"
                     /note="hypothetical protein required for growth on
                     ethanol; contains a zinc finger region and has homology to
                     human BRAP2, which is a cytoplasmic protein that binds
                     nuclear localization sequences; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_component: GO:0005737
                     - cytoplasm [Evidence IEA,IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0008139
                     - nuclear localization sequence binding [Evidence IDA]
                     [PMID 9497340]; GO_function: GO:0043130 - ubiquitin
                     binding [Evidence IDA] [PMID 16564012]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0045471 - response to ethanol [Evidence IMP] [PMID
                     19416103]"
                     /codon_start=1
                     /product="Etp1p"
                     /protein_id="XP_018734593.1"
                     /db_xref="GeneID:30035573"
                     /translation="MVRYHIIVETDSSVDKEKNSGRIEESFQTESSGFGVKYCSWSSA
                     AKSVGDIFLPVENWERDSSLGGQKEKERRFSEVASKVSEGRISRPGEGRLRATSLSQQ
                     QLVTGESAGNANPASGISLGPGNFLSRRRRSTLSGEARPVDPAIHIARTRKDQSGPKP
                     GSKEYYSIHTSRDYRFGRVEIQGFDNEMASASVTSTTVAEVAQVAQVAGSSSVNDDLV
                     PVPEAKTTATLKSTFMGYGVVRLYREQDEGEEETADTDDATVVAILAVPGYMSTGDLL
                     EYLGEDTRKRSSHIRLVTSNGVPNRYMVLIKFLDAKFATDFYLNYNGKVFNSMEAETC
                     HVVYVKSVQFRSPPRRGDGDEIPYLIKDPFTGIGIGAETDDKTATESSATAVSSSLVS
                     NSASTSSAIQHNKLSSLQELPTCPVCLERMDATITGLLTILCQHTFHCQCLQKWGDSS
                     CPVCRHTNADSYGTYEQADSSSALPALSSKCYVCEAGSNLWACLICGHVGCGRYDKAH
                     AYDHYVATGHCFSMDITTQRVWDYSSDGYVHRLIQNQSDGKLVELPSGSSSTADGKKD
                     IENDLSLQYTYLLTSQLESQREYYESLLAEAEGALLQYRTLDDRIDRIKQENEAKFQT
                     DHARLLEKVKTISESVTQANRQIEEEKAFSLGLVTKVDSLVETIKQKDQEINDLNDQI
                     RDLMFFLDAKEKLANADEDVQQGTVSVAPAPSKKKPKRKPKK"
     gene            <1132699..>1133436
                     /gene="PRS3"
                     /locus_tag="AWJ20_355"
                     /db_xref="GeneID:30035584"
     mRNA            <1132699..>1133436
                     /gene="PRS3"
                     /locus_tag="AWJ20_355"
                     /product="ribose phosphate diphosphokinase subunit PRS3"
                     /transcript_id="XM_018880576.1"
                     /db_xref="GeneID:30035584"
     CDS             1132699..1133436
                     /gene="PRS3"
                     /locus_tag="AWJ20_355"
                     /inference="similar to AA sequence:KEGG_Orthology:K00948"
                     /note="5-phospho-ribosyl-1(alpha)-pyrophosphate
                     synthetase; synthesizes PRPP, which is required for
                     nucleotide, histidine, and tryptophan biosynthesis; one of
                     five related enzymes, which are active as heteromultimeric
                     complexes; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0016301 - kinase
                     activity [Evidence IEA]; GO_function: GO:0000287 -
                     magnesium ion binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004749 - ribose phosphate
                     diphosphokinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004749 - ribose phosphate diphosphokinase activity
                     [Evidence IGI] [PMID 15280369]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0006015 - 5-phosphoribose 1-diphosphate biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006015 -
                     5-phosphoribose 1-diphosphate biosynthetic process
                     [Evidence IMP] [PMID 10212224]; GO_process: GO:0006015 -
                     5-phosphoribose 1-diphosphate biosynthetic process
                     [Evidence IGI] [PMID 15280369]; GO_process: GO:0044249 -
                     cellular biosynthetic process [Evidence IEA]; GO_process:
                     GO:0031505 - fungal-type cell wall organization [Evidence
                     IPI] [PMID 15470112]; GO_process: GO:0009165 - nucleotide
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]; GO_process:
                     GO:0008361 - regulation of cell size [Evidence IMP] [PMID
                     12089449]; GO_process: GO:0009156 - ribonucleoside
                     monophosphate biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="ribose phosphate diphosphokinase subunit PRS3"
                     /protein_id="XP_018734594.1"
                     /db_xref="GeneID:30035584"
                     /translation="MINACKTASARRITAVIPNFPYARQDRKDKSRAPITAKLMANML
                     ETAGCNHVITMDLHASQIQGFFDVPVDNLYAEPSVVNYIKNNVDYKNAIIVSPDAGGA
                     KRAASLADRLDLNFALIHKERARANEVSRMVLVGDVSDKVCILVDDMADTCGTLAKAA
                     DTLLGHGAQSVIAIVTHGILSGKATEIINKSKLHRVVCTNTVPLEGKELVCDRLQLLD
                     VSPVLAESIRRLHNGESVSYLFRNAPV"
     gene            complement(<1133631..>1134443)
                     /locus_tag="AWJ20_356"
                     /db_xref="GeneID:30035595"
     mRNA            complement(<1133631..>1134443)
                     /locus_tag="AWJ20_356"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880587.1"
                     /db_xref="GeneID:30035595"
     CDS             complement(1133631..1134443)
                     /locus_tag="AWJ20_356"
                     /inference="similar to AA sequence:KEGG_Orthology:K17623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734595.1"
                     /db_xref="GeneID:30035595"
                     /translation="MASTTANTSSSTSTTSSSTPAHAHIQIKACLFDMDGLLINSEDI
                     YTEITNEILHEHGKPSLPWEVKVQLQGRPGPDASRKLLEWAQLPYTPEEYFKMTSERQ
                     KTRWNKTTFMPGALELLQHLEDIKVPFALATSSHHANYLLKTKHLRHGFDLFGDHVVV
                     GDDKRIPPGRGKPHPDIWHVALESLNSVQRAKNLPEIKPEECLVFEDGVPGVIAGKAA
                     GCRVIWVPDSRALEVLDQNEVVDLVGDHELLESLHHFDKAKYGLEKPTLTGL"
     gene            <1135921..>1137705
                     /locus_tag="AWJ20_357"
                     /db_xref="GeneID:30035606"
     mRNA            <1135921..>1137705
                     /locus_tag="AWJ20_357"
                     /product="hypothetical protein"
                     /transcript_id="XM_018880598.1"
                     /db_xref="GeneID:30035606"
     CDS             1135921..1137705
                     /locus_tag="AWJ20_357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018734596.1"
                     /db_xref="GeneID:30035606"
                     /translation="MRLLPVSFRSRRRVTSQIKDVIIIALATGIAGLIFFRPHYRHEK
                     RIIQSQDPNLEHRRQDGDGTNTQKIFTLRPDQTFFHTYPDNNRYISGDTWRPPQSFGP
                     QVVKYDDNKDGQFGKINLQQRLTADHTVNANKILLLLKTGSKTLWDRVPVHFFTTLTR
                     FPNFALYSDAADSIAGYEVVDILANVSQSLLLESDQFSVYRSYRQLRSKHNYLRTSDV
                     DDIPGGWELDKFKNIRMFYHAYKEAPDMEWYVMIDDDTIILADNLSKYLRTLDPRKEY
                     YLGSAVAGLKHIFAHGGSGIVLSQGAMKKAFGSPSSED