GenomeNet

Database: RefSeq
Entry: NC_031673
LinkDB: NC_031673
Original site: NC_031673 
LOCUS       NC_031673            2277569 bp    DNA     linear   CON 25-OCT-2016
DEFINITION  Sugiyamaella lignohabitans strain CBS 10342 chromosome D, complete
            sequence.
ACCESSION   NC_031673
VERSION     NC_031673.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
            Assembly: GCF_001640025.1
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 2277569)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2277569)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2277569)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP014502.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2277569
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="genomic DNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Sugiyamaella
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="D"
     gene            <2427..>2521
                     /locus_tag="AWJ20_4604"
                     /db_xref="GeneID:30036755"
     tRNA            <2427..>2521
                     /locus_tag="AWJ20_4604"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:30036755"
     gene            complement(<9063..>9809)
                     /locus_tag="AWJ20_4605"
                     /db_xref="GeneID:30036756"
     mRNA            complement(<9063..>9809)
                     /locus_tag="AWJ20_4605"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881687.1"
                     /db_xref="GeneID:30036756"
     CDS             complement(9063..9809)
                     /locus_tag="AWJ20_4605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736140.1"
                     /db_xref="GeneID:30036756"
                     /translation="MSFYQAKAILDRFGLSHGDTKNVKSKDQASDASKEQKGKKRHPQ
                     KQSGQSQPENQEDSYQGQEDSVPGVTANKFERTAQPGLEAQGQRLPSTFIPTRPPYTP
                     YEPKWYDRILDLLVGEDEQSPNSRYALICQNCRMHNGLCQFGEKPQFVVYYCPHCGMQ
                     NGEEEHPEDDPKESKEAGRQNVKADEGRSEQESTKKVDAEIDIKNGYREYREGNGSED
                     EANYPNEPVNIKRKTSQKSVRQRKSRSQKE"
     gene            complement(<10902..>14051)
                     /gene="POL92"
                     /locus_tag="AWJ20_4606"
                     /db_xref="GeneID:30036757"
     mRNA            complement(<10902..>14051)
                     /gene="POL92"
                     /locus_tag="AWJ20_4606"
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 3"
                     /transcript_id="XM_018881688.1"
                     /db_xref="GeneID:30036757"
     CDS             complement(10902..14051)
                     /gene="POL92"
                     /locus_tag="AWJ20_4606"
                     /note="allele of CaO19.8194"
                     /codon_start=1
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 3"
                     /protein_id="XP_018736141.1"
                     /db_xref="GeneID:30036757"
                     /translation="MSELDIILVQEPGLNKGGTVIQHSSWVAVHSGEGKQRTNAITYI
                     SAKLRGRLPVIMDRGLTNENMVSITLGNLTITNIYNRQSEELHPLKQWCHRVEGDDSG
                     NLRVIAGDFNLHHPLWQTNALASRDSKMWVDWASDHDLMLASRADEATHMAGNTIDLV
                     FTDSRINTTMRESLDVGSDHFMLKWNLHTELVQAELVCTPTQGFNYKKADWEVFAEEV
                     NRLSKQMDVPSSLTTSKTTENCLKSADKFAERIVAILQEALKISTPKLNITFRSKRWW
                     TPELKQLKLRVQRLRRRAKRYPTEAHIKERQEANARYKRELMIAKAKNWNGFLSQVTT
                     QNVWLALKLVKPTENQVSLLPALRIDDDKHTQTYGEQISELFNSLFPSVPPSTKGVKP
                     VEASANWPKLRKKEVQSALQDQASYKAPGPDGVKTKAIKEAWKQKSFRKLVKGLFSYC
                     LRVGYHPKIFRKGLTVVLPKPKRDPTLARSYRPITLLSTLGKVLEKIFQRRLTALTAT
                     CIPRQQFGGRHGFSAVDALTKLSEDIQYNLSRSKVTSILAIDIKGAFDNVHRDSLLST
                     MEQMNLPVPVQNWVYHFMCGRRTSLMVDGKVTRERKINTGIPQGSPISPLLFLIYSSP
                     LYSIVQENGGKVIGFVDDITIYVTGKSRDENTKRLSNILQKCHEWATSAHTAIDYGEK
                     LGFMHVDNQRTSKKRQLRLVLPSGERRQASPTLKLLGVTLDSQWKFSKHVDAIAIKGK
                     MVLGIIRRLGGITWGVTGASMRNLYQGCVRPILEYASPVWYPKITKQEREQLQRIQNT
                     GLRAILGGYHQTPIDCLHRDTDIMPLEQRYDTLQDNYIVRLHRNVDPENPVNAESTWW
                     RKHMEHNELVQRLYEVLPKEEIFQDRIRRRKPPWKKEDMECESKAWKVKSELKKKIYQ
                     RHHTIWETQYRTSAKGEFYRSYTLPRLYNADHKNPLRYFLNECSKNELSKLVQLRTAK
                     GAFGMFFKRFKINNRPHQCECGEEEDVKHLLCECPVTENHRQILRDASATLDLKVLLD
                     SKKGLKAVLAFLAKAPQLL"
     gene            <16060..>16131
                     /locus_tag="AWJ20_4607"
                     /db_xref="GeneID:30036758"
     tRNA            <16060..>16131
                     /locus_tag="AWJ20_4607"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:30036758"
     gene            <16659..>18428
                     /gene="STR2"
                     /locus_tag="AWJ20_4608"
                     /db_xref="GeneID:30036759"
     mRNA            <16659..>18428
                     /gene="STR2"
                     /locus_tag="AWJ20_4608"
                     /product="Str2p"
                     /transcript_id="XM_018881689.1"
                     /db_xref="GeneID:30036759"
     CDS             16659..18428
                     /gene="STR2"
                     /locus_tag="AWJ20_4608"
                     /inference="similar to AA sequence:KEGG_Orthology:K01739"
                     /note="Cystathionine gamma-synthase, converts cysteine
                     into cystathionine; STR2 has a paralog, YML082W, that
                     arose from the whole genome duplication; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0003962 - cystathionine
                     gamma-synthase activity [Evidence IEA]; GO_function:
                     GO:0003962 - cystathionine gamma-synthase activity
                     [Evidence IMP] [PMID 10821189]; GO_function: GO:0030170 -
                     pyridoxal phosphate binding [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0009086 -
                     methionine biosynthetic process [Evidence IEA];
                     GO_process: GO:0006790 - sulfur compound metabolic process
                     [Evidence IMP] [PMID 10821189]; GO_process: GO:0019346 -
                     transsulfuration [Evidence IMP] [PMID 10821189]"
                     /codon_start=1
                     /product="Str2p"
                     /protein_id="XP_018736142.1"
                     /db_xref="GeneID:30036759"
                     /translation="MPSIDSPPTAVGCPIPSNTPHAVSVTLPSWAANVAYEEGENWVA
                     SKMSSGYPRFFVHHRIQALSDEIESSYGREGEKSLIFPSYATACRCRDFIKRYSTLQP
                     CPVRIVQLSTPKPSEGQDDGSSIQAHIAVVFFPQSEYSVARKYWQHTGEGVSSRLGEY
                     FLEHWGDNNPHNGGGNGANTSSGKGSYKDFHRRSSQSPVLEGLSENSNSNADSNKEQS
                     TFVEERFGRNLDLSFAPAAKLALRRRIAGKITESGTSASRHGNFEELSEDDVYLYATG
                     MTSIYSAHRAVLEALGDGKKKSVCFGFPYTDTLKILEKWGPGVHFYGNGEQPDLAALE
                     KLLEDGEQIVALFCEFPSNPLLKSPDLVNIRRLADKYNFAVVVDETVGNFVNIHVLPY
                     SDIVVSSLTKVFSGESNVMGGSLVLNPRGKHFKALKDTLGRQYEDNFWAEDAIYLERN
                     SRDFAKRNEKININTEAVTELLRQSPIIKDLFYPKYVSTKEYYDTCRVDGGGYGGLFS
                     IVFHNPQHAKNFFDRMVMAKGPSLGTNFTLSCPYTIIAHYLELDFVEKFGVDRHLVRI
                     SVGLEETEELLERFRKGLEACVE"
     gene            complement(<20297..>20980)
                     /locus_tag="AWJ20_4609"
                     /db_xref="GeneID:30036760"
     mRNA            complement(<20297..>20980)
                     /locus_tag="AWJ20_4609"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881690.1"
                     /db_xref="GeneID:30036760"
     CDS             complement(20297..20980)
                     /locus_tag="AWJ20_4609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736143.1"
                     /db_xref="GeneID:30036760"
                     /translation="MPEEFVPAWKKLGLKVKQTDPLAVGIVGTEQNENVKRKRKEPKQ
                     ETDANAEKGPKKPPKRVKLPKNERPPPPEADQLAYLRQYHEDKENWKFSKQKQNWILK
                     NLYTIEESYAEALDSYVDGLVGGARDRVVEEARKVISEWNEFMTKEDEEEKEKEESTS
                     KEVAEKEEKIEESNAESSKSETSENSKPKSKTQEPPQPVAPSESKAIKARHFLELLVG
                     EKPKLEFID"
     gene            <22086..>23129
                     /gene="DAL2"
                     /locus_tag="AWJ20_4610"
                     /db_xref="GeneID:30036762"
     mRNA            <22086..>23129
                     /gene="DAL2"
                     /locus_tag="AWJ20_4610"
                     /product="allantoicase"
                     /transcript_id="XM_018881692.1"
                     /db_xref="GeneID:30036762"
     CDS             22086..23129
                     /gene="DAL2"
                     /locus_tag="AWJ20_4610"
                     /inference="similar to AA sequence:KEGG_Orthology:K01477"
                     /note="Allantoicase; converts allantoate to urea and
                     ureidoglycolate in the second step of allantoin
                     degradation; expression sensitive to nitrogen catabolite
                     repression and induced by allophanate, an intermediate in
                     allantoin degradation; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0004037
                     - allantoicase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004037 - allantoicase activity [Evidence ISS] [PMID
                     1916277]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_process: GO:0000256 - allantoin
                     catabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0000256 - allantoin catabolic process [Evidence IMP]
                     [PMID 1916277]; GO_process: GO:0006144 - purine nucleobase
                     metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="allantoicase"
                     /protein_id="XP_018736144.1"
                     /db_xref="GeneID:30036762"
                     /translation="MSVSQVSLEEFEKRTAAYVNVINTHLETEIIAFSDEFFAEATNL
                     ITSTPPVREAGRYTEKGAWYDGWETRRHNTEEADWVIIKVGVNSARIAAVEVDTAFFN
                     GNHAPAISVEGVYLEGKVNQSSFDTVQWQPIISHVECGPSQRHFFARDDGLTKQSFNY
                     LRLRMYPDGGIARFRAYGSPVPVFPDDKSVVLDLASISNGGSAVAWSDKRFSGPDNLL
                     LPGRGHDMSDGWETARSRTKGHVDWAIIKLGAPARISKVVVDTAYFLGNFPAAVKVEA
                     INLDPSSEISATDSAWKDIVGETPAGPGKEHEFSLANGLATITKDELFTHVKLVMIPD
                     GGVKRLRIFGTRV"
     gene            complement(<25250..>27241)
                     /gene="MNS1"
                     /locus_tag="AWJ20_4611"
                     /db_xref="GeneID:30036763"
     mRNA            complement(<25250..>27241)
                     /gene="MNS1"
                     /locus_tag="AWJ20_4611"
                     /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase"
                     /transcript_id="XM_018881693.1"
                     /db_xref="GeneID:30036763"
     CDS             complement(25250..27241)
                     /gene="MNS1"
                     /locus_tag="AWJ20_4611"
                     /inference="similar to AA sequence:KEGG_Orthology:K01230"
                     /note="Alpha-1,2-mannosidase; involved in ER-associated
                     protein degradation (ERAD); catalyzes the removal of one
                     mannose residue from a glycosylated protein, converting
                     the modification from Man9GlcNAc to Man8GlcNAc; catalyzes
                     the last step in glycoprotein maturation in the ER and is
                     critical for ER protein degradation; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 8864657]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_function: GO:0005509 - calcium ion
                     binding [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0016798
                     - hydrolase activity, acting on glycosyl bonds [Evidence
                     IEA]; GO_function: GO:0004571 - mannosyl-oligosaccharide
                     1,2-alpha-mannosidase activity [Evidence IEA,IEA];
                     GO_function: GO:0004571 - mannosyl-oligosaccharide
                     1,2-alpha-mannosidase activity [Evidence IDA] [PMID
                     12090241]; GO_function: GO:0004571 -
                     mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
                     [Evidence IMP] [PMID 1714453]; GO_function: GO:0004571 -
                     mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
                     [Evidence IMP] [PMID 8439291]; GO_function: GO:0004571 -
                     mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
                     [Evidence IDA] [PMID 8910350]; GO_process: GO:0030433 -
                     ER-associated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 8905927]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0035977 - protein deglycosylation involved in
                     glycoprotein catabolic process [Evidence IMP] [PMID
                     9732283]; GO_process: GO:0006486 - protein glycosylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase"
                     /protein_id="XP_018736145.1"
                     /db_xref="GeneID:30036763"
                     /translation="MTSSSSEDENIFEDCEKTEPGLASTSSSASPNITSAMWRPNTER
                     RPLPMYKDKPEKTTRRESPSVRKIRKTVGFIVFFTGILYLVYNIGKATAPLPGRGRTY
                     KDILSWGSKPKEPETWPEKQQAVKNAFIDSWNGYKKYAWGKDVYRPVSKTGVNMGPKP
                     LGWIIVDSLDTLHIMGLKDQLKEARTWVHKDLDYNMDYEVNTFETTIRMLGGMLSAHY
                     LTKDDMYLDKAADLGNRLLGAFDSISGIPYSSVNLHSSKGKKSHTDLGAASTAEAATL
                     QLEFKYLAKLTGESLYWEKVEKILSIMDANKVRSGLVPIYIQPDTGQFSSRVIRLGSR
                     GDSYYEYLIKQYLQTNEEEPIYKEMYDESVQGIKDHLIKQSTPNKLTFIGELNTGVGG
                     KLSTKMDHLVCFAGGMLAIGATNGLPLDDARRKGFWSTVREADIQLAMELTHTCYEMY
                     SQTQTGLAPEIVYFNTDKDSTSDFTIKRNDGHNLQRPETVESLFILWRLTKNPIYREW
                     GWNIFKSFEHWTKLQGDAGYASINDVRNTPPAFRNNMESFWLSETLKYLYLLFDDSDE
                     LLPLTDVVFNTEAHPFPKFSMDPLFKTGWSRSKKATAPTPGNAAADEPLQKPIDQTDK
                     KPKPISKDDRKEASNAEARAEDIPVRQVGAADTAPSISE"
     gene            complement(<28542..>29183)
                     /locus_tag="AWJ20_4612"
                     /db_xref="GeneID:30036764"
     mRNA            complement(<28542..>29183)
                     /locus_tag="AWJ20_4612"
                     /product="peptidase family M20 protein"
                     /transcript_id="XM_018881694.1"
                     /db_xref="GeneID:30036764"
     CDS             complement(28542..29183)
                     /locus_tag="AWJ20_4612"
                     /inference="similar to AA sequence:KEGG_Orthology:K01438"
                     /codon_start=1
                     /product="peptidase family M20 protein"
                     /protein_id="XP_018736146.1"
                     /db_xref="GeneID:30036764"
                     /translation="MMFNSITYAVALASVFSNVVAEKQSTFSASTLKVNQELLDLHRD
                     LIQLKSVSGYEIDAAVYLQNYLESNNFTVELETVYGDSNRKNVYAYYGKERNTKALLT
                     SHIDTVPPYFNYSVVDNRIYGRGSVDAKSCVSSQIVALSQLFKDGEVEEGDVALLFVV
                     DEEVQGRGMVYASDNLGVDSWEHVIFGEPTENRLGVGHKGMASAQLKAHGKAA"
     gene            <30080..>30913
                     /locus_tag="AWJ20_4613"
                     /db_xref="GeneID:30036765"
     mRNA            <30080..>30913
                     /locus_tag="AWJ20_4613"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881695.1"
                     /db_xref="GeneID:30036765"
     CDS             30080..30913
                     /locus_tag="AWJ20_4613"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736147.1"
                     /db_xref="GeneID:30036765"
                     /translation="MPLELSAIDVLVTDWDETVTSEDTMAVLSQAAYDHKTNFHPPWE
                     YFGDMYYKDYEKYACNYNERRGSLQEEAEFLSGLKQVELESVTRVENSGLFKDVPESM
                     VRSQASKVKIRQGWWDVLSLATKNKVPIVILSVNWSDVLIEEVLSLHGFDTTNSSIRI
                     YANKIQVDDETGLATGKLGGHPILGSAGIRTAQDKLDILKKIRSQKLSGKATESIAYF
                     GDSSTDTLALLEADLGVVIHKNSLASRLEGLGVAILRKEHDKTDNNQVYYLCEWSDLL
                     T"
     gene            <32007..>33749
                     /gene="POL4"
                     /locus_tag="AWJ20_4614"
                     /db_xref="GeneID:30036766"
     mRNA            <32007..>33749
                     /gene="POL4"
                     /locus_tag="AWJ20_4614"
                     /product="Pol4p"
                     /transcript_id="XM_018881696.1"
                     /db_xref="GeneID:30036766"
     CDS             32007..33749
                     /gene="POL4"
                     /locus_tag="AWJ20_4614"
                     /inference="similar to AA sequence:KEGG_Orthology:K10981"
                     /note="DNA polymerase IV; undergoes pair-wise interactions
                     with Dnl4p-Lif1p and Rad27p to mediate repair of DNA
                     double-strand breaks by non-homologous end joining (NHEJ);
                     homologous to mammalian DNA polymerase beta; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence TAS] [PMID 9745046];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003887 - DNA-directed DNA polymerase
                     activity [Evidence IEA,IEA,IEA]; GO_function: GO:0003887 -
                     DNA-directed DNA polymerase activity [Evidence TAS] [PMID
                     9745046]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0016779 -
                     nucleotidyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA,IEA]; GO_process: GO:0006261 - DNA-dependent DNA
                     replication [Evidence IEA,IEA,IEA]; GO_process: GO:0006974
                     - cellular response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0006302 - double-strand break repair
                     [Evidence IDA] [PMID 12235149]; GO_process: GO:0006303 -
                     double-strand break repair via nonhomologous end joining
                     [Evidence IDA,IMP] [PMID 10438542]; GO_process: GO:0006303
                     - double-strand break repair via nonhomologous end joining
                     [Evidence IDA] [PMID 15342630]"
                     /codon_start=1
                     /product="Pol4p"
                     /protein_id="XP_018736148.1"
                     /db_xref="GeneID:30036766"
                     /translation="MVPSRPSSKLYQIKSKKYDEYGARVTSSFDKSVSHVLIDPEWDG
                     SRTLKYLHISAGDIRPEIDKGTIHFVRDSWPSACIENKQLIPESPDYTVQLYSPAPSP
                     ETTPEPEVSQKLVQTVISPEKPPKLKKRDISTSSNTSLSPEPDTPKQTAIDDLNPVEA
                     SGANTSIENKAEKKAQDGSGNDELDSVIQEAELQEHAARFLSDDEIEHALQTQRKKYS
                     APYSRPKRTSDGRVLKGNWDTFLCMKAGEDNIAKPDGPNALVINILSLMLHHYEAEGD
                     QWRTLAYRKAIATLKKQTVPVRTAAQAVKLPGIGSRLADKIEEINKTGDLKRLKYTQG
                     EGKFEVLELLKRIYGVGNKTANKWYSEGIRTLDDVRERKDLTANQQTSLDHYEDFAER
                     IPRDNVTKHFERVRDAVHEIDPEIEATAMGSYRRLQPDCGDIDIILTKRNASRHDLTV
                     TLAKLLDVLFEQGFAKYTFGGIEANSMRWLGASAHPDDGNKWRRMDILLVPWEERGAA
                     FIYYTGNDIFNRSMRLLAQKKGYRLNEKGLFLAPHDRKSAGAVGPLVCGEDEEKIFET
                     LGVPNRPPHKRIIG"
     gene            <37366..>38799
                     /gene="SCS2"
                     /locus_tag="AWJ20_4615"
                     /db_xref="GeneID:30036767"
     mRNA            join(<37366..37399,37772..>38799)
                     /gene="SCS2"
                     /locus_tag="AWJ20_4615"
                     /product="phosphatidylinositol-binding protein SCS2"
                     /transcript_id="XM_018881697.1"
                     /db_xref="GeneID:30036767"
     CDS             join(37366..37399,37772..38799)
                     /gene="SCS2"
                     /locus_tag="AWJ20_4615"
                     /codon_start=1
                     /product="phosphatidylinositol-binding protein SCS2"
                     /protein_id="XP_018736149.1"
                     /db_xref="GeneID:30036767"
                     /translation="MDISPEVLVFHAPFSEQATKPLVLKNTSDRKLAYKIKTTAPKLY
                     CVRPNASVIEAGQTIEVSIIRQAKDQPKPTEKSKDKFLVLTAPVSDEILENSDISKLW
                     ATLEETSKDTIVNKKIKVNYEFGTDSTGSSGSHHGETGAATSGSVGSGSLSSAATGTS
                     ESGDSSRSSGLPVNSHASALAAATSQSEGAGNTSIIDPSQYGTPLRGGHSDNAGAGSV
                     LGGGSSGDGAGSSPVNATAAGIVAAAAGGAATGSSLSNGSSGESTLKSRNIPSSADTD
                     RASQRAQEQISSQSKELKAAAAANSSSSTSGSANEPGFKSSQPGSSTAVRQQPSSGVP
                     LHLVLALALVAFFIGWKLF"
     gene            complement(<39107..>40453)
                     /gene="MAP2"
                     /locus_tag="AWJ20_4616"
                     /db_xref="GeneID:30036768"
     mRNA            complement(<39107..>40453)
                     /gene="MAP2"
                     /locus_tag="AWJ20_4616"
                     /product="Map2p"
                     /transcript_id="XM_018881698.1"
                     /db_xref="GeneID:30036768"
     CDS             complement(39107..40453)
                     /gene="MAP2"
                     /locus_tag="AWJ20_4616"
                     /inference="similar to AA sequence:KEGG_Orthology:K01265"
                     /note="Methionine aminopeptidase; catalyzes the
                     cotranslational removal of N-terminal methionine from
                     nascent polypeptides; function is partially redundant with
                     that of Map1p; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0004177 - aminopeptidase activity [Evidence IEA,IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA,IEA]; GO_function: GO:0070006 -
                     metalloaminopeptidase activity [Evidence IEA];
                     GO_function: GO:0070006 - metalloaminopeptidase activity
                     [Evidence IGI,ISA] [PMID 8618900]; GO_function: GO:0008235
                     - metalloexopeptidase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_process: GO:0070084 - protein initiator
                     methionine removal [Evidence IEA]; GO_process: GO:0035551
                     - protein initiator methionine removal involved in protein
                     maturation [Evidence IMP] [PMID 11811952]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Map2p"
                     /protein_id="XP_018736150.1"
                     /db_xref="GeneID:30036768"
                     /translation="MGSTEIANGSEKLADKVEDLKIEESTKNVPKSEQAGDEDDDDEG
                     DDEVAAEGGEEGAAKKKKKKKKNNKKKKKTAGGSGAVPTSQTEPPTVGLSNLFKDNVY
                     PEGEIVEYKDDNHYRTTSEEKRYLERASFDAFNDLRKAAEAHRQVRQYAQKTIKPGMT
                     MIEIADLIENATRALTEGNGDSKKAGPGFPTGLSLNHVAAHYTPNKGDTTVLKYEDVM
                     KVDIGVHVNGRILDSAFTLTFDDKYDNLLAAVRDATNTGVREAGIDVRLGDIGAAIQE
                     VMESYEVELDGKTFQVKPIRNLNGHNINPFEIHGGKSVPIVKSHDQTKMEEGETFAIE
                     TFGSTGKGYVHDEGEVSHYAKRTNIGHVPLRLNSAKNLLAVIDKHFGTLPFCRRYLDH
                     AGEEKYLLALNNLVKSGIVQDYPPLVDIPGSYTAQYEHTILLRPTVKEVVSRGDDY"
     gene            complement(<41803..>43146)
                     /gene="MAL31"
                     /locus_tag="AWJ20_4617"
                     /db_xref="GeneID:30036769"
     mRNA            complement(<41803..>43146)
                     /gene="MAL31"
                     /locus_tag="AWJ20_4617"
                     /product="Mal31p"
                     /transcript_id="XM_018881699.1"
                     /db_xref="GeneID:30036769"
     CDS             complement(41803..43146)
                     /gene="MAL31"
                     /locus_tag="AWJ20_4617"
                     /note="Maltose permease; high-affinity maltose transporter
                     (alpha-glucoside transporter); encoded in the MAL3 complex
                     locus; member of the 12 transmembrane domain superfamily
                     of sugar transporters; functional in genomic reference
                     strain S288C; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0005352 -
                     alpha-glucoside:proton symporter activity [Evidence ISS]
                     [PMID 18179544]; GO_function: GO:0022891 -
                     substrate-specific transmembrane transporter activity
                     [Evidence IEA]; GO_function: GO:0022857 - transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0005215 - transporter activity [Evidence IEA];
                     GO_process: GO:0000017 - alpha-glucoside transport
                     [Evidence ISS] [PMID 18179544]; GO_process: GO:0008643 -
                     carbohydrate transport [Evidence IEA]; GO_process:
                     GO:0000023 - maltose metabolic process [Evidence IEA];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Mal31p"
                     /protein_id="XP_018736151.1"
                     /db_xref="GeneID:30036769"
                     /translation="MSPDTEKTHHVVDEQDVGSISSIKAVNVILENTKELLEEERQLG
                     VIDAMKQYPKAMFWSVFFSVAVIMTGYDAQLVTSFYAMPSFIAKYGQYYNGNKEISAA
                     WQSGLGMGNPIGQLLGSLVVAWPSEKWGRKRVLIVCNLLIAALIFMQFFANNIQVLCV
                     GEILAGLLWGCFVVIAPSYASEVSPLALRGILTAFINMAFVIGQFVAQGVAAGLESRT
                     DKWAYKAPFAIQWIWCLILFVGLPFAPESPWYLVRKGRRDEAKKALQRLAWDKAGDGV
                     SLEKTLNVIEQTDLLERELHTSSTYMDCFKGSNLRRTEICCMVYLIQVICGNPLMGYC
                     NYFFIQAGLDNQKAFYMGVGTTAIGFVGTALTWVVLSYAGRRTIFNYGLSVMTLLLFI
                     IAILDCAPSYSSNLGFSWAQASLLDVWTFLYQLTVGPLTFVIIGEISSTKLVSIL"
     gene            <44455..>45597
                     /gene="DES1"
                     /locus_tag="AWJ20_4618"
                     /db_xref="GeneID:30036770"
     mRNA            <44455..>45597
                     /gene="DES1"
                     /locus_tag="AWJ20_4618"
                     /product="sphingolipid delta-4 desaturase"
                     /transcript_id="XM_018881700.1"
                     /db_xref="GeneID:30036770"
     CDS             44455..45597
                     /gene="DES1"
                     /locus_tag="AWJ20_4618"
                     /inference="similar to AA sequence:KEGG_Orthology:K04712"
                     /codon_start=1
                     /product="sphingolipid delta-4 desaturase"
                     /protein_id="XP_018736152.1"
                     /db_xref="GeneID:30036770"
                     /translation="MTMSEVKVQASGTAGHSSDGGLSNKSRVKETSEDVENIKIRREN
                     EFLFTYQEEPHRSRRMEIIKAHPEVTKLVGHEPLTKWIVVGVVALQFSTAWFMRGASF
                     SSWYFWAAAYFIGATCNSNIFLAIHELSHNLAFKKPLHNKLFAIFANIPIGIPYSAGF
                     GPYHQLHHKHMGEPDYDTDLPTSLEAMFLSSVAGKAFFATFQLLFYAIRPMCVIKVNM
                     TWVHYLNIAVQLAVDALFIKLVCHDSSGSLDLMPFYYLLLSAFLAGSLHPIAGHFIAE
                     HYVLDAPKEYDLKKTALPETYSYYGWLNVFVYNAGYHNEHHDFPYIPWSRIKTLHTIA
                     SEFYDPLPSYTSWIYVIYRFVFDENVSLWCRVKRSNIKANKGDDQP"
     gene            <48199..>49290
                     /locus_tag="AWJ20_4619"
                     /db_xref="GeneID:30036771"
     mRNA            <48199..>49290
                     /locus_tag="AWJ20_4619"
                     /product="cyclin Pch1"
                     /transcript_id="XM_018881701.1"
                     /db_xref="GeneID:30036771"
     CDS             48199..49290
                     /locus_tag="AWJ20_4619"
                     /codon_start=1
                     /product="cyclin Pch1"
                     /protein_id="XP_018736153.1"
                     /db_xref="GeneID:30036771"
                     /translation="MSSSISSDSNATTGSPVSSNGSSTTLVNDSSSANTTSNSTHDTK
                     DVDALDSSKKPERTTKERVDSGKPNHKPETLVPGQNVWIFSMAQVAKSPSAKDGIPTK
                     HEFIQRAKGVNFIIVTGTQLRLPPMTIYAAALFLHRFYLRHSLKKFHIYEVGAACLFL
                     ATKVEESNRRLKDVAIACTRVASKDMNKVVDEQSKDYWKWRDTIIYNEELALEALCFD
                     LTLKSPYEICTELMIKHEMELVEPVRKAGQHFIHDSCKTVLGLIYSAEVIAAAAFYWA
                     VRSTGTKIDLKPKNGEENKLLGVKKQHVYDAVNMMADFYSTLQETVLSSERKNKYTRM
                     TPSNKRKASDSSSSTSKKNKPDEAQTVPV"
     gene            <50474..>53815
                     /gene="RAD9"
                     /locus_tag="AWJ20_4620"
                     /db_xref="GeneID:30036773"
     mRNA            <50474..>53815
                     /gene="RAD9"
                     /locus_tag="AWJ20_4620"
                     /product="chromatin-binding protein RAD9"
                     /transcript_id="XM_018881703.1"
                     /db_xref="GeneID:30036773"
     CDS             50474..53815
                     /gene="RAD9"
                     /locus_tag="AWJ20_4620"
                     /inference="similar to AA sequence:KEGG_Orthology:K06661"
                     /codon_start=1
                     /product="chromatin-binding protein RAD9"
                     /protein_id="XP_018736154.1"
                     /db_xref="GeneID:30036773"
                     /translation="MSISGGSWFTDDLEIERDHDDKTQPVGGRGDIDQQTQIVNNQIP
                     NVLLGPFPSFGIGETKPRDSDSTHSNLSNSSKSSARTQKDEPIDLPSGETDVVSDPDP
                     VAVQPGPESNVTQKLSSMGPSSDEPVGSPSPIALKEGIDGVSRYRRYSGPVSPIRGEA
                     ANAIARFNSSPGGFESDHEETMNDRDIGGNFVATGLGASQATQLIDTANYESSPLFKG
                     HKSSQGVVLNFEELASSPLKVRNASVTSTQNDVNVVNNGVGNGIGNFGAIGEGSKQSN
                     ASSAEDDSIHIHTAFFAAEDSQLQKRRKAINKLKNQEDTAIQIDDEDVVHLNIDKAKS
                     TRDSQDKPGTVKADKPDILSLDVDPSPSHISDSIQGSQGASSATQIITGVKYSQITRN
                     TATANSQFQETQRVRLPNAIPNALLISRDQWMSTVDDSDNNDSQERGFTHPASLNTQG
                     SGRNSQPVITQVLGTPRQEMRDREREKSFKAASSSSKEEDIDMEEAITSDHEEKNVDK
                     EDEEEEKGPEEIITSSPEKYDDETPVRRGRGRSKRKIEVETPVVSRFKKPRTGNAELQ
                     PMLGEMHTDIQGGVSASNDRMAQNDSTPDGDNEAEWESEQQKDTDVQSDAVYTNESDQ
                     IVTSKRTYAKHIVPSPTTGSTEKSVENVVWGVWGTKTWYAVKLVDTTANGLFEQGGAN
                     TGTLSVRFGNGDVTDLTTDKIRRFDIQVGDKVKLDNDRRPNFEVVELLQRPPVDGSVD
                     ETVVTTTTSPDGAWVGYEGVCFVKVQHTKTNKQTTVPIRLLYMSGTQISSYLSRRQLH
                     KNAFQDGSNTLAASLRQQSKALERLTLTNNTSQSSNQFNQFTAIDSGGAKTQPTDHGV
                     AQRGILSDCVFTISAIDNTKELEALTKTIIRNGGVVLNGGLQELFSVDYSTLEIKYNH
                     TRNNFTFGGVLAKFAVRTPKYLEGLALGWPCLSFKFIIDSIAEGEMIQDWEPYLLSAG
                     VSSALDQAYCSYNVRHFHQNWLEGATLADQFINRRLILGRNSILADRIYLHNPDSKDT
                     AILFLLVAMAPQDKLELVNSRAEVPSGSVLIDMGRKPSTTSQASTSRPQLTQLRSGTS
                     TTNHPKTIIYNREWIIQCLINQRIV"
     gene            <58577..>62152
                     /gene="TDA9"
                     /locus_tag="AWJ20_4621"
                     /db_xref="GeneID:30036774"
     mRNA            <58577..>62152
                     /gene="TDA9"
                     /locus_tag="AWJ20_4621"
                     /product="Tda9p"
                     /transcript_id="XM_018881704.1"
                     /db_xref="GeneID:30036774"
     CDS             58577..62152
                     /gene="TDA9"
                     /locus_tag="AWJ20_4621"
                     /note="Transcription factor that regulates acetate
                     production; green fluorescent protein (GFP)-fusion protein
                     localizes to the nucleus; null mutant is sensitive to
                     expression of the top1-T722A allele; not an essential
                     gene; TDA9 has a paralog, RSF2, that arose from the whole
                     genome duplication; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA,IEA]; GO_function:
                     GO:0003676 - nucleic acid binding [Evidence IEA];
                     GO_function: GO:0043565 - sequence-specific DNA binding
                     [Evidence IDA] [PMID 16785442]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA,IDA] [PMID
                     19111667]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19158363]; GO_process:
                     GO:0019413 - acetate biosynthetic process [Evidence IMP]
                     [PMID 23240040]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Tda9p"
                     /protein_id="XP_018736155.1"
                     /db_xref="GeneID:30036774"
                     /translation="MDMSVDVGVGRSDPATAAAAAASVSATAASTAGASSGSRRPTEP
                     IPAKSAQVKTDKPRPHVCATCTRSFARLEHLKRHERSHTKEKPFQCPVCERCFARRDL
                     LLRHKQKLHASFEPGRSNSTGGTSTVGGGIGVGGPRGGTKRKSSSVSSASAAAAAVSA
                     ATARGLGGINSMVVNSSPSSAPRSASLGFDANSNGHVSTAPYSNLLKSQLGGINGGRP
                     HDTSASGNGTSTNSSSSGSGSAVSSTSPFSAFNGRPRPASFSAASASSYSKYKDIEVL
                     NSQMYPSAPPEVGFSTPQLLPASLGNLDIPLEDLFDSDPLFINPQLLGQEDKNDGGSG
                     QPGQSGQAHGQTTGQSSGQQSGQYDPQQQQQQQQHQQQQQQQQQHTPSMGPLDSATGA
                     MSQTPQQQQQQQGQMQLSTPTQSHGQDAGSNHQPQQGQGQIHNFLQQHAANQAFNESL
                     YTADTRSSISSNYKLEEDLSPNSVLAMEHDDFSWMPPSSDNYGRPTPQSILNSSSFSP
                     PPNSSNNNYHLSGMNVANSESPLSLVGGNGQVNLSPNEGSGHMNSDFDHHMSPGIHED
                     MRDHKAFSLHIDGMDFWNNNNGINNSQSSFDENTLNLNGGNITGMGMRVNRGQVITPQ
                     LRLHILATLSTPTPFSSSQSPQLPSTLELQRYINSYTENFGKHMPFLHHSLEFTPDNV
                     PLALGMAAIGALYTFEHASSSNIFEISRSCIHVYLESRREKRGSGDSDGFNSNKSTPI
                     WLVQALVLGIIYGLFSGEPLANEIAVAQANAVISLAKSAGLHLPPSKYIQQPSPDLEN
                     AHIEEKWRYFIAAQERIRTMHVVHMISCLLATSYNVVSSLKNEDMKCGSPCDESLWTS
                     TSSSEWWETISKKGLEDINPQQYFEGPNFNDYLQQLLQKNTLVGKIPQFTLLSLLYAV
                     HYEIYQRRHTHDSYILNNRVTPSQHEITWLESQKLNIESILRAWETTWSLSPLASLSP
                     SSQYGPLMSDAIPLSSLAHVRVYVNLSKVKEAFWKRDFNAMNHELDNLAVPTYYESVT
                     NGSPSSPHKFDGLLEAASYAADAISLWEKHSIKWTLETTASQTFIHTLVSLFDCGLAV
                     SEFIHRLEIKPQHEWSEDETMLVNRIGKIFYRVLDVVGHDSLDPNDTWARPLNEDGTL
                     TRPGKLSVLTLLIVAKMLCKAYIWPFALVMGDALQFRSRHLSAFA"
     gene            complement(<62322..>66023)
                     /locus_tag="AWJ20_4622"
                     /db_xref="GeneID:30036775"
     mRNA            complement(<62322..>66023)
                     /locus_tag="AWJ20_4622"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881705.1"
                     /db_xref="GeneID:30036775"
     CDS             complement(62322..66023)
                     /locus_tag="AWJ20_4622"
                     /inference="similar to AA sequence:KEGG_Orthology:K17263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736156.1"
                     /db_xref="GeneID:30036775"
                     /translation="MAAGSTEVSSGTISILPMAIRSVILNVTATPSVAHILAESILPG
                     LYTGSNSGLLLNNNSEHSLDSMDILIDLIKRFGSSISAAEIVKTENVLLQIISGEQGI
                     IKKRAVTAMGLLARYLTDKNWEKLTAYLIDGLTESSDLSQLRILIQLAGILARSEPTR
                     FKNDLRPVIDLIIRKGLDVNDEGITGGRNVHRDEDFDDEEEEDNADDDEEANNPELLD
                     LREASLASLEIIVGLGYQAVETQLNDILAISAYYIKYNPNIIDDEDDQDEDIDDEDED
                     IDDNDDDVEMEGHDGGEDSEFEVSDDEDAFSDDDDQSWKLRRYAAKLAAAVAIYIPTQ
                     LPRIYSQLLPPLVSMYASEKESTVKTEVISCLSEFFKAASDKGLYYSSKLSSNIATRR
                     SSDISMATDMDPKLFLERHYLRKLVRVSLSELHSSTNTVILQSILTGILGNLVSVLHT
                     RPSIQTSKIIRSLISLSKTQPGLMIDMLQLVSGIIRAQTTQELTDSLPQLLEIIVLGI
                     YDKYYKVCGAALDVVLDLVAIHSDQSIKVDISVLLPALIEKAKSTSLDLDTRSKAVKA
                     LGQFIAKNDLSGSNIDTGCKLILDLLNNEGLRLTSVESISEIASGATVRQVSSKWIIS
                     SLEGLGNFLNQSSRTLRIGSLNAILSVTNRQPSSDQATVQALANIGQIILNHGKSILT
                     SSPDAVALDLVSKILTNLVPFISVSEASEFTIQTINQTSSQTAVQISDSILGLLAAVV
                     QHSTDAAALNAVYEELCRPRHVASASAGSSIGTNQNVELAAKALAVVITEGQMVDKIP
                     SFETVVAQNGEDLKWSLLVLGYVGKLLPYTTSLEVLYDELNNNARDEITKTVIANSLG
                     LIISNNVNNYLPDLLNRLKAAGSNTIHLHLLIIREIVSGAKTADVEAYSDDIWNSLFT
                     SLDAVSSSGIGKVALAASTAAAGIVPNAEASVVSGGDLILAECLGRLSILNPRVFLPQ
                     LQVQLASEKPSVRVTVLSAVKFTFGQSHDTYDDLLRPIIADFLALVDDDDTGIRQVAL
                     SALVSAIHNKSHLLLPHLARLLPLLYRETRINTSLIHTVQMGPFKHKVDNGLELRKTA
                     YETIYTLVSTLNAERLQSVGMIDELLDQVVLGSGLSDEHDIKVLSCVIIGRLASTCLS
                     KVIAAGRLHQITTRYTTLLGVVVKENAIKQEFEKHNEIVRNIERSSTQINDAISQAIS
                     KGDASNLPSDLELGEWESFYRTKVLKKSV"
     gene            complement(<66204..>66434)
                     /locus_tag="AWJ20_4623"
                     /db_xref="GeneID:30036776"
     mRNA            complement(<66204..>66434)
                     /locus_tag="AWJ20_4623"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881706.1"
                     /db_xref="GeneID:30036776"
     CDS             complement(66204..66434)
                     /locus_tag="AWJ20_4623"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736157.1"
                     /db_xref="GeneID:30036776"
                     /translation="MQASRSYVIQASLDKLQDIDPDLRFMGFSDLNNEITNPDNAGLF
                     SADVQLTRNVINAILSKLEDPITEVQNQAMKW"
     gene            <69670..>71322
                     /locus_tag="AWJ20_4624"
                     /db_xref="GeneID:30036777"
     mRNA            <69670..>71322
                     /locus_tag="AWJ20_4624"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881707.1"
                     /db_xref="GeneID:30036777"
     CDS             69670..71322
                     /locus_tag="AWJ20_4624"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736158.1"
                     /db_xref="GeneID:30036777"
                     /translation="MTVASDVYNLSETYAEEPRPAKCIVIGAGVSGICFTYKAKQIME
                     NFDFVIYEKNPEVGGTWYESRYPGCSCDIPSHSYTYSWTANPNWSRLYVGSEEIFDYF
                     QGLAEKYGVYEKTKFETMVIGAKWLSDRDQWEVEVKDLKTGTVTKDYAEFLMNCGGLL
                     NNWKWPDIPGFHDFKGTKLHSAKWDKSVDVTNKRVAVIGSGSSAIQIVPSIQPSVSHL
                     VSFNRSPNWVTEEFSSELAFNGRETTYDEETRKKWAENREEFLKWRRRVEDTVNRGAE
                     LSLKGSELNEEVTSKARELMEKRLDYDPVLCKALIPEFPVGCKRITPGYLYLESLVEK
                     NVEVVSVGIKHVTENGIVDNNGKLHELDIIVAATGFDTTFTPRFPIIGLDGIDLRDKW
                     TKGPAAAYMSVAVPQLPNYFMTAGPNSPISNGSLIGTFETQIGYAMKLMQKVQKQGIR
                     YMVPKEDATREFNYHKDVAMQRYTYSSNCTSWYKSSKPGAPISGPWPGSSIHFRQIMQ
                     TPRYEDYDYAYQTDNRFQYLGIGRSRREYEGKDLGWYVAFDE"
     gene            <73083..>74557
                     /gene="PGK1"
                     /locus_tag="AWJ20_4625"
                     /db_xref="GeneID:30036778"
     mRNA            join(<73083..73152,73371..>74557)
                     /gene="PGK1"
                     /locus_tag="AWJ20_4625"
                     /product="phosphoglycerate kinase"
                     /transcript_id="XM_018881708.1"
                     /db_xref="GeneID:30036778"
     CDS             join(73083..73152,73371..74557)
                     /gene="PGK1"
                     /locus_tag="AWJ20_4625"
                     /inference="similar to AA sequence:KEGG_Orthology:K00927"
                     /note="3-phosphoglycerate kinase; catalyzes transfer of
                     high-energy phosphoryl groups from the acyl phosphate of
                     1,3-bisphosphoglycerate to ADP to produce ATP; key enzyme
                     in glycolysis and gluconeogenesis; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16962558]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 16622836];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004618 - phosphoglycerate kinase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004618 -
                     phosphoglycerate kinase activity [Evidence IDA] [PMID
                     6254992]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0006094 - gluconeogenesis
                     [Evidence IMP] [PMID 400791]; GO_process: GO:0006096 -
                     glycolytic process [Evidence IEA,IEA,IEA]; GO_process:
                     GO:0006096 - glycolytic process [Evidence IMP] [PMID
                     400791]; GO_process: GO:0016310 - phosphorylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="phosphoglycerate kinase"
                     /protein_id="XP_018736159.1"
                     /db_xref="GeneID:30036778"
                     /translation="MSLSNKLTIKDLDLKGKRVFIRVDVDFNVPLDGKTITNNQRIVA
                     ALPSIKYAKEQGAKAIILASHLGRPNGEVNEKYSLKPVADELSKLLDTKVAFLHDSVG
                     PEVEAYVNKADNGEIILLENVRFHIEEEGSAKKDGQKIKADPAKVKEFREQLTKLADV
                     YVNDAFGTSHRAHSSVVGLEVPQRAAGFLVSKELSFFAKALENPERPFLAILGGAKIS
                     DKIQLIDNLITKVNSLIIGGGMAFTFKKTLDNVEIGESLFDEAGSKVVASLVEKAKAN
                     NVELVFPVDYVTADKFDKDANVGSATDKSGIPSGWQGLDCGPESIKLYEAAISKAKTI
                     LWNGPPGVFEFEKFANGSKQTLNAVVKAAQNGSTVIIGGGDTATVAKKFGAEDKVSHV
                     STGGGASLELLEGKVLPGVAALSDKE"
     gene            <76568..>79138
                     /gene="GYP5"
                     /locus_tag="AWJ20_4626"
                     /db_xref="GeneID:30036779"
     mRNA            <76568..>79138
                     /gene="GYP5"
                     /locus_tag="AWJ20_4626"
                     /product="Gyp5p"
                     /transcript_id="XM_018881709.1"
                     /db_xref="GeneID:30036779"
     CDS             76568..79138
                     /gene="GYP5"
                     /locus_tag="AWJ20_4626"
                     /note="GTPase-activating protein (GAP) for yeast Rab
                     family members; involved in ER to Golgi trafficking;
                     exhibits GAP activity toward Ypt1p that is stimulated by
                     Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p
                     and Rvs167p; involved in recruiting Rvs167p to the bud tip
                     during polarized growth; relocalizes from bud neck to
                     cytoplasm upon DNA replication stress; GYP5 has a paralog,
                     GYL1, that arose from the whole genome duplication;
                     GO_component: GO:0005798 - Golgi-associated vesicle
                     [Evidence IDA] [PMID 15331637]; GO_component: GO:0005933 -
                     cellular bud [Evidence IEA]; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IEA]; GO_component: GO:0005935
                     - cellular bud neck [Evidence IDA] [PMID 15331637];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0005934 - cellular
                     bud tip [Evidence IDA] [PMID 15331637]; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 12189143]; GO_component: GO:0000131 -
                     incipient cellular bud site [Evidence IDA] [PMID
                     15331637]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 15331637]; GO_function: GO:0005096 -
                     GTPase activator activity [Evidence IEA]; GO_function:
                     GO:0005097 - Rab GTPase activator activity [Evidence IEA];
                     GO_function: GO:0005097 - Rab GTPase activator activity
                     [Evidence IGI,IPI,ISS] [PMID 12189143]; GO_function:
                     GO:0005097 - Rab GTPase activator activity [Evidence
                     IGI,IPI] [PMID 15802519]; GO_process: GO:0006888 - ER to
                     Golgi vesicle-mediated transport [Evidence IGI,IPI] [PMID
                     15802519]; GO_process: GO:0006887 - exocytosis [Evidence
                     IEA]; GO_process: GO:0043547 - positive regulation of
                     GTPase activity [Evidence IEA]; GO_process: GO:0032851 -
                     positive regulation of Rab GTPase activity [Evidence IEA];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:0032313 - regulation of Rab GTPase activity
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IGI] [PMID 12189143]"
                     /codon_start=1
                     /product="Gyp5p"
                     /protein_id="XP_018736160.1"
                     /db_xref="GeneID:30036779"
                     /translation="MQHQNLESVSITDSSVDFAKSVIVTKTKEISSVEDDVCSIVDDA
                     SSESTRFDVCSENEKALASETPAVVQFKTQAETESEAEAEAEADSRSDSEFTLNSPSI
                     SVDLYQSEANDEANDDACDKGMKADGSAAVSAVSSARSRSGTMSEVASIASDTRSVAA
                     SFAPSVASASPGAIDWESLTDIEMRMVTESDSLKLIFARRDFLLVQEAEYMSDNEGDE
                     STETMARPDISCEEVREILLQAHSVIDSSSLVPGSQASATSLYPWKDIPMLKIADPSF
                     YDTNELALWSAIISDYRKTSVKVPKYTSMMVYSGIPPALRGRVWKAMANAYSPTLLSL
                     YDSLAAESTHFAKIIARDLNRTFPEISLFREKSGNGQAMLGRVMRAYSAYDIQVGYCQ
                     GLTFLVGPLLLHMNDRDAFCVMVRLMEDYDLRSMFTADMAGVPLRMYQFEYLLADILP
                     ELYEHFQKLGISTIYVSQWFLSMFAVTCPLSMLVRIFDLIFCEGAIPTLMRTSLAIMK
                     RNQAQLLEFDDEEPILELLLGKSLWEVYNLDADLLCSDITSIDAAQVLHGLEVAERGY
                     LSMGKLERARSRKNRGKIFGRGLNLTPKSPNKTPSSASASAQSSPSKLDKKPSRFFKW
                     TSAATETPVINYPVDEEDTTMITATNKRGHKTLSTASTIKRTLSQGSLSSGSTMSSNL
                     DDVFDSSNDDDSDDIDAQSAVVSTLDIKQPKSLSVSHSNPTLTRSPSELQLSQSLEIE
                     RKERQVDKDIFQSLLAQIPSEVIQSNPQLMSLSNELCQRLQISNDALNNTTPNTSCSS
                     CDRLLLDLATARTNEALARQELDLLQDEMAHLKCEYPSVPVPKPQPTIHKSPSKWNLW
                     "
     gene            <80554..>81120
                     /gene="VPS29"
                     /locus_tag="AWJ20_4627"
                     /db_xref="GeneID:30036780"
     mRNA            <80554..>81120
                     /gene="VPS29"
                     /locus_tag="AWJ20_4627"
                     /product="Vps29p"
                     /transcript_id="XM_018881710.1"
                     /db_xref="GeneID:30036780"
     CDS             80554..81120
                     /gene="VPS29"
                     /locus_tag="AWJ20_4627"
                     /inference="similar to AA sequence:KEGG_Orthology:K18467"
                     /note="Subunit of the membrane-associated retromer
                     complex; endosomal protein; essential for
                     endosome-to-Golgi retrograde transport; forms a subcomplex
                     with Vps35p and Vps26p that selects cargo proteins for
                     endosome-to-Golgi retrieval; GO_component: GO:0005768 -
                     endosome [Evidence IPI] [PMID 9700157]; GO_component:
                     GO:0030904 - retromer complex [Evidence IMP,IPI] [PMID
                     9700157]; GO_component: GO:0030906 - retromer complex,
                     inner shell [Evidence IPI] [PMID 9700157]; GO_function:
                     GO:0008565 - protein transporter activity [Evidence
                     IMP,IPI] [PMID 9700157]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0042147 -
                     retrograde transport, endosome to Golgi [Evidence IPI]
                     [PMID 9700157]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Vps29p"
                     /protein_id="XP_018736161.1"
                     /db_xref="GeneID:30036780"
                     /translation="MSPSLPLNKVVTHGQLRIGFVAGHSVIPNSDPDALLITARQLDV
                     DMLIWGGSHRVEAYQLEGKFFISPGSATGAFTTGWPEEDVDDETDAANGADVDNTDDH
                     TTESNGTNSTKPPTSTDNDGQTTTTIDSDNKTGDNDDDADDDEHLDSTTPSFCLLDIQ
                     GSVCVLYIYSLIDGEVKVDKVSYRKDSP"
     gene            complement(<82014..>83429)
                     /gene="SHM2"
                     /locus_tag="AWJ20_4628"
                     /db_xref="GeneID:30036781"
     mRNA            complement(<82014..>83429)
                     /gene="SHM2"
                     /locus_tag="AWJ20_4628"
                     /product="glycine hydroxymethyltransferase SHM2"
                     /transcript_id="XM_018881711.1"
                     /db_xref="GeneID:30036781"
     CDS             complement(82014..83429)
                     /gene="SHM2"
                     /locus_tag="AWJ20_4628"
                     /inference="similar to AA sequence:KEGG_Orthology:K00600"
                     /note="Cytosolic serine hydroxymethyltransferase; converts
                     serine to glycine plus 5,10 methylenetetrahydrofolate;
                     major isoform involved in generating precursors for
                     purine, pyrimidine, amino acid, and lipid biosynthesis;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     12700234]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IMP] [PMID 8132653]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 16622836]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0004372 - glycine
                     hydroxymethyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0004372 - glycine hydroxymethyltransferase
                     activity [Evidence IMP] [PMID 8132653]; GO_function:
                     GO:0004372 - glycine hydroxymethyltransferase activity
                     [Evidence IMP] [PMID 9398220]; GO_function: GO:0030170 -
                     pyridoxal phosphate binding [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0006563 - L-serine metabolic process
                     [Evidence IEA]; GO_process: GO:0006544 - glycine metabolic
                     process [Evidence IEA]; GO_process: GO:0006730 -
                     one-carbon metabolic process [Evidence IEA]; GO_process:
                     GO:0006730 - one-carbon metabolic process [Evidence IMP]
                     [PMID 8132653]; GO_process: GO:0006730 - one-carbon
                     metabolic process [Evidence IGI,IMP] [PMID 9398220];
                     GO_process: GO:0035999 - tetrahydrofolate interconversion
                     [Evidence IEA]"
                     /codon_start=1
                     /product="glycine hydroxymethyltransferase SHM2"
                     /protein_id="XP_018736162.1"
                     /db_xref="GeneID:30036781"
                     /translation="MSSYALSESHRHLLEEHVAEFDPEVAGIMKDEIARQRESIVLIA
                     SENFTSRAVFDALGSPMCNKYSEGYPGARYYGGNQHIDRIETLCQNRALEAFHVTADK
                     WGVNVQTLSGSPANLQVYQAIMKPHERLMGLDLPHGGHLSHGYQTDARKISAVSTYFE
                     TMPYRVDLETGLIDYDMLEKTAVLFRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLV
                     VDMAHISGLIAAQVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRSVNAKTGKEV
                     LYDLEGPINFSVFPGHQGGPHNHTITALAVALKQANTPEFVAYQKQVLKNAKALEEAF
                     KALNYTLVSNGTDSHMVLVSLRDKGIDGARIETVCELINIALNKNSIPGDKSALVPGG
                     VRIGAPAMSTRGLGEEDFKRIVSYIDAAVKYSIDVQSNLPKEANKLKDFKATVAKDED
                     GRLAKLKAEITAWAQEFPLPV"
     gene            complement(<84309..>85184)
                     /locus_tag="AWJ20_4629"
                     /db_xref="GeneID:30036782"
     mRNA            complement(<84309..>85184)
                     /locus_tag="AWJ20_4629"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881712.1"
                     /db_xref="GeneID:30036782"
     CDS             complement(84309..85184)
                     /locus_tag="AWJ20_4629"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736163.1"
                     /db_xref="GeneID:30036782"
                     /translation="MGFSPNRIEAALKNAASDSLEDCIQWLEENEAKFEASEKFHQQL
                     NADTSTAASGDHSGEPAESSADGAAASETEPPKPLTEEEKAAKLELLRQKAAIRKAEQ
                     AKKDLEEQKKNEVIRRKHDQESIRVKEELKKKEAMQAAARRRQEAKEDALAKKRIKDL
                     IEADKRERLEKKQQLSSNPPPSLSSSSSSPSNAPTSSSTTSQPKPKPVYTESKLRFRI
                     QGIASAQPNLMKTFPIDATLGSVAETLATELAIPANSIVLTTTFPTRTLTSADFSLTL
                     KQADLVNASVILKQA"
     gene            <88864..>91776
                     /locus_tag="AWJ20_4630"
                     /db_xref="GeneID:30036784"
     mRNA            <88864..>91776
                     /locus_tag="AWJ20_4630"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881714.1"
                     /db_xref="GeneID:30036784"
     CDS             88864..91776
                     /locus_tag="AWJ20_4630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736164.1"
                     /db_xref="GeneID:30036784"
                     /translation="MVLQNGAANGGVQGAAKVKLEQGPESTRPPVSGVSGRTPVVGGG
                     AVTTINSRHAGSVPGSGSVQSSGGDGGAGVIRSREISGSAAGSGPSSSGPGSGGLRTR
                     GRGGTTVSILNVDPETDGVAPQSFTVVSSLLQETYWGQNKSDEPDIGGPLGNSSGSAG
                     SNGSAGNGTSNGTDSGSAGNGVTIGDVNGNGSANGSASASTHGTGASNSISGSPVVTA
                     IGASTGGSTTHGVLSSNSTPGVSSAMDVDGATNGGGASKAVGGASIGILPDYNFQEYL
                     SYEPTDPPDEHTADTLINSFLAGSQGRFPYIDRNVLQQTHKSRFDPPPNMDCPRYRFA
                     SFTLYTAYAISSVSYTPPPGEHPEYEPFRYYATALHHAKLCKSDNIMWKITALLMCAM
                     FQMRTDKDKGCHYDMVRRAMKICVEVGLHKEVGLENMSKREQEMCRRLFWSVYSMERL
                     FAISTGRPFVMDEKEINIPFPCDMDDIDLLDEAKIIEHEKYRDSGEVRPKTSMTFIIY
                     IWTLRRLESDLVQAIYRVDRSIEERFSHVDFYLNKLKQWKESNRVTTPKEQNITNTAY
                     SRDIRLLLQPFLGRLSPDSDLFQMCVRETGHICQIFRDFYRKKESGFTTMAMHTNFVA
                     GLTLVYCLWLAKDSSILPILENVRSCTAALYVLTERSRLCMNYRDTFENLVSTTMKHI
                     IEHRRQKRQRREMEELEHQRRLEQQELEKQQEIERLHKEEEEHRKMRERIEQERIEMV
                     RQRMRQQQQQQQQQQQQQQQQQQQLQLVKQEPDDLAKSITTSPTPLDDNKHPPLTRIT
                     SALSTGSISSTSSTFPVIDRSPYLPSNNCATGIGGSVNGLPTTTPMPAPIQIAGPAIP
                     DTAASFAQLQTQGAPPPAITPLPGTLAFNGPSGMELQKDWIEAYGYDDTLYNMIQDIS
                     SWTKQVGDATSQAAAVSGAAIVANGTVAATSAETGGWFNDNSTDNAWMNISDFGYS"
     gene            <92091..>93134
                     /gene="STI1"
                     /locus_tag="AWJ20_4631"
                     /db_xref="GeneID:30036785"
     mRNA            <92091..>93134
                     /gene="STI1"
                     /locus_tag="AWJ20_4631"
                     /product="Hsp90 cochaperone STI1"
                     /transcript_id="XM_018881715.1"
                     /db_xref="GeneID:30036785"
     CDS             92091..93134
                     /gene="STI1"
                     /locus_tag="AWJ20_4631"
                     /note="Hsp90 cochaperone; interacts with the Ssa group of
                     the cytosolic Hsp70 chaperones and activates Ssa1p ATPase
                     activity; interacts with Hsp90 chaperones and inhibits
                     their ATPase activity; homolog of mammalian Hop;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IPI] [PMID
                     12525481]; GO_function: GO:0042030 - ATPase inhibitor
                     activity [Evidence IDA] [PMID 21170051]; GO_function:
                     GO:0030544 - Hsp70 protein binding [Evidence IDA] [PMID
                     12716905]; GO_function: GO:0051879 - Hsp90 protein binding
                     [Evidence IDA] [PMID 12525481]; GO_function: GO:0051879 -
                     Hsp90 protein binding [Evidence IDA] [PMID 9927435];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 21124907]; GO_process: GO:0006457 - protein folding
                     [Evidence IGI,IMP] [PMID 8972212]; GO_process: GO:0006950
                     - response to stress [Evidence IEA]"
                     /codon_start=1
                     /product="Hsp90 cochaperone STI1"
                     /protein_id="XP_018736165.1"
                     /db_xref="GeneID:30036785"
                     /translation="MAADAESFKAEGNSYYSQGLNQEAVDSYTKAIGISNSNPVYYSN
                     RAAAYMKLGRWQAALDDCNKGLSFSHDVKLGSKLYWRQGICHRELGSLSLAEESFNEG
                     LRRDPSNSVLREELARLQDILSSAPVAQTDSGLSEIKNNDSTASPINASESETTIPIQ
                     VVDTLPDIFSEPSAKVISHDDSNKTSHLHPLESIPTATDEKRNVQDIASPSASTSAQP
                     ALPLQIPSPLTFYNLMQLMRTPKSQLPQVYDHIFFNVPPSRYAEIHQTGGIDYEVIEF
                     VLDSIAFVATNAQDKNWASRAVDILEGLAHCNRFSMSKMFVSTKRVQEVQRLLAESKL
                     DASTLSRINDLYT"
     gene            <93618..>94421
                     /gene="YIH1"
                     /locus_tag="AWJ20_4632"
                     /db_xref="GeneID:30036786"
     mRNA            <93618..>94421
                     /gene="YIH1"
                     /locus_tag="AWJ20_4632"
                     /product="Yih1p"
                     /transcript_id="XM_018881716.1"
                     /db_xref="GeneID:30036786"
     CDS             93618..94421
                     /gene="YIH1"
                     /locus_tag="AWJ20_4632"
                     /note="Negative regulator of eIF2 kinase Gcn2p; competes
                     with Gcn2p for binding to Gcn1p; may contribute to
                     regulation of translation in response to starvation via
                     regulation of Gcn2p; binds to monomeric actin and to
                     ribosomes and polyribosomes; ortholog of mammalian IMPACT;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005844 - polysome
                     [Evidence IDA] [PMID 22404850]; GO_component: GO:0005840 -
                     ribosome [Evidence IDA] [PMID 22404850]; GO_function:
                     GO:0003779 - actin binding [Evidence IEA]; GO_function:
                     GO:0003785 - actin monomer binding [Evidence IDA] [PMID
                     15126500]; GO_function: GO:0004860 - protein kinase
                     inhibitor activity [Evidence IMP] [PMID 15126500];
                     GO_function: GO:0043022 - ribosome binding [Evidence IDA]
                     [PMID 22404850]; GO_process: GO:0001933 - negative
                     regulation of protein phosphorylation [Evidence IMP] [PMID
                     15126500]; GO_process: GO:0006417 - regulation of
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="Yih1p"
                     /protein_id="XP_018736166.1"
                     /db_xref="GeneID:30036786"
                     /translation="MSNRSMSEIENEVEAINSIYEGCMSEWAPSIYDVHIPDSSVVVR
                     LSFPSVYPEKAPAVMAVVKGRQELSPQLESLISSLFVVGEVIVFDFIESCREFLEQEG
                     EGPDGADSGSYIDSPEASDVANGRDTGVDPTSSWIASEPVTDRKSLFIARVCRVESAQ
                     EAYDNIALLKTDKKISKATHNITAYRIKRSDGVSVQDCDDDGEDAAGGRLMHLLTLTD
                     SWNVVVCVSRWYGGIKLGPDRFKHINSTARDALVKGGFISISKNSSKKH"
     gene            <95708..>98530
                     /gene="PWP2"
                     /locus_tag="AWJ20_4633"
                     /db_xref="GeneID:30036787"
     mRNA            <95708..>98530
                     /gene="PWP2"
                     /locus_tag="AWJ20_4633"
                     /product="Pwp2p"
                     /transcript_id="XM_018881717.1"
                     /db_xref="GeneID:30036787"
     CDS             95708..98530
                     /gene="PWP2"
                     /locus_tag="AWJ20_4633"
                     /inference="similar to AA sequence:KEGG_Orthology:K14558"
                     /note="Conserved 90S pre-ribosomal component; essential
                     for proper endonucleolytic cleavage of the 35 S rRNA
                     precursor at A0, A1, and A2 sites; contains eight
                     WD-repeats; PWP2 deletion leads to defects in cell cycle
                     and bud morphogenesis; GO_component: GO:0030686 - 90S
                     preribosome [Evidence IDA] [PMID 12150911]; GO_component:
                     GO:0030686 - 90S preribosome [Evidence IDA] [PMID
                     15231838]; GO_component: GO:0034388 - Pwp2p-containing
                     subcomplex of 90S preribosome [Evidence IDA] [PMID
                     15231838]; GO_component: GO:0034388 - Pwp2p-containing
                     subcomplex of 90S preribosome [Evidence IDA] [PMID
                     17515605]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 8804409]; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 12068309]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 12150911]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0032040 - small-subunit processome
                     [Evidence IDA] [PMID 12068309]; GO_function: GO:0003729 -
                     mRNA binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0030515 - snoRNA binding [Evidence IPI] [PMID
                     12068309]; GO_process: GO:0007109 - cytokinesis,
                     completion of separation [Evidence IMP] [PMID 8804409];
                     GO_process: GO:0000480 - endonucleolytic cleavage in
                     5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15231838];
                     GO_process: GO:0000480 - endonucleolytic cleavage in
                     5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000480 - endonucleolytic cleavage in
                     5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15590835];
                     GO_process: GO:0000447 - endonucleolytic cleavage in ITS1
                     to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 15231838]; GO_process:
                     GO:0000447 - endonucleolytic cleavage in ITS1 to separate
                     SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic
                     rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 15489292]; GO_process: GO:0000447 -
                     endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
                     5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15590835]; GO_process: GO:0000472 - endonucleolytic
                     cleavage to generate mature 5'-end of SSU-rRNA from
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15231838]; GO_process: GO:0000472 - endonucleolytic
                     cleavage to generate mature 5'-end of SSU-rRNA from
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15489292]; GO_process: GO:0000472 - endonucleolytic
                     cleavage to generate mature 5'-end of SSU-rRNA from
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15590835]; GO_process: GO:0030010 - establishment of cell
                     polarity [Evidence IMP] [PMID 8804409]; GO_process:
                     GO:0000462 - maturation of SSU-rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 12068309]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Pwp2p"
                     /protein_id="XP_018736167.1"
                     /db_xref="GeneID:30036787"
                     /translation="MSLDFKLSNLLGTVYRQGNLLFTPDGTSILSPVGNRVSCFDLVN
                     SSSFTFTYEHRKNISRIALNPQATLMLTVDEDGRGILVNFVRRTTIHHFNFKERVSDI
                     QFSPDGRHFAVAAGRHIQVWKTPNRNDDRQFAPFVRHRIYTGHYADVTSITWSNDSRF
                     FLTCSKDLTARVYSLIATDSSAATILAGHKDSVISAFFSQDQETIYTVSKDGALFEWK
                     YISKPKRLGGSTQSKEEAEDEEQDEETDLDANGNPIEYKFRWRIVNKHFFMQDNAKVR
                     CAAFHAPTNLLVVGFSTGIFGLYELPEFTNLQILNISQNDIDFVTINKTGEWLAFGAS
                     KLGQLLVWEWQSESYIIKQQGHYDAMNSLVYSPDGSKIVTASDDGKIKVWDAISGFAI
                     VTFTEHTSAVTSLQFSKKGSVLFSASLDGSIRAWDLIRYRNFRTFTSPHRIQFTSLAI
                     DPSGEVVCAGSLDDFDIHLWSVQTSQLLDRLSGHQGPVSSLCFGNEGGLLVSGSWDKT
                     VRIWSIFGRTSNVEPLQLQSEVMSVAMRPDSKRVAVATTDGQLSFWDPELGKQVGNID
                     GREDIAGGRHLTDRFSAANSQRSKHFTTLCYSADGSSILAGGNSKYIALYDVANEVLL
                     TRFTISRNMAIDGTVDQLNSKNMTESGPLGLIDTSGEASDLEDRIDNTLPGATRGDAS
                     VRKVRPAIRTTSIQFSPTGRSFAAASTEGLLLYSVDELLIFDPFDLDIDVTVDTTLEK
                     LAEKDYLIALVMAFRLGERSIIHQVYESIPFQDIELISRDLPQVYLERLLRFISSISE
                     ESPHIEFNLLWIQHLITYHGRFMVQRRHEFASAMRGLQKFVSRIGKDIIKLSRTNIYL
                     IRYLTGGVATIDSSLLEGMDVDSDEQENREVVPTNSMGVEHEEDEDEDEEDGWFGPES
                     RTEGINGKSATSGSDDEGVSEAEEDE"
     gene            <99978..>101096
                     /gene="CTR86"
                     /locus_tag="AWJ20_4634"
                     /db_xref="GeneID:30036788"
     mRNA            <99978..>101096
                     /gene="CTR86"
                     /locus_tag="AWJ20_4634"
                     /product="Ctr86p"
                     /transcript_id="XM_018881718.1"
                     /db_xref="GeneID:30036788"
     CDS             99978..101096
                     /gene="CTR86"
                     /locus_tag="AWJ20_4634"
                     /inference="similar to AA sequence:KEGG_Orthology:K19323"
                     /note="Essential hypothetical protein; with orthologs in
                     Ashbya gossypii and Candida albicans; similar to human
                     ATXN10, mutations in which cause spinocerebellar ataxia
                     type 10; codon usage corresponds to that observed for
                     yeast genes expressed at low levels; relative distribution
                     to the nucleus increases upon DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22842922]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0008652 -
                     cellular amino acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0009088 - threonine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Ctr86p"
                     /protein_id="XP_018736168.1"
                     /db_xref="GeneID:30036788"
                     /translation="MCNEMTTSLKTEVLESPLEIVLKGSNTKFITAFKELLLHPVYSR
                     PTLQFIESSVKLAPNRARVLAESEHGRLIFIQLLKQTESWYSGEDNFYLHLLNSIISQ
                     LLSADLGNLFLSTFSEPIVNEDERLSLLKIVDAAIDSLLERKSTTLDCQPLLEILFRD
                     FTTASAQAIPFIRSADTSPEYSDSLLSQLTNIWNRLIVLLDIYQTILDNQPSLKPEIL
                     KDNIIEELVSLLGEAQKSLPRRSKLADLEKSASKSSSGNVSDHDDLDPKDFPLIKGKI
                     IYLLGTLVQENKQVQDLVRQLQGLELVLTNCIIDLNNPFIRERSILCLRYLLANNPEN
                     QDFVAKMEAKETVSEDALHEAGYETELVNGKLALKKRT"
     gene            complement(<101252..>103252)
                     /locus_tag="AWJ20_4635"
                     /db_xref="GeneID:30036789"
     mRNA            complement(<101252..>103252)
                     /locus_tag="AWJ20_4635"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881719.1"
                     /db_xref="GeneID:30036789"
     CDS             complement(101252..103252)
                     /locus_tag="AWJ20_4635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736169.1"
                     /db_xref="GeneID:30036789"
                     /translation="MSSSRTSRARHGRKRRLGNSQPSAGLRFTRISCAVIWCLLAGAP
                     IFGFSAFKQVLVANGVYREFCTPQEVEWWSEKGSHGPLLCTEQDYRLNSMFAYALAIS
                     GLLVLPVSAILDVYGPRVCGILASILLTFASLSLRAGTSITVGPYLDGYILGYILLGC
                     ASPPLFMSSLQLSTSFPKYGGSILVLLTAAMDGSSAVFLAFKLADRNGYIGSISQFFT
                     WYLFVPAFVFISQFVIMPSRGFKTVAELQRIIEVSSPFTLAGKSRGDEENNADDDGYS
                     YKWYRQQNNGHNGSRGDSTGAGNSYSFPEIASSQNEDSTPGEIDFTGAYRDNIDGNRA
                     TSGINVSSTVPRSESLSPNTSTINDGDDAEGENSPLLQHGDSSETFDDNDEYNNILAD
                     EEEAVANLNLVKDVTEVSGVWGALHNARVSQQLTSMWFILIILFSAVTTLHINYFIAS
                     IWKSYNYRLDGDTTSGSREVKLILDYFDFALPIGSILSVPFIGFILDNMSTLRAFTII
                     YVLAISIGFLQLVSGSVVAGCLGITLFVPYRSLLFTAIPDYTVNIFGFHTFGLVYGLI
                     LAVSGLANLLILQFNSGPLKMHHRLADPNSTNELLLGLTALVGLVLIMYIWLQGKKIR
                     RKQLEDEAESAPIQQMPEARITTNHDCRSGTCDDCVCEANVN"
     gene            complement(<104652..>106517)
                     /locus_tag="AWJ20_4636"
                     /db_xref="GeneID:30036790"
     mRNA            complement(<104652..>106517)
                     /locus_tag="AWJ20_4636"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881720.1"
                     /db_xref="GeneID:30036790"
     CDS             complement(104652..106517)
                     /locus_tag="AWJ20_4636"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736170.1"
                     /db_xref="GeneID:30036790"
                     /translation="MTGDSSSDVLDVVNQLRAKENDLTFVASTVVPVFMSSRQRFEKL
                     QPEIIEAIVNTPVSTYTVPWIFALWAVLENESLSWRFVQLFRQFMTSFRADHARLAGF
                     ALAELLERIDSTGSSEYISPPYAIGIATGLRRGVGKLNHEVRGESDQRPLELSRLHSS
                     LAYWSVISKRYIFAKDMLAPTNRYVRPAKDYPISQIDVLFFHYYSSIVLIAEKRYFQA
                     AQYLTVVLNVPTVDERISSDLNRIQCDLRIASYAKWVCISLLHSGHVPSLSNLISDEL
                     VQSIRKHCEEYDTLSTLLRGNFHDKNMATSLEAIQEYINTQSDKFANDDNLDLVQLCF
                     EKYKRDYVRTLQTKVSSSMSIDYLDSRMGPLNPSQKQQHKGKLTLNTRTDSNCDHSNE
                     SHDNDNSDTGANNVSNSINESVYDYVNNLILSGQTDGEYKLLDAADKPPHLISTEPTS
                     KALSHMNQHMLQMIDSIINTAQDLDATMYDLVASGKFRSLLSKLSSKRPHLASVYAEF
                     NEESLGDGYGGLPSQFGLAARGSGQINIPGLEAAMFGRRRPDSMNQIQISSGTGRRRG
                     PGTIKSSARRRQAAPRMRQGSNHRSRHESTGSASSSEDAYDPMERDSENDDSTES"
     gene            <108419..>109786
                     /gene="PRO2"
                     /locus_tag="AWJ20_4637"
                     /db_xref="GeneID:30036791"
     mRNA            <108419..>109786
                     /gene="PRO2"
                     /locus_tag="AWJ20_4637"
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /transcript_id="XM_018881721.1"
                     /db_xref="GeneID:30036791"
     CDS             108419..109786
                     /gene="PRO2"
                     /locus_tag="AWJ20_4637"
                     /inference="similar to AA sequence:KEGG_Orthology:K00147"
                     /note="Gamma-glutamyl phosphate reductase; catalyzes the
                     second step in proline biosynthesis; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0050661 - NADP
                     binding [Evidence IEA]; GO_function: GO:0004350 -
                     glutamate-5-semialdehyde dehydrogenase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004350 -
                     glutamate-5-semialdehyde dehydrogenase activity [Evidence
                     IDA] [PMID 12513997]; GO_function: GO:0004350 -
                     glutamate-5-semialdehyde dehydrogenase activity [Evidence
                     IGI] [PMID 2824433]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016620 - oxidoreductase activity, acting on the
                     aldehyde or oxo group of donors, NAD or NADP as acceptor
                     [Evidence IEA]; GO_process: GO:0055129 - L-proline
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008652 - cellular amino acid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006561 - proline biosynthetic process
                     [Evidence IEA,IEA]; GO_process: GO:0006561 - proline
                     biosynthetic process [Evidence TAS] [PMID 11084050];
                     GO_process: GO:0006561 - proline biosynthetic process
                     [Evidence IDA] [PMID 12513997]"
                     /codon_start=1
                     /product="glutamate-5-semialdehyde dehydrogenase"
                     /protein_id="XP_018736171.1"
                     /db_xref="GeneID:30036791"
                     /translation="MAENLAKSARKASNILKTLSNDKRTSALKVIHDSLRDSKDEIIE
                     ANKLDLKLAEEADLPDSLIRRLDLAKGDKYDSMLQGILDVAALEDPVGRISLSRHLDD
                     GLDLYRVSCPVGVLLVIFEARPEVIANITALAIKSGNAAILKGGKESLHTFSAMATAV
                     KKALAKTSIPPDAIHLVSTREQVGELLHQDKYIDLVIPRGSNELVRQIKASTRIAVLG
                     HADGICSIYVHDDADGEMAGKIIVDSKVNYPAGCNAVETVLINKNLLSTSNPAGQAKV
                     TSIIEQLVDAKVKVKIAPEIEAFLTSGDNSSPSTIAIPCPQIEPATEADFDREFLSLT
                     IAIKSITDIDEAIAHINEHGSHHTDAIITASKDKAEKFLKGVDSAGVFWNASTRFADG
                     FRFGFGTEVGVSTNKLHARGPVGLEGLMSYQYQIKGSGQIVGDYAGSGGSKRYLHQDF
                     TVDNN"
     gene            complement(<109973..>112303)
                     /gene="DRS2"
                     /locus_tag="AWJ20_4638"
                     /db_xref="GeneID:30036792"
     mRNA            complement(<109973..>112303)
                     /gene="DRS2"
                     /locus_tag="AWJ20_4638"
                     /product="aminophospholipid-translocating P4-type ATPase
                     DRS2"
                     /transcript_id="XM_018881722.1"
                     /db_xref="GeneID:30036792"
     CDS             complement(109973..112303)
                     /gene="DRS2"
                     /locus_tag="AWJ20_4638"
                     /inference="similar to AA sequence:KEGG_Orthology:K14802"
                     /note="Trans-golgi network aminophospholipid translocase
                     (flippase); maintains membrane lipid asymmetry in
                     post-Golgi secretory vesicles; contributes to
                     clathrin-coated vesicle formation and endocytosis; subject
                     to auto-inhibition by its C-terminal tail; mutations in
                     human homolog ATP8B1 result in liver disease;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005802 - trans-Golgi network
                     [Evidence IDA] [PMID 10601336]; GO_component: GO:0005802 -
                     trans-Golgi network [Evidence IDA] [PMID 12221123];
                     GO_component: GO:0005802 - trans-Golgi network [Evidence
                     IDA] [PMID 15090616]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0019829 -
                     cation-transporting ATPase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0000287 - magnesium ion binding
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0004012 - phospholipid-translocating ATPase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IGI]
                     [PMID 15090616]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IMP]
                     [PMID 15249668]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence
                     IGI,IMP] [PMID 16452632]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IMP]
                     [PMID 8633245]; GO_process: GO:0006812 - cation transport
                     [Evidence IEA]; GO_process: GO:0032456 - endocytic
                     recycling [Evidence IMP] [PMID 24272750]; GO_process:
                     GO:0006897 - endocytosis [Evidence IGI] [PMID 12631737];
                     GO_process: GO:0006897 - endocytosis [Evidence IGI] [PMID
                     16195350]; GO_process: GO:0006886 - intracellular protein
                     transport [Evidence IGI] [PMID 12221123]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0045332 - phospholipid translocation [Evidence IMP]
                     [PMID 15249668]; GO_process: GO:0045332 - phospholipid
                     translocation [Evidence IMP] [PMID 16452632]; GO_process:
                     GO:0015914 - phospholipid transport [Evidence IEA];
                     GO_process: GO:0006892 - post-Golgi vesicle-mediated
                     transport [Evidence IGI,IMP] [PMID 10601336]; GO_process:
                     GO:0000028 - ribosomal small subunit assembly [Evidence
                     IMP] [PMID 8247005]"
                     /codon_start=1
                     /product="aminophospholipid-translocating P4-type ATPase
                     DRS2"
                     /protein_id="XP_018736172.1"
                     /db_xref="GeneID:30036792"
                     /translation="MYYKDTDTPAVCRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS
                     CSIAGRSYASEIPEDRKLTVVDGVEVGFRSFDAMIEDMDEPELGQVVQEFFTLLASCH
                     TVIPELKDNGKIKYQAASPDEGALVEGAASVGFKFTIRRPKFITVDIRGQDYEYELLN
                     ICEFNSTRKRMSTIFRCPDGKIRLYCKGADTVILERLAPENPFVTDTMAHLEEFAGEG
                     LRTLCLAMRVVPDDEYQEWARIFDEAATSMDNRAQKLDDAAELIERDLFLLGATAIED
                     KLQEGVPETIHTLQDAGIKIWVLTGDRQETAINIGMSCKLLSEDMNLLIINEENYEAV
                     RDNIAKKVAAIRGNQVSSAEYDTLALVIDGKSLGFALEPSLEKDFLDLAVICKAVICC
                     RVSPLQKALVVKLVKRHMKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADV
                     SIGQFKYLRKLLLVHGSWSYHRLSRAILYSFYKNIALYMTQFWYVFANGFSGQSIYES
                     WTITFYNVLCTVLPPFILGIFDQFISARLLDRYPQLYQLGQRSAFLNVRHFWEWVLNG
                     FYHSIILYIGSVYAYRYGQVLSNGLIADHWTWGTALFTACVLTTLAKAALVTNMWNKY
                     TVIAIPGSFFIWLGFFPAYATIAPLVNVSDEYRGVLPHLYPTLVFWATILILPCLCLI
                     RDFAWKYYKRMYKPESYHHVQEIQKYNIADYRPRMEQFQKAIRKVRQVQRMRKQRGFA
                     FSQADEGAGQATRVVRAYDTTQSRGQYGEMKPARQQ"
     gene            complement(<112477..>114270)
                     /gene="DRS2"
                     /locus_tag="AWJ20_4639"
                     /db_xref="GeneID:30036793"
     mRNA            complement(<112477..>114270)
                     /gene="DRS2"
                     /locus_tag="AWJ20_4639"
                     /product="aminophospholipid-translocating P4-type ATPase
                     DRS2"
                     /transcript_id="XM_018881723.1"
                     /db_xref="GeneID:30036793"
     CDS             complement(112477..114270)
                     /gene="DRS2"
                     /locus_tag="AWJ20_4639"
                     /inference="similar to AA sequence:KEGG_Orthology:K14802"
                     /note="Trans-golgi network aminophospholipid translocase
                     (flippase); maintains membrane lipid asymmetry in
                     post-Golgi secretory vesicles; contributes to
                     clathrin-coated vesicle formation and endocytosis; subject
                     to auto-inhibition by its C-terminal tail; mutations in
                     human homolog ATP8B1 result in liver disease;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005802 - trans-Golgi network
                     [Evidence IDA] [PMID 10601336]; GO_component: GO:0005802 -
                     trans-Golgi network [Evidence IDA] [PMID 12221123];
                     GO_component: GO:0005802 - trans-Golgi network [Evidence
                     IDA] [PMID 15090616]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0019829 -
                     cation-transporting ATPase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0000287 - magnesium ion binding
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_function:
                     GO:0004012 - phospholipid-translocating ATPase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IGI]
                     [PMID 15090616]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IMP]
                     [PMID 15249668]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence
                     IGI,IMP] [PMID 16452632]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IMP]
                     [PMID 8633245]; GO_process: GO:0006812 - cation transport
                     [Evidence IEA]; GO_process: GO:0032456 - endocytic
                     recycling [Evidence IMP] [PMID 24272750]; GO_process:
                     GO:0006897 - endocytosis [Evidence IGI] [PMID 12631737];
                     GO_process: GO:0006897 - endocytosis [Evidence IGI] [PMID
                     16195350]; GO_process: GO:0006886 - intracellular protein
                     transport [Evidence IGI] [PMID 12221123]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0045332 - phospholipid translocation [Evidence IMP]
                     [PMID 15249668]; GO_process: GO:0045332 - phospholipid
                     translocation [Evidence IMP] [PMID 16452632]; GO_process:
                     GO:0015914 - phospholipid transport [Evidence IEA];
                     GO_process: GO:0006892 - post-Golgi vesicle-mediated
                     transport [Evidence IGI,IMP] [PMID 10601336]; GO_process:
                     GO:0000028 - ribosomal small subunit assembly [Evidence
                     IMP] [PMID 8247005]"
                     /codon_start=1
                     /product="aminophospholipid-translocating P4-type ATPase
                     DRS2"
                     /protein_id="XP_018736173.1"
                     /db_xref="GeneID:30036793"
                     /translation="MANYHGRGQAGNIPDEFSLIDHPSVPDPEPENPFDSRNASTTQI
                     GHTSTSAPLAGHDEDLDLFNGDSYHTNTTGNGGTRNGISASNGGIQQTSSNPGDWDYL
                     TPVDSSPYYDSPYNNASNPYLDGTGIVSGHDQDDFIMDSGSGIGSGSGRHDTIGLTHQ
                     ATGKHYGAKGGISGFYSNVRSKLGLNPAYTEMDLPLTEHATAGGAGRGGSGAATGIGS
                     GSRVGFSGGAGGSGSGGRGANEDRTETANDYDIRKFYYKLLGKKMPDASSLGPRIVTL
                     NDPAANQLGYKGNHISTTKYNAFTFIPKFLFEQFSKYANLFFLCTALIQQVPNVTPTN
                     RYTTIGTLAVVLLVSAFKELVEDVKRSNADKELNNSKVEVLNTNGEFETRRWVKLSVG
                     DIVRIKSEEPFPADILLLASSEPEGLCYIETANLDGETNLKIKQSRVETSTLVSTQDL
                     SRLRGRILSEQPNSSLYTYEATLELTGQDKMALAPDQLLLRGATLRNTPWIHGVVVFT
                     GHETKLMRNATAAPIKRTAVEHMINLQIIFLFSILLILAIVSSMGNVIKIKVTASTMW
                     YLQLEGTSLVKQFFQDLLTYWVLFSNLVPIR"
     gene            <121028..>122083
                     /gene="MNN10"
                     /locus_tag="AWJ20_4640"
                     /db_xref="GeneID:30036795"
     mRNA            <121028..>122083
                     /gene="MNN10"
                     /locus_tag="AWJ20_4640"
                     /product="Mnn10p"
                     /transcript_id="XM_018881725.1"
                     /db_xref="GeneID:30036795"
     CDS             121028..122083
                     /gene="MNN10"
                     /locus_tag="AWJ20_4640"
                     /inference="similar to AA sequence:KEGG_Orthology:K05531"
                     /note="Subunit of a Golgi mannosyltransferase complex;
                     complex mediates elongation of the polysaccharide mannan
                     backbone; membrane protein of the mannosyltransferase
                     family; other members of the complex are Anp1p, Mnn9p,
                     Mnn11p, and Hoc1p; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence IEA,IEA]; GO_component: GO:0000136 -
                     alpha-1,6-mannosyltransferase complex [Evidence IDA] [PMID
                     10037752]; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0000009 -
                     alpha-1,6-mannosyltransferase activity [Evidence IDA]
                     [PMID 10037752]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016757 -
                     transferase activity, transferring glycosyl groups
                     [Evidence IEA]; GO_function: GO:0016758 - transferase
                     activity, transferring hexosyl groups [Evidence IEA];
                     GO_process: GO:0000917 - barrier septum assembly [Evidence
                     IMP] [PMID 16034811]; GO_process: GO:0000032 - cell wall
                     mannoprotein biosynthetic process [Evidence IMP] [PMID
                     10037752]; GO_process: GO:0006487 - protein N-linked
                     glycosylation [Evidence IMP] [PMID 23210626]; GO_process:
                     GO:0006487 - protein N-linked glycosylation [Evidence IMP]
                     [PMID 8991513]"
                     /codon_start=1
                     /product="Mnn10p"
                     /protein_id="XP_018736174.1"
                     /db_xref="GeneID:30036795"
                     /translation="MFKSEKGWKSRRPSSTSFWNFSGSSPMSPASSHNRVAAPAYRPL
                     LNFLLRRKILIVIFIFILLLSLFTAVPFLPHFSFGSANYVIILAANEGGGVMQWKGAR
                     EWSVERSSIANKKQYAERHGYNLAIKDVSAKKRYAHEWRESWEKVDIIKETMRQFPNA
                     EWFWWLDLHTYIMEPQISLDSHIFRNLYNETYRDASYFNPLSIPIEIPYVDYNQPIDL
                     VISQDCGGFNLGSFFIRRSEWTEKLLDIWWDPVFYEQKHMDWEHKEQDALETLYRNQA
                     WIRGRVGFIPLRKMNSFPPGACSDMADDSRLFYNEKERDFVVNMAGCEWGRDCWGEME
                     HYKALSKKLHQKKFWFF"
     gene            complement(<123523..>124443)
                     /gene="ENV9"
                     /locus_tag="AWJ20_4641"
                     /db_xref="GeneID:30036796"
     mRNA            complement(<123523..>124443)
                     /gene="ENV9"
                     /locus_tag="AWJ20_4641"
                     /product="Env9p"
                     /transcript_id="XM_018881726.1"
                     /db_xref="GeneID:30036796"
     CDS             complement(123523..124443)
                     /gene="ENV9"
                     /locus_tag="AWJ20_4641"
                     /note="Protein proposed to be involved in vacuolar
                     functions; mutant shows defect in CPY processing and
                     defects in vacuolar morphology; has similarity to
                     oxidoreductases, found in lipid particles; required for
                     replication of Brome mosaic virus in S. cerevisiae, a
                     model system for studying replication of positive-strand
                     RNA viruses in their natural hosts; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0005811 - lipid particle [Evidence
                     IEA,IEA]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence ISS] [PMID
                     8972580]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0006624 - vacuolar protein processing [Evidence IMP]
                     [PMID 21912603]; GO_process: GO:0007033 - vacuole
                     organization [Evidence IMP] [PMID 21912603]"
                     /codon_start=1
                     /product="Env9p"
                     /protein_id="XP_018736175.1"
                     /db_xref="GeneID:30036796"
                     /translation="MVFFGPCWSVDSLPDFSGKSVFITGGNTGIGKHTVTELARKNMG
                     KIYLAGRNPTRCEAAIAEIKKEVPNANIEYVKLDVSKLDDVKQVAEKFVNEHTSLNYL
                     VNNAGIMATPYELNNDGYEMQFATNYMGHALLTRIMLPLLEKTAKDGDEVKIINVSSF
                     AHNFAPRVGINFEDVNLTKGSVWDRYGQSKLANILLNNELTKRYPQIKSYSLHPGFVR
                     TDLYDGMNSTYGILGRIANAVTKPFYITPYNGAITTLYCFSVEANDKAGEYLVPYGKV
                     GSLTRNAKNQELSSKLWDWTTNELTNKHYI"
     gene            <126168..>130211
                     /gene="SWI1"
                     /locus_tag="AWJ20_4642"
                     /db_xref="GeneID:30036797"
     mRNA            <126168..>130211
                     /gene="SWI1"
                     /locus_tag="AWJ20_4642"
                     /product="Swi1p"
                     /transcript_id="XM_018881727.1"
                     /db_xref="GeneID:30036797"
     CDS             126168..130211
                     /gene="SWI1"
                     /locus_tag="AWJ20_4642"
                     /inference="similar to AA sequence:KEGG_Orthology:K11771"
                     /note="Subunit of the SWI/SNF chromatin remodeling
                     complex; regulates transcription by remodeling chromatin;
                     required for transcription of many genes, including ADH1,
                     ADH2, GAL1, HO, INO1 and SUC2; can form the prion [SWI+];
                     human homolog ARID1A is a candidate tumor suppressor gene
                     in breast cancer; GO_component: GO:0016514 - SWI/SNF
                     complex [Evidence IDA] [PMID 18644858]; GO_component:
                     GO:0016514 - SWI/SNF complex [Evidence IDA] [PMID
                     8016655]; GO_component: GO:0016514 - SWI/SNF complex
                     [Evidence IDA] [PMID 8127913]; GO_component: GO:0016514 -
                     SWI/SNF complex [Evidence IDA,IMP] [PMID 8159677];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     3143101]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA,IEA]; GO_function: GO:0015616 - DNA translocase
                     activity [Evidence IDA] [PMID 17188033]; GO_function:
                     GO:0001102 - RNA polymerase II activating transcription
                     factor binding [Evidence IPI] [PMID 11865042];
                     GO_function: GO:0001102 - RNA polymerase II activating
                     transcription factor binding [Evidence IMP,IPI] [PMID
                     14580348]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_process: GO:0043044 - ATP-dependent
                     chromatin remodeling [Evidence IDA] [PMID 8016655];
                     GO_process: GO:0006261 - DNA-dependent DNA replication
                     [Evidence IMP] [PMID 10198436]; GO_process: GO:0000436 -
                     carbon catabolite activation of transcription from RNA
                     polymerase II promoter [Evidence IGI] [PMID 14580348];
                     GO_process: GO:0044109 - cellular alcohol catabolic
                     process [Evidence IMP] [PMID 1339306]; GO_process:
                     GO:0031496 - positive regulation of mating type switching
                     [Evidence IMP] [PMID 6436497]; GO_process: GO:0045944 -
                     positive regulation of transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 1339306]; GO_process:
                     GO:0045944 - positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 3542227];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 8016655]; GO_process: GO:0061412 - positive
                     regulation of transcription from RNA polymerase II
                     promoter in response to amino acid starvation [Evidence
                     IMP] [PMID 10549298]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0005987 - sucrose catabolic process
                     [Evidence IMP] [PMID 1339306]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Swi1p"
                     /protein_id="XP_018736176.1"
                     /db_xref="GeneID:30036797"
                     /translation="MDPSSPATDVLQSQQGTIQPSALYSPSLFSNMSPQMENASPALS
                     NSGANSGGNPTNANNSNISMNSPFMGGISQGRSHSDAASVSPHQRPTPLPAQLLQEVH
                     SGSNSPMIGQQQGFQGQSQQQQQQANQMQNAGGRLSTGTQPDNGLGSDISQQFNGGND
                     LGLMYQQQMLGQQQQQTNQNQNQNRMFPNQNQASNQNQNQGLNQNQNSNQNLPLNFNP
                     NQGQNQNQHGPGSGPNQMPGQVPGQIPPGQVPGQGGLGNQGFLSTLTPAQLQPIRNQL
                     RLLSPQNQEEFIRRLGMLPPQNLIQAIQQLASQQQKMAAAQNSRNQAQARNQMNQRQP
                     NQQLNQLNNQQNQPNVPPGQQNQFQFVMQQNRQKSPQVNVNQPSQIPPNQKYPAGGPS
                     GPMGPNNSGTSGPGGLNMSSAAASTMSKADQFVKSLFEFMQRRGTPINSFPTVGESRV
                     HPFALYATVMKFGGSAKVTRAQQWPNVTQALGYMPSMSEEVSRIYNNILRPFEEFLLT
                     SQLRNKGLKANLPGQAGQVPMGQVPSPSPAQGPIKGPGMVPGQVAGPGSNQDSNQGPN
                     VPQTPFGQQAQPSPQVPQSQMPMSMIPMQMGQTPQTQIQQQQPPSGLRQSATPQPQTK
                     ARQTSQSRGKQTASPIPVHMPGPMQSPAVGGSPEVQAKLTPRRTPSSRKSSTASSPAL
                     VPVPALPAASPTPIIKPKHFVPHENRKYAPKKRLVEKHGGYDIRVLAGIGREIENIRS
                     DFPFTHELGTFDVHAITMAVNSTIAGEVRQALDKLMVITADPRCYFSLVESPGLLTGL
                     AECGLVITKGLASSKPDGKALATTKHYDVNDSLFGEGVKSNIDAVFESYKSKLGKEDV
                     DLVIDVDTLTGVEVGRVEDDKPTEKIQEDDISVHKKAEGQESKDTINEKASEQDGLKP
                     FGFTNYLTLLKKTSSENEELEFDYKTPEIDQFWVTASVDRLLSITTILRNLSFVDQNR
                     SILINEPTSREFLFGLLYSLAENANLLPNSKQTLDLMKDLVTIFSNLAPVLILDSAKD
                     ALVLLLFILAFTPTPIPLTTSKDGIVFGRYTPVVHRYLPYAVDILAKVLPRDPPNRDL
                     FESIFLGTCTNFEYLQLLQRYFNGRPADPYELMTCAFGLVISTVPHDDLSVIPRGLEL
                     ARPLLHQSLLVAEMLAEMIKFEKPTRSNTNGTVDADEDNDIEMSESDKSFGKEKEQNN
                     LSDFLKEFKEKKANYNLAYEWLSASDGFGHALLRAACALGAVVGNGRARDEERNPFAR
                     ITQRSITVLRILGKKAMEYDSQDGALTGSEKAIVQLPSGVLPTIEALLGAMLASEMDK
                     YVVGQICRFCDEGNEHLIKASSSLERP"
     gene            complement(<130280..>133468)
                     /gene="RAD1"
                     /locus_tag="AWJ20_4643"
                     /db_xref="GeneID:30036798"
     mRNA            complement(<130280..>133468)
                     /gene="RAD1"
                     /locus_tag="AWJ20_4643"
                     /product="ssDNA endodeoxyribonuclease RAD1"
                     /transcript_id="XM_018881728.1"
                     /db_xref="GeneID:30036798"
     CDS             complement(130280..133468)
                     /gene="RAD1"
                     /locus_tag="AWJ20_4643"
                     /inference="similar to AA sequence:KEGG_Orthology:K10848"
                     /codon_start=1
                     /product="ssDNA endodeoxyribonuclease RAD1"
                     /protein_id="XP_018736177.1"
                     /db_xref="GeneID:30036798"
                     /translation="MSEFEEDDENDLFVRQENDFYQSQSLIEAVENERNGTTVEGYTY
                     DGTNLSQAETPSHESKGPTNGLKTTTTTSGNHIITLHETEHESATLRDDIYNSEELFK
                     SVVLSTPLSFQKTIIRDMLADDALLVLGRGLGLHLIAANILHALDVAGTTTAKSIADE
                     STIENGTRQSRSSLVLLIGTNDIENSRISQELWQLSQLADPLTSCHRGLTIVSNETTT
                     LNQREKLYKRGGIFSVRYQALVVDMLSGAIDCSKVTGIVAFDSDRRVDKHYLEWVIRL
                     YRSKNTRGFIKALTENPEGFGTSGTLQPLAAKLKNLSIKRVLLWPRYHIEVTDSLLQT
                     GRGRKRNEIIEIQVEKSEAVRRIQTAIMDSIESCISRIKRTTASIKVISTEEWNLDNA
                     LSMKLSRQVRFELRPYWHLLSYDARHAVGDLAVLEQLLDDVLSLDSVAFLQRLIEISK
                     SATKSTRDVSQWLLEDAGSMLFQLAKERVYGKKSKDSTRPAIIEELPKWYHLMNILEE
                     ISAEKSNSNPDETGGPVLIMCKEKRTVTQLKAYIDTVGKAKNEPQNDNESIPPGQIYM
                     KERLQFYIDLNKMLLQKRRSCAPRGENLTGVASTGESATNTGNDSTSSNRAPFSRNKR
                     RRVRGGSVVASAAGRSVSPSLSLPEFEETIAEDTPIDADGLDDDIMRLISQDHVEEDK
                     DILHISEVFSRLQVMDSGQLVVIQQYDRFNDDSMLAELRPSYIIMYEPDTSFFRRIEV
                     TRASNPDRQIKAYFMFHKESVEEQRFLSEIRREKDAFTRLIREKANMAIHLETEKDTA
                     ARLTNNSTLLRNFSTRIAGGGQLGFNTNKPRVVVDVRELKAPLPAVLDFNNVEVVPMT
                     LTVGDYILSPEICVERKSITDFIQSMKSGRLHEQCTAMCRYYEFPAVLIEFDDLDSFS
                     FNSVGNSGPQPRSMGTADIDRFLSENDSLRTQISLLILQHPKLSLLWSPSPNDSAEIF
                     ARLKNERDEPDPALCARIGVSGGGNSIDYNIAAIDTLLAMPGITTNNYALITRKVPNI
                     RTLCSMSEEDISAIIGKEAAAKLYRFFNETVQ"
     gene            <134318..>136012
                     /gene="PEX29"
                     /locus_tag="AWJ20_4644"
                     /db_xref="GeneID:30036799"
     mRNA            <134318..>136012
                     /gene="PEX29"
                     /locus_tag="AWJ20_4644"
                     /product="Pex29p"
                     /transcript_id="XM_018881729.1"
                     /db_xref="GeneID:30036799"
     CDS             134318..136012
                     /gene="PEX29"
                     /locus_tag="AWJ20_4644"
                     /note="Peroxisomal integral membrane peroxin; involved in
                     the regulation of peroxisomal size, number and
                     distribution; genetic interactions suggest that Pex28p and
                     Pex29p act at steps upstream of those mediated by Pex30p,
                     Pex31p, and Pex32p; forms ER foci upon DNA replication
                     stress; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005778 - peroxisomal membrane
                     [Evidence IEA]; GO_component: GO:0005778 - peroxisomal
                     membrane [Evidence IDA] [PMID 12707309]; GO_component:
                     GO:0005777 - peroxisome [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0007031 - peroxisome organization [Evidence IEA];
                     GO_process: GO:0007031 - peroxisome organization [Evidence
                     IDA,IGI,IMP] [PMID 12707309]"
                     /codon_start=1
                     /product="Pex29p"
                     /protein_id="XP_018736178.1"
                     /db_xref="GeneID:30036799"
                     /translation="MVSNSQDEKPLSDTLSSLWNNFINTSPNSSQSARDDESLFKSDS
                     DTQANAENTDIGIDMVKPEVQDDGSIGIVPATRNLGTASAVVSPVIAKTGSTEGTLLT
                     RKGDPIESLRSLPITNNEKSNSSERPRSSLLSMASASTSNWLNPIKPEKVLEMLFESW
                     AGSATQDLTTNRGRYQANLAPLSLPITFRNYNDFQSRCGIVYEMRYDIQAILEWKNPS
                     GTLSYLIVYSFACLHPRLFILCPFVYLLLGIMAPAYIAVHPGPRSGSLADMHSMPFSG
                     PPLHDPVIPKPVSQFSPEFLANVLDTQYAIGDAVKLFDKTVDWLSTFAYFTNEEWSSV
                     IYVAILFSTAIIYFSSPFLFTYIQWRYIFLSGGWVAMGTSYLKNVGIHRNMELFLAEF
                     KKSAMEKLPDSTDLSRYFEIKIPRLDVPRNFRFKEESELISKEVQIFEIQKFDVVESC
                     WQQSVFWGSPYAHMKEPCESLPDGQLPNKIESVLPPMDWNFETDAWERDYDPQEWVDN
                     HYLLQSRIFIDHDEKWVYDAEDGQKTNTYRRRRWSRVVTRTSDITPKPSTSLSKTE"
     gene            complement(<136122..>140093)
                     /gene="ADE6"
                     /locus_tag="AWJ20_4645"
                     /db_xref="GeneID:30036800"
     mRNA            complement(<136122..>140093)
                     /gene="ADE6"
                     /locus_tag="AWJ20_4645"
                     /product="phosphoribosylformylglycinamidine synthase"
                     /transcript_id="XM_018881730.1"
                     /db_xref="GeneID:30036800"
     CDS             complement(136122..140093)
                     /gene="ADE6"
                     /locus_tag="AWJ20_4645"
                     /inference="similar to AA sequence:KEGG_Orthology:K01952"
                     /note="Formylglycinamidine-ribonucleotide
                     (FGAM)-synthetase; catalyzes a step in the 'de novo'
                     purine nucleotide biosynthetic pathway; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]; GO_function: GO:0016874 - ligase activity [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0004642 -
                     phosphoribosylformylglycinamidine synthase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004642 -
                     phosphoribosylformylglycinamidine synthase activity
                     [Evidence IMP] [PMID 9331966]; GO_process: GO:0006189 -
                     'de novo' IMP biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0006189 - 'de novo' IMP biosynthetic
                     process [Evidence IC] [PMID 9331966]; GO_process:
                     GO:0006541 - glutamine metabolic process [Evidence IEA];
                     GO_process: GO:0006164 - purine nucleotide biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006164 - purine
                     nucleotide biosynthetic process [Evidence IMP] [PMID
                     1743513]"
                     /codon_start=1
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="XP_018736179.1"
                     /db_xref="GeneID:30036800"
                     /translation="MMLTLPGPVAYSPFRVSGLINNINTAVNSSAVIGLRTVYVHYVS
                     VKDGSDLAKNNEKLTVLNSLLEYDSKPDVNEPLTKVLVDAITSENQQIPDNAYLLRVV
                     PRKGTISPWSSKATNILHNCGLVDDVERVERGLALIIQVRKGFPLDEHLKSGVFLDFI
                     YDRMTQSILERIPEKADFFATHEPKPLVSVPRNGIAAANKSLGLALDQPEIDYLTSSF
                     PNRDPTDVELFMFAQVNSEHCRHKIFNADWKIDGEAKPYSLFKMIRNTHEKNPKYTIS
                     AYSDNASVLEGHEATYYAPDPKTKEYQQIKETVHFLTKVETHNHPTAVSPFPGAATGS
                     GGEIRDEGAVGRGSKSKAGLSGYSVSDLLIPDFKQPWELDVGKPAHISSPLDIMLEAP
                     IGSAAFNNEFGRPAIGGYFRTLTTSVTNAAGKQEIRGFHKPIMLAGGMGSIRPQFALK
                     NRKITPGAALIVLGGPSMLIGLGGGAASSVSSGEGSVDLDFASVQRGNPEMQRRAQMV
                     IDACVALDGANPIQSIHDVGAGGLSNALTELVHDNDLGARFELRDVPNVEPGMSPMEI
                     WCCEAQERYVLGVSPSDLDTFKAICERERAIYAVVGYATSEQRLVLHDRLLDCTPIDM
                     EMSVLFGKPPKLSRVATTRQLKLEHFETSSISIKDAADRVLKLPAVGSKSFLITIGDR
                     SVTGLIAREQMVGPWQVPVADVAVTITSHGAGIHTGEAFGIGERPTVALINAGASAKL
                     SVAESLLNIFASDTTLERIRLSANWMAAPAHEGEGAALYEAVQAIGLDLCPELGIAIP
                     VGKDSMSMKMKWDKKEVTSPMSVVITAFGPVNDVRRTWTPQLERIEGSKLVLVDLGAG
                     KNRLGGSAVAQVYGQIGNEAPDVDAKLLKSFLHALETLHKKDDLVLAYHDRSDGGLLV
                     TALEMAFAGRVGLHLDVEDPSSDLVASLFNEELGAVFQVVDVEGFKAVLLEAGVPESV
                     ISVVGTVKSAKDQAISLRFNGQPAWEESRAALQQTWSLTSYKMQRLRDNPKAADQEFS
                     NIADNSDPGLSFKLTFENTPIPANLLTHKPKVAILREQGVNGHVEMAYAMQQAGFTPI
                     DVHMSDLMSKQVSLNEFVGFAACGGFSYGDVLGAGAGWAKSVLFHDNLKKEFSHFFND
                     RKDTFAIGVCNGCQFLSRIKSLLPGADNWPSFERNLSEQYEARTVVVEIVDDSAPGTE
                     PSIFLNSMRGSRFPVAVAHGEGYASFDSEDHLKKFSHDNLAVVRYVDNYGKVTEKYPF
                     NPNGSPEGITGIRTPNGRVLAMMPHPERVVIKEANSWYPKDLDFEDGPWLRLFRNARQ
                     WVN"
     gene            <140749..>141036
                     /locus_tag="AWJ20_4646"
                     /db_xref="GeneID:30036801"
     mRNA            <140749..>141036
                     /locus_tag="AWJ20_4646"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881731.1"
                     /db_xref="GeneID:30036801"
     CDS             140749..141036
                     /locus_tag="AWJ20_4646"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736180.1"
                     /db_xref="GeneID:30036801"
                     /translation="MVQTALKKSSSLGPTKSGKVSKHSKNPKKAAPKQIAPKKRGAVE
                     DKKIAKKHSAALTSATEKLLASRVGHLELLKGTRRELEKKEKEKKKKEAKK"
     gene            <142946..>143905
                     /gene="TWF1"
                     /locus_tag="AWJ20_4647"
                     /db_xref="GeneID:30036802"
     mRNA            <142946..>143905
                     /gene="TWF1"
                     /locus_tag="AWJ20_4647"
                     /product="Twf1p"
                     /transcript_id="XM_018881732.1"
                     /db_xref="GeneID:30036802"
     CDS             142946..143905
                     /gene="TWF1"
                     /locus_tag="AWJ20_4647"
                     /inference="similar to AA sequence:KEGG_Orthology:K08870"
                     /note="Twinfilin; highly conserved actin
                     monomer-sequestering protein involved in regulation of the
                     cortical actin cytoskeleton; coordinates actin filament
                     severing and monomer sequestering at sites of rapid actin
                     turnover; composed of two cofilin-like regions, localizes
                     actin monomers to sites of rapid filament assembly;
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     TAS] [PMID 10652251]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA,IEA]; GO_component: GO:0005622 -
                     intracellular [Evidence IEA]; GO_component: GO:0043332 -
                     mating projection tip [Evidence IDA] [PMID 19053807];
                     GO_function: GO:0003779 - actin binding [Evidence
                     IEA,IEA]; GO_function: GO:0051015 - actin filament binding
                     [Evidence IDA] [PMID 16569665]; GO_function: GO:0003785 -
                     actin monomer binding [Evidence IDA] [PMID 9700161];
                     GO_process: GO:0044396 - actin cortical patch organization
                     [Evidence IMP] [PMID 16569665]; GO_process: GO:0030042 -
                     actin filament depolymerization [Evidence IDA] [PMID
                     16569665]; GO_process: GO:0007015 - actin filament
                     organization [Evidence IDA,IMP] [PMID 16569665];
                     GO_process: GO:0051014 - actin filament severing [Evidence
                     IDA,IMP] [PMID 16569665]; GO_process: GO:0030837 -
                     negative regulation of actin filament polymerization
                     [Evidence IEA]; GO_process: GO:0042989 - sequestering of
                     actin monomers [Evidence IDA] [PMID 9700161]"
                     /codon_start=1
                     /product="Twf1p"
                     /protein_id="XP_018736181.1"
                     /db_xref="GeneID:30036802"
                     /translation="MANLAESCEPGKVIPKQSDRFEDDFDGIQRQLNAKEANYVAVKQ
                     NGPDAKFVFISFVPDAAPVRSKMLYASSSNTIYRELGGTQRFATSLFWTDLSEVSSSG
                     WNAHVKHEQATAPMTEEERSLQEVLHREVDQMIGTGERKNEIHRIQLSGSSRSGTGLS
                     LAVDDAVHEAFKQLHSAEPGSALGLHVDMDRESVIVGKPLSAVHADKLGDQFIDGSKP
                     QYTIYKHASPTGETDKIVFIYTCPSGSKIKERMVYASNRESVVSFARTHVDVIKVVEA
                     TDGSDISHTQLNDELYPESSETSSTSSTPRSGGFARPKRPGRR"
     gene            complement(<144144..>144980)
                     /gene="SFC1"
                     /locus_tag="AWJ20_4648"
                     /db_xref="GeneID:30036803"
     mRNA            complement(<144144..>144980)
                     /gene="SFC1"
                     /locus_tag="AWJ20_4648"
                     /product="Sfc1p"
                     /transcript_id="XM_018881733.1"
                     /db_xref="GeneID:30036803"
     CDS             complement(144144..144980)
                     /gene="SFC1"
                     /locus_tag="AWJ20_4648"
                     /inference="similar to AA sequence:KEGG_Orthology:K15100"
                     /note="Mitochondrial succinate-fumarate transporter;
                     transports succinate into and fumarate out of the
                     mitochondrion; required for ethanol and acetate
                     utilization; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence ISS] [PMID
                     7908717]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0005469 -
                     succinate:fumarate antiporter activity [Evidence IDA]
                     [PMID 9395087]; GO_process: GO:0015741 - fumarate
                     transport [Evidence IDA] [PMID 9395087]; GO_process:
                     GO:0015744 - succinate transport [Evidence IDA] [PMID
                     9395087]; GO_process: GO:0055085 - transmembrane transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Sfc1p"
                     /protein_id="XP_018736182.1"
                     /db_xref="GeneID:30036803"
                     /translation="MQLKRREVGPDGKKVKPVGFIRTGIRIVQKETPLGLYKGLGAVI
                     AGITPKMAIRFSTYEYLKEKLTPVDKPISTLNTFVAGVGAGLTEAVLIVNPTEVVKIR
                     LQAQAHSLVDPVTGPKYRNAAHCVYTVIREEGIGAMYRGVVLTAARQASNQGVNFTVY
                     SGLKAKLQELQPEYQMLPSWQTSIIGLISGALGPLSNAPLDTIKTRMQREGGHSTESG
                     LARFTRIAKQLIQQEGTAALYRGITPRIMRVAPGQAVTFTIYEMARGQLNKIPIFNQT
                     PA"
     gene            <150734..>152857
                     /gene="RSC9"
                     /locus_tag="AWJ20_4649"
                     /db_xref="GeneID:30036804"
     mRNA            <150734..>152857
                     /gene="RSC9"
                     /locus_tag="AWJ20_4649"
                     /product="Rsc9p"
                     /transcript_id="XM_018881734.1"
                     /db_xref="GeneID:30036804"
     CDS             150734..152857
                     /gene="RSC9"
                     /locus_tag="AWJ20_4649"
                     /inference="similar to AA sequence:KEGG_Orthology:K11763"
                     /note="Component of the RSC chromatin remodeling complex;
                     DNA-binding protein involved in the synthesis of rRNA and
                     in transcriptional repression and activation of genes
                     regulated by the Target of Rapamycin (TOR) pathway;
                     GO_component: GO:0016586 - RSC complex [Evidence IDA]
                     [PMID 10619019]; GO_component: GO:0016586 - RSC complex
                     [Evidence IDA] [PMID 11931764]; GO_component: GO:0016586 -
                     RSC complex [Evidence IDA] [PMID 12183366]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA]; GO_function:
                     GO:0015616 - DNA translocase activity [Evidence IDA] [PMID
                     12183366]; GO_function: GO:0015616 - DNA translocase
                     activity [Evidence IDA] [PMID 16455496]; GO_function:
                     GO:0015616 - DNA translocase activity [Evidence IDA] [PMID
                     17188033]; GO_function: GO:0015616 - DNA translocase
                     activity [Evidence IDA] [PMID 17918861]; GO_function:
                     GO:0003682 - chromatin binding [Evidence IPI] [PMID
                     11931764]; GO_process: GO:0043044 - ATP-dependent
                     chromatin remodeling [Evidence IDA,IDA] [PMID 12183366];
                     GO_process: GO:0000086 - G2/M transition of mitotic cell
                     cycle [Evidence IMP] [PMID 17542652]; GO_process:
                     GO:0070301 - cellular response to hydrogen peroxide
                     [Evidence IDA] [PMID 11931764]; GO_process: GO:0016568 -
                     chromatin modification [Evidence IEA]; GO_process:
                     GO:0006338 - chromatin remodeling [Evidence IPI] [PMID
                     11931764]; GO_process: GO:0006337 - nucleosome disassembly
                     [Evidence IDA] [PMID 16492771]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA]; GO_process: GO:0009303 -
                     rRNA transcription [Evidence IMP] [PMID 11931764];
                     GO_process: GO:0006357 - regulation of transcription from
                     RNA polymerase II promoter [Evidence IMP] [PMID 11931764];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA,IEA]; GO_process: GO:0006368 -
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IDA] [PMID 17081996]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0061587 - transfer RNA gene-mediated silencing
                     [Evidence IMP] [PMID 23707796]"
                     /codon_start=1
                     /product="Rsc9p"
                     /protein_id="XP_018736183.1"
                     /db_xref="GeneID:30036804"
                     /translation="MSSPGGRVLRHHQTRPNYGSSSTPNTRISGISGPSKTPGGISTP
                     GTNNIPVHVRGGTVMSGLTVSNGLTPSTPGTPGTPSPSTPGLLGSAHSVTPQPTGDVP
                     AHMIPPASMAVYTPQNAPHLYQSTVYQRINPSQQPYIGMGMRGVDFIVRISMSLQCGI
                     EDEVSWALKALLELSVRQPGLIQFKNNTSIPLLLFDKIARSSIFAAPVSSTILNDSTS
                     APGPGLDSEVDSFTPSNTADDLQVGISSDIGGNTTVTTGNGPESSTDSAPITVPDLNS
                     PFYGSADSDFFQLHKTIEALLILRNASLDPENAHFLANSPFCNEIVLRGLQFMIAGND
                     PKRPNSTTSSNPAVAEISSYCIDIAESISFHMTPDSPSNPLFATICKIISASTDRSTL
                     IPTIRCLSRLMIRDDKNIVGSVPLPIVSSILRYLLVTDDEELMSASLDFLYQYTARRE
                     NVSRLINISDVENGVNNKDAHLNLEIVTTHLSRLLTYKIEPQPVADYIRLPRKTKEPV
                     PTEPPKLPAWILKELYAMEEPDRATHWIRTCYIDDEDGEVTQISLWKAYEAQFETFAR
                     ESGRRLLPAVDFIKNVTSAFRTSSAMVVQLPGGQKKFIIKGIRPREYPIAPSVLNAPK
                     QPDPKPTDQANSIVREPSAVCVTSALVLQNIARSPAGRTLLRPRVEEFIGSYTVNLAL
                     GSYIDGLLDIVSRSGEHDLDDEDHK"
     gene            <155378..>155926
                     /locus_tag="AWJ20_4650"
                     /db_xref="GeneID:30036806"
     mRNA            <155378..>155926
                     /locus_tag="AWJ20_4650"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881736.1"
                     /db_xref="GeneID:30036806"
     CDS             155378..155926
                     /locus_tag="AWJ20_4650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736184.1"
                     /db_xref="GeneID:30036806"
                     /translation="MKFSTIAIATVSAATVVNASYSYSPQVNDFLNKIDIAKAQVYDQ
                     AGSLRDDLIDSWSDSQLKEWLDAHSLYDVHTSATKDVKGYAASLKEQVLAHKDVLVED
                     IKSYQAAAAANAQPYIGKSKEFVADTGAKAGEVGAQAQVHAQTLLGHVQQHLYTQYEN
                     VKSYAWDLYKRATAYSKSKVDL"
     gene            complement(<158555..>159265)
                     /locus_tag="AWJ20_4651"
                     /db_xref="GeneID:30036807"
     mRNA            complement(<158555..>159265)
                     /locus_tag="AWJ20_4651"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881737.1"
                     /db_xref="GeneID:30036807"
     CDS             complement(158555..159265)
                     /locus_tag="AWJ20_4651"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736185.1"
                     /db_xref="GeneID:30036807"
                     /translation="MFESKQLNSRDLWTACALSGKLLRDPIVSDYKGRLYNKESILEY
                     LLTPEKFGASQRAKVTYITGIKDIVELKITRESKSQTWICPLTEKDIVKESASQRFVY
                     IAECGHLMTEKAIRQMTMVDNAKDHGNGTANGSSAESSLNHGDRDNKKEYCPVCDTEY
                     IPVNLVTVNPSIPELVKKNEDRMKLLAELGLTHSLKPKKKKEKEKKKQKSSTEKKRKS
                     LTTSDDVPAKKTKVPVDT"
     gene            <160555..>162177
                     /locus_tag="AWJ20_4652"
                     /db_xref="GeneID:30036808"
     mRNA            <160555..>162177
                     /locus_tag="AWJ20_4652"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881738.1"
                     /db_xref="GeneID:30036808"
     CDS             160555..162177
                     /locus_tag="AWJ20_4652"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736186.1"
                     /db_xref="GeneID:30036808"
                     /translation="MILCQFPRLMALLLPLLALIYGETNTCPAQTCLVSSSGGKFNGI
                     CQASFSEFLGIPYAQPPTGNLRFANAVQYTPNSSPRNAKTLPPYCPQTSTTVTSTHED
                     CLYLNVYTPSTKASNEVLFWIHGGSFIQGGSADPVFNGSQLAQAENIVVVTVNYRLGA
                     LGFYDSPETGTNFGLTDVVMALKWVNENIASYGGKPDSVTIAGESSGATVVRTLLMTP
                     SAKGLFSRAIIQSDPQAYSANNSTVSQDGIAPIIDQSLGCSTNSGEDLITCLRNASVS
                     DILSAQMNVYSELTNIPGVNSVYPFGPNVNSENLPMDLTPALTSQSPIVNPVEVMIGV
                     VKDEGLAAVSQVFGSAGMTPDIYQYALAAQLGPVGAGKILSSSLFSTDINSSTYPQGI
                     NYELQLSSIATEYEFSCPSQMTAQLYQTSSHKYTYFYQFVEGIQYPDNSGFALCSNGA
                     VCHEDDLYLVFGTYPNPTSLSSSQTSLVKEVQTRWGSFVKNGNPNCNGYSNWTPSSGQ
                     NLNVQLLGGQGSISSIDQAQCQFLDTQLGYYW"
     gene            complement(<162426..>162887)
                     /gene="RCF1"
                     /locus_tag="AWJ20_4653"
                     /db_xref="GeneID:30036809"
     mRNA            complement(<162426..>162887)
                     /gene="RCF1"
                     /locus_tag="AWJ20_4653"
                     /product="Rcf1p"
                     /transcript_id="XM_018881739.1"
                     /db_xref="GeneID:30036809"
     CDS             complement(162426..162887)
                     /gene="RCF1"
                     /locus_tag="AWJ20_4653"
                     /note="Cytochrome c oxidase subunit; required for assembly
                     of the Complex III-Complex IV supercomplex, and for
                     assembly of Cox13p and Rcf2p into cytochrome c oxidase;
                     similar to Rcf2p, and either Rcf1p or Rcf2p is required
                     for late-stage assembly of the Cox12p and Cox13p subunits
                     and for cytochrome c oxidase activity; required for growth
                     under hypoxic conditions; member of the hypoxia induced
                     gene family; C. elegans and human orthologs are functional
                     in yeast; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0031305 -
                     integral component of mitochondrial inner membrane
                     [Evidence IDA] [PMID 22310663]; GO_component: GO:0031305 -
                     integral component of mitochondrial inner membrane
                     [Evidence IDA] [PMID 22342701]; GO_component: GO:0031305 -
                     integral component of mitochondrial inner membrane
                     [Evidence IDA] [PMID 22405070]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0097249 - mitochondrial respiratory chain supercomplex
                     [Evidence IDA] [PMID 22310663]; GO_component: GO:0097249 -
                     mitochondrial respiratory chain supercomplex [Evidence
                     IDA] [PMID 22342701]; GO_component: GO:0097249 -
                     mitochondrial respiratory chain supercomplex [Evidence
                     IDA] [PMID 22405070]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0033617 -
                     mitochondrial respiratory chain complex IV assembly
                     [Evidence IGI] [PMID 22310663]; GO_process: GO:0097250 -
                     mitochondrial respiratory chain supercomplex assembly
                     [Evidence IMP] [PMID 22342701]; GO_process: GO:0097250 -
                     mitochondrial respiratory chain supercomplex assembly
                     [Evidence IMP] [PMID 22405070]"
                     /codon_start=1
                     /product="Rcf1p"
                     /protein_id="XP_018736187.1"
                     /db_xref="GeneID:30036809"
                     /translation="MSSVPPNSDYTSLTGEEDILDKLARKAKEQPVVPIGMLLTCGAL
                     YMSARALRGGNSKLANRMFYWRVGLQGFTVAALVIGGYYYGKPNRPTDRDSILRRTAK
                     EREDIWIKELERVDEMDKERKARADAVALDKKERLRRQFEEARAASGKKDE"
     gene            complement(<163421..>163678)
                     /gene="GUK1"
                     /locus_tag="AWJ20_4654"
                     /db_xref="GeneID:30036810"
     mRNA            complement(<163421..>163678)
                     /gene="GUK1"
                     /locus_tag="AWJ20_4654"
                     /product="guanylate kinase"
                     /transcript_id="XM_018881740.1"
                     /db_xref="GeneID:30036810"
     CDS             complement(163421..163678)
                     /gene="GUK1"
                     /locus_tag="AWJ20_4654"
                     /inference="similar to AA sequence:KEGG_Orthology:K00942"
                     /note="Guanylate kinase; converts GMP to GDP; required for
                     growth and mannose outer chain elongation of cell wall
                     N-linked glycoproteins; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0004385 - guanylate kinase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004385 - guanylate
                     kinase activity [Evidence IDA] [PMID 1334480];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0046037 - GMP metabolic
                     process [Evidence TAS] [PMID 11035032]; GO_process:
                     GO:0046939 - nucleotide phosphorylation [Evidence
                     IEA,IEA]; GO_process: GO:0016310 - phosphorylation
                     [Evidence IEA]; GO_process: GO:0006163 - purine nucleotide
                     metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="guanylate kinase"
                     /protein_id="XP_018736188.1"
                     /db_xref="GeneID:30036810"
                     /translation="MQGVKSVKKTDLNARFLFIAPPSVETLKSRLEGRGTETQESLNN
                     RLNQALAELEYSKEPGAHDKIIVNDDLEKAYAELKAFVTSE"
     gene            <164583..>165614
                     /locus_tag="AWJ20_4655"
                     /db_xref="GeneID:30036811"
     mRNA            <164583..>165614
                     /locus_tag="AWJ20_4655"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881741.1"
                     /db_xref="GeneID:30036811"
     CDS             164583..165614
                     /locus_tag="AWJ20_4655"
                     /inference="similar to AA sequence:KEGG_Orthology:K08502"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736189.1"
                     /db_xref="GeneID:30036811"
                     /translation="MNISIPGYSETSPTYFNIQISFDRTTYHVKRRYSEFVKFVEAIE
                     EEMGEQAPVDLPGKKWIGTKNREFLDDRRRALELFLRALAKKDEWRESLAFMDFLEVS
                     KHAKSESSVAAKARGDWLKMESEASSLIQKALKSKQLMASGIGGPTEAAEHRRLVVLS
                     RSKIKHLESVLSSDNSLGDGEYRRRRDIVQNLKLALRNGENTSSSPFGSNMSSGAGNG
                     ISSAFNQTSSLSGASGTGVSSPLSSRSPSRTSTPTRILGAPAPETGRTRQLNNSGLLA
                     LQKSDMEEQDRTVESLRQTIEQQKRLGLAINEELTFQNQLLDELDDETHRVNSRLNQA
                     KRRTGNLAN"
     gene            <168708..>170060
                     /gene="CSR1"
                     /locus_tag="AWJ20_4656"
                     /db_xref="GeneID:30036812"
     mRNA            <168708..>170060
                     /gene="CSR1"
                     /locus_tag="AWJ20_4656"
                     /product="Csr1p"
                     /transcript_id="XM_018881742.1"
                     /db_xref="GeneID:30036812"
     CDS             168708..170060
                     /gene="CSR1"
                     /locus_tag="AWJ20_4656"
                     /note="Phosphatidylinositol transfer protein; has a
                     potential role in regulating lipid and fatty acid
                     metabolism under heme-depleted conditions; interacts
                     specifically with thioredoxin peroxidase; may have a role
                     in oxidative stress resistance; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     12869188]; GO_component: GO:0005768 - endosome [Evidence
                     IEA,IEA]; GO_component: GO:0005768 - endosome [Evidence
                     IDA] [PMID 10848624]; GO_component: GO:0005768 - endosome
                     [Evidence IDA] [PMID 12869188]; GO_component: GO:0005811 -
                     lipid particle [Evidence IDA] [PMID 17803462];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005628 -
                     prospore membrane [Evidence IDA] [PMID 24390141];
                     GO_function: GO:0008525 - phosphatidylcholine transporter
                     activity [Evidence IDA] [PMID 10848624]; GO_function:
                     GO:0008526 - phosphatidylinositol transporter activity
                     [Evidence IDA] [PMID 10848624]; GO_process: GO:0043001 -
                     Golgi to plasma membrane protein transport [Evidence IGI]
                     [PMID 10848624]; GO_process: GO:0006893 - Golgi to plasma
                     membrane transport [Evidence IGI] [PMID 16126894];
                     GO_process: GO:0016042 - lipid catabolic process [Evidence
                     IEA]; GO_process: GO:0006629 - lipid metabolic process
                     [Evidence IEA]; GO_process: GO:0006869 - lipid transport
                     [Evidence IEA]; GO_process: GO:0045717 - negative
                     regulation of fatty acid biosynthetic process [Evidence
                     IDA,IGI,IMP] [PMID 17803462]; GO_process: GO:1901352 -
                     negative regulation of phosphatidylglycerol biosynthetic
                     process [Evidence IGI] [PMID 12869188]; GO_process:
                     GO:0046488 - phosphatidylinositol metabolic process
                     [Evidence IGI] [PMID 16262726]; GO_process: GO:0009395 -
                     phospholipid catabolic process [Evidence IEA]; GO_process:
                     GO:0015914 - phospholipid transport [Evidence IDA] [PMID
                     10848624]; GO_process: GO:2001247 - positive regulation of
                     phosphatidylcholine biosynthetic process [Evidence IGI]
                     [PMID 12869188]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Csr1p"
                     /protein_id="XP_018736190.1"
                     /db_xref="GeneID:30036812"
                     /translation="MSTAAKGTLPGRAGNLTTEQEHKLKEFWAQVLIYTGSAPESLAT
                     QLTSYSVTSGAAAKKKGGFFSKKDKHVDDIATQSELFRAALPKLTPETFIKAVRFMSR
                     GDNVDDLFLRFLRARKWDVAKALEMFATTISWRVEFGVDELLRTGEEQCVKDKEDGVI
                     LQFKTGKAILRGKDKTGRPIVDVHVKLHDPKAQSERDIEKFTIFLIEASRLCLNDPND
                     TAAVIFDLTDFAISNMDYAAVKFIITCFERHYPECLGFLFIHNAPWVFQGIWNVIKGW
                     IDPVVASKISFTRNHNDLVKLIDDKEIPKSMGGSRPWDFEYLPPVPGENQKLEDHETR
                     DKILAERVNLFKELEQVTVQWISATGEQSNALEAKRSQIIAEVRKNYFLLDPYVRARS
                     AYDRDGTLAEFKQQLHQPELEAAAQAAKTGKAPSLADEKNDQTRVKTAPAAAPAAVTA
                     "
     gene            <172055..>172846
                     /locus_tag="AWJ20_4657"
                     /db_xref="GeneID:30036813"
     mRNA            <172055..>172846
                     /locus_tag="AWJ20_4657"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881743.1"
                     /db_xref="GeneID:30036813"
     CDS             172055..172846
                     /locus_tag="AWJ20_4657"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736191.1"
                     /db_xref="GeneID:30036813"
                     /translation="MNWNIEYKPLVEQDARVFGGLDRDMVQQTLQMVVSFVDNFGLSL
                     LELTNDDCVVQDSILSFYENLPKVCLVRITPKIVIIGYEMAARLVFSQSPFATSRVCG
                     VIASYREICTNSKNRDDPAVSTFNSLVMDTCNILWRDNAFSESVNSDQFGLTKEFIEA
                     LDKQCQEKSLSFKALYSITNSPLFIWVSMLYLRLKEHENFAATEVYTGQITRERFQEM
                     SKAGNWLDIEYDDFRVGLLSKLEDAGYEGINVLLYTSLKQLMDRR"
     gene            <174040..>174744
                     /gene="MCH5"
                     /locus_tag="AWJ20_4658"
                     /db_xref="GeneID:30036814"
     mRNA            <174040..>174744
                     /gene="MCH5"
                     /locus_tag="AWJ20_4658"
                     /product="Mch5p"
                     /transcript_id="XM_018881744.1"
                     /db_xref="GeneID:30036814"
     CDS             174040..174744
                     /gene="MCH5"
                     /locus_tag="AWJ20_4658"
                     /note="Plasma membrane riboflavin transporter; facilitates
                     the uptake of vitamin B2; required for FAD-dependent
                     processes; sequence similarity to mammalian
                     monocarboxylate permeases, however mutants are not
                     deficient in monocarboxylate transport; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 16204239]; GO_function: GO:0008028 - monocarboxylic
                     acid transmembrane transporter activity [Evidence IGI,IMP]
                     [PMID 11536335]; GO_function: GO:0032217 - riboflavin
                     transporter activity [Evidence IGI] [PMID 16204239];
                     GO_process: GO:0032218 - riboflavin transport [Evidence
                     IGI] [PMID 16204239]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mch5p"
                     /protein_id="XP_018736192.1"
                     /db_xref="GeneID:30036814"
                     /translation="MSEKKNAESVMKPQCDENYADGGVGVGAQFDIDSQSVRSSGINV
                     EVINNSGDEEKTVGDKPIPEAVPVVGPPPNGGLQAYLAVLGGFFALFNSWGLINTFGA
                     FETYYQEDLLSHEDPSTIAWIGSIQGYFVVAAAIVFGRMVDAGYIQSLLYVGTFLLTF
                     GMMMTSISSEFYQIFLAQGVVVGIGCCCMFVVSVSVVASYFSTRRAFFVGIVASGVSL
                     MVVNDGVREIITRLAG"
     gene            <174814..>175548
                     /gene="MCH5"
                     /locus_tag="AWJ20_4659"
                     /db_xref="GeneID:30036815"
     mRNA            <174814..>175548
                     /gene="MCH5"
                     /locus_tag="AWJ20_4659"
                     /product="Mch5p"
                     /transcript_id="XM_018881745.1"
                     /db_xref="GeneID:30036815"
     CDS             174814..175548
                     /gene="MCH5"
                     /locus_tag="AWJ20_4659"
                     /note="Plasma membrane riboflavin transporter; facilitates
                     the uptake of vitamin B2; required for FAD-dependent
                     processes; sequence similarity to mammalian
                     monocarboxylate permeases, however mutants are not
                     deficient in monocarboxylate transport; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 16204239]; GO_function: GO:0008028 - monocarboxylic
                     acid transmembrane transporter activity [Evidence IGI,IMP]
                     [PMID 11536335]; GO_function: GO:0032217 - riboflavin
                     transporter activity [Evidence IGI] [PMID 16204239];
                     GO_process: GO:0032218 - riboflavin transport [Evidence
                     IGI] [PMID 16204239]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mch5p"
                     /protein_id="XP_018736193.1"
                     /db_xref="GeneID:30036815"
                     /translation="MVRELITRIGFGWATRVVAFTIFGLSILPCLFLKGRLPPRKSGP
                     LIDYASFKDIPFILYCIACFFGFMGQYIPIFFIQSYCLEIGIDSNLAFYMTSILNAGS
                     VLGRILPNFIADKTGPLNMLLPCTVACAILAYCWDFISVKGGVIAFSVLFGFFSGTFV
                     SLPPACIASMTAEMNMLGTRMGMAFFLCGFGILIGSPIGGALVTRDDGAFLYAAMFCA
                     ACMTLSSVFMFMTRVALSGPKVMVKC"
     gene            complement(<177061..>177663)
                     /gene="PMU1"
                     /locus_tag="AWJ20_4660"
                     /db_xref="GeneID:30036817"
     mRNA            complement(<177061..>177663)
                     /gene="PMU1"
                     /locus_tag="AWJ20_4660"
                     /product="Pmu1p"
                     /transcript_id="XM_018881747.1"
                     /db_xref="GeneID:30036817"
     CDS             complement(177061..177663)
                     /gene="PMU1"
                     /locus_tag="AWJ20_4660"
                     /note="Putative phosphomutase; contains a region
                     homologous to the active site of phosphomutases;
                     overexpression suppresses the histidine auxotrophy of an
                     ade3 ade16 ade17 triple mutant and the temperature
                     sensitivity of a tps2 mutant; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0016853 - isomerase activity [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Pmu1p"
                     /protein_id="XP_018736194.1"
                     /db_xref="GeneID:30036817"
                     /translation="MAQDYWSLLNGDGKIVWGPDAELTPLGIQQAKDNHTAWKEQISK
                     KIRLPQAYYSSPFTRSLDTMLYTWKGISLDFDNALRPLVMEDLREDIGVHTCDKRRTR
                     SFIEGRFGSIVDIEPQLTEEDELWSTQHRETHSEHDARSRDFLNYVFDLDWKSETPVD
                     YVSVTSHSGTTNSLLSVIGHRRFQLGTGGMIPVIVRAQKL"
     gene            <181907..>182890
                     /gene="HSP30"
                     /locus_tag="AWJ20_4662"
                     /db_xref="GeneID:30036818"
     mRNA            <181907..>182890
                     /gene="HSP30"
                     /locus_tag="AWJ20_4662"
                     /product="Hsp30p"
                     /transcript_id="XM_018881748.1"
                     /db_xref="GeneID:30036818"
     CDS             181907..182890
                     /gene="HSP30"
                     /locus_tag="AWJ20_4662"
                     /note="Negative regulator of the H(+)-ATPase Pma1p;
                     stress-responsive protein; hydrophobic plasma membrane
                     localized; induced by heat shock, ethanol treatment, weak
                     organic acid, glucose limitation, and entry into
                     stationary phase; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 1535043]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA] [PMID
                     16622836]; GO_component: GO:0005886 - plasma membrane
                     [Evidence ISS] [PMID 8319300]; GO_function: GO:0005216 -
                     ion channel activity [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEP] [PMID 10206703]; GO_process: GO:0071361 -
                     cellular response to ethanol [Evidence IEP] [PMID
                     10206703]; GO_process: GO:0034605 - cellular response to
                     heat [Evidence IEP] [PMID 10206703]; GO_process:
                     GO:0070301 - cellular response to hydrogen peroxide
                     [Evidence IEP] [PMID 10206703]; GO_process: GO:0071470 -
                     cellular response to osmotic stress [Evidence IEP] [PMID
                     10206703]; GO_process: GO:0034220 - ion transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006811 - ion
                     transport [Evidence IEA]; GO_process: GO:0032780 -
                     negative regulation of ATPase activity [Evidence IMP]
                     [PMID 9250391]; GO_process: GO:0006950 - response to
                     stress [Evidence IEA]"
                     /codon_start=1
                     /product="Hsp30p"
                     /protein_id="XP_018736195.1"
                     /db_xref="GeneID:30036818"
                     /translation="MSILVPRGNEALKLNPPFGLDIHITTHGSDWYWTVFSLFALASL
                     GGLVFSRIGPQTGSKFFYYNYMFSTFVLSIAYYTMASDLGWTGIQAEFNHATVDDGGL
                     VPGIRQIFYTRYVGWFLAFPPLVANFAVLSALPISTSFFTVLTVEVFVVSLLIGSLIH
                     STYKWGYFVFAVVSILLTAYNLFFSFRRAATSNVSHITGAVKTVTFGVSAVAGLMFLY
                     PLSWGLSEGGNVIQPDSEAVFYGVIDICMFIAVPTFFIFTTSTIEAESLGLRNFNTPL
                     FHSDNLAAEKEARYSGDTAVSNFAPTQPAAGTEPVSVPEPVATNPAAANAV"
     gene            complement(<183038..>184132)
                     /gene="NTG2"
                     /locus_tag="AWJ20_4663"
                     /db_xref="GeneID:30036819"
     mRNA            complement(<183038..>184132)
                     /gene="NTG2"
                     /locus_tag="AWJ20_4663"
                     /product="bifunctional N-glycosylase/AP lyase NTG2"
                     /transcript_id="XM_018881749.1"
                     /db_xref="GeneID:30036819"
     CDS             complement(183038..184132)
                     /gene="NTG2"
                     /locus_tag="AWJ20_4663"
                     /inference="similar to AA sequence:KEGG_Orthology:K10773"
                     /note="DNA N-glycosylase and apurinic/apyrimidinic (AP)
                     lyase; involved in base excision repair, localizes to the
                     nucleus; sumoylated; NTG2 has a paralog, NTG1, that arose
                     from the whole genome duplication; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 10471279];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     19029246]; GO_function: GO:0051539 - 4 iron, 4 sulfur
                     cluster binding [Evidence IEA,IEA]; GO_function:
                     GO:0003906 - DNA-(apurinic or apyrimidinic site) lyase
                     activity [Evidence IEA]; GO_function: GO:0003906 -
                     DNA-(apurinic or apyrimidinic site) lyase activity
                     [Evidence IDA] [PMID 14500818]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IEA]; GO_function:
                     GO:0016798 - hydrolase activity, acting on glycosyl bonds
                     [Evidence IEA]; GO_function: GO:0051536 - iron-sulfur
                     cluster binding [Evidence IEA]; GO_function: GO:0016829 -
                     lyase activity [Evidence IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0000703
                     - oxidized pyrimidine nucleobase lesion DNA N-glycosylase
                     activity [Evidence IDA,ISS] [PMID 9020769]; GO_process:
                     GO:0000737 - DNA catabolic process, endonucleolytic
                     [Evidence IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA,IEA]; GO_process: GO:0006284 - base-excision
                     repair [Evidence IEA]; GO_process: GO:0006284 -
                     base-excision repair [Evidence IDA] [PMID 14500818];
                     GO_process: GO:0006285 - base-excision repair, AP site
                     formation [Evidence IDA] [PMID 9826748]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional N-glycosylase/AP lyase NTG2"
                     /protein_id="XP_018736196.1"
                     /db_xref="GeneID:30036819"
                     /translation="MPPRLRSRGLPASTVERASKRVKKEVAVKKETELTDGQLIKSEN
                     DGSTEVSTKSTVVVKTASEIEDGTLVTSVKSESSEILDKKSFVPPTLNYDPFKIIDIS
                     KIKSVSDKEPKNWRDIYSHVQKMRANTMAPVDTMGCERLPEAISSTITPAVHRYQLLI
                     ALMLSAQTKDEVNAQAMATLRRELSPVGGLTIDGILATQESEIDRMIFKVGFHSRKAK
                     YIKLSTQILRDQYDNDIPKTIEDMVSLPGVGPKMAHLLMHRAWGVAEGIGVDVHVHRL
                     ANMWGWTGKNSKLLPTPERTREALESWLPKELWVDINPLLVGFGQTICIPRGRKCDLC
                     TLAPTGLCKNVDRSKFKKVKRPIPDIEDLI"
     gene            complement(<184427..>186664)
                     /gene="CCR4"
                     /locus_tag="AWJ20_4664"
                     /db_xref="GeneID:30036820"
     mRNA            complement(<184427..>186664)
                     /gene="CCR4"
                     /locus_tag="AWJ20_4664"
                     /product="CCR4-NOT core exoribonuclease subunit CCR4"
                     /transcript_id="XM_018881750.1"
                     /db_xref="GeneID:30036820"
     CDS             complement(184427..186664)
                     /gene="CCR4"
                     /locus_tag="AWJ20_4664"
                     /inference="similar to AA sequence:KEGG_Orthology:K12603"
                     /codon_start=1
                     /product="CCR4-NOT core exoribonuclease subunit CCR4"
                     /protein_id="XP_018736197.1"
                     /db_xref="GeneID:30036820"
                     /translation="MQQYQMTGGKDGGGGAGAGAGAVNGGAIGGAIGSALGLGNPSNS
                     GSANNGSAAASEWMSSTHWQQQMQMAQLSRQTANSPHSYARSAAVASRTASGQNPIPL
                     TVTELAVQLVQQNQNQTQAAKNAAAGGNAVVGRPAGGMLNPHQRKEQLEEERQRRINE
                     DINKQFWTAIDLSGQGLTNMTPKLFNYNFLQKLYLNHNKLTSLPASVTKLGQLKVLDL
                     SDNLLTDLPAEIGLMYTLRYLFLFDNKLQELPYALGTLFQLEVLGLDGNPLSDHTREI
                     MAKEGTRGVIIDLRERAPVTIESPPREWLLFEEDKNNSKPRKDERTPQQLQQSRDNKD
                     KSNSKDDKKDGSSSANESDSSSVAGTSASSVTTTTNTSANSAVSNGPPSQSDFSIMSY
                     NTLCDRMATPQLYAYTPSWALGWNYRKERLLEEIVSIGTDIICLQEVDKISYDDLWVP
                     KLSKLGYTALHWPKGRARTMPESEAKKVDGCAMFYKHEKIKLIERHNIDYNLLALRKD
                     DFKKTADIYNRVMNKDNIAMINVFEQVQTGRLMIVANTHLHWDPAFKDVKLVQVALLL
                     EELEKVVDKYTSNSTPEGAKYPKLTDGKNIPLVVCGDYNSTTDSAVYQLFAQGKIEGT
                     HEDLEGRVYGKITDEGTTHKLGLKSAYSEIGELPFTNYTPNFVEVIDYIWYSTNSLSV
                     GGLLGQIDPEYTKHFVAFPNPHHPSDHIPLAAQFNFKKVKDAPPKHTSTPNFGNTSYG
                     SSRKT"
     gene            <189102..>189683
                     /gene="TSA1"
                     /locus_tag="AWJ20_4665"
                     /db_xref="GeneID:30036821"
     mRNA            <189102..>189683
                     /gene="TSA1"
                     /locus_tag="AWJ20_4665"
                     /product="thioredoxin peroxidase TSA1"
                     /transcript_id="XM_018881751.1"
                     /db_xref="GeneID:30036821"
     CDS             189102..189683
                     /gene="TSA1"
                     /locus_tag="AWJ20_4665"
                     /inference="similar to AA sequence:KEGG_Orthology:K03386"
                     /note="Thioredoxin peroxidase; acts as both a
                     ribosome-associated and free cytoplasmic antioxidant;
                     self-associates to form high-molecular weight chaperone
                     complex under oxidative stress; deletion causes mutator
                     phenotype; protein abundance increases and forms
                     cytoplasmic foci during DNA replication stress; chaperone
                     activity is essential for growth under zinc deficiency;
                     required for telomere length maintenance; TSA1 has a
                     paralog, TSA2, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 10681558]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 8344960];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     18271751]; GO_component: GO:0005844 - polysome [Evidence
                     IDA] [PMID 18271751]; GO_function: GO:0016209 -
                     antioxidant activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA,IEA];
                     GO_function: GO:0004601 - peroxidase activity [Evidence
                     IEA]; GO_function: GO:0051920 - peroxiredoxin activity
                     [Evidence IEA,IEA]; GO_function: GO:0051920 -
                     peroxiredoxin activity [Evidence IDA] [PMID 17210445];
                     GO_function: GO:0043022 - ribosome binding [Evidence IDA]
                     [PMID 18271751]; GO_function: GO:0008379 - thioredoxin
                     peroxidase activity [Evidence IDA,IMP] [PMID 7961686];
                     GO_function: GO:0008379 - thioredoxin peroxidase activity
                     [Evidence IDA,IMP] [PMID 9799566]; GO_function: GO:0051082
                     - unfolded protein binding [Evidence IMP] [PMID 16251355];
                     GO_process: GO:0000077 - DNA damage checkpoint [Evidence
                     IGI] [PMID 19851444]; GO_process: GO:0042262 - DNA
                     protection [Evidence IMP] [PMID 19543365]; GO_process:
                     GO:0045454 - cell redox homeostasis [Evidence IDA,IMP]
                     [PMID 8344960]; GO_process: GO:0045454 - cell redox
                     homeostasis [Evidence IMP] [PMID 9799566]; GO_process:
                     GO:0034599 - cellular response to oxidative stress
                     [Evidence IGI] [PMID 15051715]; GO_process: GO:0034599 -
                     cellular response to oxidative stress [Evidence IMP] [PMID
                     18271751]; GO_process: GO:0034599 - cellular response to
                     oxidative stress [Evidence IDA,IMP] [PMID 8344960];
                     GO_process: GO:0061077 - chaperone-mediated protein
                     folding [Evidence IMP] [PMID 24022485]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]; GO_process: GO:0006457 - protein folding
                     [Evidence IMP] [PMID 16251355]; GO_process: GO:0001302 -
                     replicative cell aging [Evidence IMP] [PMID 20729566];
                     GO_process: GO:0033194 - response to hydroperoxide
                     [Evidence IMP] [PMID 15210711]"
                     /codon_start=1
                     /product="thioredoxin peroxidase TSA1"
                     /protein_id="XP_018736198.1"
                     /db_xref="GeneID:30036821"
                     /translation="MVATVRHPAPAFTKKAVVNGVFEDVSLEQYKGKWVILAFIPLAF
                     TFVCPTEIIAYSDAVKEFADRDAVVLFASTDSEFSLLAWDNVSKKDGGLGNVKIPLVA
                     DTNHSLSRDYGVLVEEEGIALRGIFLIDPNQVVRQITINDTPVGRSVPETLRLLDAFQ
                     FTEKHGEVCPANWQKGDATIDTSKASEYFQKQA"
     gene            complement(<189995..>193624)
                     /gene="VAC7"
                     /locus_tag="AWJ20_4666"
                     /db_xref="GeneID:30036822"
     mRNA            complement(<189995..>193624)
                     /gene="VAC7"
                     /locus_tag="AWJ20_4666"
                     /product="Vac7p"
                     /transcript_id="XM_018881752.1"
                     /db_xref="GeneID:30036822"
     CDS             complement(189995..193624)
                     /gene="VAC7"
                     /locus_tag="AWJ20_4666"
                     /note="Integral vacuolar membrane protein; involved in
                     vacuole inheritance and morphology; activates Fab1p kinase
                     activity under basal conditions and also after
                     hyperosmotic shock; GO_component: GO:0070772 - PAS complex
                     [Evidence IDA,IPI] [PMID 19037259]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 9372916]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IDA] [PMID 9372916]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005774
                     - vacuolar membrane [Evidence IDA] [PMID 19037259];
                     GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0033674 - positive regulation of
                     kinase activity [Evidence IGI] [PMID 11950935];
                     GO_process: GO:0010513 - positive regulation of
                     phosphatidylinositol biosynthetic process [Evidence IGI]
                     [PMID 11950935]"
                     /codon_start=1
                     /product="Vac7p"
                     /protein_id="XP_018736199.1"
                     /db_xref="GeneID:30036822"
                     /translation="MSSSRQPPARAAGKGGTPSGTRPVAPSPRRVSITSSEDLSYSTS
                     EELDESDDYFSYQKGKSIASGGAGAAGGSAGSGISSRASTASYSGVNPSGRSPYQFPP
                     PSKQLLRQNHRPNYGSNYGSGYGSGYGYSYHNDREGEGDGENEDYDDGDVEEYDDEDD
                     RAGHGTIKANMLPSHSIGADTSSSSDNNSSSARFKGKIKHSSSNSSSTIKRDKSSNTL
                     KSGSSSQSSPSKRYSRSSRHKKQLSNGTIRASDSGTQQDAKNDDNDTTADDNDGDTTI
                     SNLRISKDKQKNVDDKDGETTVHDKNTTGTAASSGTGASGKTKGGSANPSVNTSSLTS
                     GTTNTASAASTAPSTASTATTTTTTDSSILASSGDLPSSKSGKEQTGSASTENNSAVA
                     SRTGDNKIGSGPATATILPSSTSAPNIPVAMAMSGASVTAPPTSTITGAGSGLGINSG
                     ITPSSVNLPAKASGSAASIKKPNTMTVEAETVEAVPTIAVAPTIAGSGSLKVKKSTDN
                     VMKPINRTKKKKSSRLGQGSKAEIFAAKIASAVDEVHSSDSDETFVYESNPPDRSDSQ
                     RQHHQPLSSSQQSAVPSRPRFQSRNPSTSSLPFTGSQQQLQLQQLQQQIQAQQQQIHQ
                     NYREQTQHQLLQQQYQEQQQQQQHSQTLQQQLPQQTQQSQQQTQPTQQTQQLTGQTQP
                     GTSQPTTTGAPSLQQTALGLAISSVPGSSSTQGSSVEPSGNVAQMNRWVVSKHKRTSG
                     DTPMSSSSSITNVPVLESNSGGATGTTGGSTSGGTTAGGSGSVGAGTFLIARDRDTRS
                     NGSSKRSRGAGGSSRAESPRPEDFESPKFYTHSGPSHSPLPRKLTANRHYDSTASYKA
                     KDATLRRWRGGGSYMAEEDDDYDDQPEQDDMDDDIEYLNVSETTPLRSSGHSIRRSRK
                     AGSLVAYSPHNYQHGKSWSQFYYFRIMFWAAVFGVCVLATGFILGFLLATSKPLQETR
                     VSQIFDVLVSDEVLAFEVVIEAYNPGYLGIEVQNVNLDLFAKSKHVTDLQRETTTSTK
                     PDDDESHTMLLGNVQKFDVPLIFEGGIFSKRLQKAVGDVKLVNPGRNTTGDDLVKESL
                     AVLPPSPSMWQLLQQALKEQNGELDEGQKKWSRVNVHSFDLILRGSLKYKLLFGRERS
                     VSIAKVSPPPSVPPAAGAPPQTPLLLSLRSSRHVHGPCLLRSRSNQGLGRSPSRRRQS
                     PSRQN"
     gene            <195708..>198686
                     /gene="SWE1"
                     /locus_tag="AWJ20_4667"
                     /db_xref="GeneID:30036823"
     mRNA            <195708..>198686
                     /gene="SWE1"
                     /locus_tag="AWJ20_4667"
                     /product="tyrosine protein kinase SWE1"
                     /transcript_id="XM_018881753.1"
                     /db_xref="GeneID:30036823"
     CDS             195708..198686
                     /gene="SWE1"
                     /locus_tag="AWJ20_4667"
                     /inference="similar to AA sequence:KEGG_Orthology:K03114"
                     /codon_start=1
                     /product="tyrosine protein kinase SWE1"
                     /protein_id="XP_018736200.1"
                     /db_xref="GeneID:30036823"
                     /translation="MNSNSVTPAPNMSPLRHHHGHGHSHGHSTSNSSQNQSHSMASNH
                     DLAAPVPFRKTLRRSTRLLNLEQAAGRRDSDGDMIDVDDDVSIDIGGLSGLGLSGLAN
                     DGDSDMNTTNANDNSGSNGQLGINGLDIGSSGHHSMVSGRTVGPASSSSDSGSLVASS
                     SSFSLKRPHPSSSDMRSPSSSFPKPRFLSRNAFDSESNHSHGHKSIGPTISGSASTPT
                     PSSSNGGSSNSSQFLPSLWSSSLKRRDSFDQLFAPSSPFAINGQSTPSHSNSHSGNST
                     TTTSNNINPGNNANTSFNFQTNNPYTTSPSPSPIPASKSHHIHIQHQASASSTASQHH
                     NPLEPTTHHSPHSPHSPHHSPHHSPHRSPHHLPLPRPPLPRHAPPQMHRPKPKFNPSV
                     TAEFSDYHTHTPENYRSVKPLQTAFMSTGLLSKRNRMNNSNSQADGLRMPPDTPCKRP
                     SNMSLPLINHHNTSMFGSAPTAYSPHVSNIGGGFGTTSSGRRRSNLGLHDSLLRFSVD
                     FGNTSTQVAEADSPMHDHDDMIDHQPPETPTKETSGHDMSSFLSSHLAKYSGDTSVSS
                     TVSTSLTAGDTSGTIETANTTVDLSGSHPNLTFSAYSLADRGNHGNSFSSYPTPLPMN
                     IPNRAQSQAGSTGSELGSGGASSGSDKVISTTPQSRNSRWTDGSSSEDTLSSPRTPDV
                     IMHSDPSTIIGGSTNNSTSTVTTTSGHTSIPMIRRTTSTTSLIQEPPRTPAKTPKTPI
                     DPLMNSSNFISLRKSSVDVDDPVLNERFDRVSLIGRGEFSIVYSLSIRGDDSPTDPTS
                     PAIPHTLAHDNRYAVKRTRFPFMGPKARSRRLEEVEILRALTAPSRHSHPDDEHDPAD
                     DGRDYVLMLLDAWEANGYLYIMTEFCENGSLDTFLSERGNISRLDEWRVWKILLEIAL
                     VSSLSTHTCLRRLGLRPRPWLLLSLRSSRCVDGPGLLRSRSSQGLGRSPSRRRQTTGK
                     SSNSVGIALYPRSWVFAFGY"
     gene            <198718..>199479
                     /gene="SWE1"
                     /locus_tag="AWJ20_4668"
                     /db_xref="GeneID:30036824"
     mRNA            <198718..>199479
                     /gene="SWE1"
                     /locus_tag="AWJ20_4668"
                     /product="tyrosine protein kinase SWE1"
                     /transcript_id="XM_018881754.1"
                     /db_xref="GeneID:30036824"
     CDS             198718..199479
                     /gene="SWE1"
                     /locus_tag="AWJ20_4668"
                     /inference="similar to AA sequence:KEGG_Orthology:K03114"
                     /codon_start=1
                     /product="tyrosine protein kinase SWE1"
                     /protein_id="XP_018736201.1"
                     /db_xref="GeneID:30036824"
                     /translation="MLKIGDFGMATAYPAVKGIEREGDREYIAPEVLSSQQYDKPADV
                     FSLGIMMLEIAANIVLPDNGIHWQKLRSGDLTDAGRLSSGDLRRANEYGDDEDDECDD
                     DNCDDDSEHVRLSLDNDSRTSLEDETTSPRMPPSQFSDIHMSSHNSGASNRKVPRRLS
                     AIPPWAPKFMVDKSGALDVMVKWLLNPDPHSRPTTHEILISEECQWVEAHRRAGAVIY
                     EGDYGPEPDPVGSAEDHARQMLRPDHTQDNWRRGV"
     gene            <202093..>205500
                     /gene="SYP1"
                     /locus_tag="AWJ20_4669"
                     /db_xref="GeneID:30036825"
     mRNA            <202093..>205500
                     /gene="SYP1"
                     /locus_tag="AWJ20_4669"
                     /product="Syp1p"
                     /transcript_id="XM_018881755.1"
                     /db_xref="GeneID:30036825"
     CDS             202093..205500
                     /gene="SYP1"
                     /locus_tag="AWJ20_4669"
                     /note="Negative regulator of WASP-Arp23 complex; involved
                     in endocytic site formation; directly inhibits Las17p
                     stimulation of Arp23 complex-mediated actin assembly in
                     vitro; may regulate assembly and disassembly of the septin
                     ring; colocalizes and interacts with septin subunits;
                     potential role in actin cytoskeletal organization;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IEA]; GO_component: GO:0005935 - cellular bud neck
                     [Evidence IDA] [PMID 11014808]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 11014808];
                     GO_component: GO:0001400 - mating projection base
                     [Evidence IDA] [PMID 11014808]; GO_component: GO:0043332 -
                     mating projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 24390141]; GO_function: GO:0004857 - enzyme
                     inhibitor activity [Evidence IDA] [PMID 19962315];
                     GO_process: GO:0000147 - actin cortical patch assembly
                     [Evidence IMP] [PMID 19776351]; GO_process: GO:0007049 -
                     cell cycle [Evidence IEA]; GO_process: GO:0006897 -
                     endocytosis [Evidence IEA]; GO_process: GO:0043086 -
                     negative regulation of catalytic activity [Evidence IDA]
                     [PMID 19962315]; GO_process: GO:0032185 - septin
                     cytoskeleton organization [Evidence IGI,IMP,IPI] [PMID
                     18791237]"
                     /codon_start=1
                     /product="Syp1p"
                     /protein_id="XP_018736202.1"
                     /db_xref="GeneID:30036825"
                     /translation="MATGRSEYSNAILPNLAPDRAVDVVRDRLNNAKLLNDEIADWLK
                     ERARIEESYASELDKLSRRGPLAHEQALGTFTSVWNELTRSARETSKASADYAKKTRT
                     DIEAPIRSFSQKSPQWSDVRDLHDGLSGVAKNLVDGEDNLTKLRTKKSSSSKIEAAQH
                     AVNESRNQWENQGPYVLGQFEIADEARFALLRDSLTRLETLEADKGQAIIKGSEKVLN
                     SILSFDPIEEVRSFAAQIVAGNIGSVSSSGTAGVGGGSSGGSGLARHSQSRDSGDVDS
                     QHFNRGGLVGNIHRPSRNTLDDSSSINSGNTPLGGSGGASKLRSKVGSIFRGGRKKKG
                     EKEAAEIGAGLAAGAGAAAVAGRSNLGAGSRSASTASARAPGRRGTDSSDLYTPVDPS
                     VAAARQQQQQQQQQQQQQQQQQQQQQQQQPQAQQQSSLQQPLQPQQAQDHLSGSKPQP
                     PPSRKVNGQAQREFREEDEYEDEENQPLQNLVSGQQQPFRVNIRSDVITEEQEDANTA
                     LSNVASTLRSKPTISGRGSRGRRDIQSRLFTEIEASDLESSNAAAQDQSGPSYVGQQF
                     FNQLQSFPGQGQGSTQVPSESQNGFSAPQHAISGTTAAGAAIGAAVGSLPVLNEVEPA
                     IKREFEPQTQQGDSFNFNQPQPQQPQQQYQQSFADTQLQQGQQFNGHQFPDTQLQQGQ
                     QGEQYNGQQFPQEYNQQQPQYNQQQQISTSQAQIQQPVYSEQTAGSFGQQTAPQLPPI
                     NTDSSFHGDIGGDRSLGSATEPIVSPSGSAIADQRAPAGNVFAPVPTSVGQSTSLSSP
                     GAGASPAGDLQPPMSAFRANRTNSDVQSLRSLQSSTTGGANIAALKHPDLPTGPGLVA
                     SIVEVITVDMKDGVPTKTAVGGEVSVAYNETDDAATPGTIYVKVKTKQTKLDRLVANN
                     QIVVASSEPDTFKLDLSSPATASSLLGVRQGAKALMYTLSGDQHGYNPLVFTPIWRIE
                     ETQSSLMLNYELADTFHGSELEIHDLVISVPIEGGHAHSAQNKPVASFNKDRQRITWR
                     FPEPVVLKKGQKEKLLCRFATDGYAHEASSGLEVRFRLTDSASSQLSQLGLEYTTKTE
                     EDPFSDEATNTSAVSLSSHLNWVPVSVSRSLVTGKYSVHSELNVSKR"
     gene            complement(<205760..>206533)
                     /gene="MAK16"
                     /locus_tag="AWJ20_4670"
                     /db_xref="GeneID:30036827"
     mRNA            complement(<205760..>206533)
                     /gene="MAK16"
                     /locus_tag="AWJ20_4670"
                     /product="ribosome biosynthesis protein MAK16"
                     /transcript_id="XM_018881757.1"
                     /db_xref="GeneID:30036827"
     CDS             complement(205760..206533)
                     /gene="MAK16"
                     /locus_tag="AWJ20_4670"
                     /inference="similar to AA sequence:KEGG_Orthology:K14831"
                     /codon_start=1
                     /product="ribosome biosynthesis protein MAK16"
                     /protein_id="XP_018736203.1"
                     /db_xref="GeneID:30036827"
                     /translation="MKTAERAHTPAKLWERVKLSKQYSKALEQIDQQLIYWPNFLIHK
                     CKQRLTRLTQVAITERRLALKENERQYVGKAPKVKRREQTRERKALVAAKLEKAIEKE
                     LLDRLKTGAYGENPLNVDEKIWKKVLNGVEKEEGVEQEEEFDEDEELEDESDVGEVEF
                     VEGDDDEDDIVELEDLEKWLGGSDDDGEQRFDSSEDESSSDEESEDDEDEQETKTRKR
                     KPTPAKKPKSDKKKPRRGPRVEIEYEQERESNLQTNVNW"
     gene            <208769..>211453
                     /locus_tag="AWJ20_4671"
                     /db_xref="GeneID:30036828"
     mRNA            <208769..>211453
                     /locus_tag="AWJ20_4671"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881758.1"
                     /db_xref="GeneID:30036828"
     CDS             208769..211453
                     /locus_tag="AWJ20_4671"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736204.1"
                     /db_xref="GeneID:30036828"
                     /translation="MFAPRIFEESDQSISVADRSMFESRNADDMTNNNASPASGLRRS
                     HTVSGSPSRTTYGSRWGDNSRKKVVAGTRYFSGDKSVELNAQSSAKRSGISGGANNET
                     IEATRREILQSLERSPLKLYPDQHTDSQFPTEETRSLSKNRKLATSENKENGGQFVVP
                     AAAAPAEDDDLTNFSKYDIRNISYQSVSRASPKRPQDSNKSIGNIGLRSRSKQPLPTD
                     DSQRHHFADNEDRREPGELFERRTFSEEHHNAEDEREYARSQQSVREADNILESTDRR
                     QVRNRSREEVGDPTPEIASYRDHEPVHSNFLREEVLQQENDFSRKPTREPIRQTIREP
                     IHEPIREPVREQLHDFGRELTREPIRDPIREQENASGRELTREPVHKPVREPVRESIR
                     ESVPESVRDLTRNRRFEVDGEVSYRVDTQVRSDSQARGYRQELLHESAGTSVREHTEE
                     SSEREQLTREPVRNLGQDQQRENPRMYEQDAPPRQQTRNDYQSGTSYRARDRRQSMYT
                     DRANQTVNHDSTYHARSAQTGLSPNATGTSRKEPNMGNMTISGIPSPKKIKQPVLARS
                     KSQSRIRGPPSPTKGPYDPETNPPALKKRSVSDDRKKRQSIAILPPERERERELDRDR
                     ERERANRRQSVVPRMVGTTTTAGSTTNYHPTTATTTATSGTTTNRQMAFGRTPGRLLA
                     PKSTAELRANINAGINNNAGGSGTKTASGVSGTTNNHNSTQAQTKTNSTSQTQQKNKD
                     EISILEVDSTKPSEQSSQQLRIEMERKLAQHRTEIVSLKARLSGKDSEIKSLKASVEQ
                     SELTIESEARQREEMVARVAKELHVQYNKKHEAKLAQFKQSVKIKEETLTSEIHMLRA
                     EVENLKTRIAVERDEKAELVNAFEAYQVELERMGIRLG"
     gene            <212643..>217349
                     /gene="BEM3"
                     /locus_tag="AWJ20_4672"
                     /db_xref="GeneID:30036829"
     mRNA            <212643..>217349
                     /gene="BEM3"
                     /locus_tag="AWJ20_4672"
                     /product="Bem3p"
                     /transcript_id="XM_018881759.1"
                     /db_xref="GeneID:30036829"
     CDS             212643..217349
                     /gene="BEM3"
                     /locus_tag="AWJ20_4672"
                     /note="Rho GTPase activating protein (RhoGAP); involved in
                     control of the cytoskeleton organization; targets the
                     essential Rho-GTPase Cdc42p, which controls establishment
                     and maintenance of cell polarity, including bud-site
                     assembly; GO_component: GO:0005938 - cell cortex [Evidence
                     IDA] [PMID 17914457]; GO_component: GO:0005934 - cellular
                     bud tip [Evidence IDA] [PMID 17914457]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 17914457];
                     GO_component: GO:0000131 - incipient cellular bud site
                     [Evidence IDA] [PMID 17914457]; GO_component: GO:0005622 -
                     intracellular [Evidence IEA]; GO_component: GO:0043332 -
                     mating projection tip [Evidence IDA] [PMID 17914457];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_function: GO:0005096 - GTPase
                     activator activity [Evidence IEA]; GO_function: GO:0005100
                     - Rho GTPase activator activity [Evidence IDA] [PMID
                     12455995]; GO_function: GO:0005100 - Rho GTPase activator
                     activity [Evidence IGI,IPI] [PMID 7498791]; GO_function:
                     GO:0005100 - Rho GTPase activator activity [Evidence IDA]
                     [PMID 8227021]; GO_function: GO:0005100 - Rho GTPase
                     activator activity [Evidence IDA] [PMID 8300560];
                     GO_function: GO:0035091 - phosphatidylinositol binding
                     [Evidence IEA]; GO_function: GO:0032266 -
                     phosphatidylinositol-3-phosphate binding [Evidence IDA]
                     [PMID 11557775]; GO_process: GO:0030010 - establishment of
                     cell polarity [Evidence IMP] [PMID 8013906]; GO_process:
                     GO:0035024 - negative regulation of Rho protein signal
                     transduction [Evidence IGI,IMP,IPI] [PMID 17914457];
                     GO_process: GO:0043547 - positive regulation of GTPase
                     activity [Evidence IEA]; GO_process: GO:0031106 - septin
                     ring organization [Evidence IGI] [PMID 14517318];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Bem3p"
                     /protein_id="XP_018736205.1"
                     /db_xref="GeneID:30036829"
                     /translation="MASRISSHLPSNPLGEPYNSPSSISVADSASGDGHSEITHGSNG
                     LGAGAAGGPYGGSSGPVASSVTTDAASGADVSIVPGESIEGRGLTMSRSSSNYSLNGR
                     DDFNGDDDEDDDYENQQRNQNEHQLKNQNQTEIHNQNESQRENESQGYNNYNNENDDP
                     STRIHRGRSDVKSEHGPESAPGYLPPNEPTTNTHEPLDPKIPSPPAHASEAGTTGSGA
                     TPQPPEADPPSTKPQSKPRSESRSSRSRSRPTKGVSSDASWVKESGSGEAKDASKSVH
                     EPHSQAVINQLVREKLELDLLVNEKVLQLSELQLQNSKLWKLVKRQHLTILDLQKDLD
                     EAVDQNERLRSQTQSPVKNRSTAASASTSTIHSEEGSEDSSAGVGARSSNNDIDSVGS
                     NSKAIINNMKTLRASLLPAESSSVIKTVAEPTTTVVGTNATPRTSVDSTSQSRARTET
                     ESTATPRTSAREAASSVDVSSPTVSESASNSSVSLNLDSTASVIYSPMQKAHKVSVER
                     TRGRDNERALDGALSPFNDISTPRDYHLQQPLSQTQSDHQHHHQHHHQQQQQQQHQQL
                     QRELFGSPTREEHQQQPNHLHVPALGTPLRDTLGTPLRDRLTSPSRNATYEPLLNSGI
                     NLPQVLQPGPPLESLGPPLFQSTTSTSSASETFAPSVSITDDVSGRASALGLGASSGN
                     VSDEPADNPANDSTSTSDREYLVLPARSKSRPPIGERLARANTPPVAGDSLSVETTNH
                     HLAEPTTPTPASSSGTSGSANSSAKRRPPPLLFNNNDKYGLNDTTAVRALSPEAPLTS
                     QLPRSAPATSNSTSSTAGAYSSTAPSTTPGTASSTSSASSAGKSPFGALDISLITIEV
                     KNTLFGKPESKNASKDDPVAILNCIDRETGAVLFKIVKDYTQLSNLDQSLRKFSSQYS
                     IPPLPERNLFLSQAPIKVDLRRNQLNSYFGAIMSVPELPQEAVILLIKFLTQNVLPKT
                     AIASANPYGSLTAGKCGFLTKRGRLTSWKSRWFVLNGSSLDYYERPESDAPIGTISVY
                     KAKIGRPRKDADESDEGENEYRHAFLLMEWKKNGYVRHVFCAETDEDRDLWINALLEL
                     VEVVPGTSTSNNNNNSNGSAGESLASSVSTSTLGTAVNAASNPNAYKPMSPRSVKSDE
                     GDYSNMSSVTVLSPPPSSSIGMNYDGHHGSNSSVSSNGGTTNTAAGGSFPKTPISGPL
                     SFQKILDPGSWNSPNRNNNNNSDINHGHYVGGSGAGSGSHHVSHGSHGSNNVHSFGSE
                     SDETKRKERKKYLSIFKKGGHSPMSSNTSAHSVNAAFPNGFPSMNSINQLQSPPPPPP
                     PPPPPPPPPLNLSGTRSPGSATFGDDNYYNDSIDTSMDHHGAHRQYRGTVFATPLPQA
                     IAISSKNVNGCIVPSILYRCIELLERKGAIYEEGLFRLSGSDSAIRGLKERFNSEYDV
                     DLIAAGADIHAVSGLLKRYLREISEPVIPPLTELQFRTEMESDDAYVRSTAAKNLVSV
                     LPRENYDLLCVLYSFLRKIVDNMNLNKMNLNNLSIVFSPTLHITTNVFSTLFENYSAI
                     FKGFQSDITDPAANVL"
     gene            complement(<217620..>218831)
                     /gene="LIP5"
                     /locus_tag="AWJ20_4673"
                     /db_xref="GeneID:30036830"
     mRNA            complement(<217620..>218831)
                     /gene="LIP5"
                     /locus_tag="AWJ20_4673"
                     /product="putative lipoate synthase"
                     /transcript_id="XM_018881760.1"
                     /db_xref="GeneID:30036830"
     CDS             complement(217620..218831)
                     /gene="LIP5"
                     /locus_tag="AWJ20_4673"
                     /inference="similar to AA sequence:KEGG_Orthology:K03644"
                     /note="Protein involved in biosynthesis of the coenzyme
                     lipoic acid; has similarity to E. coli lipoic acid
                     synthase; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0051539 - 4 iron, 4 sulfur cluster binding [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0051536 - iron-sulfur
                     cluster binding [Evidence IEA,IEA]; GO_function:
                     GO:0016992 - lipoate synthase activity [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0016992 - lipoate synthase
                     activity [Evidence ISA] [PMID 8349643]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016783 - sulfurtransferase activity
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0009107 - lipoate
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0009249 - protein lipoylation [Evidence IEA];
                     GO_process: GO:0009249 - protein lipoylation [Evidence
                     IMP] [PMID 19570983]"
                     /codon_start=1
                     /product="putative lipoate synthase"
                     /protein_id="XP_018736206.1"
                     /db_xref="GeneID:30036830"
                     /translation="MLKVTASRGSICGPLRAISSFHTSAYALLESTDSVKSGATSTAP
                     TRSSRSTRFTDKLNKGPSFEDFLSKKAASDPTLLDPVVAARKSEDARLPKWLKTEIPK
                     GKNFHKLKDDLRGLKLHTVCEEARCPNIGECWGGSDKSKATATIMLMGDTCTRGCRFC
                     SVKTNRNPSPLDPNEPENTAEAIAKWGLGYVVLTTVDRDDLIDGGAYHFADTVKRIKK
                     KASHILVECLTGDFRGDLNMVKIMATSGLDVFAHNVETVEDLTPYVRDRRATFQQSLA
                     VLAHAKQSNPDVLTKTSVMLGFGETDAQVEDTLQQLRKADVDVVTFGQYMRPTKRHMK
                     VAEYVTPEKFQHWHDRAMELGFKYCASGPLVRSSYKAGEAFIENMLKNKQKLAASASA
                     TTSASSATATA"
     gene            <218227..>218514
                     /locus_tag="AWJ20_4674"
                     /db_xref="GeneID:30036831"
     mRNA            <218227..>218514
                     /locus_tag="AWJ20_4674"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881761.1"
                     /db_xref="GeneID:30036831"
     CDS             218227..218514
                     /locus_tag="AWJ20_4674"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736207.1"
                     /db_xref="GeneID:30036831"
                     /translation="MRSSLSTVVNTTYPRPHLAIASAVFSGSLGSNGEGLRLVLTEQN
                     LHPLVQVSPINMIVAVALDLSEPPQHSPIFGHLASSQTVCSFNPRRSSFNL"
     gene            <222116..>223063
                     /gene="CAR1"
                     /locus_tag="AWJ20_4675"
                     /db_xref="GeneID:30036832"
     mRNA            <222116..>223063
                     /gene="CAR1"
                     /locus_tag="AWJ20_4675"
                     /product="arginase"
                     /transcript_id="XM_018881762.1"
                     /db_xref="GeneID:30036832"
     CDS             222116..223063
                     /gene="CAR1"
                     /locus_tag="AWJ20_4675"
                     /inference="similar to AA sequence:KEGG_Orthology:K01476"
                     /note="Arginase, catabolizes arginine to ornithine and
                     urea; expression responds to both induction by arginine
                     and nitrogen catabolite repression; disruption decreases
                     production of carcinogen ethyl carbamate during wine
                     fermentation and also enhances freeze tolerance;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005829 - cytosol [Evidence
                     IDA] [PMID 205532]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0004053 - arginase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004053 - arginase
                     activity [Evidence IMP] [PMID 14582193]; GO_function:
                     GO:0004053 - arginase activity [Evidence IDA] [PMID
                     2404017]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0016813 - hydrolase
                     activity, acting on carbon-nitrogen (but not peptide)
                     bonds, in linear amidines [Evidence IEA]; GO_function:
                     GO:0030145 - manganese ion binding [Evidence IDA] [PMID
                     1939179]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA,IEA]; GO_function: GO:0090369 - ornithine
                     carbamoyltransferase inhibitor activity [Evidence IDA,IMP]
                     [PMID 12679340]; GO_function: GO:0008270 - zinc ion
                     binding [Evidence IDA] [PMID 1939179]; GO_process:
                     GO:0019547 - arginine catabolic process to ornithine
                     [Evidence IMP] [PMID 14582193]; GO_process: GO:0019547 -
                     arginine catabolic process to ornithine [Evidence IDA]
                     [PMID 2404017]; GO_process: GO:0006525 - arginine
                     metabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0090368 - regulation of ornithine metabolic process
                     [Evidence IDA,IMP] [PMID 12679340]; GO_process: GO:0000050
                     - urea cycle [Evidence IEA]"
                     /codon_start=1
                     /product="arginase"
                     /protein_id="XP_018736208.1"
                     /db_xref="GeneID:30036832"
                     /translation="MTISQKSRSLTVISAPFSGGQGKPGVDDGPQHLLDMGLVEQIGR
                     LDWTPKFAGHLQFPAVKNDTNIGHVKNPRYVSQSTKNIYEAVKKASTSSDFTLTIGGD
                     HSIAIGTVAGVQAAHPDAIVLWIDAHADLNTPAASSSGNLHGCPVAFLLGADEPLANA
                     ASKEEADLFGWVPHCLDDSQLGYIGLRDVDAFEKQYIREHKIAAFSMHHVDKYGIASV
                     VEQAINKLDPEHKRPIHLSFDVDAIDPVYAPSTGTPVRGGLTWREACYLCEAVAETGR
                     LVAMDLVECNPHLEDAKAARETIAMGLSLVRCALGETLL"
     gene            complement(<225880..>228504)
                     /gene="HOS3"
                     /locus_tag="AWJ20_4676"
                     /db_xref="GeneID:30036833"
     mRNA            complement(<225880..>228504)
                     /gene="HOS3"
                     /locus_tag="AWJ20_4676"
                     /product="Hos3p"
                     /transcript_id="XM_018881763.1"
                     /db_xref="GeneID:30036833"
     CDS             complement(225880..228504)
                     /gene="HOS3"
                     /locus_tag="AWJ20_4676"
                     /inference="similar to AA sequence:KEGG_Orthology:K11484"
                     /note="Trichostatin A-insensitive homodimeric histone
                     deacetylase (HDAC); specificity in vitro for histones H3,
                     H4, H2A, and H2B; similar to Hda1p, Rpd3p, Hos1p, and
                     Hos2p; deletion results in increased histone acetylation
                     at rDNA repeats; GO_component: GO:0005935 - cellular bud
                     neck [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005628 - prospore membrane
                     [Evidence IDA] [PMID 24390141]; GO_function: GO:0032041 -
                     NAD-dependent histone deacetylase activity (H3-K14
                     specific) [Evidence IEA]; GO_function: GO:0097372 -
                     NAD-dependent histone deacetylase activity (H3-K18
                     specific) [Evidence IEA]; GO_function: GO:0046969 -
                     NAD-dependent histone deacetylase activity (H3-K9
                     specific) [Evidence IEA]; GO_function: GO:0046970 -
                     NAD-dependent histone deacetylase activity (H4-K16
                     specific) [Evidence IEA]; GO_function: GO:0004407 -
                     histone deacetylase activity [Evidence IDA] [PMID
                     10535926]; GO_function: GO:0031078 - histone deacetylase
                     activity (H3-K14 specific) [Evidence IEA]; GO_function:
                     GO:0032129 - histone deacetylase activity (H3-K9 specific)
                     [Evidence IEA]; GO_function: GO:0034739 - histone
                     deacetylase activity (H4-K16 specific) [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_process: GO:0016568 - chromatin modification
                     [Evidence IEA]; GO_process: GO:0070932 - histone H3
                     deacetylation [Evidence IEA]; GO_process: GO:0070933 -
                     histone H4 deacetylation [Evidence IEA]; GO_process:
                     GO:0016575 - histone deacetylation [Evidence IDA] [PMID
                     10535926]; GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 17706600]; GO_process: GO:0000083 - regulation
                     of transcription involved in G1/S transition of mitotic
                     cell cycle [Evidence IGI,IPI] [PMID 19823668]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Hos3p"
                     /protein_id="XP_018736209.1"
                     /db_xref="GeneID:30036833"
                     /translation="MAENTGSQSGHGYDPNGGWDVNSGDNSKPRPSFSEYLNFDDDGD
                     TTEEDMELFSDKYVGRLGNGDLGDDELNAALEAMNLDGSEHGLHTHQNQFARPGAGVY
                     GSQEGSLENSLVLEQSSGNEVNMPVMGSFQPRQEQDTLGSFNDNFGDSQDRERVNLRP
                     VILPPPSSELYNVRDPFSRDAFTPEAASRESTFETSVDSTVDSTLETSVDTSVADVKS
                     DPLPSTKLAESTVRETINTEPQIERRTEEKLKDPGAETGESGSGELPTTPKNKLIDAP
                     IALPDDTDLSEFNSAFAQLKIGQDAISSSTEKKTLILLSPLSYKHVFSRNWVKKSYLD
                     SIVERPERLMAASLGIGTAIAKSPTKYTVQVSDRRSDLRQASHVSIVHGSKWAKRLYQ
                     LCNDSVEKLKNGDVEVPGDWHEGDIYLTGETIDALEGVVAVSETAVDKIYAEGESKVF
                     VSIRPPGHHSHPCVPSGFCLINNVHIAIQYARAKYGITHAVILDFDLHHGDGSQDICW
                     KLSGLDDDEEENEEADSENEQHQENQSNSNEHSEPTVKTEQTPSSTTPAESLQTSTPT
                     SSSQDNESPSKSPRKKGKKTSHPPPPPPPPPLSIGYFSLHDINSFPTEFGYATAENIK
                     NASVCVMAHGMCIWNVHLEPYRDEAHFNEIYSNQYSALFEKARQFLQTGKTTSAHNKQ
                     PFKPLIVLSAGFDSSEYELLSMQRHQVSVPTSFFNRFTNDSVKLANEFTDGKIISMLE
                     GGYSDAALSTGIFSHLTGLAEEQWDSNWCNPTVAKTLAKGSKLKWKRPATTSTSSTNS
                     HHTTSPTASEPHWLNPGIELGRSLWPSQIKAQVLAATKPSASTTGRRNRKWDDDSTTS
                     VLATPLRVLRDKTRKSVH"
     gene            <229381..>230076
                     /locus_tag="AWJ20_4677"
                     /db_xref="GeneID:30036834"
     mRNA            <229381..>230076
                     /locus_tag="AWJ20_4677"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881764.1"
                     /db_xref="GeneID:30036834"
     CDS             229381..230076
                     /locus_tag="AWJ20_4677"
                     /inference="similar to AA sequence:KEGG_Orthology:K18159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736210.1"
                     /db_xref="GeneID:30036834"
                     /translation="MRTGLVASPVPTELGLVNFREPALGLANLLVRCDKDLGGFSTAD
                     LSVVESDSTSNHAFGRFKGDLSLDLPADRPDIIRLGYAMFRTKDIEPKLFGLASSEYW
                     NWEPYNQMVLRVRGDRRKYFINVQAESAYPTDLYQHRLFLKTPGQWEEVTVPLGNFIL
                     TNGGIIQQQQAMELSQVKSVGIGLIDRQYGPYQLDIDWIKVVTGDGPLKPAKPTKPSS
                     ADLTPGKRLSIDD"
     gene            complement(<230292..>232610)
                     /gene="MNL1"
                     /locus_tag="AWJ20_4678"
                     /db_xref="GeneID:30036835"
     mRNA            complement(<230292..>232610)
                     /gene="MNL1"
                     /locus_tag="AWJ20_4678"
                     /product="alpha-1,2-mannosidase MNL1"
                     /transcript_id="XM_018881765.1"
                     /db_xref="GeneID:30036835"
     CDS             complement(230292..232610)
                     /gene="MNL1"
                     /locus_tag="AWJ20_4678"
                     /inference="similar to AA sequence:KEGG_Orthology:K10084"
                     /note="Alpha-1,2-specific exomannosidase of the
                     endoplasmic reticulum; in complex with Pdi1p, generates a
                     Man7GlcNac2 oligosaccharide signal on glycoproteins
                     destined for ubiquitin-proteasome degradation;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005788 - endoplasmic reticulum
                     lumen [Evidence IEA]; GO_component: GO:0005788 -
                     endoplasmic reticulum lumen [Evidence IDA] [PMID
                     19279007]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0004559 - alpha-mannosidase activity
                     [Evidence IEA]; GO_function: GO:0005509 - calcium ion
                     binding [Evidence IEA]; GO_function: GO:0030246 -
                     carbohydrate binding [Evidence IMP,ISS] [PMID 11375935];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016798 - hydrolase activity, acting
                     on glycosyl bonds [Evidence IEA]; GO_function: GO:0004571
                     - mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
                     [Evidence IEA]; GO_function: GO:0004571 -
                     mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
                     [Evidence IMP] [PMID 19124653]; GO_process: GO:0030433 -
                     ER-associated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 11254655]; GO_process:
                     GO:0030433 - ER-associated ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 11375935];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0006986 - response to unfolded protein
                     [Evidence IEA]"
                     /codon_start=1
                     /product="alpha-1,2-mannosidase MNL1"
                     /protein_id="XP_018736211.1"
                     /db_xref="GeneID:30036835"
                     /translation="MRTGLFGLRSSAVVAAVSVVGGIGALGGVEAGEARAVNPSFSNE
                     FSRESLDSLKSEVRDLFYHGWTNYMDIAFPEDELMPLSCSGQSADLDDPMNMGLNDVL
                     GGYSVTLVDSLDMFAIMGDDDLFVQYVADVEKYVSFNVSSTVQVFETTIRGMGGLLSA
                     HLYATIPRLGHRINESEYNGHLLGLAYDLGERLLPAFDTVSGIPHPRVHLQEGVVPLP
                     GQSKLITETCTSGAGSMLLEFSLLSRLTGDPRFEKAARRAFFQLWARRASTNLVGITI
                     DAVSGNWQSVITGVGAGVDSFYEYALKYYVLFGDKSFFEVFETAYEALKKYSFDGWMF
                     HNVNFSTGIYITSWIDALGAFFPGLQVLAGDLTSAIKNHLVYYKLWNTYGGIPERWST
                     GIHDAIDSVVLEWYPLRPEFIESNYYLYQATKDPFYLQVGASTLRDLQRINKVACGVA
                     GTQDVRTGELSDRMESFFLSETVKYLYVLFDEENILNKEFSNYVYSTEAHPLWYDESV
                     LEYSSVERFPELASKIADNLEVLEIPRYELDLFTTHDESYNDDEDCSIRPSVMFQRIR
                     DIWQNRKREQLASYKIRPVKPEPQCTVWDTTNSGPFLQSSIASWNGFYTLDNFYDYTK
                     PDWITTNHPDRPDAIELVPEFHTNFVDSQSTCRAAVSSQVEILFAVPSGEASKTPYSV
                     GYNHGHPSLKGQHLVVALDLYGKRVRLERKENFVGPNSTFVITAVDDIDVKDVLLVHN
                     LDLSGNDARLIQMVNNTVLFQGFRIENILIDF"
     gene            <235127..>235852
                     /gene="RPS4A"
                     /locus_tag="AWJ20_4679"
                     /db_xref="GeneID:30036836"
     mRNA            <235127..>235852
                     /gene="RPS4A"
                     /locus_tag="AWJ20_4679"
                     /product="ribosomal 40S subunit protein S4A"
                     /transcript_id="XM_018881766.1"
                     /db_xref="GeneID:30036836"
     CDS             235127..235852
                     /gene="RPS4A"
                     /locus_tag="AWJ20_4679"
                     /inference="similar to AA sequence:KEGG_Orthology:K02987"
                     /note="Protein component of the small (40S) ribosomal
                     subunit; mutation affects 20S pre-rRNA processing;
                     homologous to mammalian ribosomal protein S4, no bacterial
                     homolog; RPS4A has a paralog, RPS4B, that arose from the
                     whole genome duplication; GO_component: GO:0030686 - 90S
                     preribosome [Evidence IDA] [PMID 12150911]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0022627 - cytosolic small ribosomal
                     subunit [Evidence IDA] [PMID 6814480]; GO_component:
                     GO:0005622 - intracellular [Evidence IEA]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA,IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA,IEA];
                     GO_function: GO:0019843 - rRNA binding [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA]; GO_function: GO:0003735 -
                     structural constituent of ribosome [Evidence IDA] [PMID
                     6814480]; GO_process: GO:0002181 - cytoplasmic translation
                     [Evidence IC] [PMID 6814480]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S4A"
                     /protein_id="XP_018736212.1"
                     /db_xref="GeneID:30036836"
                     /translation="MLDKLSGTYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGREVK
                     AILMQRLVKVDGKVRTDHTFPSGFMDVISLEKTGEHFRLVYDVKGRFAIHRITDEEAQ
                     YKLGKVKRVQLGKKGIPYLVTHDGRTIRYPDPEIKVNDTVKIDLTTGKISSFVKFENG
                     NVVMITGGRNLGRVGVITHRERHEGGFDLVHIKDSLDNSFVTRLSNVFVIGEGNKPLI
                     SLPKGKGIKLSIAEERDRRRAQA"
     gene            complement(<236320..>238320)
                     /locus_tag="AWJ20_4680"
                     /db_xref="GeneID:30036838"
     mRNA            complement(<236320..>238320)
                     /locus_tag="AWJ20_4680"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881768.1"
                     /db_xref="GeneID:30036838"
     CDS             complement(236320..238320)
                     /locus_tag="AWJ20_4680"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736213.1"
                     /db_xref="GeneID:30036838"
                     /translation="MKVRFRCSGGWSAWGRLGLGFVVGFGLLGGSLAGGVKGDGTTES
                     EEGIRPLSWGHVNFVHTTDTHGWLPGHLSEPDFSANWGDYISFLQHMRELADEKGVDL
                     IVVDTGDRHDGNGLSDATYPDGEISQQIFRKADIDIVAIGNHELYKSEVTSQEYHTMR
                     PYYGEKYISSNIDVLDETGTGEWLPMGQRYRLFQTKNQNLTVLALGFLFNFKGNDYNS
                     RVNKVQDVIKEDWFQEVIRTPNLDLVVLTGHAPVRYFDEFDAVVKEIRSVWPKMPIQA
                     LGGHTHIRDYRIYDDYAVGLESGRFLETIGFASVNLSSEANVQQTVHSSQLDKTNKQN
                     EQESSESGFGSGFEDSVSSGPTFTRRYIDFNVRSLSTHAEKSLNEFYTAEGNATTQSI
                     IQFREQLNLTDIICCVPQTYYTTRAKYPGPDSLFTLLEEEVLPLLSGVVEPSRDDHPR
                     FILLNTGALRFDLFRGPFTVDTGYIVAPFRNEWIYIPSMPIKIARQILPLLNQEGSIL
                     STNEHATDFEELDFTELGPPEQRGRGSRNNLSSSQHRHNYDEQLVFSSEQQQQQHRQK
                     LTDGYVTHDDLGSDGDDTPHNPWPFYDIPNVIQASDNIDRTTTHVDLIFYDFMKPFIV
                     HALKTLRQDQYANNIVYYGGNSVISLLPEFLLGLETGTSCIV"
     gene            <240136..>241248
                     /gene="MGM101"
                     /locus_tag="AWJ20_4681"
                     /db_xref="GeneID:30036839"
     mRNA            <240136..>241248
                     /gene="MGM101"
                     /locus_tag="AWJ20_4681"
                     /product="Mgm101p"
                     /transcript_id="XM_018881769.1"
                     /db_xref="GeneID:30036839"
     CDS             240136..241248
                     /gene="MGM101"
                     /locus_tag="AWJ20_4681"
                     /note="Protein with a role in mitochondrial DNA
                     recombinational repair; also involved in interstrand
                     cross-link repair; binds to and catalyzes the annealing of
                     single-stranded mtDNA; oligomerizes to form rings and
                     filaments; related to Rad52-type recombination proteins,
                     with limited overall similarity but sharing conserved
                     functionally important residues; component of the
                     mitochondrial nucleoid, required for the repair of
                     oxidative mtDNA damage; GO_component: GO:0000262 -
                     mitochondrial chromosome [Evidence IEA]; GO_component:
                     GO:0042645 - mitochondrial nucleoid [Evidence IEA,IEA];
                     GO_component: GO:0042645 - mitochondrial nucleoid
                     [Evidence IDA] [PMID 10209025]; GO_component: GO:0042645 -
                     mitochondrial nucleoid [Evidence IDA] [PMID 10869431];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003677 - DNA binding
                     [Evidence IEA]; GO_function: GO:0003697 - single-stranded
                     DNA binding [Evidence IDA,IMP] [PMID 22948312];
                     GO_process: GO:0006281 - DNA repair [Evidence IEA];
                     GO_process: GO:0006281 - DNA repair [Evidence IMP] [PMID
                     10209025]; GO_process: GO:0000733 - DNA strand
                     renaturation [Evidence IDA] [PMID 22027892]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0036297 - interstrand
                     cross-link repair [Evidence IGI] [PMID 22912599];
                     GO_process: GO:0000002 - mitochondrial genome maintenance
                     [Evidence IEA]; GO_process: GO:0000725 - recombinational
                     repair [Evidence IMP] [PMID 22027892]"
                     /codon_start=1
                     /product="Mgm101p"
                     /protein_id="XP_018736214.1"
                     /db_xref="GeneID:30036839"
                     /translation="MISRFRGGSATTGFVRGLKTATSYKSSVAVASRPVKSPAATRAM
                     APAATVRSGSGYSSARKSPAAGSGSSSSARYATAATSRSTRTATSRTKTAAAAPAATS
                     APAIDPAIFEGSSVGPSSGTIHSSKKSSSATPAEPLASNTIDSSGSASSAPPTFASSP
                     TSTTSSAANSAATRNSSPHIDLAATNSWTEFDDSPVDEGVENGENWTRSFRGLGSEPF
                     ASHVTDTLLAELKPEEIEITPDGLLFLPEIRYRRVLNRAFGPGGWGLAPRSKTLVTAK
                     SVSREYALICHGRLVAIARGEQDYFDPNGITTAMEGCKSNAMMRCCKDLGIASELWDP
                     FFIRDFKTKYCEQKYFEKKRRMVWKRKDREWEYPYK"
     gene            <241986..>243131
                     /locus_tag="AWJ20_4682"
                     /db_xref="GeneID:30036840"
     mRNA            <241986..>243131
                     /locus_tag="AWJ20_4682"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881770.1"
                     /db_xref="GeneID:30036840"
     CDS             241986..243131
                     /locus_tag="AWJ20_4682"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736215.1"
                     /db_xref="GeneID:30036840"
                     /translation="MVSISEQMARPPAPAAQSTAQAGPAVRQNTFGQGPGPQFRFSQG
                     VWAHEGSSTSGKKNRPPRAQQSSSGSGTGKGGSTKVKVDSLADIEAALKELEMGSTNH
                     EVCGCMATRHPLLEIAPNCLNCGRIICTKEGLGPCCFCGSPLISNEELLEINRVLQLE
                     KEQLTAGMSKKALRQAGIDPGKALSDMGLKPNKNEKSLEDAQRRLNTLLEFQESSAQR
                     TKIIDQVSDFETPFQGVNKWASPIEQAQQLKRQQHQLRKMHEQQLQRSGRGKKVISID
                     LKGNKVYMTESAEPLESEGEEDELSEGVSTEAQTNSTSDKDKKKPLNSWNPNSYGKSF
                     IKPVYRPVAGSGKRQPNSILKKIGIDEITGSHSRLNAEDDETRVLEM"
     gene            <244559..>244903
                     /locus_tag="AWJ20_4683"
                     /db_xref="GeneID:30036841"
     mRNA            <244559..>244903
                     /locus_tag="AWJ20_4683"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881771.1"
                     /db_xref="GeneID:30036841"
     CDS             244559..244903
                     /locus_tag="AWJ20_4683"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736216.1"
                     /db_xref="GeneID:30036841"
                     /translation="MSGTSMASPAVAGTIAMFMGMGDTVEAAMEKVTALATVDAIDRR
                     STLVKPRSPNLIAYNGLDLGIRKEYVDDDSANGSDDDTESLLNENLSTTEKIYSSLRN
                     LNGRSPANTTDI"
     gene            <247121..>247855
                     /gene="RCF2"
                     /locus_tag="AWJ20_4684"
                     /db_xref="GeneID:30036842"
     mRNA            <247121..>247855
                     /gene="RCF2"
                     /locus_tag="AWJ20_4684"
                     /product="Rcf2p"
                     /transcript_id="XM_018881772.1"
                     /db_xref="GeneID:30036842"
     CDS             247121..247855
                     /gene="RCF2"
                     /locus_tag="AWJ20_4684"
                     /note="Cytochrome c oxidase subunit; has a role in
                     assembly of respiratory supercomplexes; similar to Rcf1p,
                     and either Rcf1p or Rcf2p is required for late-stage
                     assembly of the Cox12p and Cox13p subunits and for
                     cytochrome c oxidase activity; associates with the
                     cytochrome c oxidase - cytochrome bc1 supercomplex; null
                     mutant accumulates reactive oxygen species; member of the
                     conserved hypoxia induced gene family; C. elegans homolog
                     is functional in yeast; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0031305 - integral component of
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     22342701]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0031966 - mitochondrial membrane
                     [Evidence IEA]; GO_component: GO:0097249 - mitochondrial
                     respiratory chain supercomplex [Evidence IDA] [PMID
                     22310663]; GO_component: GO:0097249 - mitochondrial
                     respiratory chain supercomplex [Evidence IDA] [PMID
                     22342701]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0033617 -
                     mitochondrial respiratory chain complex IV assembly
                     [Evidence IGI] [PMID 22310663]"
                     /codon_start=1
                     /product="Rcf2p"
                     /protein_id="XP_018736217.1"
                     /db_xref="GeneID:30036842"
                     /translation="MKFPSKEELNEYTHTIAVGAIKGAVIGTGVSALGYLYAKRRAPV
                     FFTYGAFPRTFLLIAPPIMIGVTTMEFASREFERERYGYVDAASASPDMLIPKINGSN
                     IDPKLAAKVGANGTDGAAAEPNAVLQYAAENKYKIIMGAWAASLAGSYWAVSKDKYLT
                     KSQRIVQARMYAQGLTVALLLVSVMLSVSNGKEKDNSRETGEADLREGKQTWEEIVEQ
                     ETARETAAHLPLHLSDRKNNGNHHHD"
     gene            complement(<248524..>249822)
                     /gene="TUF1"
                     /locus_tag="AWJ20_4685"
                     /db_xref="GeneID:30036843"
     mRNA            complement(<248524..>249822)
                     /gene="TUF1"
                     /locus_tag="AWJ20_4685"
                     /product="translation elongation factor Tu"
                     /transcript_id="XM_018881773.1"
                     /db_xref="GeneID:30036843"
     CDS             complement(248524..249822)
                     /gene="TUF1"
                     /locus_tag="AWJ20_4685"
                     /inference="similar to AA sequence:KEGG_Orthology:K02358"
                     /note="Mitochondrial translation elongation factor Tu;
                     comprises both GTPase and guanine nucleotide exchange
                     factor activities, while these activities are found in
                     separate proteins in S. pombe and humans; GO_component:
                     GO:0005622 - intracellular [Evidence IEA]; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence ISS] [PMID
                     6353412]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0005525 - GTP binding [Evidence IEA,IEA]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IEA]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IGI] [PMID
                     15695360]; GO_function: GO:0003924 - GTPase activity
                     [Evidence IDA] [PMID 3301847]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0003746
                     - translation elongation factor activity [Evidence
                     IEA,IEA]; GO_function: GO:0003746 - translation elongation
                     factor activity [Evidence IGI] [PMID 15695360];
                     GO_function: GO:0003746 - translation elongation factor
                     activity [Evidence IDA] [PMID 3301847]; GO_function:
                     GO:0003746 - translation elongation factor activity
                     [Evidence ISS] [PMID 6353412]; GO_process: GO:0006184 -
                     GTP catabolic process [Evidence IEA]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence IGI]
                     [PMID 15695360]; GO_process: GO:0032543 - mitochondrial
                     translation [Evidence IGI] [PMID 16777356]; GO_process:
                     GO:0070125 - mitochondrial translational elongation
                     [Evidence ISA] [PMID 3905388]; GO_process: GO:0006412 -
                     translation [Evidence IEA]; GO_process: GO:0006414 -
                     translational elongation [Evidence IEA,IEA,IEA]"
                     /codon_start=1
                     /product="translation elongation factor Tu"
                     /protein_id="XP_018736218.1"
                     /db_xref="GeneID:30036843"
                     /translation="MFGNLRLPGAIALRTVFSTASKSVVPRAAINSRWASTFQRTKPH
                     LNIGTIGHVDHGKTTLTAAITKVLASKGGANFLDYASIDKAPEERARGITITSAHVEY
                     ETDNRHYAHVDCPGHADYIKNMISGAARMDGAIIVVAASDGQMPQTREHLLLARQVGI
                     QHVVVFVNKVDTIDDPEMLELVEMEMRELLTTYGFDGDNTPVVMGSALCALEDKRPEI
                     GVQKIEELLDRIDEYIPTPSRDLDNAFLMPLESVFSIPGRGTVVTGRVERGVLSKGEE
                     VEIVGHHKEAITTVVTGIEMFKKELDKAQAGDNAGLLLRGVKREDLKRGMVIAKVGTV
                     KAHTKFLSSIYVLTKEEGGRHSPFGVNYRPQMFVSSADVTVTLTFPEGIEHDHQVFPG
                     DNTEMIGELVHPTPIEVGQRFNIREGGRTVGTGLVTRIIE"
     gene            <256171..>257940
                     /gene="PRC1"
                     /locus_tag="AWJ20_4686"
                     /db_xref="GeneID:30036844"
     mRNA            <256171..>257940
                     /gene="PRC1"
                     /locus_tag="AWJ20_4686"
                     /product="carboxypeptidase C PRC1"
                     /transcript_id="XM_018881774.1"
                     /db_xref="GeneID:30036844"
     CDS             256171..257940
                     /gene="PRC1"
                     /locus_tag="AWJ20_4686"
                     /inference="similar to AA sequence:KEGG_Orthology:K13289"
                     /note="Vacuolar carboxypeptidase Y (proteinase C, CPY);
                     broad-specificity C-terminal exopeptidase involved in
                     non-specific protein degradation in the vacuole; member of
                     the serine carboxypeptidase family; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 11914276]; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IDA] [PMID 23708375]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0004180 -
                     carboxypeptidase activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0004185 - serine-type
                     carboxypeptidase activity [Evidence IEA]; GO_function:
                     GO:0004185 - serine-type carboxypeptidase activity
                     [Evidence IDA,IMP] [PMID 8679540]; GO_process: GO:0046938
                     - phytochelatin biosynthetic process [Evidence IDA,IMP]
                     [PMID 17408619]; GO_process: GO:0006508 - proteolysis
                     [Evidence IEA,IEA]; GO_process: GO:0007039 - vacuolar
                     protein catabolic process [Evidence TAS] [PMID 8789256]"
                     /codon_start=1
                     /product="carboxypeptidase C PRC1"
                     /protein_id="XP_018736219.1"
                     /db_xref="GeneID:30036844"
                     /translation="MKLNSGLTALAVLSSASALLVPPFTEKKEDSSSPSTQQFKFQIP
                     SELGSIDGLSSYLHIDRAQVASIMQTLAHELGQSWHDIPSLAIDSWYEVLKHSPQSFP
                     ELRENLVRQLELSRELNLPVSQVMDWGLKQSSSAHGGKAGVASSSSSSSNVKVDWEHV
                     VESDNFPAHSLNVKSPGSLGIDKVKQYSGYLNDNENDKHYFYWFFESRNDPKNDPVIL
                     WLNGGPGCSSLTGLLFENGPASISPELKPVHNPYSWNNNASVIFLDQPVNTGFSYSDS
                     STVSDTVTAGKDVYVFLSLFFQQFPEYNNLPFHIAGESYAGHYIPVFASEILSHDDRN
                     FNLSSVLIGNGLTDPLRQYDFYEPMACGKGGEPSVLSQEECDGMINSQPRCDNLINAC
                     YNSQSAWTCVPATVYCNNAMMGPYQRTGKNVYDIRANCEGGSLCYTALDDIDKYLNKP
                     EVKAALGAEVDEYASCNFDTNRNFVFAGDWMKPYQTSVTDLLEKDIPVLIYAGDKDFI
                     CNWLGNENWSKELEWSGGDKFKAAPLEPWKLADKEVGQVRNAGSHFTFLRIYGAGHMA
                     PYDQPEASLEMVNRWISGDFAFN"
     gene            complement(<258967..>259344)
                     /locus_tag="AWJ20_4687"
                     /db_xref="GeneID:30036845"
     mRNA            complement(<258967..>259344)
                     /locus_tag="AWJ20_4687"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881775.1"
                     /db_xref="GeneID:30036845"
     CDS             complement(258967..259344)
                     /locus_tag="AWJ20_4687"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736220.1"
                     /db_xref="GeneID:30036845"
                     /translation="MDSSRLHNILDNIYIPKGPQESSNSIPNHHPTLIMQDYQTDTTH
                     HLKCGCCAGACIEENAWWNKKSSTTTPASKTTSTTTKKQAGQAAPRPSVMSTVSSSSI
                     ASASSNFSAYDSYSESSASDYEN"
     gene            complement(<262449..>264314)
                     /gene="TPD3"
                     /locus_tag="AWJ20_4688"
                     /db_xref="GeneID:30036846"
     mRNA            complement(<262449..>264314)
                     /gene="TPD3"
                     /locus_tag="AWJ20_4688"
                     /product="protein phosphatase 2A structural subunit TPD3"
                     /transcript_id="XM_018881776.1"
                     /db_xref="GeneID:30036846"
     CDS             complement(262449..264314)
                     /gene="TPD3"
                     /locus_tag="AWJ20_4688"
                     /inference="similar to AA sequence:KEGG_Orthology:K03456"
                     /note="Regulatory subunit A of the heterotrimeric PP2A
                     complex; the heterotrimeric protein phosphatase 2A (PP2A)
                     complex also contains regulatory subunit Cdc55p and either
                     catalytic subunit Pph21p or Pph22p; required for cell
                     morphogenesis and transcription by RNA polymerase III;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 12388751]; GO_component: GO:0005934 - cellular
                     bud tip [Evidence IDA] [PMID 12388751]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 12388751];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 12388751]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 12388751]; GO_component: GO:0000159 -
                     protein phosphatase type 2A complex [Evidence IDA] [PMID
                     17550305]; GO_component: GO:0005816 - spindle pole body
                     [Evidence IDA] [PMID 12388751]; GO_function: GO:0004722 -
                     protein serine/threonine phosphatase activity [Evidence
                     IDA,IMP] [PMID 17550305]; GO_process: GO:0007094 - mitotic
                     spindle assembly checkpoint [Evidence IMP] [PMID 9001215];
                     GO_process: GO:0006417 - regulation of translation
                     [Evidence IMP] [PMID 10329624]"
                     /codon_start=1
                     /product="protein phosphatase 2A structural subunit TPD3"
                     /protein_id="XP_018736221.1"
                     /db_xref="GeneID:30036846"
                     /translation="MRRLSTISLALGKERTRTELVPFLEEVTQEDEDEVLTVLAEELG
                     GFIPYVGGPDNAHVLIPALEALSGAEEPVVRDKAVESLNLICQAFSTSQVKEYFLPLI
                     TRLSSTDWFTSRVSATGLYAAAISKLEGTERNDLLVLYKDLTQDEAPMVRRAAATSLP
                     KIIGELPELDFDENSTLHTMFISQITDDQDSVRLLSVDVLIAIAESLKKQSITKYNSE
                     LIGLTLDLFNDKSWRVRYMAADRYERLARSLDGSELREKFIPSFVKLMKDSEAEVRTA
                     ISKQIPGFCSLIPLAAIISEIIPNVELLAEDSSQHVRAALASEISRLAPLLEKEKTTQ
                     YLLPTFLQMLKDEFPDVRLNIISKLKIVNDVIGIELLSKSLLPAISELAKDKQWRVRL
                     AIIEYIPLLAEQLGVSFFDKELGPLCMTWLWDSVFSIREAATLNLRKLTEVFGVDWAK
                     DEIIQNVIAVAENSNYLYRLTALFAITTLIPVMDQAAITDSILPFIINLTDDAIPNIR
                     FNIAKSFKVLAETCLTWTDGGDEQDSATTTGPASPAAAKTDSASSTTEPSTGTSESTA
                     ATANKPVSPLAKQIITETIIPRLEKLTGDSDVDVRYFANKSLEEIDVLAKPLLEK"
     gene            <267515..>268207
                     /gene="NUO1"
                     /locus_tag="AWJ20_4689"
                     /db_xref="GeneID:30036847"
     mRNA            <267515..>268207
                     /gene="NUO1"
                     /locus_tag="AWJ20_4689"
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8"
                     /transcript_id="XM_018881777.1"
                     /db_xref="GeneID:30036847"
     CDS             267515..268207
                     /gene="NUO1"
                     /locus_tag="AWJ20_4689"
                     /inference="similar to AA sequence:KEGG_Orthology:K03941"
                     /codon_start=1
                     /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8"
                     /protein_id="XP_018736222.1"
                     /db_xref="GeneID:30036847"
                     /translation="MLSRSLRTNMGVSSPLRSVLMRQNGAGASASKMAVLRSCFHNVA
                     GGTEQGVPPVGFRVHRPPTWDESHESALDKATKFFLLSEMFRGMWVVLEQYFRAPYTI
                     YYPFEKGPVSPRFRGEHALRRYPSGEERCIACKLCEAICPALAITIEAEERVDGSRRT
                     TRYDIDMTKCIYCGYCQESCPVDAIVETPNVEYSTETREELLYNKEKLLANGDKWEQE
                     IQYGLDADAPYR"
     gene            complement(<275781..>276900)
                     /locus_tag="AWJ20_4690"
                     /db_xref="GeneID:30036849"
     mRNA            complement(join(<275781..276779,276898..>276900))
                     /locus_tag="AWJ20_4690"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881778.1"
                     /db_xref="GeneID:30036849"
     CDS             complement(join(275781..276779,276898..276900))
                     /locus_tag="AWJ20_4690"
                     /inference="similar to AA sequence:KEGG_Orthology:K09142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736223.1"
                     /db_xref="GeneID:30036849"
                     /translation="MIARAAVLYGASEIVIFDVANVSGSDAVDQDGDTVVSDSVVEKP
                     KKVVFDEAGESSESKKDAKKESEGPSPECIRLASLLQYYITPSYLRNLLFTDLKPLQY
                     AKKLPKIPGLPFLSHSSSQFLEGLTVAGKLPRSATGGVKKKKGSRKSKKQLQLEASTE
                     YVQIGEQNVLKLDNQRVPLGTRVTVDTKSKKVVSPKDAYTSSSGVLFTNKDSFGYTVR
                     IAKTFGKIFSESIYPGGYTYTAYVPSEEFVASSATAYEPIRPIVDKKGTIFDGAKSSS
                     HILLVYGRWADVNKAVQNDKEELNELDDATGIFDGRFAIRASGRTEDAILISLAQLE"
     gene            complement(<278236..>279282)
                     /locus_tag="AWJ20_4691"
                     /db_xref="GeneID:30036850"
     mRNA            complement(<278236..>279282)
                     /locus_tag="AWJ20_4691"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881779.1"
                     /db_xref="GeneID:30036850"
     CDS             complement(278236..279282)
                     /locus_tag="AWJ20_4691"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736224.1"
                     /db_xref="GeneID:30036850"
                     /translation="MGPLQRARVYDWSKEFLIVLSIMGYVVLHFLGLRVNQGKVSSWI
                     KAHLDVLQTQFYQVGPKPNITSTKSIDYIVTDGATAYNTYATGRVNVSHVLAKFRLLG
                     RQNFITLSMEYFTSIFLQGFNPRDQIDVVITPSDPAAIDPFVFAVVNKENMSRSRDQN
                     YFLSITRTVDSDKLPPSFTFMTESAEVTDTVVELAKEFFQALETPGVEKVLEYFAITD
                     QQPTAPLSLKDLEPKTKLYLSLKFPSNKEQSELSARILNSAINLVDILVAKKTWRPEV
                     AKKIKATRDAEIKKVQKALDLIKAEELAQKKTEALREKKAALAKLSPEEQKKLDQKSK
                     EKEQRKLRSKQIRR"
     gene            complement(<280105..>280569)
                     /locus_tag="AWJ20_4692"
                     /db_xref="GeneID:30036851"
     mRNA            complement(<280105..>280569)
                     /locus_tag="AWJ20_4692"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881780.1"
                     /db_xref="GeneID:30036851"
     CDS             complement(280105..280569)
                     /locus_tag="AWJ20_4692"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736225.1"
                     /db_xref="GeneID:30036851"
                     /translation="MKVAPGALVCRWFALDGYCDTGDKCDKRHVFECPDFEATGQCHR
                     KKCPLKHILRAKEEGKFETHDVTNTTEDSSLPIDLDAVIDMINAEDESPDDDSDNDES
                     ENDDDGSNDDESGSDDDDSADDVSSDDSDVMQWDFTHNNHLPDDDNEDFISI"
     gene            complement(<281151..>281639)
                     /locus_tag="AWJ20_4693"
                     /db_xref="GeneID:30036852"
     mRNA            complement(<281151..>281639)
                     /locus_tag="AWJ20_4693"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881781.1"
                     /db_xref="GeneID:30036852"
     CDS             complement(281151..281639)
                     /locus_tag="AWJ20_4693"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736226.1"
                     /db_xref="GeneID:30036852"
                     /translation="MTRPYHSNSYRGRGSGYRGGYRGAHRGGYHHHQSTGPTHQWKRV
                     EESSSQTTSSTTTSGGTGISTGSNTTSATSSTPIKAPKPVANSDGTVDIGGVKYRTAK
                     NGSKLIRVDPSEQPKESTPRKTTIQGVSYVRTKSGNLLRKNPLSNDRCVDHSLTYYLA
                     CF"
     gene            complement(<284118..>285305)
                     /gene="MTM1"
                     /locus_tag="AWJ20_4694"
                     /db_xref="GeneID:30036853"
     mRNA            complement(<284118..>285305)
                     /gene="MTM1"
                     /locus_tag="AWJ20_4694"
                     /product="Mtm1p"
                     /transcript_id="XM_018881782.1"
                     /db_xref="GeneID:30036853"
     CDS             complement(284118..285305)
                     /gene="MTM1"
                     /locus_tag="AWJ20_4694"
                     /inference="similar to AA sequence:KEGG_Orthology:K15119"
                     /note="Mitochondrial protein of the mitochondrial carrier
                     family; high affinity pyridoxal 5'-phosphate transporter;
                     involved in mitochondrial iron homeostasis and in
                     activating mitochondrial Sod2p by facilitating insertion
                     of an essential manganese cofactor; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 12890866]; GO_function: GO:0016530 -
                     metallochaperone activity [Evidence IMP] [PMID 12890866];
                     GO_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IDA] [PMID 24184947]; GO_process: GO:0006828 -
                     manganese ion transport [Evidence IMP] [PMID 12890866];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mtm1p"
                     /protein_id="XP_018736227.1"
                     /db_xref="GeneID:30036853"
                     /translation="MVAACSGSLLTSVVVTPFDVVRVRMQQQSAFPMVDFIDLAKNKV
                     ANASNKGVEISYKAAAGQVRNNLSKVAVSSLESLRLSSSTGVAAAEMAVKSFPITQIP
                     SGVGVTTCCKDVFWFPSTIDYCVASQLEISTSCAVDETKMNRLNGTWDGFRKIVAGEG
                     LPALWRGLSLTLLMSVPSNVVYFIAYEYMRDNSPLSESTILNPLICGGLARSLSATVV
                     SPIELVKTRLQSAKGPDAVQVVTKGVREMVATQGFSSLWRGLVLTLWRDVPFSSIYWA
                     CVEFIRAELAQTHYFRDQKSDSSTFSQAFIAGSVGGSIAAILTTPFDVGKTRRQIGHH
                     ASSSSSMGMLPFMMKILKTEGVGALYVGAIPRILKVSPACAIMISSYEMGKKFFARDN
                     NAL"
     gene            <287332..>291078
                     /gene="KOG1"
                     /locus_tag="AWJ20_4695"
                     /db_xref="GeneID:30036854"
     mRNA            <287332..>291078
                     /gene="KOG1"
                     /locus_tag="AWJ20_4695"
                     /product="Kog1p"
                     /transcript_id="XM_018881783.1"
                     /db_xref="GeneID:30036854"
     CDS             287332..291078
                     /gene="KOG1"
                     /locus_tag="AWJ20_4695"
                     /inference="similar to AA sequence:KEGG_Orthology:K07204"
                     /note="Subunit of TORC1; TORC1 is a rapamycin-sensitive
                     complex involved in growth control that contains Tor1p or
                     Tor2p, Lst8p and Tco89p; contains four HEAT repeats and
                     seven WD-40 repeats; may act as a scaffold protein to
                     couple TOR and its effectors; GO_component: GO:0031931 -
                     TORC1 complex [Evidence IEA]; GO_component: GO:0031931 -
                     TORC1 complex [Evidence IPI] [PMID 12408816];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     16394584]; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 17560372]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 16394584];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0043130 - ubiquitin binding [Evidence IDA]
                     [PMID 21070969]; GO_process: GO:0031929 - TOR signaling
                     [Evidence IEA]; GO_process: GO:0031929 - TOR signaling
                     [Evidence IC] [PMID 12408816]; GO_process: GO:0009267 -
                     cellular response to starvation [Evidence IMP] [PMID
                     12408816]; GO_process: GO:0001558 - regulation of cell
                     growth [Evidence IPI] [PMID 12408816]"
                     /codon_start=1
                     /product="Kog1p"
                     /protein_id="XP_018736228.1"
                     /db_xref="GeneID:30036854"
                     /translation="MNDPKKSLEMIGKALQSQYEALSTRTKYKQSLDPNVEDAKRFCM
                     SLRRSARDERILFHYNGHGVPRPTPSGEIWVFNRGYTQYIPVSVYDLQTWLGAPCIYA
                     YDCHAAGHIVNNFNAFVEKRKENEKKNGPDPNGPPAEAYENCIQLAACRADEVLPMHP
                     ELPADLFTCCITSPIDIAVRWFVMQSPLLRGQFDNLSIPGKITDRRTPLGELNWIFTA
                     ITDTIAWSTLEGPLFKRLFRQDLVVAAMFRNFLLAVRIMRVHNCHPVSSPELPDTHNH
                     PMWDAWDLAVDHCLVQLPMLQAASEPGGVPYTYKHSDFFEQQLTAFEVWLKYKSSDLD
                     KPPEQLPVLLQVLLSQIHRLRALVLLSKYLDLGPKAVHLALSIGIFPYVLKLLQSPAP
                     ELKPVLVFIWARIMAVDHKAIKQELVKENGYAYFINILIPQDGPVVNAINVPEHLAMC
                     AFVTALFCEGYKQGQRLCMGPDLFQACLTHTEELESPLLRQWATLCISQLWDGYPEAK
                     WQALVKDKTALDRLSRLLNDPVPEVRTACIVALTTFLGDGETVNPNSPNINATAVTSG
                     LTHGDIRQKELSFAISVLALTNDASSIVRREVVVFYSKFVKQYRSRFLVAAYSSLEED
                     VAILRSQTNIDDIRANSPAHGSIYTVVWRALLVLTEDPFPEVADYAQDVVDYVFQLLR
                     KTPLSAEVEKLEQYLVQYSMSSLSVNLPELQNNSPNKATRVSSMGPSAVAGSGVGHGS
                     HNGPTSESKFSQTLLKRSVSFANTLKQYAWGSGEEEQLQSQNQHPQHGRAGNGSASGS
                     NTLWGGFGGSFVNSTGAGAGNLGNTRSAFPTVTTVAYGVGRRPRPVRYQTKDYTKKIV
                     LPLASGFFEWSCEYFQEPQMCNTESDEPGSERYLERVWRKSRNEHIIAETQVQKEMAV
                     YGGWSTHVGLLNNLTQPTKLEFAQFEPHLVGVDDRDGVTVWDWTESTKLNRFCNSNPV
                     GTRITEAKFLNEDDVPLLLTGSSEGVVRIYRHYESVKNIELACSWRVLTDLLPAHRNS
                     GLIAEWQQSRGALLVGGDVRVIRVWDAPRELCTSDIPARSGSPVTALTSDQVAGNIVV
                     AGFGDGGIRVYDRRLGPRESLVKTWKRHKSWVVNVRMQRGGARELVSGSTDGQVYLWD
                     IRLDEPVLSFQAHSNGMRAIDVHEHAPVIATGSQTVGIWSTNGNRVATVRPPSSGYSL
                     GSKASQVSALSFHPHRMIMAVNNVQDAHIGVFNCTDDPSRKYGR"
     gene            complement(<291263..>292501)
                     /gene="LTV1"
                     /locus_tag="AWJ20_4696"
                     /db_xref="GeneID:30036855"
     mRNA            complement(<291263..>292501)
                     /gene="LTV1"
                     /locus_tag="AWJ20_4696"
                     /product="Ltv1p"
                     /transcript_id="XM_018881784.1"
                     /db_xref="GeneID:30036855"
     CDS             complement(291263..292501)
                     /gene="LTV1"
                     /locus_tag="AWJ20_4696"
                     /inference="similar to AA sequence:KEGG_Orthology:K14798"
                     /note="Component of the GSE complex; GSE is required for
                     proper sorting of amino acid permease Gap1p; required for
                     ribosomal small subunit export from nucleus; required for
                     growth at low temperature; GO_component: GO:0034448 - EGO
                     complex [Evidence IDA] [PMID 16732272]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     16888326]; GO_component: GO:0031902 - late endosome
                     membrane [Evidence IDA] [PMID 16732272]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 16888326];
                     GO_component: GO:0030688 - preribosome, small subunit
                     precursor [Evidence IDA] [PMID 16738661]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0034599 - cellular response to oxidative stress
                     [Evidence IMP] [PMID 15611164]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006970 -
                     response to osmotic stress [Evidence IMP] [PMID 15611164];
                     GO_process: GO:0042274 - ribosomal small subunit
                     biogenesis [Evidence IMP] [PMID 15611164]; GO_process:
                     GO:0000056 - ribosomal small subunit export from nucleus
                     [Evidence IGI,IMP] [PMID 16888326]; GO_process: GO:0006810
                     - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ltv1p"
                     /protein_id="XP_018736229.1"
                     /db_xref="GeneID:30036855"
                     /translation="MGPKRWIDKKKADTYSLVYRSQEDPLINDPDASQRVLVKLDNLN
                     DAKQKQERRERWAPTPSYSSTGGASKVLTADVLAQDEETFRKEGRRDNEGEAALYGIE
                     YDDSKYDYMQHLKPIGEDPSAVYISKKPTKEKQSFGKDGNLLLKSDYAAANKVNLPSD
                     VLPSKDTLKRTYQDQQNIPDEIAGLQPDMDPRLREVLEALEDEEYVDDDEDVFGQLIS
                     SGQKEEIEEDEDEWADYDPDQDFSGQDYSDDEAYDSDNGREMPAKPAKYMVTAKEGEE
                     DWETAFRQFKLDQSRSKAPIDGVSDDEFDEDRDEVGSLSQVPSGRRITKSGRKQKIGA
                     KTDLTGFSMSSSALFRNDGLTLLDNRFDKIEEEYNNDDDEEEEANEPFDMSKERDDLE
                     AIMDDFLDNYVVEGKKMYKK"
     gene            complement(<292889..>295288)
                     /gene="AVT3"
                     /locus_tag="AWJ20_4697"
                     /db_xref="GeneID:30036856"
     mRNA            complement(<292889..>295288)
                     /gene="AVT3"
                     /locus_tag="AWJ20_4697"
                     /product="Avt3p"
                     /transcript_id="XM_018881785.1"
                     /db_xref="GeneID:30036856"
     CDS             complement(292889..295288)
                     /gene="AVT3"
                     /locus_tag="AWJ20_4697"
                     /inference="similar to AA sequence:KEGG_Orthology:K14209"
                     /note="Vacuolar transporter; exports large neutral amino
                     acids from the vacuole; member of a family of seven S.
                     cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IMP] [PMID
                     11274162]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005774 - vacuolar membrane
                     [Evidence IEA]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA]; GO_function: GO:0015186 - L-glutamine
                     transmembrane transporter activity [Evidence IGI,IMP]
                     [PMID 11274162]; GO_function: GO:0015188 - L-isoleucine
                     transmembrane transporter activity [Evidence IGI,IMP]
                     [PMID 11274162]; GO_function: GO:0005302 - L-tyrosine
                     transmembrane transporter activity [Evidence IGI,IMP]
                     [PMID 11274162]; GO_function: GO:0005215 - transporter
                     activity [Evidence ISS] [PMID 11274162]; GO_process:
                     GO:0032974 - amino acid transmembrane export from vacuole
                     [Evidence IGI,IMP] [PMID 11274162]; GO_process: GO:0006865
                     - amino acid transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Avt3p"
                     /protein_id="XP_018736230.1"
                     /db_xref="GeneID:30036856"
                     /translation="MSSPKPISSSPKSANDSTNSRRGSMAGSPFRQASLRLGSPVTVG
                     SFSQRSLGPGTGASPAAVSDFDDNVFSTDRRSFSLQRKSFGNAINGGVSSGLATSLST
                     SNAIGNSNGNGTGNGSGNGTLSRAMSSSSASPSNLLGSNIPGSSAVSISDQGSSIIDI
                     DNPDPEIVKVVGRHLVREARGSDFGSDYDGSVGLGSNDGLTAGTSNGAGGNGTAGIGN
                     RATDVVDDDDKFMSLRLQGGDITRQLYNWQREHEEGDAATKRGRSRSFDLPRPAIVGP
                     DGHPIDTKNIKAPGGFRRNFISHNHQTRNRHDPESQNTRRPAFLTRNFIEFLSIYGHF
                     AGEELEDDEDEDDEEDGAGSPFGYGGIGGASVGGSGGAGSGGNGNGDEEQDQDETSAL
                     ISRPRLSRKKSAHHGPGNATQTKAVMLLLKSFVGTGVLFLPKAYSNGGLLFCSVLLVF
                     VSLISYWCFLLLIESKNRVGGGSFGDIGGVLYGPRMRQLILFSIVISQIGFAAAYIVF
                     VSENLQAFVMAVTNNQTFIRVEVFIFLQLIVFLPLSMIRDIAKLSGTALVADFFILLG
                     LVYLYYYGAHTIAEQGVADVVMFNSESWTLFIGTAIFTYEGIGLIIPIQESMKHPQKF
                     TPVLAGVMVGITLVFVSMGALQYAAYGTKVKTVIILNLPQDSHFVNGVQFLYSAAILL
                     STPLQLFPAIRIMENWLFVRSGKYNTKIKWQKNVFRFFLTFLTALVAWGGADDLDKFV
                     ALIGSFACIPLVYIYPPLLHLKAVKQSWYMVLADVVLAVAGLGAMIYTTAGTVSSWIK
                     S"
     gene            complement(<296807..>297172)
                     /gene="RPC25"
                     /locus_tag="AWJ20_4698"
                     /db_xref="GeneID:30036857"
     mRNA            complement(<296807..>297172)
                     /gene="RPC25"
                     /locus_tag="AWJ20_4698"
                     /product="DNA-directed RNA polymerase III subunit RPC25"
                     /transcript_id="XM_018881786.1"
                     /db_xref="GeneID:30036857"
     CDS             complement(296807..297172)
                     /gene="RPC25"
                     /locus_tag="AWJ20_4698"
                     /inference="similar to AA sequence:KEGG_Orthology:K03022"
                     /note="RNA polymerase III subunit C25; required for
                     transcription initiation; forms a heterodimer with Rpc17p;
                     paralog of Rpb7p; GO_component: GO:0005666 - DNA-directed
                     RNA polymerase III complex [Evidence IDA] [PMID 10611227];
                     GO_component: GO:0005666 - DNA-directed RNA polymerase III
                     complex [Evidence IDA] [PMID 3905793]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA]; GO_function:
                     GO:0003899 - DNA-directed RNA polymerase activity
                     [Evidence IEA,IEA]; GO_function: GO:0001056 - RNA
                     polymerase III activity [Evidence IDA] [PMID 3905793];
                     GO_process: GO:0042797 - tRNA transcription from RNA
                     polymerase III promoter [Evidence IMP] [PMID 15612920];
                     GO_process: GO:0042797 - tRNA transcription from RNA
                     polymerase III promoter [Evidence IDA] [PMID 3905793];
                     GO_process: GO:0042797 - tRNA transcription from RNA
                     polymerase III promoter [Evidence IMP] [PMID 8065349];
                     GO_process: GO:0006384 - transcription initiation from RNA
                     polymerase III promoter [Evidence IMP] [PMID 15612920];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit RPC25"
                     /protein_id="XP_018736231.1"
                     /db_xref="GeneID:30036857"
                     /translation="MIVFRPFVGEILVGWVSSCTEEGINVKMEFFDDIHIPKSLLFEE
                     CSFVPREQAWLWKTEESELYIDTNEKIRFRVEQEIFSNQPPKRPGVEEEEQVHNQVPP
                     YSIIGSCQTDGMGLVSWWE"
     gene            <299330..>301162
                     /gene="SDH1"
                     /locus_tag="AWJ20_4699"
                     /db_xref="GeneID:30036858"
     mRNA            <299330..>301162
                     /gene="SDH1"
                     /locus_tag="AWJ20_4699"
                     /product="succinate dehydrogenase flavoprotein subunit
                     SDH1"
                     /transcript_id="XM_018881787.1"
                     /db_xref="GeneID:30036858"
     CDS             299330..301162
                     /gene="SDH1"
                     /locus_tag="AWJ20_4699"
                     /inference="similar to AA sequence:KEGG_Orthology:K00234"
                     /note="Flavoprotein subunit of succinate dehydrogenase;
                     couples the oxidation of succinate to the transfer of
                     electrons to ubiquinone as part of the TCA cycle and the
                     mitochondrial respiratory chain; FAD binding to Sdh1p is
                     required for the assembly of the succinate dehydrogenase
                     subunits; SDH1 has a paralog, YJL045W, that arose from the
                     whole genome duplication; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0031966 - mitochondrial membrane
                     [Evidence IDA] [PMID 1939170]; GO_component: GO:0005749 -
                     mitochondrial respiratory chain complex II [Evidence IDA]
                     [PMID 9822678]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 2826438]; GO_function:
                     GO:0050660 - flavin adenine dinucleotide binding [Evidence
                     IEA]; GO_function: GO:0050660 - flavin adenine
                     dinucleotide binding [Evidence IDA] [PMID 18279395];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IMP] [PMID 1939170]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA,IEA];
                     GO_function: GO:0016627 - oxidoreductase activity, acting
                     on the CH-CH group of donors [Evidence IEA]; GO_function:
                     GO:0008177 - succinate dehydrogenase (ubiquinone) activity
                     [Evidence IEA]; GO_function: GO:0008177 - succinate
                     dehydrogenase (ubiquinone) activity [Evidence IDA] [PMID
                     13445213]; GO_function: GO:0008177 - succinate
                     dehydrogenase (ubiquinone) activity [Evidence IGI,IMP]
                     [PMID 16232921]; GO_function: GO:0008177 - succinate
                     dehydrogenase (ubiquinone) activity [Evidence IMP] [PMID
                     197391]; GO_function: GO:0008177 - succinate dehydrogenase
                     (ubiquinone) activity [Evidence IMP] [PMID 9730279];
                     GO_process: GO:0045333 - cellular respiration [Evidence
                     IGI,IMP] [PMID 16232921]; GO_process: GO:0045333 -
                     cellular respiration [Evidence IGI,IMP] [PMID 9730279];
                     GO_process: GO:0022900 - electron transport chain
                     [Evidence IEA]; GO_process: GO:0006121 - mitochondrial
                     electron transport, succinate to ubiquinone [Evidence IDA]
                     [PMID 2826438]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA,IEA,IEA]; GO_process: GO:0006099 -
                     tricarboxylic acid cycle [Evidence IC] [PMID 13445213]"
                     /codon_start=1
                     /product="succinate dehydrogenase flavoprotein subunit
                     SDH1"
                     /protein_id="XP_018736232.1"
                     /db_xref="GeneID:30036858"
                     /translation="MKPIRAQEASKHVSSKYPVIDHEYDAIVVGAGGAGLRAAFGLAE
                     AGFNTACISKLFPTRSHTVAAQGGINAALGNMHPDNWKWHMYDTVKGSDWLGDQDAIH
                     YMTKEAPQSIIELEHYGVPFSRNDEGRIYQRAFGGQSKEFGKGGQAYRTCAVADRTGH
                     ALLHSLYGQSLRHNTNFFIEFFAMDLLMQDGECVGVMAYNQEDGTLHRFRAHKTVLAT
                     GGYGRAYFSCTSAHTCTGDGLAMVTRAGLPLQDLEFVQFHPTGIYGSGCLITEGSRGE
                     GGYLLNKNGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPENDHIYLQLSHLP
                     AEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTKWTGEALTVDENGND
                     KVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTIRDQLTPGTPLKPVSAD
                     IGHESIANLDKVRTATGSKSTAEIRLNMQKVMQTDVSVFRTQESLEDGVRRITEVDKS
                     IVDLGTTDRSMIWNSDLVESLELQNLLTCAMQTAYSAVARKESRGAHAREDYPERDDV
                     NWMKHTLSWQDKPGDPVKLGYRNVISTTLDEAECPSVPPAKRVY"
     gene            <301515..>302012
                     /gene="PSF1"
                     /locus_tag="AWJ20_4700"
                     /db_xref="GeneID:30036861"
     mRNA            <301515..>302012
                     /gene="PSF1"
                     /locus_tag="AWJ20_4700"
                     /product="Psf1p"
                     /transcript_id="XM_018881790.1"
                     /db_xref="GeneID:30036861"
     CDS             301515..302012
                     /gene="PSF1"
                     /locus_tag="AWJ20_4700"
                     /inference="similar to AA sequence:KEGG_Orthology:K10732"
                     /note="Subunit of the GINS complex (Sld5p, Psf1p, Psf2p,
                     Psf3p); complex is localized to DNA replication origins
                     and implicated in assembly of the DNA replication
                     machinery; GO_component: GO:0031261 - DNA replication
                     preinitiation complex [Evidence IGI,IMP] [PMID 12730134];
                     GO_component: GO:0000811 - GINS complex [Evidence IPI]
                     [PMID 12730134]; GO_component: GO:0000811 - GINS complex
                     [Evidence IPI] [PMID 12768207]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0031298 -
                     replication fork protection complex [Evidence IDA] [PMID
                     16531994]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006260 - DNA replication
                     [Evidence IEA]; GO_process: GO:0006261 - DNA-dependent DNA
                     replication [Evidence IMP] [PMID 12730134]; GO_process:
                     GO:0006261 - DNA-dependent DNA replication [Evidence IMP]
                     [PMID 12768207]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0000727 - double-strand
                     break repair via break-induced replication [Evidence IMP]
                     [PMID 20516198]"
                     /codon_start=1
                     /product="Psf1p"
                     /protein_id="XP_018736233.1"
                     /db_xref="GeneID:30036861"
                     /translation="MYGDIANKLIQDAKLTQMLETLPLYQEELVRSIVREVRDLHRDT
                     EAVLARYGGELPTQDRKVACWIFVQHLCMRRNKRCLLAYQRLRSTRLDAMAWNDVDTM
                     DQEVLNNLNPNEQDYLRDYSELLVDYKGEWVDVDLTGSLEPPRDLFIDVRVLKDAGEI
                     QTEYG"
     gene            <303013..>304329
                     /gene="RPT1"
                     /locus_tag="AWJ20_4701"
                     /db_xref="GeneID:30036862"
     mRNA            <303013..>304329
                     /gene="RPT1"
                     /locus_tag="AWJ20_4701"
                     /product="proteasome regulatory particle base subunit
                     RPT1"
                     /transcript_id="XM_018881791.1"
                     /db_xref="GeneID:30036862"
     CDS             303013..304329
                     /gene="RPT1"
                     /locus_tag="AWJ20_4701"
                     /inference="similar to AA sequence:KEGG_Orthology:K03061"
                     /note="ATPase of the 19S regulatory particle of the 26S
                     proteasome; one of six ATPases of the regulatory particle;
                     involved in the degradation of ubiquitinated substrates;
                     required for optimal CDC20 transcription; interacts with
                     Rpn12p and Ubr1p; mutant has aneuploidy tolerance;
                     GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0000502 - proteasome complex
                     [Evidence IEA]; GO_component: GO:0008540 - proteasome
                     regulatory particle, base subcomplex [Evidence IDA] [PMID
                     9741626]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0016887 - ATPase activity
                     [Evidence ISS] [PMID 7754704]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0017111
                     - nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_process: GO:0045899 - positive regulation of
                     RNA polymerase II transcriptional preinitiation complex
                     assembly [Evidence IMP] [PMID 19843524]; GO_process:
                     GO:0045732 - positive regulation of protein catabolic
                     process [Evidence IDA] [PMID 15135049]; GO_process:
                     GO:0070682 - proteasome regulatory particle assembly
                     [Evidence IMP] [PMID 19412160]; GO_process: GO:0030163 -
                     protein catabolic process [Evidence IEA]; GO_process:
                     GO:0006511 - ubiquitin-dependent protein catabolic process
                     [Evidence IPI] [PMID 15135049]"
                     /codon_start=1
                     /product="proteasome regulatory particle base subunit
                     RPT1"
                     /protein_id="XP_018736234.1"
                     /db_xref="GeneID:30036862"
                     /translation="MPPKADWEKYKAPIDGDDEKPEENIVPLSEGDIQVLKTYGAAPY
                     GSALKVIEKDIKDIQGRINEKVGVKESDTGLAAPHLWDIMADKQTISQEQPLQVARCT
                     KIIQSPEDPEKAKYVINVKQIAKFVVSLGDQVSPTDIEEGMRVGVERNKYQIMLPLPP
                     RIDPSVTMMTVEEKPDVTYGDIGGSKEQIEKLREVVELPLLSPERFANLGIDPPKGIL
                     LYGPPGTGKTLCARAAANRTDATFIRVIGSELVQKYVGEGARMIRELFEMARTKKACI
                     IFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
                     ALLRPGRIDRKVEFSLPDIEGRANIFRIHSKSMSVDRDIRWELISRLCPNSTGAELRS
                     VCTEAGMFAIRARRKVATEKDFLAAVDKVIKGNLKFSSTSQYMQYN"
     gene            <304726..>304797
                     /locus_tag="AWJ20_4702"
                     /db_xref="GeneID:30036863"
     tRNA            <304726..>304797
                     /locus_tag="AWJ20_4702"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:30036863"
     gene            complement(<304987..>306528)
                     /gene="DBR1"
                     /locus_tag="AWJ20_4703"
                     /db_xref="GeneID:30036864"
     mRNA            complement(<304987..>306528)
                     /gene="DBR1"
                     /locus_tag="AWJ20_4703"
                     /product="Dbr1p"
                     /transcript_id="XM_018881792.1"
                     /db_xref="GeneID:30036864"
     CDS             complement(304987..306528)
                     /gene="DBR1"
                     /locus_tag="AWJ20_4703"
                     /inference="similar to AA sequence:KEGG_Orthology:K18328"
                     /note="RNA lariat debranching enzyme; catalyzes
                     debranching of lariat introns formed during pre-mRNA
                     splicing; required for efficient Ty1 transposition;
                     knockdown of human homolog Dbr1 rescues toxicity of
                     RNA-binding proteins TDP-43 and FUS which are implicated
                     in amyotrophic lateral sclerosis (ALS), suggests potential
                     therapeutic target for ALS and related TDP-43
                     proteinopathies; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IC] [PMID 1850323]; GO_function: GO:0008419 -
                     RNA lariat debranching enzyme activity [Evidence IDA,IMP]
                     [PMID 1850323]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016788 -
                     hydrolase activity, acting on ester bonds [Evidence IEA];
                     GO_process: GO:0006401 - RNA catabolic process [Evidence
                     IDA,IMP] [PMID 1850323]; GO_process: GO:0006397 - mRNA
                     processing [Evidence IEA,IEA]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IMP] [PMID
                     24919400]; GO_process: GO:0007124 - pseudohyphal growth
                     [Evidence IMP] [PMID 9055077]; GO_process: GO:0016074 -
                     snoRNA metabolic process [Evidence IMP] [PMID 9740128];
                     GO_process: GO:0032197 - transposition, RNA-mediated
                     [Evidence IMP] [PMID 10652222]"
                     /codon_start=1
                     /product="Dbr1p"
                     /protein_id="XP_018736235.1"
                     /db_xref="GeneID:30036864"
                     /translation="MMRKKSFNIVVEGCCHGELDSIYEAIGKLNKPVDLVLICGDFQA
                     LRNEQDMNCIAMPPKYRKLGDFHKYYTGEKKAPYLTLFIGGNHESSNYLWELFYGGWA
                     APNIYYMGAASVVNFNGLKIGGLSGIYNHQHFHWHHLEKLPYNGSSERSVYHVRKFDT
                     MKLLMLRQGLNVMMSHDWPARIEHFGDLKKLLRFKKHLARDVDTGRLGSPAAGSILQN
                     VRPDYWFSAHLHVRYEALVKHEPHEEIVNETKNATKLIEEESKNEDEIDLEELLDETD
                     NDKKNEDEIELEGLLDETANDNEANKSNVLHAKEETFQKEALNSDEIDLSSELSLEPS
                     TDQPVKSEAPNNVNKVGAPETHFLALDKCLPGRRFIEHITIEVETRPEKRKRRPSTLD
                     DGDSAQVTEEETGLSYDPEWLAITRAFHKYFKTSSNQTVDELPHVNDIDSLNEHISTE
                     LQWVNENIVDKDLLTIPNNFKVQTETPAAPTSSWKNQQPPEIRNNQTEDFCRLLELDN
                     RIYHL"
     gene            <307101..>308591
                     /gene="BFR2"
                     /locus_tag="AWJ20_4704"
                     /db_xref="GeneID:30036865"
     mRNA            <307101..>308591
                     /gene="BFR2"
                     /locus_tag="AWJ20_4704"
                     /product="Bfr2p"
                     /transcript_id="XM_018881793.1"
                     /db_xref="GeneID:30036865"
     CDS             307101..308591
                     /gene="BFR2"
                     /locus_tag="AWJ20_4704"
                     /inference="similar to AA sequence:KEGG_Orthology:K14782"
                     /note="Essential protein that is a component of 90S
                     preribosomes; may be involved in rRNA processing;
                     multicopy suppressor of sensitivity to Brefeldin A;
                     expression is induced during lag phase and also by cold
                     shock; GO_component: GO:0030686 - 90S preribosome
                     [Evidence IDA] [PMID 12150911]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 15590835];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0015031 - protein transport [Evidence
                     IEA]; GO_process: GO:0006364 - rRNA processing [Evidence
                     IMP] [PMID 15590835]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Bfr2p"
                     /protein_id="XP_018736236.1"
                     /db_xref="GeneID:30036865"
                     /translation="MPSLADQLAKLANPEPVDFDPEDFENRNPDDDSGNELEVNKAAT
                     EHYLEVSKSSLRNDELNVDGVKYVGKRVKRDALFEQNGGHSEESDDDDEEEVEGEDDS
                     EEEEEEEEDSEENDVVNGNESEEEDEMQSDDDISEKKEQRKLNGSASDGVPEDEVAKR
                     AQLQELIDAERKNLAGRLSNTAKADAEKGSAVQHQLNIYESIIDCRIKLQKSIQAVNE
                     LPISRSSAEKFTTEATPELISKNKESVFDLLNKVSQLRLRLLQKDGLTDLPKKLSKKR
                     SLTTAFENAQSLDKPLYGYRESVLTKWSQKVQSSTGSMALQSSKFKSLNQTAAIQVST
                     VLADMERLVKRTKLNRSNVKALGLETVAEDQEKQAKTVDIQEEDHIFDDTDFYRQILK
                     ELVDRRMADSGNTAGLKWTVTKAKVKKNIDTKASKGRKLRYTVQEKVQGFDVPRHTTT
                     WTDEQIDDLFASLLGQKIKIDENDNSDAEEDKPEEEPENDGLQIFG"
     gene            complement(<311296..>311814)
                     /gene="MCR1"
                     /locus_tag="AWJ20_4705"
                     /db_xref="GeneID:30036866"
     mRNA            complement(<311296..>311814)
                     /gene="MCR1"
                     /locus_tag="AWJ20_4705"
                     /product="Mcr1p"
                     /transcript_id="XM_018881794.1"
                     /db_xref="GeneID:30036866"
     CDS             complement(311296..311814)
                     /gene="MCR1"
                     /locus_tag="AWJ20_4705"
                     /inference="similar to AA sequence:KEGG_Orthology:K00326"
                     /note="Mitochondrial NADH-cytochrome b5 reductase;
                     involved in ergosterol biosynthesis; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0031307 - integral component of
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16689936]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005758 - mitochondrial
                     intermembrane space [Evidence IEA]; GO_component:
                     GO:0005758 - mitochondrial intermembrane space [Evidence
                     IDA] [PMID 8001120]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IEA,IEA];
                     GO_component: GO:0005741 - mitochondrial outer membrane
                     [Evidence IDA] [PMID 16407407]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     8001120]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0004128 -
                     cytochrome-b5 reductase activity, acting on NAD(P)H
                     [Evidence IEA]; GO_function: GO:0004128 - cytochrome-b5
                     reductase activity, acting on NAD(P)H [Evidence IDA] [PMID
                     8001120]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_process: GO:0034599 -
                     cellular response to oxidative stress [Evidence IMP] [PMID
                     11420140]; GO_process: GO:0006696 - ergosterol
                     biosynthetic process [Evidence IDA] [PMID 10622712];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Mcr1p"
                     /protein_id="XP_018736237.1"
                     /db_xref="GeneID:30036866"
                     /translation="MSTHIHGLKPNDVLSFKGPLPKYQWTPNAHKEIALLGGGTGITP
                     LYQLLQAIHKDPNDKTKVNLFYANVTKEDVLIRDEIEALIKDRPDQFKVTYFLDKPPS
                     GWTGETGYISKEFLSKNLPKPDSENIKIFVCGPPPFYNALSGPKVSPQDQGELTGALK
                     ELGYNKDQVYKF"
     gene            <314138..>314962
                     /locus_tag="AWJ20_4706"
                     /db_xref="GeneID:30036867"
     mRNA            <314138..>314962
                     /locus_tag="AWJ20_4706"
                     /product="NADHX dehydratase"
                     /transcript_id="XM_018881795.1"
                     /db_xref="GeneID:30036867"
     CDS             314138..314962
                     /locus_tag="AWJ20_4706"
                     /inference="similar to AA sequence:KEGG_Orthology:K17757"
                     /note="NADHX dehydratase; converts (S)-NADHX to NADH in an
                     ATP-dependent manner; homologous to Carkd in mammals, and
                     the C-terminal domain of YjeF in E.coli; enzyme is
                     widespread in eukaryotes, prokaryotes and archaea; YKL151C
                     promoter contains STREs (stress response elements) and
                     expression is induced by heat shock or methyl
                     methanesulfonate; green fluorescent protein (GFP)-fusion
                     protein localizes to the cytoplasm; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0047453 -
                     ATP-dependent NAD(P)H-hydrate dehydratase activity
                     [Evidence IEA,IEA]; GO_function: GO:0047453 -
                     ATP-dependent NAD(P)H-hydrate dehydratase activity
                     [Evidence IDA] [PMID 21994945]; GO_function: GO:0016829 -
                     lyase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0046496
                     - nicotinamide nucleotide metabolic process [Evidence
                     IEA]; GO_process: GO:0046496 - nicotinamide nucleotide
                     metabolic process [Evidence IDA] [PMID 21994945]"
                     /codon_start=1
                     /product="NADHX dehydratase"
                     /protein_id="XP_018736238.1"
                     /db_xref="GeneID:30036867"
                     /translation="MASTLVGADMSHVICEKYAGDVIKSYSPNLIVHPYLFETEHLPS
                     GHSIQNVVEKVCSVLDRIHVVVIGPGLGRDKTMLETTAAIIQEAKKRKLPIVIDADGL
                     YLIQNQPDLIKGYEKAILTPNVVEFQRLCKALEIDDAGGDDPASAPKVSKLATTFGGL
                     TILEKGKLDNISNGHTTISNDISGGPKRVSGQGDTLSGSIAAFLAWQLAYEQKLWDTE
                     PIKEAQDSRDLTLLAVFAASSITRTASALAYKNHGRALLTSDISDSVGAAFKQLFE"
     gene            complement(<315195..>315932)
                     /locus_tag="AWJ20_4707"
                     /db_xref="GeneID:30036868"
     mRNA            complement(<315195..>315932)
                     /locus_tag="AWJ20_4707"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881796.1"
                     /db_xref="GeneID:30036868"
     CDS             complement(315195..315932)
                     /locus_tag="AWJ20_4707"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736239.1"
                     /db_xref="GeneID:30036868"
                     /translation="MSARQLSDIEKKSPQIRSRSDELWKLFITRDFPDRPVSESHNRR
                     AYAQYYKEKEAHLKNASSRLRESLEKIKQEKASRTITSLEVDPQSLRAAARRKASSSA
                     PAGSRLIQKAFNSARTKGPLFSSRNTKFASMGMGSINGLPPGIPGAIRAPRSIPPPAM
                     RNVPTPSPLSMPLNARVRPTGPVSPLKPAVATKPHPTKQTAQESAIINSPDNRKKPKI
                     DTPPTTPTIAPATRKRPNSSIFLQRRK"
     gene            complement(<316979..>317716)
                     /gene="CBF1"
                     /locus_tag="AWJ20_4708"
                     /db_xref="GeneID:30036869"
     mRNA            complement(<316979..>317716)
                     /gene="CBF1"
                     /locus_tag="AWJ20_4708"
                     /product="Cbf1p"
                     /transcript_id="XM_018881797.1"
                     /db_xref="GeneID:30036869"
     CDS             complement(316979..317716)
                     /gene="CBF1"
                     /locus_tag="AWJ20_4708"
                     /inference="similar to AA sequence:KEGG_Orthology:K09104"
                     /note="Basic helix-loop-helix (bHLH) protein; forms
                     homodimer to bind E-box consensus sequence CACGTG present
                     at MET gene promoters and centromere DNA element I (CDEI);
                     affects nucleosome positioning at this motif; associates
                     with other transcription factors such as Met4p and Isw1p
                     to mediate transcriptional activation or repression;
                     associates with kinetochore proteins, required for
                     chromosome segregation; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0005694 - chromosome [Evidence IEA]; GO_component:
                     GO:0000775 - chromosome, centromeric region [Evidence
                     IEA,IEA]; GO_component: GO:0000775 - chromosome,
                     centromeric region [Evidence IDA] [PMID 9407032];
                     GO_component: GO:0000776 - kinetochore [Evidence IPI]
                     [PMID 11070082]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 11914276]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0001102 - RNA
                     polymerase II activating transcription factor binding
                     [Evidence IMP] [PMID 20935143]; GO_function: GO:0001102 -
                     RNA polymerase II activating transcription factor binding
                     [Evidence IPI] [PMID 8665859]; GO_function: GO:0000978 -
                     RNA polymerase II core promoter proximal region
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     7891681]; GO_function: GO:0000978 - RNA polymerase II core
                     promoter proximal region sequence-specific DNA binding
                     [Evidence IDA] [PMID 9894911]; GO_function: GO:0001078 -
                     RNA polymerase II core promoter proximal region
                     sequence-specific DNA binding transcription factor
                     activity involved in negative regulation of transcription
                     [Evidence IDA] [PMID 15302821]; GO_function: GO:0001077 -
                     RNA polymerase II core promoter proximal region
                     sequence-specific DNA binding transcription factor
                     activity involved in positive regulation of transcription
                     [Evidence IDA] [PMID 7891681]; GO_function: GO:0001103 -
                     RNA polymerase II repressing transcription factor binding
                     [Evidence IDA] [PMID 12820973]; GO_function: GO:0001076 -
                     RNA polymerase II transcription factor binding
                     transcription factor activity [Evidence IMP] [PMID
                     12820973]; GO_function: GO:0001076 - RNA polymerase II
                     transcription factor binding transcription factor activity
                     [Evidence IMP] [PMID 20935143]; GO_function: GO:0019237 -
                     centromeric DNA binding [Evidence IDA] [PMID 11222754];
                     GO_function: GO:0019237 - centromeric DNA binding
                     [Evidence IDA] [PMID 2057354]; GO_function: GO:0019237 -
                     centromeric DNA binding [Evidence IDA] [PMID 2249662];
                     GO_function: GO:0019237 - centromeric DNA binding
                     [Evidence IDA] [PMID 9407032]; GO_function: GO:0046983 -
                     protein dimerization activity [Evidence IEA]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 19111667]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     19158363]; GO_process: GO:0006338 - chromatin remodeling
                     [Evidence IDA] [PMID 15111622]; GO_process: GO:0006338 -
                     chromatin remodeling [Evidence IMP] [PMID 21131275];
                     GO_process: GO:0006338 - chromatin remodeling [Evidence
                     IMP] [PMID 2249662]; GO_process: GO:0006338 - chromatin
                     remodeling [Evidence IMP] [PMID 7891681]; GO_process:
                     GO:0007059 - chromosome segregation [Evidence IMP] [PMID
                     2057354]; GO_process: GO:0007059 - chromosome segregation
                     [Evidence IMP] [PMID 2185892]; GO_process: GO:0007059 -
                     chromosome segregation [Evidence IMP] [PMID 2188087];
                     GO_process: GO:0007059 - chromosome segregation [Evidence
                     IGI] [PMID 9584087]; GO_process: GO:0061427 - negative
                     regulation of ceramide biosynthetic process by negative
                     regulation of transcription from RNA Polymerase II
                     promoter [Evidence IMP] [PMID 15302821]; GO_process:
                     GO:0000122 - negative regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 10921921];
                     GO_process: GO:0000122 - negative regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 22696683]; GO_process: GO:1900375 - positive
                     regulation of inositol biosynthetic process by positive
                     regulation of transcription from RNA polymerase II
                     promoter [Evidence IMP] [PMID 17351075]; GO_process:
                     GO:1900375 - positive regulation of inositol biosynthetic
                     process by positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 20935143];
                     GO_process: GO:1900478 - positive regulation of sulfate
                     assimilation by positive regulation of transcription from
                     RNA polymerase II promoter [Evidence IMP] [PMID 7601277];
                     GO_process: GO:1900478 - positive regulation of sulfate
                     assimilation by positive regulation of transcription from
                     RNA polymerase II promoter [Evidence IMP] [PMID 7891681];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 22696683]; GO_process: GO:0061432 - regulation
                     of transcription from RNA polymerase II promoter in
                     response to methionine [Evidence IMP] [PMID 7891681];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Cbf1p"
                     /protein_id="XP_018736240.1"
                     /db_xref="GeneID:30036869"
                     /translation="MDKPPSKRARIEDPSSANIDDALLKNDQQTAASEAVVPTTEAQQ
                     GETHDASNELENKMATALAAVAAAASANGGEYPSVVSRQAQTSASPYDHSRPNGSASA
                     GVDGHEPTISVGDSSFKPSAGSEEWHKIRRDNHKEVERRRREAINKGISELATIVPDC
                     EKHKGQILQKTVDYIKKLKDNEQRNMEKLTLEKLLTEQAISELSATNKALKQELAQAW
                     KEVEHWKQACGASTGADASKSADAGSK"
     gene            <318793..>318864
                     /locus_tag="AWJ20_4709"
                     /db_xref="GeneID:30036870"
     tRNA            <318793..>318864
                     /locus_tag="AWJ20_4709"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:30036870"
     gene            complement(<319055..>321037)
                     /gene="BRN1"
                     /locus_tag="AWJ20_4710"
                     /db_xref="GeneID:30036872"
     mRNA            complement(<319055..>321037)
                     /gene="BRN1"
                     /locus_tag="AWJ20_4710"
                     /product="Brn1p"
                     /transcript_id="XM_018881799.1"
                     /db_xref="GeneID:30036872"
     CDS             complement(319055..321037)
                     /gene="BRN1"
                     /locus_tag="AWJ20_4710"
                     /inference="similar to AA sequence:KEGG_Orthology:K06676"
                     /note="Subunit of the condensin complex; required for
                     chromosome condensation and for clustering of tRNA genes
                     at the nucleolus; may influence multiple aspects of
                     chromosome transmission; GO_component: GO:0005694 -
                     chromosome [Evidence IEA,IEA]; GO_component: GO:0000796 -
                     condensin complex [Evidence IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IEA,IEA]; GO_component: GO:0000799 -
                     nuclear condensin complex [Evidence IPI,ISS] [PMID
                     10749931]; GO_component: GO:0000799 - nuclear condensin
                     complex [Evidence IDA] [PMID 10811823]; GO_component:
                     GO:0000799 - nuclear condensin complex [Evidence IPI,ISS]
                     [PMID 7698648]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 10749931]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IGI] [PMID 11864994];
                     GO_process: GO:0006268 - DNA unwinding involved in DNA
                     replication [Evidence IMP] [PMID 24062159]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0030261 - chromosome condensation [Evidence IEA];
                     GO_process: GO:0007076 - mitotic chromosome condensation
                     [Evidence IEA]; GO_process: GO:0007076 - mitotic
                     chromosome condensation [Evidence IGI,IMP] [PMID
                     10749931]; GO_process: GO:0007076 - mitotic chromosome
                     condensation [Evidence IMP] [PMID 10811823]; GO_process:
                     GO:0007076 - mitotic chromosome condensation [Evidence
                     IMP] [PMID 7698648]; GO_process: GO:0007067 - mitotic
                     nuclear division [Evidence IEA]; GO_process: GO:0000070 -
                     mitotic sister chromatid segregation [Evidence IMP] [PMID
                     10749931]; GO_process: GO:0070058 - tRNA gene clustering
                     [Evidence IMP] [PMID 18708579]"
                     /codon_start=1
                     /product="Brn1p"
                     /protein_id="XP_018736241.1"
                     /db_xref="GeneID:30036872"
                     /translation="MSLLRDGDGINFQRASYTLDGCVKIYTSRIDSVATETGKLLSGL
                     ADAKKNRGKGGDDEEVEGDDEGHEDEDGNDEESSKKRKRRPRAENTLVEEYSQLEVKK
                     LDLELNIDPLFRKMCADFDEGGAKGLLLNSLMIDKTGRVVFDGDANDGDDDEDEEADK
                     DEVDANTSTSSSGSSKDKTLNPHFQGDTIDMDLLRSKYFSNLDDLDELEICPSLPGIY
                     DALNDPALLNSQLVKELQEMSIKDRADYRPFAESLDDMALGEDGYGDAPPDMDYDDMP
                     ELIANDDDEASFAVGKGSTTVIPYTGATSVNVMSGRDTDILSYFDETLKKNWAGPEHW
                     KIQKLKDTTVAGIKTETSKEIKKPKKTKEQLVIDFLSDEGAIDESELFASGGNINLPK
                     SQRKSKDYNLLPDDRQFSSKKLIKLFSKPKGNVISNKLFGGAITGNQTSNDSEGIQEN
                     DENFWAKQYQQPEDGKSGSDYNQNFFNDDDYDGMGIPDIGGDEDDGLPLDAGESLYRD
                     GPTQLLAKGQRARPDYVNYAKFAKRVNVKLLKDNIWSVMKLPEPSSDETANEPKIDEV
                     DDDDVDPSTGKPLRKPSLAPAAEFTERKFTDLAKELKQVYPAQQMSEISTSFCFICVL
                     HLANERGLIIEDNEMHNDLTIKWDPSVPRGTAINSF"
     gene            <321891..>323192
                     /gene="IME4"
                     /locus_tag="AWJ20_4711"
                     /db_xref="GeneID:30036873"
     mRNA            <321891..>323192
                     /gene="IME4"
                     /locus_tag="AWJ20_4711"
                     /product="mRNA (N6-adenosine)-methyltransferase"
                     /transcript_id="XM_018881800.1"
                     /db_xref="GeneID:30036873"
     CDS             321891..323192
                     /gene="IME4"
                     /locus_tag="AWJ20_4711"
                     /codon_start=1
                     /product="mRNA (N6-adenosine)-methyltransferase"
                     /protein_id="XP_018736242.1"
                     /db_xref="GeneID:30036873"
                     /translation="MSSSSSSTIFSLNQALLYSPNTTINLSSYQNSIETPSSDIGSRI
                     ASHHLRSVSVTGSLDGEMSVNDNSLEEIVVSFLINHKPKLFPALPFGINVLLRTINQV
                     HNCHISSDAFDNACLNLAMQIPSSFVVSKMCSQNASYSSKYQLEFYDPEMLILWSSSS
                     LSTIFTRSSASSSGSSTLDCSISVIADHDTPNRNLNENIAYADNSKLYQTMLSLITND
                     DSYYAQMRQTLANLLSEPTQRNILYKEQILSASSTKPYVEICPYPKRNECLLQGRLDC
                     LRKIHFEPVITSNTDVSIGDCSYLDTCFKGKGCKYVHYRITYPDTFQRGQARQPQEAK
                     QNQGPLFHIAERDYSKPKVGQNISEKYLVLITRQIHKCLLTGLFRLLPSGFAAISGDL
                     TSAFSVTLVSSLPTVSAIEPQTTDLDNQFNLTDFQLLGIYI"
     gene            <324452..>327079
                     /gene="CUL3"
                     /locus_tag="AWJ20_4712"
                     /db_xref="GeneID:30036874"
     mRNA            <324452..>327079
                     /gene="CUL3"
                     /locus_tag="AWJ20_4712"
                     /product="cullin CUL3"
                     /transcript_id="XM_018881801.1"
                     /db_xref="GeneID:30036874"
     CDS             324452..327079
                     /gene="CUL3"
                     /locus_tag="AWJ20_4712"
                     /inference="similar to AA sequence:KEGG_Orthology:K03869"
                     /note="Ubiquitin-protein ligase; forms a complex with
                     Elc1p that polyubiquitylates monoubiquitylated RNA
                     polymerase II to trigger its proteolysis; cullin family
                     member with similarity to Cdc53p and human CUL3;
                     GO_component: GO:0031463 - Cul3-RING ubiquitin ligase
                     complex [Evidence IDA] [PMID 16675952]; GO_component:
                     GO:0031463 - Cul3-RING ubiquitin ligase complex [Evidence
                     IMP] [PMID 17296727]; GO_component: GO:0031461 -
                     cullin-RING ubiquitin ligase complex [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0031625 - ubiquitin
                     protein ligase binding [Evidence IEA]; GO_function:
                     GO:0004842 - ubiquitin-protein transferase activity
                     [Evidence IDA] [PMID 12676951]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence IDA]
                     [PMID 16675952]; GO_process: GO:0016567 - protein
                     ubiquitination [Evidence IEA]; GO_process: GO:0042787 -
                     protein ubiquitination involved in ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 17296727];
                     GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     IC] [PMID 12676951]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     ISS] [PMID 9531531]"
                     /codon_start=1
                     /product="cullin CUL3"
                     /protein_id="XP_018736243.1"
                     /db_xref="GeneID:30036874"
                     /translation="MATRGGRARIRAPKKSLADEANFDVSWNEKLSPAIREIYDKNAS
                     KRSFEELYRTAYYLVLKKHGKRLYESTKQQIREHLENKVVGSLTRYIQDHGQNSGSGT
                     SVAAGGDDNVDGTIRENGTELATTENATKTTPKGTLDLESVPVDFLKQVRRYWDDSCL
                     CMKMTSDILMYLDRVYVQDAKVPLIYDAGLILFRDAVIFNQKLPVGSIIDNIIINEVI
                     NERNGQIIDRVAIKATVNMLESLRDSHNPLFTSPIRTAQNDGRPYDYLKNGTDGLIDL
                     DSGFGSVYTGEFEPKFLASSEEYYSTTARNVLESTPDAHVYIQKVKFWLEEEAQRCNR
                     YLSIHTLDKVITLIEDVLITQRISEVLELPTTGLVSWIENEQYEDLSLAYQLVGRVDK
                     TYKCICELVKKDLLIAGREANNVAIRSSEEAKASKGRPKEKQDAANPASGAAGAGATA
                     TLNPTTIAINWVEQVIRLKDKYDKILIQCFENQQNIRIANEESFILFVNENPKVAEFL
                     SLFIDENLKRTIKGKSDEEIEDTLEKAITLFRYIADKDLFETYYKVHLAKRLLNGKSV
                     SDEVERNMIGKIKREVGTAFTSKLEGMFKDMRISKDINNEFKAAQSQLQQSDSGNKGL
                     ADIQVNVLTSTFWPSGIVNTQAKFVLPPVVDEAKQRFEKFYLGRHTGRVLAWNMSMGT
                     ADIKARFKKRTHEINLSTVAMVVLMLFNELPEGHYLTYEDIQNTTGIATSELTRHLQS
                     IAVAPRTRLLRKEPMSRDVKPTDKFYFNDKFESPMARIKVLAVSAKSKAENDSERKET
                     LDRVDQSRKYETDAAIVRIMKSRRTLEHVQLIADATRQLSSRFKPDPILIKQRIDALL
                     EREYLERDPERRNVYNYLA"
     gene            complement(<327291..>328283)
                     /locus_tag="AWJ20_4713"
                     /db_xref="GeneID:30036875"
     mRNA            complement(<327291..>328283)
                     /locus_tag="AWJ20_4713"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881802.1"
                     /db_xref="GeneID:30036875"
     CDS             complement(327291..328283)
                     /locus_tag="AWJ20_4713"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736244.1"
                     /db_xref="GeneID:30036875"
                     /translation="MSSLSPIPTSAAERLIRNPHSLPRVPTALANIISQNKHSDRIKH
                     HAEQAYFIRRAKLENQRSERILAAATTNGTSLSGSQYRDANATPSPPSSPILDAVSPT
                     NSRPRVFTHRRNSDTVTSTSVFSPSTQPIDIRRRSSSFTGHNGSPPRSGRPSPSRASR
                     SLSFSHVNNRRLSSIDPRESTTALFNSGVYFIPESPEEDELISLLYPLDATYHGPPVS
                     SSSGPGSPPPNLQHNMAFSSRIFSKKPEERLKQRCYFTKRPAPSWKSRNFEPIKQGKT
                     WVSAHPGWHRFMRNEYKVNGQEDTWREERSRFLQEFRRERQFQKQSKRRMSSHL"
     gene            complement(<330502..>330918)
                     /gene="RPS17B"
                     /locus_tag="AWJ20_4714"
                     /db_xref="GeneID:30036876"
     mRNA            complement(<330502..>330918)
                     /gene="RPS17B"
                     /locus_tag="AWJ20_4714"
                     /product="ribosomal 40S subunit protein S17B"
                     /transcript_id="XM_018881803.1"
                     /db_xref="GeneID:30036876"
     CDS             complement(330502..330918)
                     /gene="RPS17B"
                     /locus_tag="AWJ20_4714"
                     /inference="similar to AA sequence:KEGG_Orthology:K02962"
                     /note="Ribosomal protein 51 (rp51) of the small (40s)
                     subunit; homologous to mammalian ribosomal protein S17, no
                     bacterial homolog; RPS17B has a paralog, RPS17A, that
                     arose from the whole genome duplication; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0022627 - cytosolic small ribosomal
                     subunit [Evidence IBA]; GO_component: GO:0022627 -
                     cytosolic small ribosomal subunit [Evidence NAS] [PMID
                     9559554]; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence NAS] [PMID 9559554]; GO_process:
                     GO:0002181 - cytoplasmic translation [Evidence NAS] [PMID
                     9559554]; GO_process: GO:0000028 - ribosomal small subunit
                     assembly [Evidence IMP] [PMID 3915776]; GO_process:
                     GO:0006412 - translation [Evidence IEA]; GO_process:
                     GO:0006414 - translational elongation [Evidence IBA]"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S17B"
                     /protein_id="XP_018736245.1"
                     /db_xref="GeneID:30036876"
                     /translation="MGRVRTKTVKRAAKQIIEGYYPKLTLDFETNKRLADEIAFIPSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERRDQYVPEVSALDVSQTENGLEV
                     DADTANLLKTLGFAKLPVSVVHVSQQAPERRFRKRN"
     gene            <332839..>334332
                     /gene="ADA2"
                     /locus_tag="AWJ20_4715"
                     /db_xref="GeneID:30036877"
     mRNA            <332839..>334332
                     /gene="ADA2"
                     /locus_tag="AWJ20_4715"
                     /product="chromatin-binding transcription regulator ADA2"
                     /transcript_id="XM_018881804.1"
                     /db_xref="GeneID:30036877"
     CDS             332839..334332
                     /gene="ADA2"
                     /locus_tag="AWJ20_4715"
                     /inference="similar to AA sequence:KEGG_Orthology:K11314"
                     /codon_start=1
                     /product="chromatin-binding transcription regulator ADA2"
                     /protein_id="XP_018736246.1"
                     /db_xref="GeneID:30036877"
                     /translation="MIVEQHAYPIFDDDWGADEELLLLEGAELQGLGNWQDISDHIGG
                     RSREEVDEHYNKVYLQSATYPLPEMNKKFNISPAEFAEKKRQRLEDRRKNAPALPIPK
                     QKPTASVPACHEVQGYMPGRLEFEQETENEAEMSVKDMVFDPEEPSQEVNFKLTILDI
                     YNSRLTTRAERKRSILAHGLLDYRKNAGIEKKRTKEERDLVNKLKPFARMMTRKDYEM
                     LTDSMLTELRCRRRIAELQEYRRNGIRTLEAAAKYERDKVTRINALNRAGIILGGGMT
                     PSSNSTILNNSNIINGTSLTRNSLGSKPGTPGPLNSTSSIDSTSTVNDSTSSTNGSSN
                     VNNTAVSVMSPLGYKFSPSVFTNISESERSSPFGSLSLPGTSSSTALNGGSGSGLGST
                     GGSVTPTATTNGTTLKIRKSISMTTPPLDISQAADVELLSPQEQLLCSQLRILPKPYL
                     AIKETLFRELVRTGGILKRKTARELIKIDAAKTGRIYEFFQSQNWLS"
     gene            complement(<334548..>335276)
                     /locus_tag="AWJ20_4716"
                     /db_xref="GeneID:30036878"
     mRNA            complement(<334548..>335276)
                     /locus_tag="AWJ20_4716"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881805.1"
                     /db_xref="GeneID:30036878"
     CDS             complement(334548..335276)
                     /locus_tag="AWJ20_4716"
                     /inference="similar to AA sequence:KEGG_Orthology:K14397"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736247.1"
                     /db_xref="GeneID:30036878"
                     /translation="MTTVTETARKTTILPPLPKPFTEKQAPTIRLYPVSNYTFDVKEA
                     QPEEDNSVTGRLQRLQEQYETSGMRRTCEGILVCHEHGHPYVLLLQIANTFFKLPGDY
                     IQPDQDEITGFKQRLNERLAPAKDSEHASDPINSEWEIGDCITQWWRPNFETFMYPFI
                     PPHISRPKECKKMFLIHLPKHKVLSVPQNMKLLAVPLFELYDNATRYGNQLAAIPLYL
                     SRYNFEFVDSDDNVIATYPASNAN"
     gene            complement(<337729..>338937)
                     /gene="UTP6"
                     /locus_tag="AWJ20_4717"
                     /db_xref="GeneID:30036879"
     mRNA            complement(<337729..>338937)
                     /gene="UTP6"
                     /locus_tag="AWJ20_4717"
                     /product="Utp6p"
                     /transcript_id="XM_018881806.1"
                     /db_xref="GeneID:30036879"
     CDS             complement(337729..338937)
                     /gene="UTP6"
                     /locus_tag="AWJ20_4717"
                     /inference="similar to AA sequence:KEGG_Orthology:K14557"
                     /note="Nucleolar protein; component of the small subunit
                     (SSU) processome containing the U3 snoRNA that is involved
                     in processing of pre-18S rRNA; GO_component: GO:0030686 -
                     90S preribosome [Evidence IDA] [PMID 12150911];
                     GO_component: GO:0034388 - Pwp2p-containing subcomplex of
                     90S preribosome [Evidence IDA] [PMID 15231838];
                     GO_component: GO:0034388 - Pwp2p-containing subcomplex of
                     90S preribosome [Evidence IDA] [PMID 17515605];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     12068309]; GO_component: GO:0005730 - nucleolus [Evidence
                     IDA] [PMID 12150911]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0032040 - small-subunit processome [Evidence IDA] [PMID
                     12068309]; GO_function: GO:0030515 - snoRNA binding
                     [Evidence IPI] [PMID 12068309]; GO_process: GO:0006396 -
                     RNA processing [Evidence IEA]; GO_process: GO:0000480 -
                     endonucleolytic cleavage in 5'-ETS of tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 15489292]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000472 - endonucleolytic cleavage to
                     generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000462 - maturation of SSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 12068309]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Utp6p"
                     /protein_id="XP_018736248.1"
                     /db_xref="GeneID:30036879"
                     /translation="MSDKVRFYLEQSVAELEDLRKKELFTKQELAVIMRKRTDHEHRI
                     SGRTVKPRDFLKYAEYEINVERLRKKRVKRLGNKDVGGKSGISDWAGPRRIMFIFDRS
                     TKRFPGEIQLWLQYLEYAKQQKAIHVINKIFTTMLQLHPTKPKLWILAAKHESDENAS
                     MKAARYILQRSLRFNYDSELLWYEYIKLELIYVSKILARRKLLGLDLDTEEQQAQKEQ
                     DEEDEESEAHIELPDIKEQVKDDLKALPEADMSMLGNPQTNPALRGDVALAIYDASME
                     RAKTVDAKYDFSLKIIELFDSFIDLDRAHLSKHVIDYLSHTQASPKTLFLSTTLPVRY
                     VSHDDPTFPDMIKLMITKYNKSLSLEEKTPELKQHLREFLTSKYLEPTLEPALDQNIR
                     LVLQSFTKKL"
     gene            <339974..>341797
                     /gene="AMF1"
                     /locus_tag="AWJ20_4718"
                     /db_xref="GeneID:30036880"
     mRNA            <339974..>341797
                     /gene="AMF1"
                     /locus_tag="AWJ20_4718"
                     /product="Amf1p"
                     /transcript_id="XM_018881807.1"
                     /db_xref="GeneID:30036880"
     CDS             339974..341797
                     /gene="AMF1"
                     /locus_tag="AWJ20_4718"
                     /note="Putative paralog of ATR1; but not required for
                     boron tolerance; member of the DHA2 family of drug:H+
                     antiporters; YOR378W is not an essential gene;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0008150 - biological_process
                     [Evidence ND]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Amf1p"
                     /protein_id="XP_018736249.1"
                     /db_xref="GeneID:30036880"
                     /translation="MPDNEQNQNGDSFHEDRPVVTNRPSHTSAIPTSNPPSSPPSIRH
                     VESETNQLWSRMSIKMSVVEQQNSGLNSEIASENHVDLYHQGEAEETDLDVASRVPTN
                     MSALSELAMKRPACFRSTFHEVVCVFILTMAPVLSSTNNGVLYIALPRIGKEFRVADG
                     TLSWTMSASSLATGAFLLLMGQLADTIGRRRMVLFSYAFYTLMSLGAGLCKNYIGFTI
                     LRALQGIASAAGVTAAVGILGSEYLPGKRRNFALAAFSSGAPLGFVFGLLAGGISTEI
                     LNWESSLYFFAMVYFVLTIIGFFVIPKSDPRFDRRFLYESLQKIDYVGALLTISGFTL
                     FVFALSQWSSTAHGWKTPYILVCLFLGALIIALLCVYEGYVPARPLMPMHIWIAPGFA
                     LCMATIICGWILFTGVVSYYATLYFQNIRHTSPILTTACFLPMAIGGIMVNVFAGLVL
                     HKISGRILLIVAMASFTISALLWSFVGEHTLYWALPFPGLLLVVVGADLAYNVCNMHA
                     LSTVDKSLQSTAAGVFNTCLQLATALGLAISSSVVAAVVPDQLNATPSELLKGYRAGY
                     WFATGVGGLGLIFSFFLKIGTQGGRTKRKTVSEKDPAPSDV"
     gene            complement(<343594..>346173)
                     /gene="YPK1"
                     /locus_tag="AWJ20_4719"
                     /db_xref="GeneID:30036881"
     mRNA            complement(join(<343594..345933,346144..>346173))
                     /gene="YPK1"
                     /locus_tag="AWJ20_4719"
                     /product="serine/threonine protein kinase YPK1"
                     /transcript_id="XM_018881808.1"
                     /db_xref="GeneID:30036881"
     CDS             complement(join(343594..345933,346144..346173))
                     /gene="YPK1"
                     /locus_tag="AWJ20_4719"
                     /inference="similar to AA sequence:KEGG_Orthology:K13303"
                     /codon_start=1
                     /product="serine/threonine protein kinase YPK1"
                     /protein_id="XP_018736250.1"
                     /db_xref="GeneID:30036881"
                     /translation="MDQTSQESSFRSTTGSGAAPQPPEAAPEPKLTNPLELKETHLSA
                     AFSPRSSASSSSTNGGADSSPNGKSGASSGASSTSDLAGSNNSNRTPVSFVSVTTGHH
                     SPGRKIPNSSASSLETISGNNSSGAATSGSPSVVPALSSSVSSSVSLNANSTNSSSGQ
                     AANPAISSASSSSSAAAVASASAAAADAAIKEGDPATSTSTITPGLLSVSITKAVGLS
                     LPPGNVWPNYILNATNSSIGAGSVSGSIAPGGTGSGIGGVGSLSNGNSISPRKQQLSS
                     PSQLHQLQRDKQSPSNLGRRRPPPIYIVLEYDKTQVILDAMGGTVDGPIWDKVSNFDV
                     SRIESLSIQVFAKIPVTVNTDGTSSVGAGGSVIVGGESPFTPPRQSLGDNGTAESTRG
                     GNLNSEALRKKGYQEIFLGTCKIDANLSKTVICDGWLPLSSGTGKIQVRIEFKANKNN
                     KHLTIEDFDLLKVVGKGSFGKVMQVRKIDTRRIYALKTIRKAHIISRSEVNHTLAERT
                     VLAQIDNPFIVPLKFSFQSPEKLYLVLAFVNGGELFHHLQREGRFDLNRSRFYTAELL
                     CALECLHEYNVIYRDLKPENILLDYTGHIALCDFGLCKLNMAGQEKTNTFCGTPEYLA
                     PELLLGQGYTKVVDWWTLGVLFYEMLTGLPPFYDQDTNEMYRKILQDPLRFPDDMDRE
                     ARSLLTGLLNRDPKKRLGVNGAAEIKAHPFFAQIDWKRLMNKKYAAPFKPSVESATDT
                     SNFDQEFTSEVPTDSVVEKDFYLSESVQQQFGGWTYTNTDSKLASSGRW"
     gene            <352921..>356430
                     /gene="HSL1"
                     /locus_tag="AWJ20_4720"
                     /db_xref="GeneID:30036883"
     mRNA            <352921..>356430
                     /gene="HSL1"
                     /locus_tag="AWJ20_4720"
                     /product="protein kinase HSL1"
                     /transcript_id="XM_018881810.1"
                     /db_xref="GeneID:30036883"
     CDS             352921..356430
                     /gene="HSL1"
                     /locus_tag="AWJ20_4720"
                     /inference="similar to AA sequence:KEGG_Orthology:K02515"
                     /codon_start=1
                     /product="protein kinase HSL1"
                     /protein_id="XP_018736251.1"
                     /db_xref="GeneID:30036883"
                     /translation="MTTVAVAAAQAATHTASSGPAAGSDEAVKANHRLSQTSNHSSAS
                     KRSKSHVGPWRLGRTLGRGSSGRVRLAKHSLTGQLAAVKIVPKEIVVGGGSAGNGAAT
                     SPSANGGAGPGATAVVDATQYGSDPKDQGGLPYGIEREVIIMKLIEHPNVMALYDVWE
                     NKGELYLVLEYVEGGELFDYLIKKGRLDEREAVNYFRQIIYGVDYCHKFNICHRDLKP
                     ENLLLDKNRNIKIADFGMAALETSDRMLETSCGSPHYASPEIVAGKNYHGAPSDIWSC
                     GVILFALLTGHLPFDDDNIRKLLLKVQTGKFIMPSDISSEAQDLIWRMLRVDPIKRIS
                     MAEILRHPLLKKYPVRKNGHHNTRLHQPVDTIFANADRPVKTVSDIDPEILKNLQILW
                     HGASKKAVIEKLLAPGPNSEKTFYCLLMKYRHDHRQDEEYSNNKNNSVSRDNESSSHH
                     HASRHNHTHTHHQSHHRKRSSQVSITLKKTAVRNAAGAAGPHSRNHSRSNSVASVITA
                     SSSHRRNVAFVRKRASSSHMRHQSGNTTPQKTTPPSSIIARNATTTTTTSTANPTSAG
                     ATTTSTEIETATTAVTAKPQVESLPIPRTYINQTPTPHLTPEEDFNFISKRASVELAS
                     MCEQAFFSTDLPSRTSDRAVSDPLSSIKAPKMATTEKRVFSLGEHEVNSVEPGSRPYS
                     AYSTVSEASTTSTATPYFLPMIFEEDRFADAIEEEVDLKIYKRPNRAHDKRDTITQDY
                     DYDYDYFKQESVLAQPKKRELVPPSAHTAVTKESSRLQISGLVKTDSFKARSHTGFAA
                     YRTPSAPVPKPNPVVTTEPVLLISPSPPPSPIEATNSITTATGKDSSDNTTKPSQSDR
                     RPNTANNNTKSSAKSTNRPATTTKQAPVVSTSTITTTNASKPISNPYKNSQVSQVQRT
                     KTDPLKNHDQQPVSKPVRKPLAVKSNNIMITSNDVTDMSDLKSKEAAATAKPNAATSL
                     FRRLTLNPRRPPPPPPPATAVSTTQPQAVRPAPPPPPAPTVATRTSSGKSNEVKQNWF
                     MKMLNPNPQYTTRPTPSTAKKSQYATKTLFSTSSVTTMRHIIVEVLEDWQKYGISQIN
                     EDSVSSTVTAVISSRNVLSMRSAKFRINVYPMQGGTRAVFTQEKGSNTTFLRFLGELE
                     RALGEMDVLSPPRTDARTAIGLR"
     gene            <356877..>358460
                     /gene="NAM9"
                     /locus_tag="AWJ20_4721"
                     /db_xref="GeneID:30036884"
     mRNA            <356877..>358460
                     /gene="NAM9"
                     /locus_tag="AWJ20_4721"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_018881811.1"
                     /db_xref="GeneID:30036884"
     CDS             356877..358460
                     /gene="NAM9"
                     /locus_tag="AWJ20_4721"
                     /note="Mitochondrial ribosomal component of the small
                     subunit; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005763 - mitochondrial
                     small ribosomal subunit [Evidence IPI] [PMID 11278769];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0019843 - rRNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IPI] [PMID 11278769]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 11278769]"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_018736252.1"
                     /db_xref="GeneID:30036884"
                     /translation="MTRRNKVLFSLTRKRIRPSYNKYNVFNAMTWRKNIRRGTLYQQI
                     FSAKQESRSYHGEHLTETQFRNIFKSELNSVNPLQSTKSAGSAESKSSQDEIPWALQT
                     YVGLERRLDTAVFRAMFASSIRQSAQFIVRGNVKVNGIKIKQPGYILRPGDVFSVEPE
                     RVLEALGRQKPTIKQSVELVNKQIKKYNKYLDKCRAKPEVMWRIRQHNRKRNKAYYTK
                     YLEKQTARNIAWNKQVREDMSKKIDEVTPVSVLEGILRNEAYFNKHGTLPQDGGKAIL
                     AKSLSIYGLVKGVNVNLKVDSAPAVKAAATETTTENTASETASETASETATETATEST
                     TESSAAAAAETGEVASADVSKTVSKYYSKEESGESGPANKSDVKKLVQDVVKLRQEHI
                     RQTYSSKIRDLKNSSEEYDPTWVDRLPEKLPIVRAKDAREDINSVLPIRLPYGHGKLY
                     GLSKPEKGYFTPWTPRQFLTPFAVLPHHIEVSFLTCHAVYLRDPVARPGHSELVSPFP
                     LDMHERAHMYYFARRRKNI"
     gene            complement(<358683..>360675)
                     /gene="SRV2"
                     /locus_tag="AWJ20_4722"
                     /db_xref="GeneID:30036885"
     mRNA            complement(join(<358683..360369,360614..>360675))
                     /gene="SRV2"
                     /locus_tag="AWJ20_4722"
                     /product="Srv2p"
                     /transcript_id="XM_018881812.1"
                     /db_xref="GeneID:30036885"
     CDS             complement(join(358683..360369,360614..360675))
                     /gene="SRV2"
                     /locus_tag="AWJ20_4722"
                     /inference="similar to AA sequence:KEGG_Orthology:K17261"
                     /note="CAP (cyclase-associated protein); N-terminus binds
                     adenylate cyclase and facilitates activation by RAS;
                     N-terminus forms novel hexameric star-shaped shuriken
                     structures that directly catalyze cofilin-mediated
                     severing of actin filaments; C-terminus, in physically and
                     genetically separate activity, binds and recycles cofilin
                     bound, ADP-actin monomers, facilitating regulation of
                     actin dynamics and cell morphogenesis; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IEA];
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     IDA] [PMID 8552082]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_function: GO:0003779 - actin binding [Evidence
                     IEA,IEA]; GO_function: GO:0003779 - actin binding
                     [Evidence IDA] [PMID 19201756]; GO_function: GO:0008179 -
                     adenylate cyclase binding [Evidence IDA] [PMID 2184942];
                     GO_process: GO:0007265 - Ras protein signal transduction
                     [Evidence IMP] [PMID 9774417]; GO_process: GO:0030036 -
                     actin cytoskeleton organization [Evidence IEA];
                     GO_process: GO:0007015 - actin filament organization
                     [Evidence IDA,IMP] [PMID 19201756]; GO_process: GO:0051014
                     - actin filament severing [Evidence IDA] [PMID 23135996];
                     GO_process: GO:0000902 - cell morphogenesis [Evidence
                     IEA]; GO_process: GO:0007010 - cytoskeleton organization
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Srv2p"
                     /protein_id="XP_018736253.1"
                     /db_xref="GeneID:30036885"
                     /translation="MSVNENTPSGPGYNIVTLMKRLEAATSRLEDLTVYHSEALSRSA
                     LGTAAGVTAEKRAEAAAGSDAGSAVGEKGVGSGADSIATSPTDTSGSGGVGSTPAAKS
                     VDSPSSSPIIEEFETIIKTGLTQLLALSKSLDPLIEEQVIPLLRAFEAERDFLIVSLK
                     ASKPDVSSKTFSELFAPIQQHAETIINIRETNRGSKFINHLATVAEGIPALGWVTVDS
                     PVDYISDFKDSAQFYSNRILKEYKDVEKKHVDWARTFSSVIVDLQSFVRKHYPKGLQW
                     NENGKPLDVVIKEKNEEGASTSVIATPAVTPPDSTSGAAKTGGAPPPPPPPPASLFTD
                     DAKSGPETDSSSSSGGGMNAVFAALNQGEGITSSLKKVDKSEMTHKNPALRAGANEAS
                     KVKKSPPPPKKPASLAAGAPSAASNVQSKKKPAHKELIDTKWIVEYFENEHKIVIEGE
                     MNQGVFIDRCSNCTIQIKGKVSAITINECSKVGVLFENLVSGVDVIKSTGFGLQVTGS
                     MPTLTIDQSHEGQIYLSEESLNVDIYTSQTSAINIEVPRNAEEGDYSETPLPEQVVHR
                     IGPNGQLTSTVVAIDG"
     gene            <361197..>363431
                     /gene="ARP5"
                     /locus_tag="AWJ20_4723"
                     /db_xref="GeneID:30036886"
     mRNA            <361197..>363431
                     /gene="ARP5"
                     /locus_tag="AWJ20_4723"
                     /product="Arp5p"
                     /transcript_id="XM_018881813.1"
                     /db_xref="GeneID:30036886"
     CDS             361197..363431
                     /gene="ARP5"
                     /locus_tag="AWJ20_4723"
                     /inference="similar to AA sequence:KEGG_Orthology:K11672"
                     /note="Nuclear actin-related protein involved in chromatin
                     remodeling; component of chromatin-remodeling enzyme
                     complexes; promotes nucleosome shifts in the 3 prime
                     direction; GO_component: GO:0031011 - Ino80 complex
                     [Evidence IEA]; GO_component: GO:0031011 - Ino80 complex
                     [Evidence IDA,IMP] [PMID 12887900]; GO_component:
                     GO:0031011 - Ino80 complex [Evidence IDA] [PMID 15525518];
                     GO_component: GO:0031011 - Ino80 complex [Evidence IPI]
                     [PMID 24034245]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 10923024]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 11011149]; GO_function:
                     GO:0043140 - ATP-dependent 3'-5' DNA helicase activity
                     [Evidence IDA] [PMID 10952318]; GO_process: GO:0006281 -
                     DNA repair [Evidence IEA]; GO_process: GO:0006338 -
                     chromatin remodeling [Evidence IMP] [PMID 12887900];
                     GO_process: GO:0006338 - chromatin remodeling [Evidence
                     IPI] [PMID 15525518]; GO_process: GO:0042766 - nucleosome
                     mobilization [Evidence IDA] [PMID 12887900]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA,IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Arp5p"
                     /protein_id="XP_018736254.1"
                     /db_xref="GeneID:30036886"
                     /translation="MPPSIDSVKVEEPVEEFAPVLYPLRDIEKPEAVEPITGGWKEGV
                     PIAIDFGSYQTRIGYANEESPSHEFFSQVSKFRDRRANRSYTLVGNDIYLDATARQSI
                     KSPFDGPLISNWDATETILDYSFAKLSVGSRNGVENPIVMTEILGAPEPQRKFMNELL
                     FEGYNVPSLTYGIDSLFSFHYNQGVNVSDSSHTGIVVSCGHEATHIIPVIKGRGILSQ
                     AKRINWGGRQASSYLQALLALKYPYFPTKVTPSQATYMIHDHCYVSSDYPQELSNYLE
                     YSTMSTRERIIQAPFTEVVVQEKSEEELARIAEQRKESGRRLQEQAAKKRLEKLVQQE
                     QELEYYNELKNRIASAPNKKEVKRMLDGEGIKDEAALQKTISELEKTIRRGRKQDVGD
                     DTEEQVAPSFPLVEIPDEDLDEEQIKEKRRQRLLKASYDARMRAKEEKLLEEQRLAEE
                     ARKDDEWREADLEGWIKEKRDKLDGLLANVREKERLREELSNRKSHASQMRMKSIAVL
                     ASDSRGGNKRRRAAGAGDDDPDDTFGANDDDWAVYRRIANASDSEEEEEEKNTIKALQ
                     EQLLQHDPTFSIEDTREAQLDWRKSTIHMFLRGPHEFDPESRAQSHQLNLNVERIRVP
                     EVLFQPSIAGVDQAGIVEVCGDILLRNKTIPYANNLFLHGGQAHFPNFEDRLFNELRA
                     ILPVNTSLSVKRASNLSFDAWRGMAQWSLTDDFRSSVVTREDYLEMGSGYIKEHGFGN
                     ALVR"
     gene            <363829..>363940
                     /locus_tag="AWJ20_4724"
                     /db_xref="GeneID:30036887"
     tRNA            <363829..>363940
                     /locus_tag="AWJ20_4724"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:30036887"
     gene            complement(<364114..>365994)
                     /gene="NCL1"
                     /locus_tag="AWJ20_4725"
                     /db_xref="GeneID:30036888"
     mRNA            complement(<364114..>365994)
                     /gene="NCL1"
                     /locus_tag="AWJ20_4725"
                     /product="Ncl1p"
                     /transcript_id="XM_018881814.1"
                     /db_xref="GeneID:30036888"
     CDS             complement(364114..365994)
                     /gene="NCL1"
                     /locus_tag="AWJ20_4725"
                     /inference="similar to AA sequence:KEGG_Orthology:K14835"
                     /note="S-adenosyl-L-methionine-dependent tRNA:
                     m5C-methyltransferase; methylates cytosine to m5C at
                     several positions in tRNAs and intron-containing
                     pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
                     at wobble position in response to hydrogen peroxide,
                     causing selective translation of mRNA from genes enriched
                     in TTG codon; loss of NCL1 confers hypersensitivity to
                     oxidative stress; similar to Nop2p and human proliferation
                     associated nucleolar protein p120; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9767141];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA,IEA];
                     GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016428 - tRNA
                     (cytosine-5-)-methyltransferase activity [Evidence IEA];
                     GO_function: GO:0016428 - tRNA
                     (cytosine-5-)-methyltransferase activity [Evidence IDA]
                     [PMID 10445884]; GO_function: GO:0000049 - tRNA binding
                     [Evidence IEA]; GO_function: GO:0000049 - tRNA binding
                     [Evidence IDA] [PMID 17567576]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0070301 - cellular response to hydrogen peroxide
                     [Evidence IMP] [PMID 22760636]; GO_process: GO:0032259 -
                     methylation [Evidence IEA]; GO_process: GO:0030488 - tRNA
                     methylation [Evidence IDA] [PMID 10445884]; GO_process:
                     GO:0008033 - tRNA processing [Evidence IEA]; GO_process:
                     GO:0002127 - wobble base cytosine methylation [Evidence
                     IMP] [PMID 22760636]"
                     /codon_start=1
                     /product="Ncl1p"
                     /protein_id="XP_018736255.1"
                     /db_xref="GeneID:30036888"
                     /translation="MGRKAKNKQPAPPSLDEFHEGKKRKGHKSAGSSSSSSKKHKPNG
                     TNGTTEHKSKRSSKSKTSAPIDKEEIEKTKKSLFENSDEEEDDDVVGSELDDDEFYDS
                     DEDRQAKPMFSDDDEDDEILEQMNKKAAATFGLEDSEDEEDDDEDEEENDEFDVDEED
                     EDDDEDDEDGEDDSGKYATEEAPKAHVLPSEQEKEIETQHPTDLHALRTRILEVVKVL
                     EDFKTLAEEGRSRSEYTDQLLDDIAAYYGYSRYLAEKLFNLFSPAEAIEFFEANEVAR
                     PVTIRTNTLKTRRRDLAQALINRGVNLQPIGKWTKVGLQVFESQVPIGATPEYLAGHY
                     ILQAASSFLPVMALDPQENERVLDMASAPGGKTTFISAMMKNTGCVFANDSNKSRTKS
                     LIANIHRLGCSNTIVCNYDAREFPKVIGGFDRVLLDAPCSGTGVIAKDPAVKTSRTEK
                     DFIQLPHLQKQLLLSAIDSVDASSKTGGVIVYSTCSVMVEENEAVVDYVLRKRPNVKL
                     VETHLEIGKEGFTNFRGKKFDPSVKLTRRYYPHTYNVDGFYVAKFQKTSGSFHDNSKA
                     GAREKERAIREDEDAEPLIHGDFAEFNDPEDSALIEQTRRRSMKKKGLNPNAHKPKPA
                     KN"
     gene            <366366..>367721
                     /gene="GCD10"
                     /locus_tag="AWJ20_4726"
                     /db_xref="GeneID:30036889"
     mRNA            <366366..>367721
                     /gene="GCD10"
                     /locus_tag="AWJ20_4726"
                     /product="Gcd10p"
                     /transcript_id="XM_018881815.1"
                     /db_xref="GeneID:30036889"
     CDS             366366..367721
                     /gene="GCD10"
                     /locus_tag="AWJ20_4726"
                     /inference="similar to AA sequence:KEGG_Orthology:K03256"
                     /note="Subunit of tRNA (1-methyladenosine)
                     methyltransferase with Gcd14p; required for the
                     modification of the adenine at position 58 in tRNAs,
                     especially tRNAi-Met; first identified as a negative
                     regulator of GCN4 expression; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 9851972]; GO_component:
                     GO:0031515 - tRNA (m1A) methyltransferase complex
                     [Evidence IDA,IPI] [PMID 10779558]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0016429 - tRNA (adenine-N1-)-methyltransferase activity
                     [Evidence IDA] [PMID 10779558]; GO_function: GO:0003743 -
                     translation initiation factor activity [Evidence IEA];
                     GO_process: GO:0006446 - regulation of translational
                     initiation [Evidence IEA]; GO_process: GO:0030488 - tRNA
                     methylation [Evidence IDA] [PMID 10779558]; GO_process:
                     GO:0008033 - tRNA processing [Evidence IEA]; GO_process:
                     GO:0006413 - translational initiation [Evidence IEA]"
                     /codon_start=1
                     /product="Gcd10p"
                     /protein_id="XP_018736256.1"
                     /db_xref="GeneID:30036889"
                     /translation="MTSTRQQKQLQSLQQQDPESIDYSHEFDQTHIKPGQYVMIRLPS
                     ENFRVLQLHPGQTVNLGKFGSFKVDDILNHPYGYTYEIGADNKLSIVNHNYELDNQDE
                     PVSELAPHENNRELVDDSSVQGLSMAEIEELKKGGLSGKQIIEKVKTSHSSFDKKTAF
                     SKEKYLKRKQQKFLNQFTPEPIGSAELIDIYLDKDASRIQNMSEESLALMLSLANVRP
                     GGTYLVVDDISGLLVGAMMERMGGEGLIVVAHDNEHPNLDGLRYMNYSQGLIAKMIKT
                     VNWLEFFEPSEIEPFEEKTTEELQQLKSNQRGQYYRRRTRYNDSVTVQNLISNSGFDG
                     LLVATGLHLASLIPRIIPAVGGSRPIVMFSETKELLTETTLVLHKDFRVISPTILETR
                     LRKYQTLPGRMHPHMTSRGGGGYVLWGIRVFPDENANAVGKVHRKRKATDSGTSTPAE
                     E"
     gene            complement(<367873..>368628)
                     /gene="MTQ1"
                     /locus_tag="AWJ20_4727"
                     /db_xref="GeneID:30036890"
     mRNA            complement(<367873..>368628)
                     /gene="MTQ1"
                     /locus_tag="AWJ20_4727"
                     /product="Mtq1p"
                     /transcript_id="XM_018881816.1"
                     /db_xref="GeneID:30036890"
     CDS             complement(367873..368628)
                     /gene="MTQ1"
                     /locus_tag="AWJ20_4727"
                     /note="S-adenosylmethionine-dependent methyltransferase;
                     methylates translational release factor Mrf1p; similar to
                     E.coli PrmC; is not an essential gene; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_function: GO:0008757 -
                     S-adenosylmethionine-dependent methyltransferase activity
                     [Evidence IDA,IMP] [PMID 16321977]; GO_function:
                     GO:0008168 - methyltransferase activity [Evidence
                     IEA,IEA]; GO_function: GO:0008276 - protein
                     methyltransferase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0032259 - methylation [Evidence IEA];
                     GO_process: GO:0006479 - protein methylation [Evidence
                     IEA]; GO_process: GO:0006451 - translational readthrough
                     [Evidence IGI] [PMID 16321977]"
                     /codon_start=1
                     /product="Mtq1p"
                     /protein_id="XP_018736257.1"
                     /db_xref="GeneID:30036890"
                     /translation="MRGRGVPLQYIIGSQPFGDLDIKCARGVLIPRWETEEWTLKLAQ
                     LLQYQQLIEQDQNSSRPHSQMTVVDLCTGTGCIPLSLASKLRNTVAYGVDISQKAVKL
                     FKSNIKSVNRSRRLDKRNSKVIPAQGDISIDPYVFCEKTGITDADIVTANPPYIGRRE
                     FFSQTERSVRLYEPHQALLGGLEFYRWIYDLSVHLQAKGLVCEVGNAGQIDFMRSLGA
                     KNGWSSSEFHDLNGHPRAVVMWKDPSWSFLEAL"
     gene            <369392..>370609
                     /locus_tag="AWJ20_4728"
                     /db_xref="GeneID:30036891"
     mRNA            <369392..>370609
                     /locus_tag="AWJ20_4728"
                     /product="putative cysteine synthase"
                     /transcript_id="XM_018881817.1"
                     /db_xref="GeneID:30036891"
     CDS             369392..370609
                     /locus_tag="AWJ20_4728"
                     /inference="similar to AA sequence:KEGG_Orthology:K01738"
                     /note="Putative cysteine synthase; localized to the
                     mitochondrial outer membrane; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16407407]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004124 - cysteine
                     synthase activity [Evidence IEA]; GO_function: GO:0003674
                     - molecular_function [Evidence ND]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0008150 - biological_process [Evidence ND];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0019344 - cysteine
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0006535 - cysteine biosynthetic process from serine
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative cysteine synthase"
                     /protein_id="XP_018736258.1"
                     /db_xref="GeneID:30036891"
                     /translation="MTHYSRSEDIVLTIYIRDPDRTMLAKRLVLSSGLLGKGSVSLAA
                     RGYATIGTAADGGPFVPPFIPLVSESGFPGAVGNTPLVRLNKLSDETGTNIYGKAEFM
                     NPGGSVKDRAALFIIQDAEKKGLIKPGGTIVEGTAGNTGIGLAHMCRARGYKCVIYMP
                     NTQSQGKIDHLRRLGAEVYPVPAVAFDNPDNYNHQAKRHADRLDNAVWTNQFDNVANR
                     QAHIETTGPEIWAQTNGKLDAFTCATGTGGSLAGTTRYLKEISNGRVKAFLADPPGSV
                     LHSYISSGGKLIERSGSSITEGIGQGRVTDNLKPDIELMDGSLTISDEKTINMVYRLL
                     DEEGLYLGASSCLNVVAAYEVAQKLGPGSTVVTLLCDSADRYADRLFSRKWLQSKNLD
                     VLPEHLQKYIVLE"
     gene            complement(<370763..>371788)
                     /gene="PPH21"
                     /locus_tag="AWJ20_4729"
                     /db_xref="GeneID:30036892"
     mRNA            complement(<370763..>371788)
                     /gene="PPH21"
                     /locus_tag="AWJ20_4729"
                     /product="phosphoprotein phosphatase 2A catalytic subunit
                     PPH21"
                     /transcript_id="XM_018881818.1"
                     /db_xref="GeneID:30036892"
     CDS             complement(370763..371788)
                     /gene="PPH21"
                     /locus_tag="AWJ20_4729"
                     /inference="similar to AA sequence:KEGG_Orthology:K04382"
                     /note="Catalytic subunit of protein phosphatase 2A (PP2A);
                     functionally redundant with Pph22p; methylated at C
                     terminus; forms alternate complexes with several
                     regulatory subunits; involved in signal transduction and
                     regulation of mitosis; forms nuclear foci upon DNA
                     replication stress; PPH21 has a paralog, PPH22, that arose
                     from the whole genome duplication; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 22842922];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0000159 - protein phosphatase
                     type 2A complex [Evidence IDA] [PMID 17550305];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA,IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0004721 - phosphoprotein
                     phosphatase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004722 - protein serine/threonine phosphatase activity
                     [Evidence IMP] [PMID 2176150]; GO_process: GO:0000082 -
                     G1/S transition of mitotic cell cycle [Evidence IGI] [PMID
                     12518319]; GO_process: GO:0007015 - actin filament
                     organization [Evidence TAS] [PMID 9001215]; GO_process:
                     GO:0007117 - budding cell bud growth [Evidence TAS] [PMID
                     9001215]; GO_process: GO:0007094 - mitotic spindle
                     assembly checkpoint [Evidence IPI] [PMID 9001215];
                     GO_process: GO:0006470 - protein dephosphorylation
                     [Evidence TAS] [PMID 9001215]; GO_process: GO:0006417 -
                     regulation of translation [Evidence IPI] [PMID 10329624]"
                     /codon_start=1
                     /product="phosphoprotein phosphatase 2A catalytic subunit
                     PPH21"
                     /protein_id="XP_018736259.1"
                     /db_xref="GeneID:30036892"
                     /translation="MEVDQEDPLSQVKHPASTSRSGDGIPEIKPAENLHSIGIGILET
                     WIERLLKCEILSESQVMRLCDTAREILVNESNVQPVSSPVTICGDIHGQFHDLLELFR
                     IGGPCPDTNYLFMGDYVDRGYFSVETISLLLAYKVRYPHRITILRGNHESRQITQVYG
                     FYDECLRKYGNTKVWTAFTDLFDYLPLTALVENRIFCLHGGLSPSIETLDQIVQLDRF
                     QEAPHEGPVCDLLWSDPDERSAWGVSPRGAGFTFGFDISSQFNHANSLSLIARAHQLI
                     MEGYQFTHEERVVTIFSAPNYCYRCGNQAAIMEVDENMNTTFLQFDPSPRSGQSNFSR
                     RTPDYFL"
     gene            <374864..>376864
                     /gene="TAF12"
                     /locus_tag="AWJ20_4730"
                     /db_xref="GeneID:30036894"
     mRNA            <374864..>376864
                     /gene="TAF12"
                     /locus_tag="AWJ20_4730"
                     /product="Taf12p"
                     /transcript_id="XM_018881820.1"
                     /db_xref="GeneID:30036894"
     CDS             374864..376864
                     /gene="TAF12"
                     /locus_tag="AWJ20_4730"
                     /inference="similar to AA sequence:KEGG_Orthology:K03126"
                     /note="Subunit (61/68 kDa) of TFIID and SAGA complexes;
                     involved in RNA polymerase II transcription initiation and
                     in chromatin modification, similar to histone H2A;
                     GO_component: GO:0000124 - SAGA complex [Evidence IDA]
                     [PMID 9674426]; GO_component: GO:0046695 - SLIK
                     (SAGA-like) complex [Evidence IDA] [PMID 12446794];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005669 - transcription factor TFIID
                     complex [Evidence IEA]; GO_component: GO:0005669 -
                     transcription factor TFIID complex [Evidence IDA] [PMID
                     10788514]; GO_component: GO:0005669 - transcription factor
                     TFIID complex [Evidence IDA] [PMID 15448131]; GO_function:
                     GO:0001102 - RNA polymerase II activating transcription
                     factor binding [Evidence IDA,IPI] [PMID 12501245];
                     GO_function: GO:0001075 - RNA polymerase II core promoter
                     sequence-specific DNA binding transcription factor
                     activity involved in preinitiation complex assembly
                     [Evidence IC]; GO_function: GO:0017025 - TBP-class protein
                     binding [Evidence IDA] [PMID 10751405]; GO_function:
                     GO:0003682 - chromatin binding [Evidence IDA] [PMID
                     10817999]; GO_function: GO:0003682 - chromatin binding
                     [Evidence IDA] [PMID 12600943]; GO_function: GO:0032947 -
                     protein complex scaffold [Evidence IMP] [PMID 9674426];
                     GO_function: GO:0046982 - protein heterodimerization
                     activity [Evidence IEA]; GO_process: GO:0006352 -
                     DNA-templated transcription, initiation [Evidence IEA];
                     GO_process: GO:0051123 - RNA polymerase II transcriptional
                     preinitiation complex assembly [Evidence IMP] [PMID
                     12600943]; GO_process: GO:0051123 - RNA polymerase II
                     transcriptional preinitiation complex assembly [Evidence
                     IMP] [PMID 12840001]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IDA,IMP] [PMID 9674426];
                     GO_process: GO:0016573 - histone acetylation [Evidence
                     IDA] [PMID 9674426]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006366 - transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 10751405]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IMP] [PMID 11561287]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 12138208]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 12582246]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 15448131]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Taf12p"
                     /protein_id="XP_018736260.1"
                     /db_xref="GeneID:30036894"
                     /translation="MNNGNNRAGASGGGGMPNIPNQSPANQAQAVRERLVNLQPQQLN
                     ALIQQYQQAMQGVIQAGPQSQEGQEHFLRAQRIKQVLQQYQGQMQAQAQQRGQRPPVA
                     NQAQTAAHAQAQAMNARAQQQAMNAAAANGAIPQNQQAMAQLQQQQLLLQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQAAVAAAAAANPNANHARLASQQQQQQQQQQQ
                     QQQQQQQQQQQQQQRQRQFQSMTPQQQFAYRTSQLEQFRNTQRTLQEQLDRLERALRE
                     QPNLDEEMKAKIRQQEQSLRDRKDSYKSLELQVMQQIRVAAGQQQLQQQQQQQQQQQQ
                     QQNPGAQAQVQAQQSQAQTPAAQAQFQQQQQQQAAAAAVRQSPALQNQLPQGSPIGVP
                     ISSPMNAASTPIQRPGSVASNSSAGRPISPAVGAGAGGPGTPGAPGTPSVNMARMANG
                     LAPSTRVAMQLSANNIPGGTPPTGPSARPNPPNHLAASQAMSSPTRASVPSLPIPQNL
                     TVKQPVPVTMKPGRPSLSGGNAIPAAALTTPALTKPPQFEVTGDRVLSKRKLSELVSS
                     VVGDDKEAMIDGDVEELLLDLADEFVTSVTSFACRLAKHRKSDTLEVKDLQLHLERNW
                     NIRIPGYSADEIRSVRKIAPTQSYIQKIAGVNMSRSVGGKGI"
     gene            complement(<377202..>377861)
                     /locus_tag="AWJ20_4731"
                     /db_xref="GeneID:30036895"
     mRNA            complement(<377202..>377861)
                     /locus_tag="AWJ20_4731"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881821.1"
                     /db_xref="GeneID:30036895"
     CDS             complement(377202..377861)
                     /locus_tag="AWJ20_4731"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736261.1"
                     /db_xref="GeneID:30036895"
                     /translation="MDLRTFKEASVRGGRASFDWENVKNDKYKTNYLGHSLMAPHQGR
                     GGSKDPIWYSKEKDGGGGGGEQKNEGEQSELEMMKDMERKALAELLGYDPADMEKLEK
                     KKDDRSNCEGSSHRSQRSHHHRSSDRDSSRERHRNHHSHRRRDRSNDRDSNKSTRSHE
                     PRDRHRSRSRSRSRSRTREPSHRESRPRSRDSRKRHSHRHRDRSRERNRDQRDRSRDR
                     R"
     gene            <379854..>380492
                     /gene="SNF7"
                     /locus_tag="AWJ20_4732"
                     /db_xref="GeneID:30036896"
     mRNA            <379854..>380492
                     /gene="SNF7"
                     /locus_tag="AWJ20_4732"
                     /product="ESCRT-III subunit protein SNF7"
                     /transcript_id="XM_018881822.1"
                     /db_xref="GeneID:30036896"
     CDS             379854..380492
                     /gene="SNF7"
                     /locus_tag="AWJ20_4732"
                     /inference="similar to AA sequence:KEGG_Orthology:K12194"
                     /note="One of four subunits of the ESCRT-III complex;
                     involved in the sorting of transmembrane proteins into the
                     multivesicular body (MVB) pathway; recruited from the
                     cytoplasm to endosomal membranes; ESCRT-III stands for
                     endosomal sorting complex required for transport III;
                     GO_component: GO:0000815 - ESCRT III complex [Evidence
                     IDA] [PMID 12194857]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 9606181]; GO_component: GO:0005768 -
                     endosome [Evidence IEA]; GO_component: GO:0010008 -
                     endosome membrane [Evidence IEA]; GO_component: GO:0016020
                     - membrane [Evidence IEA]; GO_function: GO:0005515 -
                     protein binding [Evidence IPI] [PMID 15086794];
                     GO_process: GO:0071454 - cellular response to anoxia
                     [Evidence IMP] [PMID 20402793]; GO_process: GO:0070676 -
                     intralumenal vesicle formation [Evidence IMP] [PMID
                     19234443]; GO_process: GO:0045324 - late endosome to
                     vacuole transport [Evidence IMP] [PMID 9606181];
                     GO_process: GO:0015031 - protein transport [Evidence
                     IEA,IEA]; GO_process: GO:0006810 - transport [Evidence
                     IEA]; GO_process: GO:0043162 - ubiquitin-dependent protein
                     catabolic process via the multivesicular body sorting
                     pathway [Evidence IC] [PMID 15086794]"
                     /codon_start=1
                     /product="ESCRT-III subunit protein SNF7"
                     /protein_id="XP_018736262.1"
                     /db_xref="GeneID:30036896"
                     /translation="MWGYLFGSGAKKDQAKNSIISLREQIDTLSKREKHFQKQIEELE
                     ATARKNVTTNKAAARTALKRKKEREADLDKTQAQIDSLQQQLHAIENAKLNYETMKIM
                     SQGAQAMKHIHGNMNIDKVDATMDDIRDQVALGEEISDAISRPLGQEVDEDDLNEELE
                     ALEQEALDAKMVNAGKAPVHNLPTQQLHEPEPAVEEDDEEEELRKLQAEMAL"
     gene            complement(<380498..>382045)
                     /gene="SED5"
                     /locus_tag="AWJ20_4733"
                     /db_xref="GeneID:30036897"
     mRNA            complement(<380498..>382045)
                     /gene="SED5"
                     /locus_tag="AWJ20_4733"
                     /product="Sed5p"
                     /transcript_id="XM_018881823.1"
                     /db_xref="GeneID:30036897"
     CDS             complement(380498..382045)
                     /gene="SED5"
                     /locus_tag="AWJ20_4733"
                     /inference="similar to AA sequence:KEGG_Orthology:K08490"
                     /note="cis-Golgi t-SNARE syntaxin; required for vesicular
                     transport between the ER and the Golgi complex; binds at
                     least 9 SNARE proteins; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence IEA]; GO_component: GO:0000139 - Golgi
                     membrane [Evidence IEA]; GO_component: GO:0031201 - SNARE
                     complex [Evidence IDA] [PMID 11001058]; GO_component:
                     GO:0031201 - SNARE complex [Evidence IDA] [PMID 11959998];
                     GO_component: GO:0005801 - cis-Golgi network [Evidence
                     IDA] [PMID 9725919]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence IDA]
                     [PMID 1400588]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0005484 - SNAP
                     receptor activity [Evidence IEA]; GO_function: GO:0005484
                     - SNAP receptor activity [Evidence IDA] [PMID 11001058];
                     GO_function: GO:0005484 - SNAP receptor activity [Evidence
                     IDA] [PMID 11959998]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IMP] [PMID 9545229];
                     GO_process: GO:0006891 - intra-Golgi vesicle-mediated
                     transport [Evidence IMP] [PMID 7596416]; GO_process:
                     GO:0006886 - intracellular protein transport [Evidence
                     IEA]; GO_process: GO:0015031 - protein transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0006906 - vesicle fusion [Evidence IDA]
                     [PMID 11001046]; GO_process: GO:0048280 - vesicle fusion
                     with Golgi apparatus [Evidence IMP] [PMID 9545229];
                     GO_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Sed5p"
                     /protein_id="XP_018736263.1"
                     /db_xref="GeneID:30036897"
                     /translation="MASAVLLPSVQDRTQEFRACVTSIAKINGTVVGRPGSSSSGQTG
                     SYGGSGIINGPESAFGGPGASSGSGTGLENKSPKSQFALRASGIAQEISETTAMLQRL
                     ALLAKRKTLFDDRPVEIGELSFVIKQKLSKINDSIASLQAFVKTQGGGKAASAWGTNK
                     SETQLNEHSRNVVVLLQGKLTDVTTGFTEVLETRTKNTQATRSRTEQFISSASSSVRD
                     HTSSESPLYAAAANRRGNSSPAGSAATGGAGGDESYGENPYGRPLSSSTAQSLLPDHD
                     KPGSGQDDFLVLPQQEQTMALLEEQQDSYLSQRSSAVEAIESTIQELGGIFSQLATMV
                     AEQRETVQRIDANTEDIALNVSGAQRELLKYYSRISSNRWLMVKMFGIIIVSYTGATA
                     SGGWGSAPDPVAPLAALESARLLTAVTSSSSSSGSSSRRLPHSLTNSIPLTLVGPLVP
                     PAAGAPPQTLVAPASQEFVPGPSTQRLERSERSNQGLGRSPSRRRQSVRQNYFMYSYI
                     ECSGPGG"
     gene            <383190..>384938
                     /locus_tag="AWJ20_4734"
                     /db_xref="GeneID:30036898"
     mRNA            <383190..>384938
                     /locus_tag="AWJ20_4734"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881824.1"
                     /db_xref="GeneID:30036898"
     CDS             383190..384938
                     /locus_tag="AWJ20_4734"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736264.1"
                     /db_xref="GeneID:30036898"
                     /translation="MSQQISQSVPFRYINAIILTPIRSIVNNLNPALQRLACYGLTVY
                     IGLYYWAPELLESVVRSTVASDLFIRILLPLGLFAAEITCPTTAGVKSLRGGVGDNPG
                     AYSGVASGAVSSGGAGDAGGAEHDDESKSSLNSAIYREYSANDNDFTGKKDENKKGHN
                     DEDSVHAASSVVASRGINEGKESATSVGSIDYSGRNNQTSSSWVGKTIPEVDEEESFN
                     INERDISERDIAEMSVNTSTSGFDVPGLPNPPAASGTTSAVSEPAKDKSPDADVPSDA
                     SPAGTVGAAAAAQSNDSVHSSNTTPESQTLPVEQSISLSSSQATKFSPSSDCPNSKDQ
                     KTTDDPTSRHHPLPSLISTSLISDDTKPQSPTQPPPSPPKFIFGNNPGDFTRTNVTED
                     DLSIMNNLSEGIEKSIESLYKVITPVDANHNDFTVQDYNFSQTWKIGAPKKLIWRDVK
                     FKEYSPKVLKRIRQLNHIDDLAYSSSFEHILLTKTPAGYTYYSRDKQYIIKPFTNDEF
                     RTLRASLPLYYQHLLAHPDSSAPRYCGLYKMGNTNFVASTNTRTSPPPASTLAQDARL
                     PPVIWAHQGLQNQAEY"
     gene            <386967..>387689
                     /locus_tag="AWJ20_4735"
                     /db_xref="GeneID:30036899"
     mRNA            <386967..>387689
                     /locus_tag="AWJ20_4735"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881825.1"
                     /db_xref="GeneID:30036899"
     CDS             386967..387689
                     /locus_tag="AWJ20_4735"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736265.1"
                     /db_xref="GeneID:30036899"
                     /translation="MPPAAGAPPQTLVAPASQEIFRVGTVSQRLERSERSNPGLGRSP
                     SRRRQTPVPGESPLTRVTVNRTRAILGEIAGDGSFEAHAKGVSWPEFVDLVVELLDAN
                     VSGLYDRPEKSYIDPLTGQESSESEMTDQVKSLLRTEFAAGPPFTVQRLAELLGSPLD
                     FYPAPFVYKYLTALKRVLSVASLSTDYPAVDLQAEIAQSKTDTSSANYGEPGVVMTEI
                     PWVLDTGLPENTPTAAPADDPF"
     gene            complement(<387936..>388418)
                     /gene="RSM24"
                     /locus_tag="AWJ20_4736"
                     /db_xref="GeneID:30036900"
     mRNA            complement(<387936..>388418)
                     /gene="RSM24"
                     /locus_tag="AWJ20_4736"
                     /product="mitochondrial 37S ribosomal protein RSM24"
                     /transcript_id="XM_018881826.1"
                     /db_xref="GeneID:30036900"
     CDS             complement(387936..388418)
                     /gene="RSM24"
                     /locus_tag="AWJ20_4736"
                     /inference="similar to AA sequence:KEGG_Orthology:K17413"
                     /note="Mitochondrial ribosomal protein of the small
                     subunit; GO_component: GO:0005763 - mitochondrial small
                     ribosomal subunit [Evidence IPI] [PMID 11278769];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IPI] [PMID 11278769]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 11278769]"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM24"
                     /protein_id="XP_018736266.1"
                     /db_xref="GeneID:30036900"
                     /translation="MKLTRVELASPYRPPSDESVLTFKYNTFLGEDHPAGKKVTVQFS
                     PSELGLTAAQKHKLCLLAGARYNSDTDVVTISSSKFPQQAQNKRFLGDILKSLLEAAR
                     DESDTFADVPLETRHMVAKRRRNKPVRPRVEFPEAWNRPQDAPKPKDDIVSVIHRLPL
                     "
     gene            <389936..>390820
                     /gene="RSM7"
                     /locus_tag="AWJ20_4737"
                     /db_xref="GeneID:30036901"
     mRNA            <389936..>390820
                     /gene="RSM7"
                     /locus_tag="AWJ20_4737"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="XM_018881827.1"
                     /db_xref="GeneID:30036901"
     CDS             389936..390820
                     /gene="RSM7"
                     /locus_tag="AWJ20_4737"
                     /inference="similar to AA sequence:KEGG_Orthology:K02992"
                     /note="Mitochondrial ribosomal protein of the small
                     subunit; has similarity to E. coli S7 ribosomal protein;
                     GO_component: GO:0005763 - mitochondrial small ribosomal
                     subunit [Evidence IPI] [PMID 11278769]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IPI] [PMID 11278769]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence IC] [PMID
                     11278769]; GO_process: GO:0006412 - translation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="XP_018736267.1"
                     /db_xref="GeneID:30036901"
                     /translation="MSWVAKSSSVLAKSFGQRLFQSGSPSLLALRYNSTAASPKPSSA
                     STTPSTASNQPSTAKYLVSLTEKELGEEGITRESADKEAQQWIDALNEVRNEFYAEGG
                     FSPNKTFAPPGSTDFQFFRDVPRETPRSFELTAEQMEQYERIKEKAIPVRNDPTIEYL
                     TKLIMRHGLKARAQKYMSQALYLVHLRTRQDPVALLKDTLEKMAPLVKLKRYTDGGAR
                     AEMIPVPLSERHRLRQSWLWLLESSRKRPSKDFSVRLSEEILSAIQGKSPGFEKRTQQ
                     HKLAIVNRSYVSLMTRKR"
     gene            <393587..>394708
                     /gene="HMO1"
                     /locus_tag="AWJ20_4738"
                     /db_xref="GeneID:30036902"
     mRNA            join(<393587..393694,393767..>394708)
                     /gene="HMO1"
                     /locus_tag="AWJ20_4738"
                     /product="Hmo1p"
                     /transcript_id="XM_018881828.1"
                     /db_xref="GeneID:30036902"
     CDS             join(393587..393694,393767..394708)
                     /gene="HMO1"
                     /locus_tag="AWJ20_4738"
                     /note="Chromatin associated high mobility group (HMG)
                     family member; involved in genome maintenance;
                     rDNA-binding component of the Pol I transcription system;
                     associates with a 5'-3' DNA helicase and Fpr1p, a prolyl
                     isomerase; relocalizes to the cytosol in response to
                     hypoxia; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 8969238]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 22932476]; GO_component: GO:0000790 -
                     nuclear chromatin [Evidence IDA] [PMID 16612005];
                     GO_component: GO:0000790 - nuclear chromatin [Evidence
                     IDA] [PMID 17646381]; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 12374750]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22932476]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 22553361];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0008301 - DNA binding, bending [Evidence
                     IDA] [PMID 15507436]; GO_function: GO:0008301 - DNA
                     binding, bending [Evidence IDA] [PMID 16533046];
                     GO_function: GO:0003690 - double-stranded DNA binding
                     [Evidence IDA] [PMID 15507436]; GO_function: GO:0003690 -
                     double-stranded DNA binding [Evidence IDA] [PMID
                     16533046]; GO_function: GO:0000400 - four-way junction DNA
                     binding [Evidence IDA] [PMID 15507436]; GO_function:
                     GO:0000400 - four-way junction DNA binding [Evidence IDA]
                     [PMID 16533046]; GO_process: GO:0060962 - regulation of
                     ribosomal protein gene transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 17875934]; GO_process:
                     GO:0060962 - regulation of ribosomal protein gene
                     transcription from RNA polymerase II promoter [Evidence
                     IGI,IMP] [PMID 18187511]; GO_process: GO:0034401 -
                     regulation of transcription by chromatin organization
                     [Evidence IDA] [PMID 18451108]; GO_process: GO:0006356 -
                     regulation of transcription from RNA polymerase I promoter
                     [Evidence IGI] [PMID 12374750]; GO_process: GO:0006356 -
                     regulation of transcription from RNA polymerase I promoter
                     [Evidence IMP] [PMID 16612005]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Hmo1p"
                     /protein_id="XP_018736268.1"
                     /db_xref="GeneID:30036902"
                     /translation="MSVSDPLIQCYRWIARPFAEILNRILAISCEAGATRLISALFTL
                     SKAAQEASGATIDFYNQLSGTSSGFPSSLSDLSSILASSATDLSLAHTDADFTAATAG
                     LDVGSGSVVDPTGLSTPANDADEDAEGGKKKKAKRQRAPVDPNAPKKPVTAFFLYVAA
                     NRKHVQADLQAAKPEGEIVGNHELTAELGVRWHALSEAERASWKNQYKELMDIYNVEK
                     QAYDSKKALTGDVNGVNGIGNLVVPGKATPVKKQANPVKKQRKDGLPGPNVVPGPGIP
                     LGNELPGSLVHPQHHQVQHQVQHPGQHPGQHPGPLHTPGQLQSPLSGDKAKRDKKKEK
                     KRRKPELPTDAPPTI"
     gene            <400511..>402397
                     /gene="ARE2"
                     /locus_tag="AWJ20_4739"
                     /db_xref="GeneID:30036903"
     mRNA            <400511..>402397
                     /gene="ARE2"
                     /locus_tag="AWJ20_4739"
                     /product="Are2p"
                     /transcript_id="XM_018881829.1"
                     /db_xref="GeneID:30036903"
     CDS             400511..402397
                     /gene="ARE2"
                     /locus_tag="AWJ20_4739"
                     /inference="similar to AA sequence:KEGG_Orthology:K11155"
                     /note="Acyl-CoA:sterol acyltransferase; endoplasmic
                     reticulum enzyme that contributes the major sterol
                     esterification activity in the presence of oxygen; ARE2
                     has a paralog, ARE1, that arose from the whole genome
                     duplication; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 10672016];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0008374 -
                     O-acyltransferase activity [Evidence IEA]; GO_function:
                     GO:0034736 - cholesterol O-acyltransferase activity
                     [Evidence IEA]; GO_function: GO:0034737 - ergosterol
                     O-acyltransferase activity [Evidence IGI,IMP] [PMID
                     10672016]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016746 - transferase
                     activity, transferring acyl groups [Evidence IEA];
                     GO_process: GO:0008204 - ergosterol metabolic process
                     [Evidence IGI,IMP] [PMID 10672016]"
                     /codon_start=1
                     /product="Are2p"
                     /protein_id="XP_018736269.1"
                     /db_xref="GeneID:30036903"
                     /translation="MEQGSTSTMSSLVYLPRQKPFHRKLTPTTSPLAMSPNLHGISTG
                     TSYGKQLGGKLADKDKLSSSHYNSNPNSSPNSNSNSYSYTDSEVLSPAQIHSQTQTQI
                     LEPPRFHTHSPHSRAHTHASGLSHKSNTGLTRKKSNSSTSGYLPHYKPIHTKSSASIL
                     SLSKHSPTSSYTGFRHLAMIVLTLGNLRLMIHDYQTYGFIMTLYRLGISQSDLNVAGL
                     LLLSTPIHLFIALLIELGASKTVSNANHTTSEADNAHQVDSTSGITTGSRLGSKENSS
                     VDVPTSTTKNSKASSNPTEPNKPHKKYLWKLFAALHTINATLVLIISSYTVYTSIWHP
                     LIGTVIECHSIILCLKVSSYALTNRDLRDAYLEDAPVPELYGPSKYPHNLTIGNLVYF
                     WWAPTLVYQPEYPRAPKVRYGFLVNRVLEMVGTIVLIWFLSGQYAVPILESSLVHFQN
                     ADLGQICETIMRLSTVSIVVWLLGFFFIFQSYLNFLAELLRFGDRDFYQDWWNAGSVG
                     TYWRLWNKPVSNYFRRHFYAPLLKRGWTPMSSSLVVFFISAVLHELVVGIPTRNVIGV
                     AFVCMMLQVPLIMVTAPLEKMRGPATTVGNCIFWLSFFLGQPVAVLMYYFAWNVKNGT
                     HIKI"
     gene            complement(<403065..>404108)
                     /locus_tag="AWJ20_4740"
                     /db_xref="GeneID:30036905"
     mRNA            complement(<403065..>404108)
                     /locus_tag="AWJ20_4740"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881831.1"
                     /db_xref="GeneID:30036905"
     CDS             complement(403065..404108)
                     /locus_tag="AWJ20_4740"
                     /inference="similar to AA sequence:KEGG_Orthology:K10082"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736270.1"
                     /db_xref="GeneID:30036905"
                     /translation="MNPVTLLVAVLSLVAGSVEARRRPQTVDVSRFPNTENPFSRTES
                     LAHSMEKPYLDKNFQSRYYDYGGSTFIRGDKYIRLTPDLPDQRGWLMSKIPSMPDNFQ
                     IEVEFGIDGQGTSIYGDGMAIWLLNERVTQEGPVFGLRDNFKGTAIFLDTYKNNGPGK
                     VFPYAMIMHGDGQTSYDQAHDGLANEIAGCSVRGLHNGREGNRIRITYVQGKFLSLET
                     DYRGKHKWEKCFETNQVTINKPAFLGFSAQTGELSEYHDIYSIKVYSLDNPPASYAEV
                     DYYLNGNKNAPIHESYSSHSSSSSSSSSSSSSGWGSFFLKTFLFILVVAGGYVGFTLY
                     RAKQRRERDAFYL"
     gene            complement(<404681..>406552)
                     /gene="SKN7"
                     /locus_tag="AWJ20_4741"
                     /db_xref="GeneID:30036906"
     mRNA            complement(<404681..>406552)
                     /gene="SKN7"
                     /locus_tag="AWJ20_4741"
                     /product="kinase-regulated stress-responsive transcription
                     factor SKN7"
                     /transcript_id="XM_018881832.1"
                     /db_xref="GeneID:30036906"
     CDS             complement(404681..406552)
                     /gene="SKN7"
                     /locus_tag="AWJ20_4741"
                     /inference="similar to AA sequence:KEGG_Orthology:K15859"
                     /codon_start=1
                     /product="kinase-regulated stress-responsive transcription
                     factor SKN7"
                     /protein_id="XP_018736271.1"
                     /db_xref="GeneID:30036906"
                     /translation="MSSGRWDSPNASGSWLDMHMSMGQPPPPGQDQDHDHTDPMDLSQ
                     GQDAGHGTSHGQPVRNISPTQQHARNIQVPIQDTHPNNMNMKSELDYTRHQVNPNTGT
                     GPAGPNEPSRESKDFVKKLFTMLEDPTHRHIVRWSNSEDSFVVLDASEFTKEVLPRHF
                     KHSNFASFVRQLNKYDFHKIRANVSKSSGGDNYPDNSWEFHHPDFNPKNKDQLDKIKR
                     KVPGKKVHPAGGVGGSGNSNTPSLTDVNGHGLVSIGQEKVDSISYELENARKLNGFLA
                     ARVEQLEDDSRTMSKNLSLIHDAFLMQTSYLQRMLSLLAMNDPNGQFSELLDSLSKDG
                     GYSGISSSVSHELQLQQQKQQHQHLQNQHLQQQQQQTQQQQPPQLTHQLPQIRVPPPQ
                     QQPQPPHQLPPQQQQQQQPSQQQQQPTQQSNMPSALPSSATSTSLSPSIPNSNRINQV
                     GTTSESNSQFHVLLADEDDNSVLICRRMLLQYGCEVDVANDGLAAVQRAESTQYDLIL
                     MDMILPQLDGMSATELIRHSDQTTPIIAMMSTTDSDGQLDSRTVEKYRSKGVTMILPK
                     PFSKSVLYSTLSIFLKPVSTTTHHPGQPDRLGYMAPSARLRDPTTDSLGSQTKKHRY"
     gene            complement(<412627..>414981)
                     /gene="SCH9"
                     /locus_tag="AWJ20_4742"
                     /db_xref="GeneID:30036907"
     mRNA            complement(<412627..>414981)
                     /gene="SCH9"
                     /locus_tag="AWJ20_4742"
                     /product="serine/threonine protein kinase SCH9"
                     /transcript_id="XM_018881833.1"
                     /db_xref="GeneID:30036907"
     CDS             complement(412627..414981)
                     /gene="SCH9"
                     /locus_tag="AWJ20_4742"
                     /inference="similar to AA sequence:KEGG_Orthology:K08286"
                     /codon_start=1
                     /product="serine/threonine protein kinase SCH9"
                     /protein_id="XP_018736272.1"
                     /db_xref="GeneID:30036907"
                     /translation="MPDFAKSLFSFGGFSKSSNSSQNSSPTGSANVSPGLHPLKDKPI
                     SAVTQSNAAPTFRSSTSSAATALSLGFGRSGGSGSGGSEDQMVLSDEDNGSASGGAGG
                     AGAANSGLATARPSTVDVGGSDSANSNAVVTILGNDTQANGLGAVTTVPEAGLSSVRP
                     MGKLRVRIIEARGLVAQPEGSIPYVVCTYGTSEFISHGPTGTGSGGDPSVSAGAGANS
                     TQPIGIAIPKSRQSSSLTLSKLNNGAHRGAGSNTNPMWKDEAQFDVTSNDGELEVSIY
                     DAKNNDLFLGHARLKPDLTSRVIEKWLTLEPRIQGERVSGEVRVGIFYEKVSKRQYGP
                     QDFEVLRLVGKGTFGQVYQVRKKDTQRIYAMKVLSKKAIVQKKEIAHTIGERNILVRT
                     SSANSAFIVGLKMSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEQRAKFYIAELIVA
                     LEHLHDNDIVYRDLKPENILLDANGHIALCDFGLSKANLNDNGTTNTFCGTTEYLAPE
                     VLLDDQGYTKMVDFWSLGVLVFEMCCGWSPFYAEDNQQMYKNIAFGKVRFPKDALSPD
                     GRNFVKGLLNRNPKHRLGATDDARELRAHPFFSDINWDLLIAKKIPPPFKPQVSSETD
                     TSNFDPEFTQASTSVLHRAFMPVSSTPLSPGIQANFQGFTYVDDSSLDENFRSRLGTS
                     VRPKSHIQHDDDIDLYDDKDIKISESYYNESDLMARSIKRTGPLSGLGPHGSSGLKPP
                     GHSAQGHSQGHNQGHNNDGDYDADVDIMMEDDEHDFVNGQGFEM"
     gene            complement(<417173..>418498)
                     /gene="ALG1"
                     /locus_tag="AWJ20_4743"
                     /db_xref="GeneID:30036908"
     mRNA            complement(<417173..>418498)
                     /gene="ALG1"
                     /locus_tag="AWJ20_4743"
                     /product="chitobiosyldiphosphodolichol beta-1,4
                     mannosyltransferase"
                     /transcript_id="XM_018881834.1"
                     /db_xref="GeneID:30036908"
     CDS             complement(417173..418498)
                     /gene="ALG1"
                     /locus_tag="AWJ20_4743"
                     /inference="similar to AA sequence:KEGG_Orthology:K03842"
                     /note="Mannosyltransferase; involved in asparagine-linked
                     glycosylation in the endoplasmic reticulum (ER); essential
                     for viability, mutation is functionally complemented by
                     human ortholog; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IPI] [PMID 15044395];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISS]
                     [PMID 2182636]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0019187 -
                     beta-1,4-mannosyltransferase activity [Evidence IDA] [PMID
                     6368538]; GO_function: GO:0004578 -
                     chitobiosyldiphosphodolichol beta-mannosyltransferase
                     activity [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0016757 - transferase activity, transferring glycosyl
                     groups [Evidence IEA,IEA]; GO_process: GO:0009058 -
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0097502 - mannosylation [Evidence IEA]; GO_process:
                     GO:0006490 - oligosaccharide-lipid intermediate
                     biosynthetic process [Evidence IMP] [PMID 7037780];
                     GO_process: GO:0006487 - protein N-linked glycosylation
                     [Evidence IMP] [PMID 6369318]; GO_process: GO:0006486 -
                     protein glycosylation [Evidence IEA]"
                     /codon_start=1
                     /product="chitobiosyldiphosphodolichol beta-1,4
                     mannosyltransferase"
                     /protein_id="XP_018736273.1"
                     /db_xref="GeneID:30036908"
                     /translation="MNYHALSIAKCGYEVDLCGYKESKLMDEVIENPLITVREIPVVK
                     NAYKLPFVLFAPYKVVKQHWILYDLLKQLKRADFLLVQNPPSIPVLGMVRFFSLFMSP
                     RTKVIIDWHNLGYSILALKFPDNPNHPFVKIYKWYENWFGYRSFVHLTVTVALGQFLR
                     TEFAMNAKRIIPLYDRPASQFSLLSESQRKEIISKYQTTLFKDFDAKTEKILVTSTSY
                     TPDEDLTILLEALEKYSLASNPSSQTTEEKPTSDDNKSESKKSQILTRSSASTQLPPL
                     RVIITGKGPMFKETRAKIDALQPTLHNISIHTTWLPIEDYPKVLGAADLGISLHQSSS
                     GWDLPMKIVDMFGCGVPVISLSFPAISELVKHSENGLIVDTSTDMAKQLAKLFTNPAT
                     LNNLKRGAVRESRIKWDTNWTEKLGPLFGVGQYREPAPGEDDSSSSDDD"
     gene            complement(<419425..>420120)
                     /locus_tag="AWJ20_4744"
                     /db_xref="GeneID:30036909"
     mRNA            complement(<419425..>420120)
                     /locus_tag="AWJ20_4744"
                     /product="calmodulin"
                     /transcript_id="XM_018881835.1"
                     /db_xref="GeneID:30036909"
     CDS             complement(419425..420120)
                     /locus_tag="AWJ20_4744"
                     /codon_start=1
                     /product="calmodulin"
                     /protein_id="XP_018736274.1"
                     /db_xref="GeneID:30036909"
                     /translation="MWPSPLASASLIISSTSSSVKRSPIVVMTWRNSAAEINPLPSRS
                     NTLNASRISSSESVSFIFRAIMVRNSGKSIVPSLSTSTSWIISDNSLSEGFNAKLLMT
                     VPSSLVVILPGCVRFSRGWGVAFGGWGSAPDPGCSCFAGDGGDSGGNDSSEARGAAGS
                     GAQPQPPEARGERTIVVLIEQRKCLFKRGDLLFGQLVSLFGLLVPVSSLITQPLSPMS
                     RSVISPVTGLKTL"
     gene            <419597..>420163
                     /gene="CMD1"
                     /locus_tag="AWJ20_4745"
                     /db_xref="GeneID:30036910"
     mRNA            <419597..>420163
                     /gene="CMD1"
                     /locus_tag="AWJ20_4745"
                     /product="calmodulin"
                     /transcript_id="XM_018881836.1"
                     /db_xref="GeneID:30036910"
     CDS             419597..420163
                     /gene="CMD1"
                     /locus_tag="AWJ20_4745"
                     /inference="similar to AA sequence:KEGG_Orthology:K02183"
                     /note="Calmodulin; Ca++ binding protein that regulates
                     Ca++ independent processes (mitosis, bud growth, actin
                     organization, endocytosis, etc.) and Ca++ dependent
                     processes (stress-activated pathways), targets include
                     Nuf1p, Myo2p and calcineurin; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IDA] [PMID 1639847];
                     GO_component: GO:0005934 - cellular bud tip [Evidence IDA]
                     [PMID 1639847]; GO_component: GO:0005823 - central plaque
                     of spindle pole body [Evidence IDA] [PMID 8601600];
                     GO_component: GO:0005823 - central plaque of spindle pole
                     body [Evidence IDA] [PMID 8886974]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005856 - cytoskeleton [Evidence IEA]; GO_component:
                     GO:0000131 - incipient cellular bud site [Evidence IDA]
                     [PMID 1639847]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 1639847];
                     GO_component: GO:0005816 - spindle pole body [Evidence
                     IEA]; GO_function: GO:0005509 - calcium ion binding
                     [Evidence IEA]; GO_function: GO:0005509 - calcium ion
                     binding [Evidence IDA] [PMID 3533275]; GO_function:
                     GO:0005509 - calcium ion binding [Evidence IDA] [PMID
                     8461293]; GO_function: GO:0048306 - calcium-dependent
                     protein binding [Evidence IDA] [PMID 1321337];
                     GO_function: GO:0048306 - calcium-dependent protein
                     binding [Evidence IPI] [PMID 9756868]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0005515 - protein binding [Evidence IPI]
                     [PMID 10749918]; GO_function: GO:0005515 - protein binding
                     [Evidence IPI] [PMID 7925277]; GO_function: GO:0005515 -
                     protein binding [Evidence IPI] [PMID 8247006];
                     GO_function: GO:0005515 - protein binding [Evidence IPI]
                     [PMID 8294515]; GO_function: GO:0005515 - protein binding
                     [Evidence IPI] [PMID 9450989]; GO_process: GO:0006607 -
                     NLS-bearing protein import into nucleus [Evidence IMP]
                     [PMID 17878171]; GO_process: GO:0007114 - cell budding
                     [Evidence IMP] [PMID 8310294]; GO_process: GO:0007010 -
                     cytoskeleton organization [Evidence IMP] [PMID 8310294];
                     GO_process: GO:0000742 - karyogamy involved in conjugation
                     with cellular fusion [Evidence IGI,IMP] [PMID 12836012];
                     GO_process: GO:0016237 - microautophagy [Evidence IMP]
                     [PMID 16055436]; GO_process: GO:0006661 -
                     phosphatidylinositol biosynthetic process [Evidence
                     IGI,IMP] [PMID 12079494]; GO_process: GO:0006898 -
                     receptor-mediated endocytosis [Evidence IMP] [PMID
                     7988551]; GO_process: GO:0006898 - receptor-mediated
                     endocytosis [Evidence IMP] [PMID 9450989]; GO_process:
                     GO:0051300 - spindle pole body organization [Evidence IMP]
                     [PMID 1469052]; GO_process: GO:0042991 - transcription
                     factor import into nucleus [Evidence IMP] [PMID 17878171];
                     GO_process: GO:0042144 - vacuole fusion, non-autophagic
                     [Evidence IDA,IMP] [PMID 9859992]"
                     /codon_start=1
                     /product="calmodulin"
                     /protein_id="XP_018736275.1"
                     /db_xref="GeneID:30036910"
                     /translation="MVRSPRASGGWGCAPDPAAPLASLESLPPESPPSPAKQEQPGSG
                     AEPQPPKATPHPRENLTQPGKITTKELGTVMRSLALNPSESELSDMIHEVDVDNDGTI
                     DFPEFLTMMARKMKDTDSEEEIREAFKVFDRDGNGFISAAELRHVMTTIGERLTEEEV
                     DEMIREADANGDGHIDYNEFVNLLQNTK"
     gene            <424057..>427372
                     /locus_tag="AWJ20_4746"
                     /db_xref="GeneID:30036911"
     mRNA            join(<424057..424204,424335..>427372)
                     /locus_tag="AWJ20_4746"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881837.1"
                     /db_xref="GeneID:30036911"
     CDS             join(424057..424204,424335..427372)
                     /locus_tag="AWJ20_4746"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736276.1"
                     /db_xref="GeneID:30036911"
                     /translation="MSSSGIGSFLKESRDKLNDVSAKGKQKYDSGDWKKAPKFSLPSS
                     RIGRQARGATRVWGGAPAAGGNLTPVVEVTNRTSEENERESIQARPLSALTDPSLFPP
                     PPKHRGYENGAPVQPAQPVAPVQPVQAAHPGYGQQQQPQTGYAPSPAAGYGQLPPQAP
                     AQVPGQAPGVAPGQTYQAYGQNQGQLPPQQQQQQPQVQGYNPNPAAGYGQVASPGQPG
                     SYQQQQQLSGYGQPGQLGQPGVIPAPSPPVQQPPQQYGQPQSFQQPPQQQYGQQPAQQ
                     QYGQQPAQQQYGQQPAQQQYGQQPAQQQPAPQYGQEYGQQQPAQPYAQQYGQQAPQQI
                     VPQAAPQPTPVEQPPNYPSQNAAPSPAPALSPAPPARPPLPDPTSFPKPPVFGNPASA
                     AINSPNSTTRAPATPGVGAPEDAQSKPVKAPLPDPASFAPPPVFGRPGSAASSAVASP
                     GVNRSSPSKPGAGMPPPPPPRQNLPDPTSFAPPPIYGNPASASYKAPAPQAAAATITA
                     TQQPQHQQQQQLPPPVSRQTPTPPASRVSPTPPATRATPPGSATHSTGPRQAPPKPAS
                     LKVQPTPPPKPSAFSTSGNTNTVPHPQPARTYPSQQQLPQPLQSQFQGQPQGQPPAYA
                     LTDSLNNLSVNDNQNEVQAVPSPSGDSQSSAPQPAVAFAQPGIPNFAAEIAARKTRNS
                     VSHSSTASASPPPISPASTGASINKKAPPPPPKKKPSLSTGSSFSAASTPAPAAPGTG
                     YAHSSVASPPVIAPKPIVPSAPARNHPHTVGVNSSHAPSLPPPINHATRPSVETIARS
                     GSFSDSQVQPEPKEPKRFDFQLATAWFAVPMGQPLHFPPDLSGTEYTYSTSSSGSTRT
                     LKIALRITEDLSVVRFTMTWDESDPVRTCRVTRTDSAVPRLLTGPELVYSHSQYGELV
                     ASWAESKMGQQVGNGECWTLAQQAIEQSTHGQAMTSKGLVHGMLIYGTNPAISREEIR
                     RGDIIQFREARFEKRDPTTGRVVSQSLSGAPDHTSVVTSVDSNTIHVVHQNVSNVRRV
                     QPGEYVLSDFVSGDIKIYRVVAKDWVEALSV"
     gene            <428316..>429392
                     /locus_tag="AWJ20_4747"
                     /db_xref="GeneID:30036912"
     mRNA            <428316..>429392
                     /locus_tag="AWJ20_4747"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881838.1"
                     /db_xref="GeneID:30036912"
     CDS             428316..429392
                     /locus_tag="AWJ20_4747"
                     /inference="similar to AA sequence:KEGG_Orthology:K07119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736277.1"
                     /db_xref="GeneID:30036912"
                     /translation="MSLQIKELVLENPPVTETNLVLGQETSTFKEVTSTLDPESLKTG
                     DIVVQPLIFSNDPTQRAWIQKGLDPKRMYVPPVLKGEAMRSLGAGKVIVSKSDKYKVG
                     DIVIGLLSWSNYSLVNELRISTKVSDPNADLPTYLSLVGASGLAAYYGLTEVGRVKPE
                     HTVVVSAASGATGIIAVQYAKHVIGCKKVIGITGSDDKIDHVKKVGADVAVNYKDPEF
                     KKQLSDAIGPDFADVYFDNVGGEILDFMLSKVKPFGVVIACGAIAGYNDHSKGFIRNW
                     GQIITNRLRVEGFIVTDFKDKHAETFVKLFTALQQGKISLSDSINLVDLSSESNSLAK
                     IPEVWGQLFSGNKVGKLLTRVSKI"
     gene            complement(<429684..>431108)
                     /gene="HRT3"
                     /locus_tag="AWJ20_4748"
                     /db_xref="GeneID:30036913"
     mRNA            complement(<429684..>431108)
                     /gene="HRT3"
                     /locus_tag="AWJ20_4748"
                     /product="SCF ubiquitin ligase complex subunit HRT3"
                     /transcript_id="XM_018881839.1"
                     /db_xref="GeneID:30036913"
     CDS             complement(429684..431108)
                     /gene="HRT3"
                     /locus_tag="AWJ20_4748"
                     /inference="similar to AA sequence:KEGG_Orthology:K10295"
                     /note="Putative SCF-ubiquitin ligase F-box protein; based
                     on both genetic and physical interactions and sequence
                     similarity; identified in association with Cdc53p, Skp1p
                     and Ubi4 in large and small-scale studies; GO_component:
                     GO:0019005 - SCF ubiquitin ligase complex [Evidence IDA]
                     [PMID 10582239]; GO_component: GO:0019005 - SCF ubiquitin
                     ligase complex [Evidence IDA,IPI] [PMID 14747994];
                     GO_component: GO:0019005 - SCF ubiquitin ligase complex
                     [Evidence IPI] [PMID 17141224]; GO_function: GO:0030674 -
                     protein binding, bridging [Evidence ISA] [PMID 10582239];
                     GO_function: GO:0030674 - protein binding, bridging
                     [Evidence ISA] [PMID 9635407]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence ISA]
                     [PMID 10582239]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence ISA]
                     [PMID 9635407]; GO_process: GO:0031146 - SCF-dependent
                     proteasomal ubiquitin-dependent protein catabolic process
                     [Evidence IGI,ISA] [PMID 10582239]; GO_process: GO:0031146
                     - SCF-dependent proteasomal ubiquitin-dependent protein
                     catabolic process [Evidence ISA] [PMID 9635407];
                     GO_process: GO:0071406 - cellular response to
                     methylmercury [Evidence IMP] [PMID 17141224]; GO_process:
                     GO:0016567 - protein ubiquitination [Evidence IEA]"
                     /codon_start=1
                     /product="SCF ubiquitin ligase complex subunit HRT3"
                     /protein_id="XP_018736278.1"
                     /db_xref="GeneID:30036913"
                     /translation="MSELDRFRQAWRSEVQHRHSDGQNSTAPSATSSTATNGRTAASN
                     NAGEAAINRDTTDDISTERALSPTRVITPDSAFRAERPEHVYYNKDLSRTDLDALEAF
                     ERAVDSEHTGKLSDAVRHYRDAFRLNERVDKLYREKYYSIKPTHKKPSTKSSGGAESS
                     TKTSTKKSQKVLLGDGTGSVSELSKNLAELSLTAEDEELPCPILQVPVEILSEIFRYL
                     ALDDLSSFTKCTYSCKSFAHIGYTTKSIWMALCQQAYSKQHYTEDAVEELCNGNELEA
                     VKKYWGNSFRRMYLERPRIRFDGVYISTCNYLRPGVGDTWNAPIHMVTYYRYCKFYED
                     GTCINLLTTSEPSDVVPVFTRNITGTAHGTGPTRPSKKQPAVIYTKEDGTVLSRPKGI
                     MSGTWKINGLDGTVLIESEGSVERYTFYMQLQIRSSGHNRHNKLKWVKFWSINNLSDT
                     YGEFSLRHDKAFFFLKRHPAALTT"
     gene            <434099..>436300
                     /gene="SPA2"
                     /locus_tag="AWJ20_4749"
                     /db_xref="GeneID:30036914"
     mRNA            <434099..>436300
                     /gene="SPA2"
                     /locus_tag="AWJ20_4749"
                     /product="Spa2p"
                     /transcript_id="XM_018881840.1"
                     /db_xref="GeneID:30036914"
     CDS             434099..436300
                     /gene="SPA2"
                     /locus_tag="AWJ20_4749"
                     /note="Component of the polarisome; functions in actin
                     cytoskeletal organization during polarized growth; acts as
                     a scaffold for Mkk1p and Mpk1p cell wall integrity
                     signaling components; potential Cdc28p substrate; coding
                     sequence contains length polymorphisms in different
                     strains; SPA2 has a paralog, SPH1, that arose from the
                     whole genome duplication; GO_component: GO:0005938 - cell
                     cortex [Evidence IDA] [PMID 23673619]; GO_component:
                     GO:0051286 - cell tip [Evidence IEA]; GO_component:
                     GO:0005935 - cellular bud neck [Evidence IDA] [PMID
                     9214378]; GO_component: GO:0005934 - cellular bud tip
                     [Evidence IDA] [PMID 12361575]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 2647769];
                     GO_component: GO:0000131 - incipient cellular bud site
                     [Evidence IDA] [PMID 9214378]; GO_component: GO:0043332 -
                     mating projection tip [Evidence IDA] [PMID 2647769];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 9214378]; GO_component: GO:0000133 - polarisome
                     [Evidence IDA] [PMID 9632790]; GO_function: GO:0005078 -
                     MAP-kinase scaffold activity [Evidence IDA,IMP] [PMID
                     12361575]; GO_process: GO:0007121 - bipolar cellular bud
                     site selection [Evidence IMP] [PMID 8909546]; GO_process:
                     GO:0007118 - budding cell apical bud growth [Evidence
                     IGI,IMP] [PMID 10866679]; GO_process: GO:0030010 -
                     establishment of cell polarity [Evidence IMP] [PMID
                     8013906]; GO_process: GO:0030010 - establishment of cell
                     polarity [Evidence IMP] [PMID 8909546]; GO_process:
                     GO:0036267 - invasive filamentous growth [Evidence IGI]
                     [PMID 9443897]; GO_process: GO:0031382 - mating projection
                     assembly [Evidence IGI] [PMID 9443897]; GO_process:
                     GO:2000251 - positive regulation of actin cytoskeleton
                     reorganization [Evidence IGI,IMP] [PMID 12857882];
                     GO_process: GO:2000251 - positive regulation of actin
                     cytoskeleton reorganization [Evidence IMP] [PMID
                     19633059]; GO_process: GO:0007124 - pseudohyphal growth
                     [Evidence IMP] [PMID 9055077]; GO_process: GO:0007124 -
                     pseudohyphal growth [Evidence IMP] [PMID 9443897];
                     GO_process: GO:0008360 - regulation of cell shape
                     [Evidence IEA]; GO_process: GO:0031384 - regulation of
                     initiation of mating projection growth [Evidence IMP]
                     [PMID 14734532]; GO_process: GO:0032880 - regulation of
                     protein localization [Evidence IMP] [PMID 10085294];
                     GO_process: GO:0032880 - regulation of protein
                     localization [Evidence IMP] [PMID 11740491]; GO_process:
                     GO:0032880 - regulation of protein localization [Evidence
                     IMP] [PMID 12857882]; GO_process: GO:0032880 - regulation
                     of protein localization [Evidence IMP] [PMID 16166638];
                     GO_process: GO:0032880 - regulation of protein
                     localization [Evidence IMP] [PMID 8909546]; GO_process:
                     GO:0032880 - regulation of protein localization [Evidence
                     IMP] [PMID 9571251]; GO_process: GO:0032880 - regulation
                     of protein localization [Evidence IMP] [PMID 9632790];
                     GO_process: GO:0031385 - regulation of termination of
                     mating projection growth [Evidence IMP] [PMID 14734532]"
                     /codon_start=1
                     /product="Spa2p"
                     /protein_id="XP_018736279.1"
                     /db_xref="GeneID:30036914"
                     /translation="MSSVNYNQPIHSRGPSLDKYSGMTNSHSNSNLYGANGNGNPNTS
                     PNPTDGSIHTTRSSTDDVSIDDTIASYHHTFCQFTGHYNGIWDGSRGDGNGGPSAPGS
                     KARQKLEKLSKVHFSELSTDVYDELVRRVDPLPHETEFLAPRDNIHRKRNQARQKLAM
                     LSPSRFNDLASDILYEIERRYPNLRANPPADRPSISDPNDPNSAKESPALGSTSQSPY
                     LTTRRFSNASAVSNATSRYTSEDYHLRDSVMPPRNSSLNTLGISSPAATPPMPSESAF
                     THQHNASIVPPLQEEVSIPPSNRSAPLAQPIKSTTIIPTKSTLVEEDDDDDEEGFEDT
                     IDADDEADESAGIANNSTFSSNGSVRNSKRLSMLTPLSDIEEEADAARLAAVAAAANG
                     GVTGDRGVHDVAEDEITRGGSYGNEQDSAGGIEEGEESDDESVSAKLRDRDEQIQMLV
                     AEGSRMDETINNLESRLQESETVKTTLEEENNRLHDMVGELEEQRQKAVDEKESIQKR
                     LEALEQEVEESKAAIAAHEATINSHKETIDKLGDEKKQSEDELSRATGLLTQLREEHA
                     NDSDLQQANARHVETIAGHETTIDNLQRELDSTKETHSREIDDLKQQHESQIAELTTS
                     HSTLKDQVDSHANEKEELTKRHQQELDELVNSHSMAIQQYKTEAEEHKANLVLLQESH
                     SALEQEHNNIKDRHAESLSKQNEYAESSATLSNDYLLLQNKLTEHETVSSY"
     gene            <436538..>437770
                     /gene="SPA2"
                     /locus_tag="AWJ20_4750"
                     /db_xref="GeneID:30036916"
     mRNA            <436538..>437770
                     /gene="SPA2"
                     /locus_tag="AWJ20_4750"
                     /product="Spa2p"
                     /transcript_id="XM_018881842.1"
                     /db_xref="GeneID:30036916"
     CDS             436538..437770
                     /gene="SPA2"
                     /locus_tag="AWJ20_4750"
                     /note="Component of the polarisome; functions in actin
                     cytoskeletal organization during polarized growth; acts as
                     a scaffold for Mkk1p and Mpk1p cell wall integrity
                     signaling components; potential Cdc28p substrate; coding
                     sequence contains length polymorphisms in different
                     strains; SPA2 has a paralog, SPH1, that arose from the
                     whole genome duplication; GO_component: GO:0005938 - cell
                     cortex [Evidence IDA] [PMID 23673619]; GO_component:
                     GO:0051286 - cell tip [Evidence IEA]; GO_component:
                     GO:0005935 - cellular bud neck [Evidence IDA] [PMID
                     9214378]; GO_component: GO:0005934 - cellular bud tip
                     [Evidence IDA] [PMID 12361575]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 2647769];
                     GO_component: GO:0000131 - incipient cellular bud site
                     [Evidence IDA] [PMID 9214378]; GO_component: GO:0043332 -
                     mating projection tip [Evidence IDA] [PMID 2647769];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 9214378]; GO_component: GO:0000133 - polarisome
                     [Evidence IDA] [PMID 9632790]; GO_function: GO:0005078 -
                     MAP-kinase scaffold activity [Evidence IDA,IMP] [PMID
                     12361575]; GO_process: GO:0007121 - bipolar cellular bud
                     site selection [Evidence IMP] [PMID 8909546]; GO_process:
                     GO:0007118 - budding cell apical bud growth [Evidence
                     IGI,IMP] [PMID 10866679]; GO_process: GO:0030010 -
                     establishment of cell polarity [Evidence IMP] [PMID
                     8013906]; GO_process: GO:0030010 - establishment of cell
                     polarity [Evidence IMP] [PMID 8909546]; GO_process:
                     GO:0036267 - invasive filamentous growth [Evidence IGI]
                     [PMID 9443897]; GO_process: GO:0031382 - mating projection
                     assembly [Evidence IGI] [PMID 9443897]; GO_process:
                     GO:2000251 - positive regulation of actin cytoskeleton
                     reorganization [Evidence IGI,IMP] [PMID 12857882];
                     GO_process: GO:2000251 - positive regulation of actin
                     cytoskeleton reorganization [Evidence IMP] [PMID
                     19633059]; GO_process: GO:0007124 - pseudohyphal growth
                     [Evidence IMP] [PMID 9055077]; GO_process: GO:0007124 -
                     pseudohyphal growth [Evidence IMP] [PMID 9443897];
                     GO_process: GO:0008360 - regulation of cell shape
                     [Evidence IEA]; GO_process: GO:0031384 - regulation of
                     initiation of mating projection growth [Evidence IMP]
                     [PMID 14734532]; GO_process: GO:0032880 - regulation of
                     protein localization [Evidence IMP] [PMID 10085294];
                     GO_process: GO:0032880 - regulation of protein
                     localization [Evidence IMP] [PMID 11740491]; GO_process:
                     GO:0032880 - regulation of protein localization [Evidence
                     IMP] [PMID 12857882]; GO_process: GO:0032880 - regulation
                     of protein localization [Evidence IMP] [PMID 16166638];
                     GO_process: GO:0032880 - regulation of protein
                     localization [Evidence IMP] [PMID 8909546]; GO_process:
                     GO:0032880 - regulation of protein localization [Evidence
                     IMP] [PMID 9571251]; GO_process: GO:0032880 - regulation
                     of protein localization [Evidence IMP] [PMID 9632790];
                     GO_process: GO:0031385 - regulation of termination of
                     mating projection growth [Evidence IMP] [PMID 14734532]"
                     /codon_start=1
                     /product="Spa2p"
                     /protein_id="XP_018736280.1"
                     /db_xref="GeneID:30036916"
                     /translation="MRTLAENQRNLEPAEKMAEQIHALKVEVQEWKSRYSRAKGLVRN
                     LRNSAYGGNSVFATPDVGLSNDSPYISTEGRVRDLSVTKFQVAVDEFLTKSRLGTTDL
                     LDNLHNVVVATRHITQDLNGPDDASPVSEKIETELAQCATLVSKTANQLISTTRNHRI
                     SGGMAPISILDAVTSDLSFAVIELIKVAKVRRTNNRDNRGSASFSPKEIDVSKASRFS
                     GNSVTSPADMHPAVTPTEDIHMERSDPRRYASTSNQFSTTNFNIEDPDNTISELQGYL
                     EEQTATAIDSIQSLLTAIKDGSSLYVLRHNMLDIIKLVDITVVATSTSMKQTKNWLLK
                     DKGSYILENLRDCSQRMAQLQEETKNIDGDSNPDRQVKQRLAGIAFDMAKFTKELVKT
                     VEEVSLTSEINHIDNQLR"
     gene            complement(<438011..>439675)
                     /gene="AMD2"
                     /locus_tag="AWJ20_4751"
                     /db_xref="GeneID:30036917"
     mRNA            complement(<438011..>439675)
                     /gene="AMD2"
                     /locus_tag="AWJ20_4751"
                     /product="Amd2p"
                     /transcript_id="XM_018881843.1"
                     /db_xref="GeneID:30036917"
     CDS             complement(438011..439675)
                     /gene="AMD2"
                     /locus_tag="AWJ20_4751"
                     /inference="similar to AA sequence:KEGG_Orthology:K01426"
                     /note="Putative amidase; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0004040
                     - amidase activity [Evidence IEA]; GO_function: GO:0004040
                     - amidase activity [Evidence ISS] [PMID 2263500];
                     GO_function: GO:0016884 - carbon-nitrogen ligase activity,
                     with glutamine as amido-N-donor [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016811 - hydrolase activity, acting
                     on carbon-nitrogen (but not peptide) bonds, in linear
                     amides [Evidence IEA]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA,IEA,IEA]"
                     /codon_start=1
                     /product="Amd2p"
                     /protein_id="XP_018736281.1"
                     /db_xref="GeneID:30036917"
                     /translation="MVFSYFLHKKTVAAKQKEREDRINDLPEYKEPLTEEEKSILSQE
                     ASKVIAKVQAGEIKPISVLRAYGKRALESQPELNAITEIFIKDSEKWAEHANTKGPLA
                     GFPITFKDTINVTGYDSCIGYSSRSFKPAVKDAPIVKLLKDAGAVPMLKTNVPFTLLS
                     FESYNDVWGVTSNPYHKDYAPGGSTGGEAALLAYGGSRLGVGTDVAGSVRVPAHFSGI
                     YSLKCSTGRFPKIGNTTSMAGQEGIPAVYSPMTRSLPDLGFFLKTIIDMKPWEYDYSV
                     HPIPWRKVDLPAKLKVGVIYDDGVVTPSPACARALDLTIDALEKQGHSIVKFDAPDPL
                     RCLRIASQLLCSDAGRIATRGQLWGENNDAGVGRMLFAQRLPRFVKKIYAWILQYIYR
                     DPVWAYMVRDWNEKTITERWDLVAEREQYKLEFFEAWKESGIDILLTVPNATPALPHK
                     GLYESISSCGYTFMFNLLDYSAGVLPVTRVDKEKDQLPPGFNPNKLNRIAKGAYDNYD
                     ATKMHGLPVGVQVVGQRLEEEKVIKAMEVVEDALHKSGVVYVQRNS"
     gene            complement(<442508..>442924)
                     /locus_tag="AWJ20_4752"
                     /db_xref="GeneID:30036918"
     mRNA            complement(<442508..>442924)
                     /locus_tag="AWJ20_4752"
                     /product="gluconokinase"
                     /transcript_id="XM_018881844.1"
                     /db_xref="GeneID:30036918"
     CDS             complement(442508..442924)
                     /locus_tag="AWJ20_4752"
                     /inference="similar to AA sequence:KEGG_Orthology:K00851"
                     /note="Putative gluconokinase; sequence similarity to
                     bacterial and human gluconokinase; green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm;
                     upregulated by deletion of the RNAP-II associated factor,
                     PAF1; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0046316 -
                     gluconokinase activity [Evidence IEA]; GO_function:
                     GO:0016301 - kinase activity [Evidence IEA,IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0046177 -
                     D-gluconate catabolic process [Evidence IEA]; GO_process:
                     GO:0019521 - D-gluconate metabolic process [Evidence IEA];
                     GO_process: GO:0008150 - biological_process [Evidence ND];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]; GO_process: GO:0016310 - phosphorylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="gluconokinase"
                     /protein_id="XP_018736282.1"
                     /db_xref="GeneID:30036918"
                     /translation="MSNGIPLTDDDRWDWLADVAATSSRAAAGNESTYIAVAACSALT
                     PKYREFLKSKVLPGTRIVIAFMWAPEEVLVARVGARKNHYMGTNMVASQAALMQVPKD
                     EELLENGGFSIPMSTVDQDPTFIAGEVVKKVNAFLK"
     gene            complement(<443791..>444552)
                     /gene="MRPL15"
                     /locus_tag="AWJ20_4753"
                     /db_xref="GeneID:30036919"
     mRNA            complement(<443791..>444552)
                     /gene="MRPL15"
                     /locus_tag="AWJ20_4753"
                     /product="mitochondrial 54S ribosomal protein YmL15"
                     /transcript_id="XM_018881845.1"
                     /db_xref="GeneID:30036919"
     CDS             complement(443791..444552)
                     /gene="MRPL15"
                     /locus_tag="AWJ20_4753"
                     /inference="similar to AA sequence:KEGG_Orthology:K17437"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; GO_component: GO:0005762 - mitochondrial large
                     ribosomal subunit [Evidence IPI] [PMID 12392552];
                     GO_component: GO:0005762 - mitochondrial large ribosomal
                     subunit [Evidence IDA] [PMID 9151978]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0004525 - ribonuclease III activity [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IPI] [PMID 12392552]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IDA] [PMID 9151978]; GO_process: GO:0090501 - RNA
                     phosphodiester bond hydrolysis [Evidence IEA]; GO_process:
                     GO:0090502 - RNA phosphodiester bond hydrolysis,
                     endonucleolytic [Evidence IEA]; GO_process: GO:0006396 -
                     RNA processing [Evidence IEA]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 12392552];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IC] [PMID 9151978]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL15"
                     /protein_id="XP_018736283.1"
                     /db_xref="GeneID:30036919"
                     /translation="MYLRQIPRSLRPFQPLGRLVVGESAGISHGQLAFKSQQTQQVRT
                     LVYTKDGVVRARGLKKNEEEYLTVNGVTYPGNEDTLKDAKTFLGEEYSLPDPVILQTI
                     THKSFAHGKKPYNEKLAILGKEFLRLQASHYAVSQTNDNPHAINKHNFDISPQPIEVL
                     SSSVALHEVCKKTGIHKNIFWKKRISENTSTGQELDAKFTGEQSVFARSIHALIGAIL
                     LRHGEPKARKFISEKLLSGPYSLISVSEKVYAPRP"
     gene            <445059..>446798
                     /gene="ROK1"
                     /locus_tag="AWJ20_4754"
                     /db_xref="GeneID:30036920"
     mRNA            <445059..>446798
                     /gene="ROK1"
                     /locus_tag="AWJ20_4754"
                     /product="RNA-dependent ATPase ROK1"
                     /transcript_id="XM_018881846.1"
                     /db_xref="GeneID:30036920"
     CDS             445059..446798
                     /gene="ROK1"
                     /locus_tag="AWJ20_4754"
                     /inference="similar to AA sequence:KEGG_Orthology:K14779"
                     /note="RNA-dependent ATPase; involved in pre-rRNA
                     processing at sites A0, A1, and A2, and in control of cell
                     cycle progression; contains two upstream open reading
                     frames (uORFs) in 5' untranslated region which regulate
                     translation; GO_component: GO:0030686 - 90S preribosome
                     [Evidence IDA] [PMID 12150911]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 9154839]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0004004 - ATP-dependent RNA helicase activity [Evidence
                     IDA] [PMID 23153376]; GO_function: GO:0008026 -
                     ATP-dependent helicase activity [Evidence IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0008186 - RNA-dependent ATPase activity
                     [Evidence IDA] [PMID 18975973]; GO_function: GO:0008186 -
                     RNA-dependent ATPase activity [Evidence IDA] [PMID
                     23153376]; GO_function: GO:0004386 - helicase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0003676 - nucleic
                     acid binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006200
                     - ATP catabolic process [Evidence IEA]; GO_process:
                     GO:0000480 - endonucleolytic cleavage in 5'-ETS of
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 9154839]; GO_process:
                     GO:0000447 - endonucleolytic cleavage in ITS1 to separate
                     SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic
                     rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 9154839]; GO_process: GO:0000472 -
                     endonucleolytic cleavage to generate mature 5'-end of
                     SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 9154839]; GO_process: GO:0006364 - rRNA
                     processing [Evidence IEA]; GO_process: GO:0042254 -
                     ribosome biogenesis [Evidence IEA]; GO_process: GO:0048254
                     - snoRNA localization [Evidence IMP] [PMID 18833290]"
                     /codon_start=1
                     /product="RNA-dependent ATPase ROK1"
                     /protein_id="XP_018736284.1"
                     /db_xref="GeneID:30036920"
                     /translation="MDIFKLLSRGATIQRNGKHQKDLELFNPNATAAKEVAAGSDSVD
                     LKIAKEIDFFKNASKADKKAKKVSSETNNKDKKVKQSNKNVIDNRNDEDDEEDDAVSV
                     PLSITSPEEASVQRKKFKIKTTGDDIPLPIGSFEDLTTRFQLHRHLLRNLEQQNFSSP
                     TAIQSESIPILLHGRDLIACAPTGSGKTLAFSIPLVQSLKEHKTTGIRCLIVSPTKEL
                     ATQIYNEVVKLSRGRDLNICILTKAAAAKFRNDALSRQKFDILITTPLRLVDAVKSEI
                     IDLSHVQHLVLDEADKLFEQGFLEQTDDILAACSNPRLQKALFSATIPSGVEEMAKTI
                     MHSPIRIIVGHKEGASHDIDQKLVYAGNEQGKLIAIRQMITGGEVVPPVIIFVQSIQR
                     AKALFHELLYDKVNVDAIHGERTQNQRDKVIERFKQGEIWVLICTDVLSRGIDFRGVN
                     LVINYDVPQSSQSYVHRIGRTGRAGRAGKAVTFFTKDDHDAVKNVVNVMKQSGCDVGD
                     WMLKMKKITKNDKKQLKKKPVERTEISTVPSVIRQKRKQRRDMVEASKKRKLHSTDDG
                     PASAEQSSDEASD"
     gene            complement(<447044..>447526)
                     /gene="ATP20"
                     /locus_tag="AWJ20_4755"
                     /db_xref="GeneID:30036921"
     mRNA            complement(<447044..>447526)
                     /gene="ATP20"
                     /locus_tag="AWJ20_4755"
                     /product="F1F0 ATP synthase subunit g"
                     /transcript_id="XM_018881847.1"
                     /db_xref="GeneID:30036921"
     CDS             complement(447044..447526)
                     /gene="ATP20"
                     /locus_tag="AWJ20_4755"
                     /inference="similar to AA sequence:KEGG_Orthology:K02140"
                     /note="Subunit g of the mitochondrial F1F0 ATP synthase;
                     reversibly phosphorylated on two residues;
                     unphosphorylated form is required for dimerization of the
                     ATP synthase complex, which in turn determines
                     oligomerization of the complex and the shape of inner
                     membrane cristae; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0031966 - mitochondrial
                     membrane [Evidence IEA]; GO_component: GO:0000276 -
                     mitochondrial proton-transporting ATP synthase complex,
                     coupling factor F(o) [Evidence IEA]; GO_component:
                     GO:0000276 - mitochondrial proton-transporting ATP
                     synthase complex, coupling factor F(o) [Evidence
                     IMP,IPI,ISS] [PMID 10336613]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0045263 - proton-transporting ATP
                     synthase complex, coupling factor F(o) [Evidence IEA];
                     GO_function: GO:0015078 - hydrogen ion transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0046933 - proton-transporting ATP synthase activity,
                     rotational mechanism [Evidence IDA] [PMID 20691145];
                     GO_function: GO:0005198 - structural molecule activity
                     [Evidence IMP,IPI] [PMID 9857174]; GO_process: GO:0006754
                     - ATP biosynthetic process [Evidence IEA]; GO_process:
                     GO:0015986 - ATP synthesis coupled proton transport
                     [Evidence IEA]; GO_process: GO:0015986 - ATP synthesis
                     coupled proton transport [Evidence IMP,ISS] [PMID
                     10336613]; GO_process: GO:0015986 - ATP synthesis coupled
                     proton transport [Evidence IDA] [PMID 20691145];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IMP,IPI] [PMID 9857174]; GO_process:
                     GO:0042407 - cristae formation [Evidence IMP] [PMID
                     19528297]; GO_process: GO:0006811 - ion transport
                     [Evidence IEA]; GO_process: GO:0006461 - protein complex
                     assembly [Evidence IMP] [PMID 17761666]; GO_process:
                     GO:0035786 - protein complex oligomerization [Evidence
                     IMP] [PMID 16551625]; GO_process: GO:0015992 - proton
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="F1F0 ATP synthase subunit g"
                     /protein_id="XP_018736285.1"
                     /db_xref="GeneID:30036921"
                     /translation="MLRNQLLNNSRLIARRSVRYNSTASQASSAVSKASSAVSTITSK
                     AAGFVNCSIYWAKVVAELGKHIYVKEGLSPPSGTQFQSVYKNLWQQILTQSKHFANSP
                     AQLVDTVTGVSRQQVVAGGAYLVQFAGLFALGEIIGRRNVFGYPHHHVEEEAEHAAEH
                     "
     gene            <448978..>450198
                     /locus_tag="AWJ20_4756"
                     /db_xref="GeneID:30036922"
     mRNA            <448978..>450198
                     /locus_tag="AWJ20_4756"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881848.1"
                     /db_xref="GeneID:30036922"
     CDS             448978..450198
                     /locus_tag="AWJ20_4756"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736286.1"
                     /db_xref="GeneID:30036922"
                     /translation="MTFQVDPIKDAQYNIHPFTHVHETSDKTLDYVDLVAIDLSKYTD
                     TPEGQESRRALAKQLHNALSTYGFFYVTGHGIEKERIDHLYSVAQSILELPDEIKYKH
                     LAGALRSDDEDRSVSLGAERGGGFKPRQYWAMKNGVRDQIEHYNFLDLLHDKLMTEQN
                     HPEIAKAYLEEVAEYYRLLHHTVLKKITVLCDIILEIPEGTIWEKNFKVVPEDRDASG
                     SGFGRFMMYHGMSPEDEAKTDDTWLRGHSDSTAFTFITSQPMASLQIRDYYTGKWRYI
                     PYLPNAFVVNIGDAMEFITGGYFKSTIHRVVKPPADQLYNRRLGLIYFSKPSAKSVID
                     PEAVNSPLLERLGYTKPEEWDRIEYAKWDDEKGRLFGRKDLNNTQTDEPLPVKLYGRY
                     AERWHQASGPKVFT"
     gene            <450577..>452274
                     /gene="FMO1"
                     /locus_tag="AWJ20_4757"
                     /db_xref="GeneID:30036923"
     mRNA            <450577..>452274
                     /gene="FMO1"
                     /locus_tag="AWJ20_4757"
                     /product="Fmo1p"
                     /transcript_id="XM_018881849.1"
                     /db_xref="GeneID:30036923"
     CDS             450577..452274
                     /gene="FMO1"
                     /locus_tag="AWJ20_4757"
                     /note="Flavin-containing monooxygenase; localized to the
                     cytoplasmic face of the ER membrane; catalyzes oxidation
                     of biological thiols to maintain the ER redox buffer ratio
                     for correct folding of disulfide-bonded proteins;
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 10077572]; GO_function: GO:0004499 -
                     N,N-dimethylaniline monooxygenase activity [Evidence IEA];
                     GO_function: GO:0004499 - N,N-dimethylaniline
                     monooxygenase activity [Evidence IDA] [PMID 10600176];
                     GO_function: GO:0050661 - NADP binding [Evidence IEA];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]; GO_function: GO:0004497 -
                     monooxygenase activity [Evidence IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0006457 - protein
                     folding [Evidence IDA] [PMID 10077572]"
                     /codon_start=1
                     /product="Fmo1p"
                     /protein_id="XP_018736287.1"
                     /db_xref="GeneID:30036923"
                     /translation="MNVKRIAIIGAGPAGAAGLDSFLSHGFTDIRVFERRPLPGGTWV
                     GDTELGFASNTGNTVPPIDDEVGDVPVEIPPEAASATEESPYVRKATIKARRFDEPTL
                     YSQLETNILPELMSFKRRSMPKNLLSNSVSKYENEDVFRSYKTIQEYVGEFFTGENEK
                     YVSYNTSVEQAEQPDGPGTKWVLTLKRQNGQNNNEEWWTEEFDGVYAASGRYNVPRVS
                     HINGLDEVAKAVPQGVIEHTKWFRGAESYKGKKVLIVGASVSTTDIIQLVKETAQLPL
                     YLSVRHVAPAYRAGFEQPFVDGRGSITSVSLNESGKSIDVIFEDGSTVTNIEKLVLAT
                     GYNFSYPYLEKYTQKFGGIVRNNVLHNVFLTTWWSEDPTLVLPGVFTEGINFRCMETQ
                     AMATAALWSGFPGSGFPSKEICVQWEADRRKFKTPAQWHFWFPHFDNIIEAIAKVGGG
                     YKALCEFAGITSSDLKTFVPVYEKGIAFKCLFFTKVANEYMLKHPKTLQQYNQTVALL
                     KTKTVEPDPTAAEADHELFKRLFVNWSGGRGEPKIPSKIQTTELSEKTPVVTEVAVK"
     gene            <452728..>454086
                     /gene="DUS1"
                     /locus_tag="AWJ20_4758"
                     /db_xref="GeneID:30036924"
     mRNA            <452728..>454086
                     /gene="DUS1"
                     /locus_tag="AWJ20_4758"
                     /product="Dus1p"
                     /transcript_id="XM_018881850.1"
                     /db_xref="GeneID:30036924"
     CDS             452728..454086
                     /gene="DUS1"
                     /locus_tag="AWJ20_4758"
                     /inference="similar to AA sequence:KEGG_Orthology:K05542"
                     /note="Dihydrouridine synthase; member of a widespread
                     family of conserved proteins including Smm1p, Dus3p, and
                     Dus4p; modifies pre-tRNA(Phe) at U17; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]; GO_function: GO:0050660 - flavin adenine
                     dinucleotide binding [Evidence IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA];
                     GO_function: GO:0017150 - tRNA dihydrouridine synthase
                     activity [Evidence IEA]; GO_function: GO:0017150 - tRNA
                     dihydrouridine synthase activity [Evidence IDA] [PMID
                     12003496]; GO_function: GO:0017150 - tRNA dihydrouridine
                     synthase activity [Evidence IMP] [PMID 14970222];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0002943 - tRNA
                     dihydrouridine synthesis [Evidence IEA]; GO_process:
                     GO:0006400 - tRNA modification [Evidence IDA] [PMID
                     12003496]; GO_process: GO:0006400 - tRNA modification
                     [Evidence IMP] [PMID 14970222]; GO_process: GO:0008033 -
                     tRNA processing [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Dus1p"
                     /protein_id="XP_018736288.1"
                     /db_xref="GeneID:30036924"
                     /translation="MTVSQAATPEPEVVTKTAAPVKTVVERPSEFTVENKLTGRDLLK
                     SVGFPKTIVAPMVDQSELAWRLISRKYGADLCYTPMFHARLFGEDKRYREDQFGPLDG
                     DANVDRPLIVQFCANDPEELLKAAKYVVGRCDAVDLNLGCPQGIAKKGKYGAFLMEDW
                     DLIYRLINILHTKLEIPVTAKIRIYETKEKTLEYAKMVLSAGAQFLTVHGRTREMKGQ
                     LTGLADWSYIRYVRDNLPPDTVIFANGNVLYSEDIDRSLEATKADAVMSAESNLYNPG
                     VFNVNKPGIDDQFPRVDKLLREYFETAKSTPGNASQTSMKSHFFKVLQSFLPKHLNIR
                     NAIGPIRKGQYDQFEDVVKQVEEIVEGIYEKVNKGELEDKVITLPDGYKSVPYWRCQP
                     YFRVVNGVLSNGKRKADVDPEAAQRKKEAKLEKEKAAAALASLSSDGPQPTGDEAPEP
                     SN"
     gene            complement(<455674..>456630)
                     /gene="cwf15"
                     /locus_tag="AWJ20_4759"
                     /db_xref="GeneID:30036925"
     mRNA            complement(<455674..>456630)
                     /gene="cwf15"
                     /locus_tag="AWJ20_4759"
                     /product="complexed with Cdc5 protein Cwf15"
                     /transcript_id="XM_018881851.1"
                     /db_xref="GeneID:30036925"
     CDS             complement(455674..456630)
                     /gene="cwf15"
                     /locus_tag="AWJ20_4759"
                     /inference="similar to AA sequence:KEGG_Orthology:K12863"
                     /codon_start=1
                     /product="complexed with Cdc5 protein Cwf15"
                     /protein_id="XP_018736289.1"
                     /db_xref="GeneID:30036925"
                     /translation="MTTAHRPTFDPARGQKNTQISGSIVHTRMLPAHTQLKFRKRGQG
                     GAADADAHGTDGGKRDFKRELLLAENESKQSNGKKRGLVEYDAEEEEAADVGSSRKRR
                     EISDGSVSKSVPLLKGDETSNSLHNGDEEKNNENIPEDESDSDVGDTDGYDSKARNED
                     EDEEYRRRILEKYKDIDADSDSDGDDDDEEKDEDDDDDEDEDDDDDDDDEEDETVMLM
                     RELEKIKKEKALEKQRLEEIAARKAEEEREREIAYGNPLMNPATKDGKDSFAVKRSWM
                     EDTVFKNQASSLAANQSEPKKELINDLLRSDFHKKFMDRYIK"
     gene            <459024..>460070
                     /gene="NBP2"
                     /locus_tag="AWJ20_4760"
                     /db_xref="GeneID:30036927"
     mRNA            <459024..>460070
                     /gene="NBP2"
                     /locus_tag="AWJ20_4760"
                     /product="Nbp2p"
                     /transcript_id="XM_018881853.1"
                     /db_xref="GeneID:30036927"
     CDS             459024..460070
                     /gene="NBP2"
                     /locus_tag="AWJ20_4760"
                     /note="Protein involved in the HOG (high osmolarity
                     glycerol) pathway; negatively regulates Hog1p by
                     recruitment of phosphatase Ptc1p the Pbs2p-Hog1p complex;
                     interacts with Bck1p and down regulates the cell wall
                     integrity pathway; found in the nucleus and cytoplasm,
                     contains an SH3 domain and a Ptc1p binding domain (PBM);
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14573466]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 11914276]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006972 -
                     hyperosmotic response [Evidence IMP,IPI] [PMID 14685261];
                     GO_process: GO:0000200 - inactivation of MAPK activity
                     involved in cell wall organization or biogenesis [Evidence
                     IMP,IPI] [PMID 22570491]; GO_process: GO:0006469 -
                     negative regulation of protein kinase activity [Evidence
                     IDA] [PMID 14685261]; GO_process: GO:0009408 - response to
                     heat [Evidence IMP] [PMID 14573466]"
                     /codon_start=1
                     /product="Nbp2p"
                     /protein_id="XP_018736290.1"
                     /db_xref="GeneID:30036927"
                     /translation="MAAKPPSPIASSAFQSGASHDISVLQDVLSGVSQPHDSKTDVVS
                     ENLDSKHQQLEHTDNDSPENNSDVAHQNVDAKGSVVYQDLEEIPNFHSALSYATVRDF
                     AYPEFHPLHYGVPEFEQASGETDDDEDYEPTYEYNDTYDANDPHSHYYNDKSAGFEDG
                     PPWQQDSDLNSPVIKSHEVGDRISKEYQFSVASADEIHGRAVALFDFTPENDNEAPLQ
                     EGQIVWISYRHGQGWLVAEDPETGETGLVPEEYVQLLNSISYEEDILQDSSEPAIYQS
                     PESDSEGWVDEAEPEGDAAEPATEPVVKSASDTDYTDLKKGIKDLSLRESEEHEHNQT
                     EPETAEVYSQVPSE"
     gene            complement(<460379..>461458)
                     /locus_tag="AWJ20_4761"
                     /db_xref="GeneID:30036928"
     mRNA            complement(<460379..>461458)
                     /locus_tag="AWJ20_4761"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881854.1"
                     /db_xref="GeneID:30036928"
     CDS             complement(460379..461458)
                     /locus_tag="AWJ20_4761"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736291.1"
                     /db_xref="GeneID:30036928"
                     /translation="MDTVQQARKLLESSEAAKCLELALPVLDSQSSDDVKLEALHLIG
                     EAYLENGDPKNAFECFSKCAELDPDGSKGGMEKFLWLGQLSGGEPGLKWFEKGLHGLR
                     NALTEVNNKAASSSKVNGDNDLQMQFQVKLLHKKINEALCGMIEVWMTDLCMEPEAES
                     QCEKLIAEALLLDEEIPESWSMLGSIRISQQRNDDAREALERSWQLFQAVGDGSIDEL
                     PSLIRLAQNMMEMGQHQYVLDVTKRIHVMDDQVVDSFYLNGLAHNELYKEIRDGPDAE
                     SKSRIAARHIAGARDAWTLLLNLTNTGDVEVDDELVSSVQELLTTLPEVGDDDFSSSS
                     EEEDEDMEDDDDKVDLKDLDSDEEL"
     gene            complement(<461752..>464247)
                     /gene="RLF2"
                     /locus_tag="AWJ20_4762"
                     /db_xref="GeneID:30036929"
     mRNA            complement(<461752..>464247)
                     /gene="RLF2"
                     /locus_tag="AWJ20_4762"
                     /product="Rlf2p"
                     /transcript_id="XM_018881855.1"
                     /db_xref="GeneID:30036929"
     CDS             complement(461752..464247)
                     /gene="RLF2"
                     /locus_tag="AWJ20_4762"
                     /note="Largest subunit (p90) of the Chromatin Assembly
                     Complex (CAF-1); chromatin assembly by CAF-1 is important
                     for multiple processes including silencing at telomeres,
                     mating type loci, and rDNA; maintenance of kinetochore
                     structure; deactivation of the DNA damage checkpoint after
                     DNA repair; and chromatin dynamics during transcription;
                     GO_component: GO:0033186 - CAF-1 complex [Evidence IDA]
                     [PMID 9030687]; GO_component: GO:0000775 - chromosome,
                     centromeric region [Evidence IDA] [PMID 11782447];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     9030688]; GO_function: GO:0042393 - histone binding
                     [Evidence IDA] [PMID 16503640]; GO_process: GO:0006335 -
                     DNA replication-dependent nucleosome assembly [Evidence
                     IDA] [PMID 9030687]; GO_process: GO:0006335 - DNA
                     replication-dependent nucleosome assembly [Evidence IMP]
                     [PMID 9030688]"
                     /codon_start=1
                     /product="Rlf2p"
                     /protein_id="XP_018736292.1"
                     /db_xref="GeneID:30036929"
                     /translation="MLSLQAKTGPMSPKDTNIVSGKSIDNATPRDPVETVKTKLCKRD
                     RDNDIGQGQENSGIPIKNSQSKNQDSSLSNIESNTHERSSKDKTVKAKESSTTSAPDT
                     SKQSELPSQKTNPSVTQSDSPVNWTGANQNIVMMPNNVPMNVQGMTPNMVPPPNMIFT
                     NMLASGMIPPNMIPPGMVPANMISPNAIPPTTIPLNMIPPQMIPPHMLPPNMVSPPFL
                     PSGMIPVSTIQDGESTPSPERPNKKQKIGKTKEEREQERLDKENERLAKLEAEQQKKA
                     EKMAEKMAEKQRREEEKEEKKRQKEEEKRLKEEEKRLKEAAKEEEKRQKEEEKRLKEA
                     AKEEERRQKEEEKRLKEEAKEQARLKEERKQLRMDRFFKKVQKPTSAETPAGSSESKE
                     ARSFSSSIIDDSNNSSLNATKSTASESTASVESSSNGSENSTEESKADLNTSPCTFDE
                     IFLPFHIKVDTTLCARDSWIEKRARNELPSTDIDIFLKTNKQQRGFSPDKTTVEIIQL
                     MNTGSLTESRVMELLNKLPRRHLKFAENIRPPYVGTFSKPTPRIMVIQPWKRFIAPQD
                     TNPETLVSTTDLIPDTTRVELGNSLLSINYDYDSDYDWVNDNEEGDEEIGEDIGEEDE
                     SESDDDDNEMAGFVEDESDTPTPSSSSDEGSPTNTNRRRIIGPLASLVAWNDGTEPHI
                     FDHMETALLIDLKGDASIDPFKDYWASSPAEATAVGTALPSTASPTSSATATPAKLIP
                     DHLLRDFLTKIQGSDKNQTLLVETLKIEFNSVSKSTIRDTIKACAKRVGAKENDKRWV
                     INPPFADKYGILTAPTTNSTSTTRQASPFLAGN"
     gene            complement(<465594..>468080)
                     /gene="VPS70"
                     /locus_tag="AWJ20_4763"
                     /db_xref="GeneID:30036930"
     mRNA            complement(<465594..>468080)
                     /gene="VPS70"
                     /locus_tag="AWJ20_4763"
                     /product="Vps70p"
                     /transcript_id="XM_018881856.1"
                     /db_xref="GeneID:30036930"
     CDS             complement(465594..468080)
                     /gene="VPS70"
                     /locus_tag="AWJ20_4763"
                     /inference="similar to AA sequence:KEGG_Orthology:K01301"
                     /note="hypothetical protein involved in vacuolar protein
                     sorting; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_function:
                     GO:0004177 - aminopeptidase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0008237 - metallopeptidase
                     activity [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0008233
                     - peptidase activity [Evidence IEA,IEA]; GO_process:
                     GO:0006623 - protein targeting to vacuole [Evidence IMP]
                     [PMID 12134085]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0006508 -
                     proteolysis [Evidence IEA,IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Vps70p"
                     /protein_id="XP_018736293.1"
                     /db_xref="GeneID:30036930"
                     /translation="MVVVRVDEESQSLIRGPNGLKVRKRRASCLRFGCYTLLGVFFLA
                     VFNVIFLPRTSISRDWNRLHSIKVSDADVKRTLFQSVNASSIRDWSYKYTQEPHLAGT
                     NYGLVEWTRDKFEEYGIPAEIVSYDIYLNYPRDHAVKLLNEDGSVQFSASLEEAVIEE
                     DPTTSREDRVPTFHGYSASGNVTGQLIYVNYGTREDYDQLIAKGVDFKGKIVIARYGG
                     IFRGLKVKFAQDLGAIGALLYSDPGDDGGITIKNGYEAYPNGPARHPSSVQRGSVQFL
                     SLGPGDPTTPGWASKPDSKRVDPYDTIPSIPSIPISYEDALPLLKAINGKGLKGSDLG
                     ENWVGELTDEFDYSVGPSTLEVNLYNDQDYDIRPTYNVIGKIEGIISDEAIVIGNHRD
                     AWIAGGAGDPNSGSAALIELAKAFGELKKIGWKPSRTIILGSWDGEEYGLLGSTEWGE
                     DNAEYLQHHVIAYLNVDVAFSGSRFGASASPLLDNVLIDVTKQVPAPSGNGTLYDLWY
                     SQNGARISSLGSGSDYTVFQDYLGIPSVDFGFGGGKGDPVYQYHSNYDSFYWMDKFGD
                     KDFAHHSVMVKAWGLLTLTLSETELIPFKLASYAKLLDTYLEKTESQLPKEIFDDGDD
                     EYDDDDDFDFDFSEEMSVDMAVAIANADSSALASVNPVSSTDVSDTEVDAQQIFTRPK
                     HRKPKHPKRKLHKEARKAFEKLRKEVDKFKTRARKYDAYTERLQEEFTQDYAWFYSYK
                     KLILLVKIKVANIKLAQIEQLFTYDKGLDNGRSWFKHVVFAPGINTGYAGALLPGLTE
                     AIDARDPSAILKWATIIRASVTSVNALVSK"
     gene            complement(<468452..>471052)
                     /gene="slx4"
                     /locus_tag="AWJ20_4764"
                     /db_xref="GeneID:30036931"
     mRNA            complement(<468452..>471052)
                     /gene="slx4"
                     /locus_tag="AWJ20_4764"
                     /product="structure-specific endonuclease subunit"
                     /transcript_id="XM_018881857.1"
                     /db_xref="GeneID:30036931"
     CDS             complement(468452..471052)
                     /gene="slx4"
                     /locus_tag="AWJ20_4764"
                     /codon_start=1
                     /product="structure-specific endonuclease subunit"
                     /protein_id="XP_018736294.1"
                     /db_xref="GeneID:30036931"
                     /translation="MEDVVLVSSTGIDTSSPNSLSNNSPVHSRLTRTISKFAFEGSVS
                     NITTTTTTTTKTGSFVSSAVELETLDAQHVTITTTVSKELTVNHSPQASKEKKKKRKK
                     SATTKSSETSKKSVVKKTRKPKEKVPATLNERMVAIFEKSALITVPDEYRGNVDPSHH
                     GIDITRNDSNGYYINNNDRSENNDNKDENKNSYYNETNDKSQQDDRMAASISSTIARH
                     DISANNRPFNFGCDIQLNDPDYDNARLLSGKPGKVRALRRNRQNQEKQDRASGQSKRL
                     KPSYQLEAVPKPQIPADFLVSVEEGCQNIKQLKLIFPDTPKPKRHCSSQRNNSAETIS
                     PVRNRTSFNREKRGSESLTMFDLASRIPSDILSQEMRMLDSRSEKENIFDEEVPEAGD
                     TDSDESPEIAVSTSSKLAAVSVLTPNRSLVSGSGKSITNSRAEFDDGVQVLTKNVHPR
                     RVLTPLLNSEVRSQSDPFVASRSGDDRTSQNAISLPRSKRQDSNTEKNSFVEIYEISD
                     SENDYGSPLVLSQQRPTNLLCNSPIRQLSAATIITISSSPIHNETGPSKPDKLNSIDT
                     FDEFHSSSPPRASLSISSARRLTLEPDKISDRLANSTDDSYSFNSVDEVPQSPGYADS
                     ENLLEYAPYIMTVGEPYKDIISGSPPNRCSQPISIPSSSISTFSSFGSQDDTANSNVP
                     ITDIHSEPQTTDFVDPTPLTDKTADELPPRTENVDYKSIYEAMPLDELRRTVDKYGFK
                     PRRSRQAMIELLLSCHTDTTDIPSIAAVSQPSTSMPNSDSDMRSKLFTRISTQIRTNP
                     LAKPWWTKMLLYEPLPLESFQRFLQQTLSIDLDLELVRSWCDHCGVCTRASDPTHSDT
                     PSSQTSETEV"
     gene            complement(<471658..>472089)
                     /gene="CPR1"
                     /locus_tag="AWJ20_4765"
                     /db_xref="GeneID:30036932"
     mRNA            complement(<471658..>472089)
                     /gene="CPR1"
                     /locus_tag="AWJ20_4765"
                     /product="peptidylprolyl isomerase CPR1"
                     /transcript_id="XM_018881858.1"
                     /db_xref="GeneID:30036932"
     CDS             complement(471658..472089)
                     /gene="CPR1"
                     /locus_tag="AWJ20_4765"
                     /inference="similar to AA sequence:KEGG_Orthology:K01802"
                     /note="Cytoplasmic peptidyl-prolyl cis-trans isomerase
                     (cyclophilin); catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues; binds the
                     drug cyclosporin A; N-terminally propionylated in vivo;
                     protein abundance increases in response to DNA replication
                     stress; GO_component: GO:0034967 - Set3 complex [Evidence
                     IDA] [PMID 11711434]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0000118 - histone
                     deacetylase complex [Evidence IPI] [PMID 15643056];
                     GO_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IEA]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IDA] [PMID
                     22984289]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 15643056]; GO_function:
                     GO:0016018 - cyclosporin A binding [Evidence IMP] [PMID
                     7515500]; GO_function: GO:0016853 - isomerase activity
                     [Evidence IEA]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA] [PMID 23222640]; GO_function: GO:0042277 -
                     peptide binding [Evidence IEA]; GO_function: GO:0003755 -
                     peptidyl-prolyl cis-trans isomerase activity [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0003755 - peptidyl-prolyl
                     cis-trans isomerase activity [Evidence IDA] [PMID
                     2687115]; GO_process: GO:0030437 - ascospore formation
                     [Evidence IMP] [PMID 15643056]; GO_process: GO:0044267 -
                     cellular protein metabolic process [Evidence IMP] [PMID
                     11641409]; GO_process: GO:0044267 - cellular protein
                     metabolic process [Evidence IMP] [PMID 12242280];
                     GO_process: GO:0016575 - histone deacetylation [Evidence
                     IDA] [PMID 11711434]; GO_process: GO:0045836 - positive
                     regulation of meiosis [Evidence IGI,IMP] [PMID 15643056];
                     GO_process: GO:0006457 - protein folding [Evidence
                     IEA,IEA]; GO_process: GO:0000413 - protein peptidyl-prolyl
                     isomerization [Evidence IEA,IEA,IEA]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="peptidylprolyl isomerase CPR1"
                     /protein_id="XP_018736295.1"
                     /db_xref="GeneID:30036932"
                     /translation="MLTVAQIVPKTAKNFRELATGSEGFGYAKSGFHRVIPEFMLQGG
                     DFTNHNGTGGKSIYGAKFADENFQAKHTRPGLLSMANAGPNTNGSQFFITTVPCPWLD
                     GKHVVFGEVVEGYDVVKKIETFGSSSGATRAKLVIDASGTV"
     gene            <477114..>478451
                     /gene="ENT3"
                     /locus_tag="AWJ20_4766"
                     /db_xref="GeneID:30036933"
     mRNA            <477114..>478451
                     /gene="ENT3"
                     /locus_tag="AWJ20_4766"
                     /product="Ent3p"
                     /transcript_id="XM_018881859.1"
                     /db_xref="GeneID:30036933"
     CDS             477114..478451
                     /gene="ENT3"
                     /locus_tag="AWJ20_4766"
                     /inference="similar to AA sequence:KEGG_Orthology:K12471"
                     /note="Protein containing an N-terminal epsin-like domain;
                     involved in clathrin recruitment and traffic between the
                     Golgi and endosomes; associates with the clathrin adaptor
                     Gga2p; GO_component: GO:0005794 - Golgi apparatus
                     [Evidence IEA,IEA]; GO_component: GO:0030479 - actin
                     cortical patch [Evidence TAS] [PMID 10652251];
                     GO_component: GO:0030125 - clathrin vesicle coat [Evidence
                     IDA] [PMID 12483220]; GO_component: GO:0030665 -
                     clathrin-coated vesicle membrane [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0031410 - cytoplasmic vesicle [Evidence
                     IEA]; GO_component: GO:0005768 - endosome [Evidence IDA]
                     [PMID 12967568]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_function: GO:0030276 - clathrin binding
                     [Evidence IDA] [PMID 12967568]; GO_function: GO:0008289 -
                     lipid binding [Evidence IEA]; GO_function: GO:0080025 -
                     phosphatidylinositol-3,5-bisphosphate binding [Evidence
                     IDA] [PMID 14630930]; GO_function: GO:0032266 -
                     phosphatidylinositol-3-phosphate binding [Evidence IDA]
                     [PMID 14630930]; GO_function: GO:0005515 - protein binding
                     [Evidence IPI] [PMID 12483220]; GO_process: GO:0006895 -
                     Golgi to endosome transport [Evidence IMP] [PMID
                     12483220]; GO_process: GO:0000147 - actin cortical patch
                     assembly [Evidence ISS] [PMID 10449404]; GO_process:
                     GO:0030036 - actin cytoskeleton organization [Evidence
                     IMP] [PMID 12967568]; GO_process: GO:0007015 - actin
                     filament organization [Evidence ISS] [PMID 10449404];
                     GO_process: GO:0034498 - early endosome to Golgi transport
                     [Evidence IGI] [PMID 20658963]; GO_process: GO:0032511 -
                     late endosome to vacuole transport via multivesicular body
                     sorting pathway [Evidence IMP] [PMID 15107463];
                     GO_process: GO:0071985 - multivesicular body sorting
                     pathway [Evidence IMP] [PMID 12967568]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ent3p"
                     /protein_id="XP_018736296.1"
                     /db_xref="GeneID:30036933"
                     /translation="MPMIYKRFTDKSAEEWRQIYKALQLLEFLVKNGSERVVDYARSH
                     SAVIDMLKHFHFIDQNGKDQGINIRNRAKELTALLNDVERIRTERKKARSNKAKYSGI
                     GNDIEGDEDFGGFGGTGKKYGGFGSDSMEFGGGYNANKVYGDGGGFNGSNYDGPGYSR
                     GAGAGDDDEFEEYEVGGGYNDDSSGSAGSTSGSRNKGKTAASSSSRTKTTSSSSAAAP
                     APVADFISFDDDVAPPAATGASSSAAAEDDDDFDDFQSATPVAGASSNTKTTGGGSST
                     KADLLDLFSQPSTASSFQSQPLQQQQQFSSFTSSPGLPTQLSSTPSVVSPSAFSTTST
                     IGSNSTGFPGFSSTPSTPSIGAGSGLGNSSTGKPAAKKANDAFGDLWSSASKTKKSSA
                     KTEPTSLAALAHENAQKSMWGGAPASSSSPSQPQPQSQQPSSSSGQIDDLLSF"
     gene            complement(<478679..>479569)
                     /gene="GIR2"
                     /locus_tag="AWJ20_4767"
                     /db_xref="GeneID:30036934"
     mRNA            complement(join(<478679..479334,479500..>479569))
                     /gene="GIR2"
                     /locus_tag="AWJ20_4767"
                     /product="Gir2p"
                     /transcript_id="XM_018881860.1"
                     /db_xref="GeneID:30036934"
     CDS             complement(join(478679..479334,479500..479569))
                     /gene="GIR2"
                     /locus_tag="AWJ20_4767"
                     /note="Highly-acidic RWD domain-containing hypothetical
                     protein; cytoplasmic; forms a complex with Rbg2p;
                     interacts with Rbg1p and Gcn1p; associates with
                     translating ribosomes; putative intrinsically unstructured
                     protein; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005844 - polysome
                     [Evidence IDA] [PMID 19448108]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0002181 -
                     cytoplasmic translation [Evidence IGI] [PMID 21076151]"
                     /codon_start=1
                     /product="Gir2p"
                     /protein_id="XP_018736297.1"
                     /db_xref="GeneID:30036934"
                     /translation="MDNKEEQEQEIDVLRSIYPDELEILSENKYNIHIKLDTTPTKFL
                     ILEVEYPDDYPQVVPVLDVDNSDGSYVNASGEDDEGYDGSDEEEYEDGIDETQGDSIE
                     FTNADLVDLRKVLEENAEENIGLPSIFTLASLLKDQAEELVEKKIKIKEKQREKLIFE
                     QEEKEQAKFRGTPVTPESFKAWRLKFRAELGLDNKEDANKPKHKLTGKEIFEKGLNKD
                     EDEDDDTPAEPDQLASSVENLAV"
     gene            <480189..>482804
                     /gene="MIF2"
                     /locus_tag="AWJ20_4768"
                     /db_xref="GeneID:30036935"
     mRNA            <480189..>482804
                     /gene="MIF2"
                     /locus_tag="AWJ20_4768"
                     /product="Muscle M-line assembly protein unc-89"
                     /transcript_id="XM_018881861.1"
                     /db_xref="GeneID:30036935"
     CDS             480189..482804
                     /gene="MIF2"
                     /locus_tag="AWJ20_4768"
                     /codon_start=1
                     /product="Muscle M-line assembly protein unc-89"
                     /protein_id="XP_018736298.1"
                     /db_xref="GeneID:30036935"
                     /translation="MIRLQVRIIPASQADNEVSSRVSRPSNFGPSSYHLQSSTPNASV
                     KSFSNNDDDTYGFLHLVTPSELLKTVRDSIVNRFAKIYPEEGPLFIERLQDSSGLDLD
                     PDYKVGDVFADRDDLFVILQEPVTRNDILQSNVSVADEPSLKRRAEDDSNSSIVLRPT
                     KSRKRKSSIWMTPSNNAADISSLSHTPVPVLSSGTPASHLNVAPQLSESNGSPRVRRR
                     PSLDLMAKPSAAEIPDSDVDEEAHEGNLSLPPPSNEAYANADPLKPVSPSANLNGSKN
                     ILNLESDKVQLLPPTPAKKSPIAGKKRAPQSELQLTPEITVKAAEQAEAVLEVASSQP
                     SQDEASITQESDDKIETGLQPIAGTPTGSQPKAKRQRAKATEKKIQDTLINATETKGV
                     EVSPISGLTRKEQAQEAKRLREEAKKLKQLEAQKKKEEQLKKKELQAQRKRELEAQKS
                     AKAAELRELQRKKALEELEKLGEENRRKREEERLKQQEQQQREQKDETNPSQDDIIET
                     ENSDDGAKGKKRPSAETLRRNQQRLEANRKSMEKFHNAVNSLEKDADGSAAVPEASVE
                     PPTQSEEPPKRKRGRPPKKKVEVQPETVKPVSPVKPDVVPTAAKINGSQGSTNDKQEN
                     KQEEPNDNEEDDDEQEEGQKIKPVTNQRSQGNTAARYAQRLLRDDSNSDSSSADELSD
                     GDSDLSDSPAPVKRPRIVPTPSSAKLVTANGNGRATGSQSQASPAPNPVRTTMPQPHP
                     SAVRTSSATPSSPNPAPQTRLTGLNLLSSLASQAIPDVRERVTGVLPVAPKVNSKPSQ
                     PKEDTDSDSNSDSDSDSDSDSNSDSDAESDGEETNGIPLSKMASKTKQPKKKKRNTGF
                     MGLMKDAFAGSVKSR"
     gene            <483229..>485949
                     /gene="MCM4"
                     /locus_tag="AWJ20_4769"
                     /db_xref="GeneID:30036936"
     mRNA            <483229..>485949
                     /gene="MCM4"
                     /locus_tag="AWJ20_4769"
                     /product="MCM DNA helicase complex subunit MCM4"
                     /transcript_id="XM_018881862.1"
                     /db_xref="GeneID:30036936"
     CDS             483229..485949
                     /gene="MCM4"
                     /locus_tag="AWJ20_4769"
                     /inference="similar to AA sequence:KEGG_Orthology:K02212"
                     /note="Essential helicase component of heterohexameric
                     MCM2-7 complexes; MCM2-7 complexes bind pre-replication
                     complexes on DNA and melt DNA prior to replication; forms
                     an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in
                     G1; homolog of S. pombe Cdc21p; GO_component: GO:0031261 -
                     DNA replication preinitiation complex [Evidence IDA] [PMID
                     9554851]; GO_component: GO:0042555 - MCM complex [Evidence
                     IEA]; GO_component: GO:0042555 - MCM complex [Evidence
                     IDA] [PMID 12480933]; GO_component: GO:0097373 - MCM core
                     complex [Evidence IDA] [PMID 13679365]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 10559985];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     10704410]; GO_component: GO:0005656 - nuclear
                     pre-replicative complex [Evidence IDA] [PMID 16824194];
                     GO_component: GO:0005656 - nuclear pre-replicative complex
                     [Evidence IDA] [PMID 9335335]; GO_component: GO:0043596 -
                     nuclear replication fork [Evidence IDA] [PMID 16103218];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     10559985]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 10704410]; GO_component: GO:0031298 -
                     replication fork protection complex [Evidence IDA] [PMID
                     16531994]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0043140 - ATP-dependent 3'-5'
                     DNA helicase activity [Evidence IDA] [PMID 13679365];
                     GO_function: GO:0004003 - ATP-dependent DNA helicase
                     activity [Evidence IDA] [PMID 15723534]; GO_function:
                     GO:1990163 - ATP-dependent four-way junction helicase
                     activity [Evidence IDA] [PMID 13679365]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0003678 - DNA helicase activity [Evidence IEA];
                     GO_function: GO:0003678 - DNA helicase activity [Evidence
                     IDA] [PMID 18657510]; GO_function: GO:0003688 - DNA
                     replication origin binding [Evidence IDA] [PMID 11756674];
                     GO_function: GO:0003688 - DNA replication origin binding
                     [Evidence IDA] [PMID 16824194]; GO_function: GO:0004386 -
                     helicase activity [Evidence IEA]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0003697 - single-stranded DNA binding
                     [Evidence IMP] [PMID 17895243]; GO_function: GO:0017116 -
                     single-stranded DNA-dependent ATP-dependent DNA helicase
                     activity [Evidence IDA] [PMID 18657510]; GO_function:
                     GO:0043142 - single-stranded DNA-dependent ATPase activity
                     [Evidence IDA] [PMID 15723534]; GO_process: GO:0006260 -
                     DNA replication [Evidence IEA,IEA]; GO_process: GO:0006270
                     - DNA replication initiation [Evidence IEA]; GO_process:
                     GO:0006270 - DNA replication initiation [Evidence IGI]
                     [PMID 2044962]; GO_process: GO:0006271 - DNA strand
                     elongation involved in DNA replication [Evidence IMP]
                     [PMID 10834843]; GO_process: GO:0006268 - DNA unwinding
                     involved in DNA replication [Evidence IDA] [PMID
                     13679365]; GO_process: GO:0006268 - DNA unwinding involved
                     in DNA replication [Evidence IDA] [PMID 15723534];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0000727 - double-strand break repair via
                     break-induced replication [Evidence IMP] [PMID 20516198];
                     GO_process: GO:0033260 - nuclear cell cycle DNA
                     replication [Evidence IMP] [PMID 10834843]; GO_process:
                     GO:0033260 - nuclear cell cycle DNA replication [Evidence
                     IMP] [PMID 2044962]; GO_process: GO:0006267 -
                     pre-replicative complex assembly involved in nuclear cell
                     cycle DNA replication [Evidence IDA] [PMID 16824194];
                     GO_process: GO:0006267 - pre-replicative complex assembly
                     involved in nuclear cell cycle DNA replication [Evidence
                     IPI] [PMID 9335335]"
                     /codon_start=1
                     /product="MCM DNA helicase complex subunit MCM4"
                     /protein_id="XP_018736299.1"
                     /db_xref="GeneID:30036936"
                     /translation="MASSPPAPGDSSPLFFNSVTSSSPIRARASQDDGALSERAGRLR
                     IEDVSSPLGYPSSERDHTLYSASRNGRSSHFSETDNISADNHHRSYNRRGDIFSSDLT
                     PSRRMLVSSDGHAPSDSGLFTLSARGSDVSETGNPGDPVRLIWGTNVSIAETMNSFRS
                     FLQSFKSKYRMMHDDIPIGPGEGEDLVYVNMMNQMRILGSANLNLDAQNLLAYPATHK
                     LYYQLINYPYELVPIMDQVIKDCMVTLVTTTTNGGTVDAKELEATEMRNYKVRPFGID
                     NKRGMRDLNPGDIDKLVTVKGLVLRATPVIPDMKEAFFKCIVCSHTVVVEIDRGTITE
                     PTKCPRPVCGRTNSMQIVHNRCLFADKQVIRLQETPDITPDGQTPHSISLCVYDELVD
                     ICKAGDRVEVTGIFRSVPVRINPRQRTLKSLFKTYVDILHVQKVDKKRMGIDVTTNLE
                     AEVAEQQQADVEETRKITEDDIAKIKEVAARDDLYDLLARSLAPSIYEQDDVKKGILL
                     QLFGGSNKTFEKGGSPRYRGDINILLCGDPSTSKSQMLQYVHKIAPRGIYTSGKGSSA
                     VGLTAYVTRDIETKQLVLESGALVLSDGGICCIDEFDKMSDATRSVLHEVMEQQTISI
                     AKAGIITTLNARTSILASANPIGSKYDVKLSVPQNIDLPPSLLSRFDLVYLMIDKIDA
                     QADRHLANHLTRMYAEDVPENAATSEILPVEFLTLYISYAKNLQPQITPEAKDELVKA
                     YVAMRKLGEDSRTAEKRITATTRQLESMIRLSEAHAKMRLSEVVTADDVLEAVRLIRS
                     AIKEYAMDPITGTIDMDLVQTGTSSAQRRLRVDLKENLLSIMDTAIARTGSGGTLRYD
                     ELVRLVADIIPTRVENLELGNALRSLEQEGKIVMTGSNTRRTIRRVTGLV"
     gene            complement(<486060..>488579)
                     /gene="SLS1"
                     /locus_tag="AWJ20_4770"
                     /db_xref="GeneID:30036938"
     mRNA            complement(<486060..>488579)
                     /gene="SLS1"
                     /locus_tag="AWJ20_4770"
                     /product="Sls1p"
                     /transcript_id="XM_018881864.1"
                     /db_xref="GeneID:30036938"
     CDS             complement(486060..488579)
                     /gene="SLS1"
                     /locus_tag="AWJ20_4770"
                     /note="Mitochondrial membrane protein; coordinates
                     expression of mitochondrially-encoded genes; may
                     facilitate delivery of mRNA to membrane-bound translation
                     machinery; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IDA] [PMID 8917313]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IDA] [PMID 8917313]; GO_component:
                     GO:0042645 - mitochondrial nucleoid [Evidence IDA] [PMID
                     12637560]; GO_component: GO:0042645 - mitochondrial
                     nucleoid [Evidence IDA] [PMID 15692048]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0009060 - aerobic respiration
                     [Evidence IMP] [PMID 8917313]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IMP] [PMID 12637560];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="Sls1p"
                     /protein_id="XP_018736300.1"
                     /db_xref="GeneID:30036938"
                     /translation="MLSFGGRAGRAICLLPKRGSVGVLSKAGNIINSCTTYGYGIRWN
                     SGPGSDNLGDTKNELLSSKEGMKGIAVDDISSLKKSPLLNQKDSTPAAAADTAGSSST
                     TIDSAAGSNTSTVDSQSETKFSGSETTENVTGNSHSLAASKTRGKKLPPPPQEYIILG
                     ARSSRVIPKHRRPKTNFSRDIKVDDLDEQRKQLLVFTSSVPIGTAIANIDRMKPSASL
                     LSPKRYDQLVIDLKRSFAVPQLREYIREKSNSTLRSSGTKAQLINTILLSLWRVSASQ
                     SVSESSDVIIERTFQLTRRELFIIVSQNSKLPRSWTKSGASIVILGDEQKIIVRATAD
                     TCNWIMASLHKTLQSIQDNDIDFSCLEPFASINDIPLDQIQRLSDTYLRYQQSEKMLV
                     ASSKSKDHAEHARRLILHSSGFTPKSISNYIYEDSNFTPRSLSRIIDDDALAWNERSR
                     IWKRWKKVRSKQPFSSFERLRNLGSQPKNIVLAQGKINKVAPQPSTLKDSYEDSVSNI
                     LLKNLEQEDSNNQLTFTATFGYLLHEAPSESNAKSAADPSYLAGDVQRTFLSNVPFVF
                     QRCSELSLYHNEIYHDPSKPPPPPKPSPDSGSTTATSSAWNKLLSNAKLLTDSVPSTE
                     DDSLVPVEGTRGLLDDDNMRLVQIKFIPSPFHLKDSDKLQKLPPVEMWFELKENSDEC
                     DLDSLRLVSADHEANSYLSLPDYETDIKFSATSANFLDHNEQEGVNQFLSRAQLGISG
                     NKKIYVPNELKLKMPGFEDDVTYLYQSMCYRRQIDLGFKGHILQLSSLESGGFGGRRI
                     EANLVLDFPDGSESVSKSEVKSFVNDALEFCESLRRRSIHL"
     gene            <488843..>490696
                     /gene="rrn5"
                     /locus_tag="AWJ20_4771"
                     /db_xref="GeneID:30036939"
     mRNA            <488843..>490696
                     /gene="rrn5"
                     /locus_tag="AWJ20_4771"
                     /product="RNA polymerase I upstream activation factor
                     complex subunit Rrn5"
                     /transcript_id="XM_018881865.1"
                     /db_xref="GeneID:30036939"
     CDS             488843..490696
                     /gene="rrn5"
                     /locus_tag="AWJ20_4771"
                     /codon_start=1
                     /product="RNA polymerase I upstream activation factor
                     complex subunit Rrn5"
                     /protein_id="XP_018736301.1"
                     /db_xref="GeneID:30036939"
                     /translation="MPPKRKSLPDISNEGPSQKKLFLQADYRIKYGKPQLEKYVAQFN
                     KEVVEFLTGIDTSDSGEQVDFVSEKDNDAGTEEPLVDDVSERTEPAINGSEAVTSKSE
                     VVTNILEVDSDSEHSTNGVLNRVDECSSSEDSIGIDETDLEPSEDDYRCGTIWSEEEK
                     ERFFTALGRKSCHDMAAISRAVGTKTLIECEAYYNLLKSCYEYLKRRKPLLSKTLQRE
                     IFVSYEDLPYSYEMTESWDSVENKYANAVIDAIADMEVEKQNQQQETTNDQNGTTEHT
                     NSEPLLLKLDTDTSSQHPIDTTLINGSSHEHPNTGTLQGVGSEISVSNVASSDYKVSA
                     TRTATTVATNVVPRKTLFAKRSGMCAKASSQLLNIPEAVKFANMFFRQSQKNLGHMYH
                     HGGRGQKKSHFYLEDISQEAVDYLENIIKSQTRLILGRYIWSAEDYDPSDEEHRNKAF
                     YENLVHAMGYITRVNKHLQERYPRATFWKAISDFNGVEIDTYNTPPLQKNPADEYRFH
                     FGVEPKHQNRFPFGLKQQFQPYEHLAYSQPTIDVEDSYSPQQRRFFQQVLEAAQEVAQ
                     RRPEDSTSPSDIVKSSNTDDDIDRYLDLVEIDISRHEEKRLLVWFNGAEAT"
     gene            <492519..>494135
                     /gene="CRH1"
                     /locus_tag="AWJ20_4772"
                     /db_xref="GeneID:30036940"
     mRNA            <492519..>494135
                     /gene="CRH1"
                     /locus_tag="AWJ20_4772"
                     /product="Crh1p"
                     /transcript_id="XM_018881866.1"
                     /db_xref="GeneID:30036940"
     CDS             492519..494135
                     /gene="CRH1"
                     /locus_tag="AWJ20_4772"
                     /note="Chitin transglycosylase; functions in the transfer
                     of chitin to beta(1-6) and beta(1-3) glucans in the cell
                     wall; similar and functionally redundant to Utr2;
                     localizes to sites of polarized growth; expression induced
                     by cell wall stress; GO_component: GO:0031225 - anchored
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0005618 - cell wall [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005576 - extracellular region [Evidence
                     IEA]; GO_component: GO:0009277 - fungal-type cell wall
                     [Evidence IDA] [PMID 10757808]; GO_component: GO:0009277 -
                     fungal-type cell wall [Evidence IDA] [PMID 15781460];
                     GO_component: GO:0000131 - incipient cellular bud site
                     [Evidence IDA] [PMID 10757808]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0016798
                     - hydrolase activity, acting on glycosyl bonds [Evidence
                     IEA,IEA]; GO_function: GO:0004553 - hydrolase activity,
                     hydrolyzing O-glycosyl compounds [Evidence IEA];
                     GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IGI,IMP] [PMID
                     18694928]; GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IDA] [PMID
                     23919454]; GO_process: GO:0005975 - carbohydrate metabolic
                     process [Evidence IEA]; GO_process: GO:0006037 - cell wall
                     chitin metabolic process [Evidence IGI,IMP] [PMID
                     18694928]; GO_process: GO:0071555 - cell wall organization
                     [Evidence IEA]; GO_process: GO:0031505 - fungal-type cell
                     wall organization [Evidence IGI,IMP] [PMID 18694928];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Crh1p"
                     /protein_id="XP_018736302.1"
                     /db_xref="GeneID:30036940"
                     /translation="MVGKHSFLSAVAIALISPTVNAQTFTTCNPLSSNDCPADPALGG
                     PLFVDFTQGSSNDFSPLTAASKISYNDLGVGFTVAQQGDNPTLASNGYIMFGRIEVVL
                     QAAPGQGMVSSVILQSDDLDEIDMEWIGGDNTQFQSNYFSKGQTTTFDRGEFHSVNDP
                     VGSFHNYTVDWTADQTTWYLDGAPVRVLESNAPEGYPQTPMKLRMGSWAGGDPSNPPG
                     TIEWAGGPTNYAAGPFTFYVKSVYYVDYSTGSEYVYGDESGSWQSIKAIGGSVIGSPV
                     SPPAVNALAAVASSADPPSSLPPVASSTPAMSSSASPPPPPPPSPTPSSSAIPSSSIE
                     SSPTIFSSSVATSTLSSSSSIFSSSSPPPPPSTSTPSSSSLFTSSSLPPPPPPSTTST
                     TSTPSSSSAPPSSSSTTSSTTSSIESSSSSSVEPSTTSSSSTPPPPPPPPTTTSAIRS
                     SSLTSTSSTTSSTTSSTTSTTTSSTISTTSTTSINTTTSLPPPPSTSSSTSASTTPSI
                     VPPSEGAASLSSIPSFVSLTIVIISVILHV"
     gene            complement(<494344..>495246)
                     /locus_tag="AWJ20_4773"
                     /db_xref="GeneID:30036941"
     mRNA            complement(<494344..>495246)
                     /locus_tag="AWJ20_4773"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881867.1"
                     /db_xref="GeneID:30036941"
     CDS             complement(494344..495246)
                     /locus_tag="AWJ20_4773"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736303.1"
                     /db_xref="GeneID:30036941"
                     /translation="MNDRPPESPSGIKVGEDGARYVGGSVRSDGSVRKTVKIRPGFVP
                     AEDVPKYVIRARRTEGPGNASSGGPGGASRPQFRPSAAFGLITKTLQDNRTADKRDNA
                     RSGPDQTDDLADALSKVSIADKTSRDEKRVEGSDSDTAKKNGLKERSGASRPDDTVSK
                     TRSEFTKHLKSKTESSQLASEEEPIGLKSKSMRHPIRNSRSKDKKLNPTTSQKPSEKE
                     QKDSSKSIESSEKSNDRESKASLSPETTEKEQNRSSKSIEPTGRTIPTSKDAERSSPA
                     STTSEKGGSRAYVPPWKRNNDKRA"
     gene            complement(<496087..>497916)
                     /gene="ASH1"
                     /locus_tag="AWJ20_4774"
                     /db_xref="GeneID:30036942"
     mRNA            complement(<496087..>497916)
                     /gene="ASH1"
                     /locus_tag="AWJ20_4774"
                     /product="DNA-binding transcription repressor ASH1"
                     /transcript_id="XM_018881868.1"
                     /db_xref="GeneID:30036942"
     CDS             complement(496087..497916)
                     /gene="ASH1"
                     /locus_tag="AWJ20_4774"
                     /codon_start=1
                     /product="DNA-binding transcription repressor ASH1"
                     /protein_id="XP_018736304.1"
                     /db_xref="GeneID:30036942"
                     /translation="MVSSLVLPAPRSSDLLMRDRSPEIMSLRGGAINTTSPRSSGLVP
                     VSSVGNNSNNGSGSVSGSGTSSGLARTVPDSDLNQRDYDSIPNDNEVVNGADSSTGAG
                     AATIGYDTNVNSVSAASTPSSTSVFTSQSSSSTTASTPIPFFPSTGQSDQSSKSTGHE
                     STHNEYFSSATDAPLPGSNSTLHTDSLPTNLQPEESSSPVVSIELPKTSSSSDGSIDE
                     ETLSVSSITDTPSTSLGVAQKDSKSYSHVASPLTPTSLAHLSPPTVSLLYPDTAPRET
                     WRPQLDAWMKKNHPLKLKELSQISYPWIHDKLPSTAPINFPSRPHSHTSTSSSSSSHR
                     DTTSTSTSSSSSHSVPPSSRSQETSPPYPPATLSTTSIYGKAGLSKVSSSNSILPLYA
                     SSASHDRTSTASSMSPTTQYLSPSLSIPSSSASSTSSGSLSMSVPTVSSSSYHRPQKA
                     ARRASYSATSHTKPYSRPNHSTIGGPTGLSQEDDDRDDHAHIHNPRLPSPPESPQLSA
                     NSNSQLTLEQYTNSIKRRCISCGSDQSPCWRPSWSASAGQLCNSCGLRYKKTGARCLS
                     AKCGRIPAKGEWAAMKSVAVRVGGQLHYSCLWCGDEVEVMPRG"
     gene            <501045..>501920
                     /locus_tag="AWJ20_4775"
                     /db_xref="GeneID:30036943"
     mRNA            <501045..>501920
                     /locus_tag="AWJ20_4775"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881869.1"
                     /db_xref="GeneID:30036943"
     CDS             501045..501920
                     /locus_tag="AWJ20_4775"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736305.1"
                     /db_xref="GeneID:30036943"
                     /translation="MSSSSSRKHLVGVKVLQLSRPVLSRAEILKETPSTLVELPSSFN
                     VYVGEKFSCLVSVYSESTQPVHVNLSVFVVTPSHKETVLVHSDQPEVSEFTLEPGKST
                     QLTVHYEPKSSGSHSLTTAISYRPKVYESAEDLSDEGSGSPSTQQTPGKTNSSTPTGT
                     SGTQADQNPITNPIVKFHKRNEFLATQALEVRGKVTFIDGNQSAYTFEAEIENVSHNT
                     MILETVDLLPGTGWLATASPNTPDTPLHPKDVWQMAYIVTTDPDATTVTSARPDKFML
                     GWRREPLGERGWLAL"
     gene            complement(<502142..>502729)
                     /gene="SGN1"
                     /locus_tag="AWJ20_4776"
                     /db_xref="GeneID:30036944"
     mRNA            complement(<502142..>502729)
                     /gene="SGN1"
                     /locus_tag="AWJ20_4776"
                     /product="Sgn1p"
                     /transcript_id="XM_018881870.1"
                     /db_xref="GeneID:30036944"
     CDS             complement(502142..502729)
                     /gene="SGN1"
                     /locus_tag="AWJ20_4776"
                     /inference="similar to AA sequence:KEGG_Orthology:K14396"
                     /note="Cytoplasmic RNA-binding protein; contains an RNA
                     recognition motif (RRM); may have a role in mRNA
                     translation, as suggested by genetic interactions with
                     genes encoding proteins involved in translational
                     initiation; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 10764794]; GO_function: GO:0003723 - RNA
                     binding [Evidence IEA]; GO_function: GO:0003676 - nucleic
                     acid binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0008143
                     - poly(A) binding [Evidence IDA] [PMID 10764794];
                     GO_process: GO:0016071 - mRNA metabolic process [Evidence
                     IGI] [PMID 10764794]"
                     /codon_start=1
                     /product="Sgn1p"
                     /protein_id="XP_018736306.1"
                     /db_xref="GeneID:30036944"
                     /translation="MSENNQATEAVTSQEPQDVEINHDEAQEHSEQAPSGDGEQTVDA
                     MKTRLKELEAEAERLQAMQSELQKEGADLTEDKADVDSRSVYVGNVDFGSTPEELQQH
                     FQSCGTINRVTILIDKFTGQPKGYAYVEFAEPSLVSQALLLNESIFRGRPLKVTPKRT
                     NIPGMSARGRGRGGRGGRGYRGGFRGRGRGGYRPY"
     gene            <505064..>505726
                     /locus_tag="AWJ20_4777"
                     /db_xref="GeneID:30036945"
     mRNA            <505064..>505726
                     /locus_tag="AWJ20_4777"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881871.1"
                     /db_xref="GeneID:30036945"
     CDS             505064..505726
                     /locus_tag="AWJ20_4777"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736307.1"
                     /db_xref="GeneID:30036945"
                     /translation="MRGKYVHEIVSHKVIPARAYDYVQLVSKIYPAIAQDPKNGVHLV
                     GSWRTVIGDQDTYTHIWEYNGFEGFHRTQNVIHEDPKYLQYLGELRECLRSRESSIMQ
                     EFSFWGGTAAPRELGGIFELRSYDLKAGCLLEWETHWKKGIECRRQVMEPVGAWFSQI
                     GSLNRVHHLWQFADLEHRKLSRARSWEIPGWAETVSAMIFICVSFCNTNYSFRLTRPL
                     NS"
     gene            complement(<506179..>508368)
                     /gene="RSM22"
                     /locus_tag="AWJ20_4778"
                     /db_xref="GeneID:30036946"
     mRNA            complement(<506179..>508368)
                     /gene="RSM22"
                     /locus_tag="AWJ20_4778"
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /transcript_id="XM_018881872.1"
                     /db_xref="GeneID:30036946"
     CDS             complement(506179..508368)
                     /gene="RSM22"
                     /locus_tag="AWJ20_4778"
                     /note="Mitochondrial ribosomal protein of the small
                     subunit; also predicted to be an
                     S-adenosylmethionine-dependent methyltransferase;
                     GO_component: GO:0005763 - mitochondrial small ribosomal
                     subunit [Evidence IPI] [PMID 11278769]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity [Evidence ISM] [PMID 19351663];
                     GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA,IEA]; GO_function: GO:0003735 - structural
                     constituent of ribosome [Evidence IPI] [PMID 11278769];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0032259 - methylation [Evidence IEA];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IC] [PMID 11278769]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /protein_id="XP_018736308.1"
                     /db_xref="GeneID:30036946"
                     /translation="MFSIQRRLVQRARLSSPQLVRYRSSAPSARGTGRLSGVKAIPYA
                     EIVNEHSDLQDNVEVLNLEELINASNEPNFAEENRSARTERLDIDTRQGKTAGNKLLV
                     LPEEITSVISNATRGYTPNRLRSNASKYYLSLAESGAHRPATETIDVDTHLTGVFLQN
                     YASLYNVLKEARQRLGEKWRPNRILDVGFGPATGMIALNEVFSDVDAEDWQPERKLAI
                     VIGHRDMKKRAVSVLATQKHEESEEQGQLFEENEEALTEEEQQELEEILAVETKGLEE
                     TQQEELDVNTEETDSVNEIEFEEIPKTKQKAHIKTVVRQQLPAAKSSSKYDLIIATHQ
                     LYRSGYHYPASVDDHTSHLLSLLSPGGILVLVERGDPTGFESIARARQIMFRPEDHQS
                     PEKYPPRLWKNDEQFPLSIVAPCSHHGKCPLQVELGIRNKGKNPAYFGWCKFAQMVQR
                     PKFALELKKGQLLSQKWSLVNTASGKVSGEGGKSLAGSGRAFGRSFETATHSYLIVER
                     KAKEQKGTNEQSQELELKDDSISDPASWPRILQNPLKRDKHVVMEVCAPSGQVEQWTV
                     TQKFGKQAYHDARKATGGDLWALGAKVKQVRGGNLSKLRKASAKIQSESRRATKENLQ
                     AEIKIDEKVAAEIQEENVDSESESKAPDAIDIAWLRNDSFNSQKMKRKQAYTRGSEPG
                     AYEDIDGGFSSEYFDDLAQVFENKKAKDYAKKLEKSSHVEKKRVMKW"
     gene            <508852..>509604
                     /gene="FSH3"
                     /locus_tag="AWJ20_4779"
                     /db_xref="GeneID:30036947"
     mRNA            <508852..>509604
                     /gene="FSH3"
                     /locus_tag="AWJ20_4779"
                     /product="Fsh3p"
                     /transcript_id="XM_018881873.1"
                     /db_xref="GeneID:30036947"
     CDS             508852..509604
                     /gene="FSH3"
                     /locus_tag="AWJ20_4779"
                     /note="Putative serine hydrolase; likely target of
                     Cyc8p-Tup1p-Rfx1p transcriptional regulation; sequence is
                     similar to S. cerevisiae Fsh1p and Fsh2p and the human
                     candidate tumor suppressor OVCA2; GO_component: GO:0005575
                     - cellular_component [Evidence ND]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0008150 - biological_process [Evidence
                     ND]; GO_process: GO:0008152 - metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Fsh3p"
                     /protein_id="XP_018736309.1"
                     /db_xref="GeneID:30036947"
                     /translation="MSQKILCLHGFTQNGPLFARKVSAVRKTLQKAGFETVFLTAPVK
                     LEIADLPFEPTNVASLGGSDDSMRSWWPNSDSNPNHYKLDQAFEAIKQSIIEDGPYVG
                     VLGFSQGAALAGVLCQHIHKLHETQPVLKFGIFYSGFRIMRPEHQHFYNELISVPTLH
                     ILGSLDTVVSEERSMALYNSCSDNTRTLLHHPGGHFVPNSKDFVTRVVEMVVSSTSSS
                     PPATEPDVVNEKISETSQPSDDWSAFDTIGRA"
     gene            complement(<511059..>514622)
                     /gene="KEL1"
                     /locus_tag="AWJ20_4780"
                     /db_xref="GeneID:30036949"
     mRNA            complement(<511059..>514622)
                     /gene="KEL1"
                     /locus_tag="AWJ20_4780"
                     /product="Kel1p"
                     /transcript_id="XM_018881875.1"
                     /db_xref="GeneID:30036949"
     CDS             complement(511059..514622)
                     /gene="KEL1"
                     /locus_tag="AWJ20_4780"
                     /note="Protein required for proper cell fusion and cell
                     morphology; functions in a complex with Kel2p to
                     negatively regulate mitotic exit, interacts with Tem1p and
                     Lte1p; localizes to regions of polarized growth; potential
                     Cdc28p substrate; KEL1 has a paralog, KEL2, that arose
                     from the whole genome duplication; GO_component:
                     GO:0005938 - cell cortex [Evidence IDA] [PMID 23673619];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 9786949]; GO_component: GO:0005934 - cellular
                     bud tip [Evidence IDA] [PMID 9786949]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 9786949];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 24390141]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0000755 -
                     cytogamy [Evidence IGI,IMP,IPI] [PMID 9786949];
                     GO_process: GO:0001100 - negative regulation of exit from
                     mitosis [Evidence IMP,IPI] [PMID 12234925]; GO_process:
                     GO:0008360 - regulation of cell shape [Evidence IMP] [PMID
                     9786949]"
                     /codon_start=1
                     /product="Kel1p"
                     /protein_id="XP_018736310.1"
                     /db_xref="GeneID:30036949"
                     /translation="MSYDLTTLRSENAQWTLVQPEGGISPPPRTNHTVVSYQDKLYLF
                     GGTDGKLWYSDTWCYDPSINTWTSLDCSGFIPAPCEGHAATIVGDIMYVFGGRSSQGK
                     DLGTLSALKLTTKKWFTFQNLGPGPSPRSGHSMTAFAGNKILVMGGECPELHENDNDV
                     NYDNYEVNSKLSMVFVLDTLRINYPVDSDVPQNSAVSDLSGKRSVNDSRTPSAASGNY
                     RTATGDSSTPPSTFSTASTSSVPPPHGVPVNSGTGIAGAGAGAVAAAAAMGAGVTGFP
                     HPESSQHEANTESSPRGVARDEYTREAVSPYQEYPSGAKSNGSGSGNRNANGNGNGGY
                     GSYNAGNNGVASQDVQRSPYDDGSDGVSNTTFESADEEKFKTSPSHDQVANIPGAWQQ
                     ASSPSSTSSRDSESYREPIKLPKLRTSPRVDTSAKGLAGIAGLAGIAAGTAGAGATAG
                     LGSGSGADADFSQSTRDYTEENATTPTVSNMSQDRSVDSFTDQHPVDQSTPRGSQVNL
                     AEPANANNVNQVIEQLKASNSWYETELAAAKEAGYVSKSNPPVDVLKLRRVSQRLTQD
                     NQESLSEREILITALSDLKGELRTVQGDIQRQAAAASDRISAVEKERDAALAELKSLK
                     ESSQPVGVPEQHQREIDDHKATIASLQNELETTRASRGLLLGNADSLSALDDLKMSNA
                     QLEQQLRNQADRLVIAEHEAAQFKSKHEDLQAQHKELTSSAAEKVAALAAAGAAITAS
                     QSKFKELSKQLDEHKSARSDLEAKNLDLERQLSDHKLQLEASQRELNDHRNLLQAAEE
                     QNEHSSKALGDGIDKIVSMWSGSKYFAVAGVGAGLGAAAGAAAANGTASRGLDEDDEE
                     DPRISHLQSQLEMANKLHVSHKEAAEKATDDLTVALTQVSGLKKELAESEAARKQAED
                     KLALLEEELKSTSGDLQSHRELLDNHKKSLSELTEKHDALTTQLSSQSEAHTTQAKEL
                     DAKLEKALKEHQETAEQRYQELEQQYKETLQYVRNSDKALNKTRDELNKHKDLNSKLQ
                     EEINELKLRSQQDDDEADTTTGERSINSIGSNYNNKHFDLQLRDLKAQIIILQEERDE
                     LRASSLELKKKAINNAHDIEEAKTEKSRLAQENAKLQQRAREAEEKLSVLLHDKRSSR
                     DPIIDPESGQTLDSFSDNLEKIRTERERLSGLLRESPGADE"
     gene            complement(<514937..>515938)
                     /locus_tag="AWJ20_4781"
                     /db_xref="GeneID:30036950"
     mRNA            complement(<514937..>515938)
                     /locus_tag="AWJ20_4781"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881876.1"
                     /db_xref="GeneID:30036950"
     CDS             complement(514937..515938)
                     /locus_tag="AWJ20_4781"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736311.1"
                     /db_xref="GeneID:30036950"
                     /translation="MAIFSKNKKNKKDGARNSVVPKAFEGAKDALVGGAGGEEGSSPT
                     QRQVSGASTVSSTNSMISGNGSQSPHNGHGAGNVPNIANTISNLYSGPGSSGPYPGRS
                     PGSGSGGPNGASPQNRNYPQSGSRSNSAMSGHGPNGSSGGVRSPPGSRNATSPMGQQY
                     PGGQQQWGGQQQWQQSPQQQQLHHQQSVPSNLRSQSSPHPSSQPQYPWSRHTISNSSP
                     FPRHGHAANAVAARDGEVFVMGGLKGSNVFGDLWVIESGKSVGGQDASGGRALPGPVC
                     ARFASPKGTGCLRRPGAARTRCAPLRGAVKGSLGLAKRAQTGPGSARPPEAAKAPEI"
     gene            complement(<521591..>522196)
                     /gene="SFP1"
                     /locus_tag="AWJ20_4782"
                     /db_xref="GeneID:30036951"
     mRNA            complement(<521591..>522196)
                     /gene="SFP1"
                     /locus_tag="AWJ20_4782"
                     /product="zinc-coordinating transcription factor SFP1"
                     /transcript_id="XM_018881877.1"
                     /db_xref="GeneID:30036951"
     CDS             complement(521591..522196)
                     /gene="SFP1"
                     /locus_tag="AWJ20_4782"
                     /inference="similar to AA sequence:KEGG_Orthology:K19487"
                     /codon_start=1
                     /product="zinc-coordinating transcription factor SFP1"
                     /protein_id="XP_018736312.1"
                     /db_xref="GeneID:30036951"
                     /translation="MPPVPVSMSPINSTSYLPNLEADFCKDYSCCGQILPTLHDLLRH
                     YEEAHISPSPPVEPPVMRRMQSLEAVSTNEVFLSPVSSATATPMMMDEDDEMCIDDPA
                     RHLYVMERGEHKPFKCPVIGCEKTYKNQNGLKYHRMHGHQNQTLHLNEDGTYSIIDPT
                     SNTPYPEGMGMEKDKPYRCEVCGKRYKNLNGLKYHRGHSTH"
     gene            complement(<529692..>532442)
                     /gene="ADP1"
                     /locus_tag="AWJ20_4783"
                     /db_xref="GeneID:30036952"
     mRNA            complement(<529692..>532442)
                     /gene="ADP1"
                     /locus_tag="AWJ20_4783"
                     /product="putative ATP-dependent permease ADP1"
                     /transcript_id="XM_018881878.1"
                     /db_xref="GeneID:30036952"
     CDS             complement(529692..532442)
                     /gene="ADP1"
                     /locus_tag="AWJ20_4783"
                     /note="Putative ATP-dependent permease of the ABC
                     transporter family; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11914276]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 19001347]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0016887 - ATPase
                     activity [Evidence IEA]; GO_function: GO:0042626 - ATPase
                     activity, coupled to transmembrane movement of substances
                     [Evidence ISS] [PMID 9020838]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_process: GO:0006200 - ATP catabolic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence ISS] [PMID 9020838]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="putative ATP-dependent permease ADP1"
                     /protein_id="XP_018736313.1"
                     /db_xref="GeneID:30036952"
                     /translation="MCNVTNRKILDILAGKIPQVTFSCNSTSAECDFQFWVDQVESFY
                     CGLSNCTFETEVLSNTNITKYQCPEISCKCVPERMLCGEAGSIDISDFLTETISGPGF
                     FECDRSTKSCKFSEPSMNDLIKSVFGDPYITLECDSSECLHYTELPGYLPPEKSVRRG
                     FVLAAFISALVFILGGAVIFQYFMNRSQNNKLGYLQIPSDSDAAKLMANHQATSLQFE
                     DISYSDKKRPVKILDGVFGQVKEGSVLAIMGGSGAGKTTLLDILASKTKRGVTEGHIY
                     VNGREVISKNRYKKVIGFVDQEDCLIPTLTVYETIVTSALLRLPKSMSDDAKKLRALE
                     TMNELGILGLKDQLVGNETNRGISGGEKRRVAIACELVTSPSILFLDEPTSGLDAYNA
                     FNVISSLVHLARNYNRTVVFTIHQPRSNIVAQFDELMLLAKGSVVYSGPQSEASNYFA
                     EIGYPCPSGYNMGDFLIDLAMEADNSGGSSSNGDSAGDDQANEHLSEGGQSNSTESDD
                     IHNPIPRANTIEDSTREWRHYAVHRNELSGEEAHENHLRRRISTTPAIRAPPSLSTLV
                     ELYKNSPLAESIRQKIQAQKQAVIDADESNLTSGYETPNQNGDGPETGDDATSPATRG
                     GASSIPKELKGHDKVGVFGQFRILSGRTFKNLYRNPMLLLTHYVMAVLLAVFCGVLYF
                     NVTNDISGFQNRLGLFFFLLALFGFSTLTTLQLFAEERIIFIRERANGYYHPIAYYLA
                     KVMFDIIPLRVFPPILLGLIVYPLVGLSTDGYAFLRFLLILVLFNLTAASTCLLIGIM
                     IQNTGVASLVGCLVMLFSLLFAGLFLNQDSMPAGAVWFKYISIFHYAYEALTVNEVRY
                     LTLTEKKFGLSIEVPGATILSTFGFDSGALWDDVAGLAIVFGLFLIAGYVAMHFFLVE
                     RR"
     gene            complement(<536380..>537141)
                     /locus_tag="AWJ20_4784"
                     /db_xref="GeneID:30036953"
     mRNA            complement(<536380..>537141)
                     /locus_tag="AWJ20_4784"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881879.1"
                     /db_xref="GeneID:30036953"
     CDS             complement(536380..537141)
                     /locus_tag="AWJ20_4784"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736314.1"
                     /db_xref="GeneID:30036953"
                     /translation="MSVNMVFDAETLADGCLDALTSEAVYYEGTSIKPTEIRPAKPYP
                     FKEGVTLTVRQAFESDRKIKGARARSRYYLFNGEPTRAEDELRFGLDDYFEQAGKGPN
                     SSSNRGYRDDRRSRYRDRDGRRGRDRDQDDDGDLFPLKAGEFRESIRGSDLRGRDSGS
                     DRDRNYDRRPAKRGKSYRYLDRNRSRSPGRDSADEPTPSNDSRSRNLSDRLDTPWVKG
                     DLLEKIDNGRDELADRLDLPRTKDRRNRRKAADLF"
     gene            complement(<537264..>537707)
                     /locus_tag="AWJ20_4785"
                     /db_xref="GeneID:30036954"
     mRNA            complement(<537264..>537707)
                     /locus_tag="AWJ20_4785"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881880.1"
                     /db_xref="GeneID:30036954"
     CDS             complement(537264..537707)
                     /locus_tag="AWJ20_4785"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736315.1"
                     /db_xref="GeneID:30036954"
                     /translation="MSGQDEGLEIDIDDDFSVRSVKTGAVEGAGSVASEGASVAASAG
                     TATGSDVAVSVEAGAEAVPAVTGAGPVADDSMDVEVTDSRKIEAPGSEGSQPGAEENA
                     LVPRPVAVHLIGVNDLSTDEVEKYVGYYYPRIKYRVQWVDDSSCK"
     gene            complement(<538006..>539226)
                     /locus_tag="AWJ20_4786"
                     /db_xref="GeneID:30036955"
     mRNA            complement(<538006..>539226)
                     /locus_tag="AWJ20_4786"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881881.1"
                     /db_xref="GeneID:30036955"
     CDS             complement(538006..539226)
                     /locus_tag="AWJ20_4786"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736316.1"
                     /db_xref="GeneID:30036955"
                     /translation="MTVDLNLEGYNVVRQLWLMFYDKDQHNFICHNNSGGPYCKEGRY
                     TLWPVAVTVQAIVDAMRIFPKEIGPMMRPAFEAFDAYYSPKHHAYCASFNYDGNNDVY
                     YDDNAQVASCFLSAYEVTHDKYYLDKAVENVHFLMTGAEKGIYGGVRWHMGKQGSNTC
                     TTAEVGIACMRLARVVQNNQVYIDFAKMCADWIFERVQADDKLIADGLEPDGDHFRLN
                     DAKWTYNQGTPITLCSLLYNAIRDEKYYKYAEGLALAATDHNTAIFDRDTQNMDARYY
                     RDTTYFYQLLAEGLADFLLFFSDKAPQNVLDQIRGELLHTIDYVYKYIRDDQDGLYFQ
                     LFSIYEIDQKRADLFRELTGETGKPYKPHEGEREKTDAPVDQRKLVKGLMGCGAAARV
                     LFQTARVHPTIDPK"
     gene            <548268..>551057
                     /gene="SWA2"
                     /locus_tag="AWJ20_4787"
                     /db_xref="GeneID:30036956"
     mRNA            <548268..>551057
                     /gene="SWA2"
                     /locus_tag="AWJ20_4787"
                     /product="Swa2p"
                     /transcript_id="XM_018881882.1"
                     /db_xref="GeneID:30036956"
     CDS             548268..551057
                     /gene="SWA2"
                     /locus_tag="AWJ20_4787"
                     /note="Auxilin-like protein involved in vesicular
                     transport; clathrin-binding protein required for uncoating
                     of clathrin-coated vesicles; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IDA] [PMID 11553703]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0030276 - clathrin binding [Evidence IDA] [PMID
                     16687570]; GO_function: GO:0043130 - ubiquitin binding
                     [Evidence IDA] [PMID 18948116]; GO_process: GO:0072318 -
                     clathrin coat disassembly [Evidence IMP] [PMID 11146663];
                     GO_process: GO:0048309 - endoplasmic reticulum inheritance
                     [Evidence IMP] [PMID 11553703]; GO_process: GO:0032781 -
                     positive regulation of ATPase activity [Evidence IDA]
                     [PMID 16687570]"
                     /codon_start=1
                     /product="Swa2p"
                     /protein_id="XP_018736317.1"
                     /db_xref="GeneID:30036956"
                     /translation="MDSFAELKWSSSGTAPGTGTSSKASSKPGTPAPGQAKGLDSFAS
                     LAPMGTGSNKPKKLESLSLQERQNMLQKGNGNAFGTSGGSSSTGGSTWSGLDLLSGGI
                     ASSERLGKSTVPASGLSNGASGSGSNSLLDGFDDIPGANEISTGSNTEGNVDPETKED
                     NIDDLFSVFNKPKVDTAKIEKEKDYETIDRAQDRLSSGSGSRSRATPDRQIQLGDDQD
                     DYGDTEYNGDYDEDDYSAEEGVFGNRGHRSALNSSSNRHNSSNGGSRHSSMAGSRAES
                     RAESRTGSRAGSGRGGSSTPSSISSRGPPAADPRDHAIAELMDMGFSDEQAIYALAQT
                     DTGLDVRQAVDVLMMQAHQKATGQPVTAGSRSNSRRKQKDVPVDDISKLASDLSTQFI
                     SKAGSLWSMGKKNLAKAIDQYNSQPSSDGTPAWMRDAQRYVSEDESGTPPIHLDSDSD
                     ISIKRGRTGTNRPSRRFNDSDFTDDDTPPPSSSQLATDEAMMLESEGPRSRRNKNPAT
                     GHRQQPPVPPPSRRYVDDAQSNSIPVPRAVPDSARTPPPPSNTPPIAQRQQPALSRAQ
                     LLRERQKERKDDDVMYVSSSRRRGPTSSNQSSRAPTPSLPAQSPAAPSSRIASPKPSI
                     PPREAVSISPTALTMANTSREQGTEAFKRGDFTQATEHYSQALQSIPPKHLLLTLILT
                     NRSTCYLKCGDAKSALADAEQSLAIIGPGLGANEEVEPGKSLKDIWSKAVARKAEAYE
                     HLEKFQDALDSWTVLISNGYSSKQSMDGKRRCQDALSPKPKPRPVTSSTPSRVSTPAN
                     DGPQSAAGKAALARVKNAHATAEKNDSERFILHDSVSSRIESWRHGKEDNLRALLGSL
                     DNILWPESGWKKVSLAELVIPKKVKLVYMKAVARTHPDKVSSTATTEQKMIAEGVFIT
                     LNKAWDQFKVANNLS"
     gene            complement(<551288..>553303)
                     /gene="TFB1"
                     /locus_tag="AWJ20_4788"
                     /db_xref="GeneID:30036957"
     mRNA            complement(<551288..>553303)
                     /gene="TFB1"
                     /locus_tag="AWJ20_4788"
                     /product="TFIIH/NER complex subunit TFB1"
                     /transcript_id="XM_018881883.1"
                     /db_xref="GeneID:30036957"
     CDS             complement(551288..553303)
                     /gene="TFB1"
                     /locus_tag="AWJ20_4788"
                     /inference="similar to AA sequence:KEGG_Orthology:K03141"
                     /note="Subunit of TFIIH and nucleotide excision repair
                     factor 3 complexes; required for nucleotide excision
                     repair, target for transcriptional activators; relocalizes
                     to the cytosol in response to hypoxia; GO_component:
                     GO:0000439 - core TFIIH complex [Evidence IEA];
                     GO_component: GO:0000439 - core TFIIH complex [Evidence
                     IDA] [PMID 14500720]; GO_component: GO:0000439 - core
                     TFIIH complex [Evidence IDA] [PMID 19818408];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     22932476]; GO_component: GO:0005675 - holo TFIIH complex
                     [Evidence IDA] [PMID 19818408]; GO_component: GO:0000112 -
                     nucleotide-excision repair factor 3 complex [Evidence IDA]
                     [PMID 8855246]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22932476]; GO_function: GO:0000990 -
                     core RNA polymerase binding transcription factor activity
                     [Evidence IC] [PMID 19818408]; GO_function: GO:0032266 -
                     phosphatidylinositol-3-phosphate binding [Evidence IDA]
                     [PMID 15909982]; GO_function: GO:0010314 -
                     phosphatidylinositol-5-phosphate binding [Evidence IDA]
                     [PMID 15909982]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA]; GO_process: GO:0006974 - cellular response
                     to DNA damage stimulus [Evidence IEA]; GO_process:
                     GO:0006289 - nucleotide-excision repair [Evidence IEA];
                     GO_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IMP] [PMID 7891722]; GO_process: GO:0070816 -
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 19450536]; GO_process: GO:0070816 -
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 19679665]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006360 - transcription from RNA polymerase
                     I promoter [Evidence IMP] [PMID 12015980]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IDA] [PMID 19818408]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="TFIIH/NER complex subunit TFB1"
                     /protein_id="XP_018736318.1"
                     /db_xref="GeneID:30036957"
                     /translation="MSAGTTVSTTYPANFKKEPGTIEISDGDRDGNRLFVWKPNNTGS
                     AKPPINIKLETVTQLQATPATSEKLHLKIICTVGDVSSATTPASGQTSQAPATPAAPG
                     SETQSYVFAFKERSVMENTKTTIQKLVQAIRAAVTEKSANGTGQNGTSNGGANGTANN
                     NNNNMNRPENKQAVVELDSKKLLLNLNLQQGLLRENKELMRTFQETVINGGLANDKFW
                     NTRIHLLRAYALTSSQKRGAYNVLGTIRPTTGSDNQINVSLTREKIHDIFDQYPIVRQ
                     AYSDSVPGKMTEGSFWERFFLSRLFRRLRGEKVPQTHLVDAILDTKYLTLYEEEQEGY
                     NNRILGIVSTTSTSSGSSITNNNSNNNINANNKRTREDDPISADNNDDNRPAGEVTDD
                     MYHKIVPQYLDIGGNEENDPQKLGNLPDITMQPGKSDASSISLIRSMNSLSQRMLYGN
                     ATSRIISGRQEPASTEVSSLGDQLKFDDLESDSVADSNIELHLVNEPGISINGKSNSH
                     EADDTTVIEQIRDRYSKSLQTGSSINLNDVGNNTEDLKAAVGQVTSIIELRSQESDQA
                     SNIWTSNEQDKRLLDQVQLCHATSVEFLRHFWLHFLSGDPNQASSISKLVTNLAKSLE
                     RIDAVSKAAPTPDAQNHARASLGPLKTSILTALDRYEKALEASSAEK"
     gene            <553633..>555303
                     /gene="SSZ1"
                     /locus_tag="AWJ20_4789"
                     /db_xref="GeneID:30036958"
     mRNA            <553633..>555303
                     /gene="SSZ1"
                     /locus_tag="AWJ20_4789"
                     /product="Ssz1p"
                     /transcript_id="XM_018881884.1"
                     /db_xref="GeneID:30036958"
     CDS             553633..555303
                     /gene="SSZ1"
                     /locus_tag="AWJ20_4789"
                     /note="Hsp70 protein that interacts with Zuo1p (a DnaJ
                     homolog); interacts with Zuo1p to form a
                     ribosome-associated complex that binds the ribosome via
                     the Zuo1p subunit; also involved in pleiotropic drug
                     resistance via sequential activation of PDR1 and PDR5;
                     binds ATP; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 10792726]; GO_component: GO:0005844 - polysome
                     [Evidence IDA] [PMID 16413483]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0051082
                     - unfolded protein binding [Evidence IGI,IPI] [PMID
                     11054575]; GO_function: GO:0051082 - unfolded protein
                     binding [Evidence ISS] [PMID 9488429]; GO_process:
                     GO:0002181 - cytoplasmic translation [Evidence IGI,IPI]
                     [PMID 11054575]; GO_process: GO:0002181 - cytoplasmic
                     translation [Evidence IGI,IMP] [PMID 11929994];
                     GO_process: GO:0006364 - rRNA processing [Evidence IMP]
                     [PMID 20368619]; GO_process: GO:0006450 - regulation of
                     translational fidelity [Evidence IMP] [PMID 15456889];
                     GO_process: GO:0006452 - translational frameshifting
                     [Evidence IMP] [PMID 16607023]"
                     /codon_start=1
                     /product="Ssz1p"
                     /protein_id="XP_018736319.1"
                     /db_xref="GeneID:30036958"
                     /translation="MSGPTVIGLAFGNTTSSIAIEKDGKVELIANQDGDRAIASVISY
                     VGSDEYHGAQAKAQLIRNAKNTVAYFRDFLGVSFDNVDPTNSHASAHPVELNGQASFS
                     LKTEDDDEETGEVKPAKLLSVHEIAVRHLDRLRESAADYIGKAIDGAVIAVPTDYSEE
                     RRQAIVAAAKDANLKILQVINEPTAALLAHVSANGDSTDKKYAVIDIGGTRSDGAIIA
                     SRGGIFTILTTLHNYELGGKNLDEALVDFFAKDFEKQHKVDPKTEARAVAKLLAESES
                     TKKTLSNTSSANFAVESVAQGYDYSLSINRLRFEVAARSVFTKITQFVEELIKKANLD
                     VLDIDEVLLVGGTSAVPKVATSIASLFDESVTKISAPAFDTKAIQPDELISRGAAIQA
                     SLVAGYDDEEINESLQAVVTVAPHTTKSIGVKVGDNEYVEVIASETALPIRKTVTLST
                     PADATAVLVGVYEGASEIVVTKVEKEEKKDDAEDDESDWSEDEEDEEIRTKVLKPAAK
                     IAELGLQNIPAGSKVEVVLNITRELKLQIAARAGSVAVRGETAVAHVA"
     gene            complement(<555554..>558037)
                     /gene="PXA1"
                     /locus_tag="AWJ20_4790"
                     /db_xref="GeneID:30036960"
     mRNA            complement(<555554..>558037)
                     /gene="PXA1"
                     /locus_tag="AWJ20_4790"
                     /product="ATP-binding cassette long-chain fatty acid
                     transporter PXA1"
                     /transcript_id="XM_018881886.1"
                     /db_xref="GeneID:30036960"
     CDS             complement(555554..558037)
                     /gene="PXA1"
                     /locus_tag="AWJ20_4790"
                     /inference="similar to AA sequence:KEGG_Orthology:K15628"
                     /note="Subunit of a heterodimeric peroxisomal ABC
                     transport complex; required for import of long-chain fatty
                     acids into peroxisomes; similarity to human
                     adrenoleukodystrophy transporter ABCD1 and ABCD2 and
                     ALD-related proteins; mutations in ABCD1 cause X-linked
                     adrenoleukodystrophy (X-ALD), a peroxisomal disorder;
                     complex also includes Pxa2p; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005779 -
                     integral component of peroxisomal membrane [Evidence IDA]
                     [PMID 8670886]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005778 - peroxisomal
                     membrane [Evidence IEA]; GO_component: GO:0005777 -
                     peroxisome [Evidence IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IEA]; GO_function: GO:0042626 -
                     ATPase activity, coupled to transmembrane movement of
                     substances [Evidence IEA]; GO_function: GO:0042626 -
                     ATPase activity, coupled to transmembrane movement of
                     substances [Evidence IMP,ISS] [PMID 8670886]; GO_function:
                     GO:0017111 - nucleoside-triphosphatase activity [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA,IEA]; GO_process: GO:0006200 - ATP catabolic
                     process [Evidence IEA]; GO_process: GO:0015908 - fatty
                     acid transport [Evidence IMP] [PMID 8670886]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="ATP-binding cassette long-chain fatty acid
                     transporter PXA1"
                     /protein_id="XP_018736320.1"
                     /db_xref="GeneID:30036960"
                     /translation="MAASSTLRSDRTKRMLMMYAQLALSLAQNPRLALQLIRSQYRYS
                     SGRIKAVILLLALLTAGSVTFGITELQKRRKRDAKERRELHRQSSSVLLSDGWSREIF
                     VPTANKPLTSKSKSSTVESGEVSGDATARVVIKPTKKVTFEAHRRLFLQSGSGGKSGN
                     GSVAEKKAGVNRQFLKEFSAIWSIIVPRLQSKTSALLFIHALFLASRTYLSLLVAKLD
                     GQIVRDLIAANGKDFLRGLGYWFLLAIPASYTNAMIRFLQAKISIAFRTKLIRYIHDI
                     YLSKELGYYKVTNIDGGIEGADQYITADVTRFCDSAASLYSNLGKPFADFIIFSYQLQ
                     RNLGPLALIGIFSNYALTAWLLKSVAPPFGRLAAAEARLEGDYRNAHTKLITNAEEIA
                     FYDGTGFERAILDKTYKRVIVHISKILKIKVSYNMFEDFILKYSWSALGYMFASLPVF
                     LPTWSGNDGISELATTTPSISLAKRDFRERDRMKQFITNKRLMLSLADAGGRMMYSIK
                     DLAELAGYTSRVFQLLSTLHRVHANSYGHELAPNEVAEPFTLADVHGTVQQGFEGVRF
                     EHTPIVIPGLARTGQPGEVLIKDLNIRINPGDHILISGANGVGKSSIARVLAGLWPVY
                     RGLVSKPLPKDITFLPQRPYLSHGTLRDQIIYPDSHADMLEAGGTDAKLMEILKLVRL
                     EYIPGREGGWETRKQWKDVFSGGEKQRVMFARILYKNPKFAVIDEGTSAVSADVEGLL
                     YEICKKQSITLVTISHRPSLLKYHTAQLRVGLGANGDEWSLERSGTAEARLTVDKEIE
                     DLKAKLSQVDAWKARRQQIVDELSGKTAA"
     gene            complement(<558555..>558671)
                     /locus_tag="AWJ20_4791"
                     /db_xref="GeneID:30036961"
     rRNA            complement(558555..558671)
                     /locus_tag="AWJ20_4791"
                     /product="8S ribosomal RNA"
                     /transcript_id="XR_001989277.1"
                     /db_xref="GeneID:30036961"
     gene            complement(<558873..>561473)
                     /gene="KCH1"
                     /locus_tag="AWJ20_4792"
                     /db_xref="GeneID:30036962"
     mRNA            complement(<558873..>561473)
                     /gene="KCH1"
                     /locus_tag="AWJ20_4792"
                     /product="Kch1p"
                     /transcript_id="XM_018881887.1"
                     /db_xref="GeneID:30036962"
     CDS             complement(558873..561473)
                     /gene="KCH1"
                     /locus_tag="AWJ20_4792"
                     /note="Potassium transporter that mediates K+ influx;
                     activates high-affinity Ca2+ influx system (HACS) during
                     mating pheromone response; expression up-regulated in
                     response to alpha factor; localized to sites of polarized
                     growth; member of a fungal-specific gene family; potential
                     Cdc28p substrate; KCH1 has a paralog, PRM6, that arose
                     from the whole genome duplication; GO_component:
                     GO:0000324 - fungal-type vacuole [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0005887 - integral component
                     of plasma membrane [Evidence IDA] [PMID 23204190];
                     GO_component: GO:0005937 - mating projection [Evidence
                     IDA] [PMID 23204190]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005774 - vacuolar
                     membrane [Evidence IEA]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA]; GO_function: GO:0015079 -
                     potassium ion transmembrane transporter activity [Evidence
                     IDA] [PMID 23204190]; GO_process: GO:0071805 - potassium
                     ion transmembrane transport [Evidence IDA] [PMID
                     23204190]"
                     /codon_start=1
                     /product="Kch1p"
                     /protein_id="XP_018736321.1"
                     /db_xref="GeneID:30036962"
                     /translation="MYVGILLAIAAFASDIYTGIVLLAFDRWSSTIEPYVPFRISRWL
                     FGGCIILSVLLFIYDFIVAYTTIRTKNISLNYTDPIARNVYSIRGYRYFCLFAKLTKS
                     RSLTEYVALFVYFSFKGWIRLIFADSPRQVLNALTLYSVLQIQGNFVSTIKKLAQNST
                     VEAVVIGFMAFSLLVWVVNIIQFGLALICAVPIYIHIGDQASGLEEYCCVKVNKRIAR
                     LVEKYHRKGMKELAEANKKLEKQPSLPRVDTSTLDSHSRYNEKASYSFDQLSSLQPSS
                     SLKQDTFGPGPRTRPGEQPYRNRAGVYRNQSAPRSQTQPQLQPRANKNDTLYREYPVN
                     TPDLGASTTSVDSISGGITGGGGYGYDSTENDNAPLLDQNARTKTPAPVLPRNNTSQT
                     NIYNRRPSVPPKGANLSTPRENFVPNQSNRNANPYQTQQPNTNSNPFPTNQFNPNVNQ
                     YQNNGQKPYRNMATNTRVQQPYQPSNVAPTGMSNYSQAPSFGTQPNFPNTVQTSDQSQ
                     TGLQDYDGRPPRPDPYRLVPFPDPNAERQRPTPYPVDGRSLTSTPFNTTNPLSSYPAN
                     ISQGPVVPQGMELRSVPQQPVVVVDQPRPLVKQKSLPIQTQIPPKSVSRQKTMPAAIP
                     VNKEMPMSRKSTLLPDEIEHREPKLPFSSVPDTNLPSSRGSKLEPSDLEFREPKLPFT
                     STVENDPSSDESDADTFDFGKPELSAHLRRQLSAETKPSPEELKSREPKLPFESTSEE
                     NHSTTDHKTAADLRKSKLSPTELQFREPKLPNLQDRNPFRQSTSSLSDAEEDLIVYSN
                     DEISSPEQPPPFGHDNHPRGPSPVSFVFQPNAPPKAAARLRQPTIPKITFEDTSSPAS
                     QQSGRPSPFY"
     gene            <565732..>567987
                     /gene="PMT4"
                     /locus_tag="AWJ20_4793"
                     /db_xref="GeneID:30036963"
     mRNA            <565732..>567987
                     /gene="PMT4"
                     /locus_tag="AWJ20_4793"
                     /product="Pmt4p"
                     /transcript_id="XM_018881888.1"
                     /db_xref="GeneID:30036963"
     CDS             565732..567987
                     /gene="PMT4"
                     /locus_tag="AWJ20_4793"
                     /inference="similar to AA sequence:KEGG_Orthology:K00728"
                     /note="Protein O-mannosyltransferase; transfers mannose
                     residues from dolichyl phosphate-D-mannose to protein
                     serine/threonine residues; appears to form homodimers in
                     vivo and does not complex with other Pmt proteins; target
                     for new antifungals; GO_component: GO:0097586 -
                     dolichyl-phosphate-mannose-protein mannosyltransferase
                     Pmt4p homodimer complex [Evidence IPI] [PMID 12551906];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0004169 -
                     dolichyl-phosphate-mannose-protein mannosyltransferase
                     activity [Evidence IEA]; GO_function: GO:0004169 -
                     dolichyl-phosphate-mannose-protein mannosyltransferase
                     activity [Evidence IDA,IMP] [PMID 21956107]; GO_function:
                     GO:0004169 - dolichyl-phosphate-mannose-protein
                     mannosyltransferase activity [Evidence IMP,ISS] [PMID
                     8585318]; GO_function: GO:0000030 - mannosyltransferase
                     activity [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0016757 - transferase activity, transferring glycosyl
                     groups [Evidence IEA]; GO_process: GO:0006493 - protein
                     O-linked glycosylation [Evidence IEA]; GO_process:
                     GO:0006493 - protein O-linked glycosylation [Evidence
                     IMP,ISS] [PMID 8585318]; GO_process: GO:0035269 - protein
                     O-linked mannosylation [Evidence IMP] [PMID 18182384];
                     GO_process: GO:0035269 - protein O-linked mannosylation
                     [Evidence IMP] [PMID 21231968]; GO_process: GO:1900101 -
                     regulation of endoplasmic reticulum unfolded protein
                     response [Evidence IGI] [PMID 21231968]"
                     /codon_start=1
                     /product="Pmt4p"
                     /protein_id="XP_018736322.1"
                     /db_xref="GeneID:30036963"
                     /translation="MPSELRNRKGASATLRSPEPVEKKKAKKPVFKSTVADSNTDNRY
                     RLAKIIVTVFAFATRFYLINDPKEVVFDEVHFGKFASYYLEGTYFFDLHPPFAKMLIA
                     FVGWLVGYDGAFKFENIGDSYIANRVPYVAYRSLSATLGALTVPIVFETLQECGFSVW
                     ACVIGSSLILFDNAHIAETRLILLDATLIISVALSLYAYVRFSKQRDSPFSRDWWTWL
                     LATGVSLSFVISTKYVGAFTFTTVGAAVLIDLWNLLDYRRGLSMKEFGKHFFARLFSL
                     IFVPLCIFLFWFWVHFAILTKSGPGDGFMSSKFQETLGDNILAKLAKQVNYYDEITIS
                     HKESPLFLSSGSIHYPLRYDDGRISSQGQLVSTQELVNGAPTNDQIWQIVPVVDFPEG
                     HREGIPIETETQVRLKHVSTNSFLLAHDVASPYYPTNEEFTTASFEEAEGPRFNDTLF
                     EIRSVTGEKDILKTKGSFFRLIHVPTRVAMWTHDDKQLPAEWASGHYEVNGVKNVHER
                     TATWFVDEIVNLTDPERLKFTPRAPRKMNFFRKYLELQYTMFAQNNALTSSHPYASEP
                     ITWPFLVRGVSFWTKDTERRQIYFIGNFIGWWIEAAMLAIYAGVVVADQLTRRRAMYP
                     INDVARSKIYNSLGFFFIAWATHYFPFFLMGRQKFLHHYLPAHLAAALLTGGLYDFVF
                     CELDDEAVHAAQSGKKRSNWRLKIVSVISLVGIVICFAYFSPLTYGNTPLTPAEVRAR
                     QWMDIELHFAK"
     gene            <569415..>570353
                     /gene="TFB3"
                     /locus_tag="AWJ20_4794"
                     /db_xref="GeneID:30036964"
     mRNA            <569415..>570353
                     /gene="TFB3"
                     /locus_tag="AWJ20_4794"
                     /product="TFIIH/NER complex subunit TFB3"
                     /transcript_id="XM_018881889.1"
                     /db_xref="GeneID:30036964"
     CDS             569415..570353
                     /gene="TFB3"
                     /locus_tag="AWJ20_4794"
                     /inference="similar to AA sequence:KEGG_Orthology:K10842"
                     /note="Subunit of TFIIH and nucleotide excision repair
                     factor 3 complexes; involved in transcription initiation,
                     required for nucleotide excision repair; ring finger
                     protein similar to mammalian CAK and TFIIH subunit;
                     GO_component: GO:0070985 - TFIIK complex [Evidence IDA]
                     [PMID 19818408]; GO_component: GO:0005675 - holo TFIIH
                     complex [Evidence IDA] [PMID 19818408]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_function:
                     GO:0000990 - core RNA polymerase binding transcription
                     factor activity [Evidence IC] [PMID 19818408];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IMP] [PMID 10681587]; GO_process: GO:0070816 -
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 19450536]; GO_process: GO:0070816 -
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 19679665]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006366 - transcription from RNA polymerase
                     II promoter [Evidence IDA] [PMID 19818408]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="TFIIH/NER complex subunit TFB3"
                     /protein_id="XP_018736323.1"
                     /db_xref="GeneID:30036964"
                     /translation="MCPICKSSRYLNPDMRFLVNPECYHKICESCVDRIFSVGPAQCP
                     YAGCEKILRKNKFKTQVFEDLGVEREVDIRARVSRTFNKRQQDFDSLDDYNDYLEEVE
                     NIIFNLVNGVDVEATESKLQAYEQANRNIILANSLRQKQEDEQMEELQSLETQRRRKA
                     QLLALQAEEDERRIKEQTEKELVRQLATGEGDAAAIMKNVSNMALKRSSARRRQLEEE
                     LRQPLSIPLRLRGARSATPGNATPFTPFNGDRQQEYLFTVNDEYFDPLMNDVANNPQY
                     RASGFSVKGSFRQALVSAFFGIGCDVQHEKAAPLAV"
     gene            <571975..>572736
                     /gene="RCR2"
                     /locus_tag="AWJ20_4795"
                     /db_xref="GeneID:30036965"
     mRNA            <571975..>572736
                     /gene="RCR2"
                     /locus_tag="AWJ20_4795"
                     /product="Rcr2p"
                     /transcript_id="XM_018881890.1"
                     /db_xref="GeneID:30036965"
     CDS             571975..572736
                     /gene="RCR2"
                     /locus_tag="AWJ20_4795"
                     /note="Vacuolar protein; presumably functions within the
                     endosomal-vacuolar trafficking pathway, affecting events
                     that determine whether plasma membrane proteins are
                     degraded or routed to the plasma membrane; RCR2 has a
                     paralog, RCR1, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IDA] [PMID 17287526]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISS]
                     [PMID 15590673]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_component: GO:0031982 - vesicle
                     [Evidence IDA] [PMID 17287526]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IGI] [PMID 17287526]"
                     /codon_start=1
                     /product="Rcr2p"
                     /protein_id="XP_018736324.1"
                     /db_xref="GeneID:30036965"
                     /translation="MYLYLAEALLVRRDNNDDLVCDDEGDCYYNTPWYNYGRWLVVAA
                     IAIVFAVSIYLMRRNAANRLRGAMAPLSNRGWTWVPPTYHQSQRDYSNTTQAPPAAPP
                     YNRSLGTEDAGYYDSYGNFIQTGPVHTVAPPTGPPPPPSPLSPVDSSGVQIPPPVLHH
                     PSNYEMRDVYPSDRKSPSVFTYGPFPEDRYEDLSGPSNGSSSDPNHIIHHENSSNDPS
                     SAAGGPSFVELGGASVPPVDDPEHHLVPPPSQQHN"
     gene            complement(<573354..>574247)
                     /gene="FOL2"
                     /locus_tag="AWJ20_4796"
                     /db_xref="GeneID:30036966"
     mRNA            complement(<573354..>574247)
                     /gene="FOL2"
                     /locus_tag="AWJ20_4796"
                     /product="GTP cyclohydrolase I"
                     /transcript_id="XM_018881891.1"
                     /db_xref="GeneID:30036966"
     CDS             complement(573354..574247)
                     /gene="FOL2"
                     /locus_tag="AWJ20_4796"
                     /inference="similar to AA sequence:KEGG_Orthology:K01495"
                     /note="GTP-cyclohydrolase I; catalyzes the first step in
                     the folic acid biosynthetic pathway; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005525 - GTP
                     binding [Evidence IEA]; GO_function: GO:0003934 - GTP
                     cyclohydrolase I activity [Evidence IEA,IEA]; GO_function:
                     GO:0003934 - GTP cyclohydrolase I activity [Evidence IMP]
                     [PMID 8573145]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0035998 - 7,8-dihydroneopterin
                     3'-triphosphate biosynthetic process [Evidence IEA];
                     GO_process: GO:0046656 - folic acid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0009396 - folic
                     acid-containing compound biosynthetic process [Evidence
                     IMP] [PMID 8573145]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]; GO_process: GO:0046654 -
                     tetrahydrofolate biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="GTP cyclohydrolase I"
                     /protein_id="XP_018736325.1"
                     /db_xref="GeneID:30036966"
                     /translation="MAHTEPSKLDLSAAAATNESAIVDSDSVPAGEHDSRSIVPSTVP
                     SHHRAPSGAPSGPVATAPNQYPKYIEHLTRLADARPSSPYLNPIDYDGLSWPSVGARE
                     RLESSVEEKAAREKRIADAVRTLLTELGEDPNRSGLLETPERYARAMLFFTKGYEDNV
                     KDVIKNALFEEDHDEMVIVKDIDVFSLCEHHLVPFYGKIHIGYIPNSRVIGLSKLARL
                     AEMFARRLQVQERLTKQVAMALWELLQPQGVAVVMEASHMCMVMRGVQKPGSSTTTSC
                     MLGRFREAQRTREEFLSLLKK"
     gene            complement(<577671..>578729)
                     /gene="HUA1"
                     /locus_tag="AWJ20_4797"
                     /db_xref="GeneID:30036967"
     mRNA            complement(<577671..>578729)
                     /gene="HUA1"
                     /locus_tag="AWJ20_4797"
                     /product="Hua1p"
                     /transcript_id="XM_018881892.1"
                     /db_xref="GeneID:30036967"
     CDS             complement(577671..578729)
                     /gene="HUA1"
                     /locus_tag="AWJ20_4797"
                     /note="Cytoplasmic protein containing a zinc finger
                     domain; sequence similarity to that of Type I J-proteins;
                     computational analysis of large-scale protein-protein
                     interaction data suggests a possible role in actin patch
                     assembly; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 11489916]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11914276]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Hua1p"
                     /protein_id="XP_018736326.1"
                     /db_xref="GeneID:30036967"
                     /translation="MSTNPFISHKPVPISNNTGGSSRNGDSRLSQYNTNGGSSRPNTS
                     TTGGDASSTLSIPRTETGSYSRSSIGSGNSESNSTSNHILPPEEEHPDEEPPPYTPEA
                     EPGMSVAGMSNIPPHIQAQISMATGNSQTSNNNFQNHAHNQSHVNNSHPQSQTYHPPP
                     HPPPPARPPRPTTASSSSPARPPRPQSSAFPGSNYHSYGQTNNSHNRPTTSQHQAYHH
                     RPGNANTNHPPPQNPNLPFTYPPGYYCYKCNNTGIKLKNGLTCQDCYGRFARQGRNVQ
                     VIHSGQPSMFNPLAPFMGPTTSYVPYYPGQPPPRVVRPGDPSIGGTLCGRCRGRGMIS
                     DFFGDETCPTCRGVGRLL"
     gene            <580480..>580551
                     /locus_tag="AWJ20_4798"
                     /db_xref="GeneID:30036968"
     tRNA            <580480..>580551
                     /locus_tag="AWJ20_4798"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:30036968"
     gene            complement(<586370..>587032)
                     /locus_tag="AWJ20_4799"
                     /db_xref="GeneID:30036969"
     mRNA            complement(<586370..>587032)
                     /locus_tag="AWJ20_4799"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881893.1"
                     /db_xref="GeneID:30036969"
     CDS             complement(586370..587032)
                     /locus_tag="AWJ20_4799"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736327.1"
                     /db_xref="GeneID:30036969"
                     /translation="MNIAEILNDDGEERIHNNASSRSTSPRSGSPVKRPRNSSDIEGG
                     SDPKRLADGSTSTLKSDSTPLQQSPSAAGPSESGNSNLNTRNSTGGLPRDIEPEPTAA
                     SSTIASGSSSSLASIPGPSIGSSVVKSEPTTEGAPVATVSGGESEGTPAADKKGKSKR
                     SKAKNSTWAIEDDRKLVDLVMSTLPTQDFAEYARVLNKRDAQTIRYRWKVILRRAKGE
                     GL"
     gene            complement(<595111..>595182)
                     /locus_tag="AWJ20_4800"
                     /db_xref="GeneID:30036972"
     tRNA            complement(<595111..>595182)
                     /locus_tag="AWJ20_4800"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:30036972"
     gene            complement(<595202..>595273)
                     /locus_tag="AWJ20_4801"
                     /db_xref="GeneID:30036973"
     tRNA            complement(<595202..>595273)
                     /locus_tag="AWJ20_4801"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:30036973"
     gene            complement(<595567..>597051)
                     /gene="UGA1"
                     /locus_tag="AWJ20_4802"
                     /db_xref="GeneID:30036974"
     mRNA            complement(<595567..>597051)
                     /gene="UGA1"
                     /locus_tag="AWJ20_4802"
                     /product="4-aminobutyrate transaminase"
                     /transcript_id="XM_018881896.1"
                     /db_xref="GeneID:30036974"
     CDS             complement(595567..597051)
                     /gene="UGA1"
                     /locus_tag="AWJ20_4802"
                     /inference="similar to AA sequence:KEGG_Orthology:K13524"
                     /note="Gamma-aminobutyrate (GABA) transaminase; also known
                     as 4-aminobutyrate aminotransferase; involved in the
                     4-aminobutyrate and glutamate degradation pathways;
                     required for normal oxidative stress tolerance and
                     nitrogen utilization; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 23740823];
                     GO_function: GO:0003867 - 4-aminobutyrate transaminase
                     activity [Evidence IEA,IEA]; GO_function: GO:0003867 -
                     4-aminobutyrate transaminase activity [Evidence IMP] [PMID
                     3888627]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0030170 - pyridoxal
                     phosphate binding [Evidence IEA]; GO_function: GO:0008483
                     - transaminase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0009450 - gamma-aminobutyric acid catabolic
                     process [Evidence IMP] [PMID 3888627]; GO_process:
                     GO:0009448 - gamma-aminobutyric acid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="4-aminobutyrate transaminase"
                     /protein_id="XP_018736328.1"
                     /db_xref="GeneID:30036974"
                     /translation="MIRSVTRSSLLRNRVAGARLTRLSSSVAASYFPNEPTAPSVKTA
                     IPGPQTKAALEKLNKSMDIPAAYFVADYYKSLGNYIVDVDGNVLLDVYAQIASIALGY
                     NNPALIEAAKSDAMINSLVNRPATGNFPSNDYADILEKGIMAAAPKGFSNVWTALSGS
                     DANETAFKAAFIYQASKKRGSGGFTQEELTTTMSNQAPGSPAGSILSFESSFHGRLFG
                     SLSATRSKPIHKLDIPAFDWPKAPFPRLQYPLEANVEANKQEEKRCLEEFEKILTTWK
                     TPVAAVIVEPILSEGGDFHASRDFFQGIRDITKKHDVVMIVDEVQTGVGGTGKLWAHE
                     HWNLDSVPDIVTFSKKAQAAGYYFSNPELRPKLAYRQFNTWCGDPSKAIIASAIFNEI
                     KKNNLVERTAQVGDYLFGKLEALATKYPQNIANLRGKGQGTFIAWDCSSPEFRDNFIK
                     KAKELGVNIGGCGVQAIRLRPALTFEEKHADILLDVVEKIVASA"
     gene            complement(<598643..>601018)
                     /gene="SET2"
                     /locus_tag="AWJ20_4803"
                     /db_xref="GeneID:30036975"
     mRNA            complement(<598643..>601018)
                     /gene="SET2"
                     /locus_tag="AWJ20_4803"
                     /product="histone methyltransferase SET2"
                     /transcript_id="XM_018881897.1"
                     /db_xref="GeneID:30036975"
     CDS             complement(598643..601018)
                     /gene="SET2"
                     /locus_tag="AWJ20_4803"
                     /inference="similar to AA sequence:KEGG_Orthology:K11423"
                     /codon_start=1
                     /product="histone methyltransferase SET2"
                     /protein_id="XP_018736329.1"
                     /db_xref="GeneID:30036975"
                     /translation="MSKISRPIKVIEFSDSDDDLYGDKPSKQNGSHGPAENSVSSEKV
                     RVAAAPSKVLKKENNIKISTSKPKVEIIDISNDDKSDIDEDDEPVSGAGRRARGNGTV
                     TRSDLKQENTITDGDSAGSEEPVDPFDDQIKPKSEDKKNVKVTRQLFNDLESKTAEAQ
                     STYIQLEQCTYQGRGNIGSSGQVEAMNCDCREHWVNGKNIACGDDSDCINRLTSIECT
                     NDNCTCGDDCGNQRFQAKQYANVDVIQTELKGYGVRALEAIPQNTFIYEYIGEVIDES
                     NFRQRMETYKLEGIRHFYFMMLQKGEFIDATKQGSMARFCNHSCRPNCYVDKWIVGDK
                     VRMGIFSKRDIIKGEEITFDYNVDRYGTQAQPCYCGESNCIGILGGKTQTEAAATKLP
                     QLIVDVLDLTRQDEKQWLSIAKKFKKDGRDGKYATADASGASDEDLYREYSLSLPAKP
                     VQEESVTKIMSALLQGQEQWLIEKLVNRIFITDDSSVHGQVMRMHGYQVFSVILAADW
                     PNDVVPLMILEILTRWPRLTKNKISSSKIESIVAGLAKDSTSDKVQKLASTLLQEWSS
                     LEMAYRIPRRERGAKESTNSNSASGTPQEEGASSSPTRPAYPRAYGSNSHDNIQDNRG
                     EKLPRRDWGAKDNYNNRGRERDYDNRYRRNRTRSPSPLPSGWETALAPDGRRYYFNRT
                     TGLSSWTLPKEGSPQKDSRIIPDNEREKAELLQKEQERLQIEQIIESANQSRQNIVLL
                     QQQKINELQSIVDAVKTKSSHRSSHRPSSEKKKKREDDTPESVFTRTVSST"
     gene            complement(<601398..>602336)
                     /locus_tag="AWJ20_4804"
                     /db_xref="GeneID:30036976"
     mRNA            complement(<601398..>602336)
                     /locus_tag="AWJ20_4804"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881898.1"
                     /db_xref="GeneID:30036976"
     CDS             complement(601398..602336)
                     /locus_tag="AWJ20_4804"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736330.1"
                     /db_xref="GeneID:30036976"
                     /translation="MSCPPPWTPLLDSCLKAVEKLPTFTFCTVSHNRIPHARTCVSRG
                     WLFDDKSTGVLVFTTDMRMQKVSDLNETNDAYEACFYFPNKSTQIRLSGFAQLLSPNH
                     TPQLSSTLPLSQPVKSSPPSSGSSSRSGSPSGNPGSPNPNNSSAPVAVPDSSSNNTAN
                     NEAKGTSSSPSETILAPLASAATSRKHLPRSYYPVITPSYDPSTDYDSIFPPPTAEEW
                     LNEYNRLWSSMSPRMKKTFKYPTPKSLLDGSTTKALDSISRGVDGASEDSGKEHFVVV
                     LMLVNQVDIVVDESIGRRTLFTRVRYDEWKEQDLSP"
     gene            complement(<604056..>604766)
                     /gene="ARC1"
                     /locus_tag="AWJ20_4805"
                     /db_xref="GeneID:30036977"
     mRNA            complement(<604056..>604766)
                     /gene="ARC1"
                     /locus_tag="AWJ20_4805"
                     /product="Arc1p"
                     /transcript_id="XM_018881899.1"
                     /db_xref="GeneID:30036977"
     CDS             complement(604056..604766)
                     /gene="ARC1"
                     /locus_tag="AWJ20_4805"
                     /inference="similar to AA sequence:KEGG_Orthology:K15437"
                     /note="Protein that binds tRNA and methionyl- and
                     glutamyl-tRNA synthetases; involved in tRNA delivery,
                     stimulating catalysis, and ensuring localization; also
                     binds quadruplex nucleic acids; protein abundance
                     increases in response to DNA replication stress;
                     methionyl-tRNA synthetase is Mes1p; glutamyl-tRNA
                     synthetase is Gus1p; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11726524]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 15710377]; GO_component:
                     GO:0017102 - methionyl glutamyl tRNA synthetase complex
                     [Evidence IMP,IPI] [PMID 9659920]; GO_function: GO:0003677
                     - DNA binding [Evidence IEA]; GO_function: GO:0003723 -
                     RNA binding [Evidence IEA]; GO_function: GO:0008047 -
                     enzyme activator activity [Evidence IDA] [PMID 11069915];
                     GO_function: GO:0080025 -
                     phosphatidylinositol-3,5-bisphosphate binding [Evidence
                     IDA] [PMID 16343487]; GO_function: GO:0032266 -
                     phosphatidylinositol-3-phosphate binding [Evidence IDA]
                     [PMID 16343487]; GO_function: GO:0000049 - tRNA binding
                     [Evidence IEA,IEA]; GO_function: GO:0000049 - tRNA binding
                     [Evidence IMP,IPI] [PMID 11726524]; GO_process: GO:0051351
                     - positive regulation of ligase activity [Evidence IDA]
                     [PMID 11069915]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IMP]
                     [PMID 9659920]"
                     /codon_start=1
                     /product="Arc1p"
                     /protein_id="XP_018736331.1"
                     /db_xref="GeneID:30036977"
                     /translation="MALCLGRTCLKHTFKTSASYSVKYSVFRVNTNQNIRLPDWPLKS
                     SIRTYSTENQPKTPNPSVVQFKTAVVEKVDYHPNADSLYVSQVRVEGGPTSELLTVCS
                     GLVKYVPKDELEGRRIVVVTNLKPSKLRGIKSEAMLLAAVGDDSAGNKKLELVSPPKQ
                     AALGETLFFDKYPISQSQQVPLKSIKSKVWQEVQKQLFVNVSHEVIFRDHELGDLVLR
                     NDAGDPATVASLTNGTVS"
     gene            <605389..>608388
                     /locus_tag="AWJ20_4806"
                     /db_xref="GeneID:30036978"
     mRNA            <605389..>608388
                     /locus_tag="AWJ20_4806"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881900.1"
                     /db_xref="GeneID:30036978"
     CDS             605389..608388
                     /locus_tag="AWJ20_4806"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736332.1"
                     /db_xref="GeneID:30036978"
                     /translation="MLGRLLSHAFTSPDGSSSPDGGRFSRASSPNFVSIGDGANDDEI
                     HPTFPVSFLDEADTRNLLYGQSFTPAGILSLDVLKDIRVVVICDSSCVGGFIYDSARE
                     VTASGSVNTNNSVSGGKTSITPHRGSLDHRTNSPSLVASTLSSVSALTRSFSSTALSS
                     AAAINNLSGLGIGLGQTDSTTANPDGVTSGKGLGDSSPSNKPLARPNTIASPQISSGR
                     VSAPNSPHRRKSSGNNLPTIAPDVAPILQLALLKDLVFGYSAMKFQGQLTKIHPLPRS
                     KGSSSKKQPWIVSRIFKIAVDDPSLNRTDPVNRQSTTMRVDSAPKQFLTSTGSTISNA
                     SVDTNNTDLTVDDADNENDSATDGLPGWQPKSNSTVPPLPPHTKDVRCAICISFNLPP
                     ESEDAITNHWTELSYALADLQATIYRKLERQLPQVVLDSRRKKHTPIMSGGHGSGLNH
                     DSRFSGGRVLYSIDGDLEIQNAVDFFKSRFSTALRIPRVLCGQDNWSDLYSEMCIAAK
                     KWEGTSDGGFLGAMICCYIDFNKDLLGGLIHEDDDIPKRTIILANNRIVSRKLIFILS
                     SLIRSRTSERIRKRISLANSLNDSFVKTHTQRSSSVSTTYSVGTNSPRTRTSAKFSFV
                     DGGWEVSQPASMIEPVGTVAIPHVVRPSFSSSSLAHSVGYGSTSDALSSSINGRNSRN
                     SGGFFSNLWNSDNSYPETPGTPYDDYYFHEQLANADRDMASSFQSKNFTIGDTTNGTV
                     TPSLIRPSMSRCHSSERSATTLNTINHRLYHRQHTGESNISANNPHTSLHQRTLLQNA
                     SDNDLTNLSYLPTAPPYRLVHDEENQIVIDVSESATPDQPYEDLRPIVLPRVAGHVSN
                     FHPDFILQACPITRDLEDQISRTMLRDGDVNSVSIAARNSISSVPSKRQALSKSLIIN
                     LRTREISTYTLVASTDETSNMTQKLVRKVVFANHKPSPGFSTAFANISKQIADIVEGE
                     EGTIHSPNRGAYFTSLVKAFEGCFGLL"
     gene            complement(<608637..>609689)
                     /gene="TFB4"
                     /locus_tag="AWJ20_4807"
                     /db_xref="GeneID:30036979"
     mRNA            complement(<608637..>609689)
                     /gene="TFB4"
                     /locus_tag="AWJ20_4807"
                     /product="TFIIH/NER complex subunit TFB4"
                     /transcript_id="XM_018881901.1"
                     /db_xref="GeneID:30036979"
     CDS             complement(608637..609689)
                     /gene="TFB4"
                     /locus_tag="AWJ20_4807"
                     /inference="similar to AA sequence:KEGG_Orthology:K03143"
                     /note="Subunit of TFIIH complex; involved in transcription
                     initiation, similar to 34 kDa subunit of human TFIIH;
                     interacts with Ssl1p; GO_component: GO:0000439 - core
                     TFIIH complex [Evidence IEA]; GO_component: GO:0000439 -
                     core TFIIH complex [Evidence IDA] [PMID 14500720];
                     GO_component: GO:0000439 - core TFIIH complex [Evidence
                     IDA] [PMID 19818408]; GO_component: GO:0005675 - holo
                     TFIIH complex [Evidence IDA] [PMID 19818408];
                     GO_component: GO:0000112 - nucleotide-excision repair
                     factor 3 complex [Evidence IPI] [PMID 10681587];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0000990 - core RNA polymerase binding
                     transcription factor activity [Evidence IC] [PMID
                     19818408]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA]; GO_process: GO:0006974 - cellular response
                     to DNA damage stimulus [Evidence IEA]; GO_process:
                     GO:0006289 - nucleotide-excision repair [Evidence IEA];
                     GO_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IMP] [PMID 10506223]; GO_process: GO:0070816 -
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 19450536]; GO_process: GO:0070816 -
                     phosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 19679665]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence
                     IEA,IEA]; GO_process: GO:0006366 - transcription from RNA
                     polymerase II promoter [Evidence IDA] [PMID 19818408];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="TFIIH/NER complex subunit TFB4"
                     /protein_id="XP_018736333.1"
                     /db_xref="GeneID:30036979"
                     /translation="MNAVDDTHASLGGSERTGSDEHPTLLGIVLDTNPTAWAELENKL
                     SLKEAVESLLIFINAHLSLNNANRVAVIAAHTTGAKFLYPKPPSSSFENGSQSGHTSL
                     KAMSGTTGTANIFDRQTMYRQFREVDEAVVGELDRLVSSATEKSVRSTQSAVSGALSL
                     ALTYINRVNSNEDEVKTHARILLVSVSGDLSSQYIPTMNCIFAAQKKRIPIDVCKLAG
                     DTVFLQQASDSTNGTYMKLDHPRGLVQYLLSAFLVDPAILPHVNLSTQRDVDFRAACF
                     VTKTVVDIGCVCSVCLCIMSKVPADGSCPMCGTVYDPQALQKINRKPMVIVKKKPKKK
                     KAKLDSTPVGTPSPIP"
     gene            complement(<610680..>611036)
                     /gene="MRPL37"
                     /locus_tag="AWJ20_4808"
                     /db_xref="GeneID:30036980"
     mRNA            complement(<610680..>611036)
                     /gene="MRPL37"
                     /locus_tag="AWJ20_4808"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_018881902.1"
                     /db_xref="GeneID:30036980"
     CDS             complement(610680..611036)
                     /gene="MRPL37"
                     /locus_tag="AWJ20_4808"
                     /inference="similar to AA sequence:KEGG_Orthology:K17435"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; GO_component: GO:0005762 - mitochondrial large
                     ribosomal subunit [Evidence IDA] [PMID 2060626];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IDA] [PMID 2060626]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 2060626];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_018736334.1"
                     /db_xref="GeneID:30036980"
                     /translation="MLRLITRQVLRTTVPRTSFVRLASTSAPNTETTSSTKKTITSIA
                     PAGTKLKGLNIKKGGEDPIALAENEYPEWLWELLDPAAQKAKLESDAGRQARKERRSA
                     NRQKIKMNNFLAGMKN"
     gene            <614858..>617515
                     /gene="LAS21"
                     /locus_tag="AWJ20_4809"
                     /db_xref="GeneID:30036981"
     mRNA            <614858..>617515
                     /gene="LAS21"
                     /locus_tag="AWJ20_4809"
                     /product="Las21p"
                     /transcript_id="XM_018881903.1"
                     /db_xref="GeneID:30036981"
     CDS             614858..617515
                     /gene="LAS21"
                     /locus_tag="AWJ20_4809"
                     /inference="similar to AA sequence:KEGG_Orthology:K05310"
                     /note="Integral plasma membrane protein; involved in the
                     synthesis of the glycosylphosphatidylinositol (GPI) core
                     structure; mutations affect cell wall integrity;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0030176 -
                     integral component of endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 10329735]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005887 -
                     integral component of plasma membrane [Evidence IDA] [PMID
                     10329735]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0051377 -
                     mannose-ethanolamine phosphotransferase activity [Evidence
                     IMP] [PMID 15452134]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IMP] [PMID
                     10329735]; GO_process: GO:0006506 - GPI anchor
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0006506 - GPI anchor biosynthetic process [Evidence
                     IMP] [PMID 10329735]; GO_process: GO:0006506 - GPI anchor
                     biosynthetic process [Evidence IMP] [PMID 15452134];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Las21p"
                     /protein_id="XP_018736335.1"
                     /db_xref="GeneID:30036981"
                     /translation="MNTSVRKWILIGVILCLQLGGFGLFARGFFPKKLVLPGEGVFFS
                     DENGMLSVDELEPRFDKLILVVIDALRSDFIFSSGRSAMSEVHRLIRDGAGFPFTAHS
                     TPPTVTLPRIKGLTTGSTPNFLDAILNIAESDTSSTLANQDSWVNQIQKQGKRLHMFG
                     DDTWIKLFPRAFEKFDGTASFFVSDYTEVDNNVTRHIDYELGPGRESWDTLILHYLGL
                     DHIGHKGGPDSVFMPEKQREMDHIIHKLYENMEENTLLVVTGDHGMNEAGNHGGSSSG
                     ETSAGMVFLSPKFVQIKNSSQEGNNGHKAPLDNPTEGEFTYYSRIQQTDLVPTLASLL
                     KFPIPRNSLGVVIPDILELWENGEKAIILEQNVKQFVHVMASTYPGFDKIDVDIEMKC
                     QAAQDSVELGEVDELRCLWWRLKSGGREIYGDKDLVFEFLYGCQDLLSKAASNYVERD
                     LQFGLGLVILSAIVAISAVFLLKFSANLKIVLIIIAGVFSASMFGSSLVEEEHHFWYW
                     GATGWLSWLYITSSRRKFRDGGNWIACLMLIRIIRGWNQTGQKYAGGPDTAKWLGQDS
                     LGDNMGMESGAGQVLWGLVLVQYASLLGKLWLGGFSDVSSLAGFVFSFCIAMSSLVFK
                     INMAIQSGEFVPKYLQFIVVSADDSEGLINLARLSFFTIGLASLYELSKLILAPRDNR
                     VAVSSSLTNLSYIFEAFLVTQTRTVNIPLFIFFHLLRTYLARAYLINHRSSRDIVIII
                     TIFTLILQHVSFFAMGNSNSLASIDLSNAYNGISSYQIVLVGVLTFVNNWVGPLYWTV
                     AGLTMLIDSGIIPQTTTKAQIISNKILISQMFFSIATAGILGACYVLKHHLFIWTVFS
                     PKLLYSAAWLILQHGLIDIMASTALAYLF"
     gene            <619169..>620080
                     /gene="TAF5"
                     /locus_tag="AWJ20_4810"
                     /db_xref="GeneID:30036983"
     mRNA            <619169..>620080
                     /gene="TAF5"
                     /locus_tag="AWJ20_4810"
                     /product="Taf5p"
                     /transcript_id="XM_018881905.1"
                     /db_xref="GeneID:30036983"
     CDS             619169..620080
                     /gene="TAF5"
                     /locus_tag="AWJ20_4810"
                     /inference="similar to AA sequence:KEGG_Orthology:K13124"
                     /note="Subunit (90 kDa) of TFIID and SAGA complexes;
                     involved in RNA polymerase II transcription initiation and
                     in chromatin modification; GO_component: GO:0000124 - SAGA
                     complex [Evidence IDA] [PMID 9674426]; GO_component:
                     GO:0046695 - SLIK (SAGA-like) complex [Evidence IDA] [PMID
                     12446794]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005669 - transcription
                     factor TFIID complex [Evidence IDA] [PMID 10788514];
                     GO_component: GO:0005669 - transcription factor TFIID
                     complex [Evidence IDA] [PMID 15448131]; GO_function:
                     GO:0001075 - RNA polymerase II core promoter
                     sequence-specific DNA binding transcription factor
                     activity involved in preinitiation complex assembly
                     [Evidence IC] [PMID 15448131]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IDA] [PMID 12600943];
                     GO_function: GO:0032947 - protein complex scaffold
                     [Evidence IMP] [PMID 11585915]; GO_function: GO:0043130 -
                     ubiquitin binding [Evidence IDA] [PMID 21070969];
                     GO_process: GO:0051123 - RNA polymerase II transcriptional
                     preinitiation complex assembly [Evidence IC] [PMID
                     10788514]; GO_process: GO:0016568 - chromatin modification
                     [Evidence IDA] [PMID 9674426]; GO_process: GO:0016573 -
                     histone acetylation [Evidence IDA] [PMID 9674426];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA,IEA]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 12138208]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 15448131]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Taf5p"
                     /protein_id="XP_018736336.1"
                     /db_xref="GeneID:30036983"
                     /translation="MSVKLKIPHAHTGAIHALSYNSNGSYVLSGGQDRKVVLWNANSG
                     VKVQVYQFHAYEILDINVTFDDTRFVSCGGDRTAYVCDVSSGKTTNRFTGHIARINSA
                     CFNFDSSVVATASYDKTVKMWDCRSSSHSPIQTLTDASDSVSSVVIDRAQVFTGSVDG
                     KVRIYDIRKGKLSTMTIGYPVTSVKPNVDGDTVLVSSLDSRIRLMDVADGNLLKTYKG
                     HVNMLYRIKSAFVKNESEVVTCSEDGKIYFWDIESGEIERTLTQTSQLNSNSTMSSTS
                     YSLAIHPTTNEISTSSLDGSIQLWNKF"
     gene            <620369..>621115
                     /gene="MRP20"
                     /locus_tag="AWJ20_4811"
                     /db_xref="GeneID:30036984"
     mRNA            <620369..>621115
                     /gene="MRP20"
                     /locus_tag="AWJ20_4811"
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /transcript_id="XM_018881906.1"
                     /db_xref="GeneID:30036984"
     CDS             620369..621115
                     /gene="MRP20"
                     /locus_tag="AWJ20_4811"
                     /inference="similar to AA sequence:KEGG_Orthology:K02892"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005762 - mitochondrial
                     large ribosomal subunit [Evidence IDA] [PMID 1544898];
                     GO_component: GO:0005762 - mitochondrial large ribosomal
                     subunit [Evidence IDA] [PMID 9151978]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IDA] [PMID 1544898]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IDA] [PMID 9151978]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IMP] [PMID 1544898];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IC] [PMID 9151978]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /protein_id="XP_018736337.1"
                     /db_xref="GeneID:30036984"
                     /translation="MPRRIPKSIKRSSRAKPPTPYIPKQVKFPLSKKAQAKPTPKGPS
                     YSERIFNKLQESIEGDGPHFPVGGREVYFPHAKVVLVRPSAKHTPYQAKFVVPRYFNK
                     LDLRDYLYHVYGLKALNITTQLLWARWKRDAPGKPRYRTPQVKKMTIEMADPFVWPKP
                     TTLQEIRKHYNVNFIKELHKYGEDANRFGSDKLKPPRAFGGIAGPYVPPASPFLPKQI
                     TRQMLKKKKVAEVQALRQKDVDMVKNFLRL"
     gene            complement(<621264..>625349)
                     /locus_tag="AWJ20_4812"
                     /db_xref="GeneID:30036985"
     mRNA            complement(join(<621264..624717,625288..>625349))
                     /locus_tag="AWJ20_4812"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881907.1"
                     /db_xref="GeneID:30036985"
     CDS             complement(join(621264..624717,625288..625349))
                     /locus_tag="AWJ20_4812"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736338.1"
                     /db_xref="GeneID:30036985"
                     /translation="MASLRFSAESNEELIVTAPRCSLRSVSKSIEALLSSKASATGSG
                     SGAGDGAGTGSTDVGTGSSTSYSLDTETAENIQLYIEKHPPDPAEATRLHDELVRIHK
                     AYVLPESHPDSELYFVRCLIDFVPCLINTDSIEEWFGRYSGPAIDSAGHRNALVKLSR
                     EFLLALLLVSTNNNMGSLSDQDNESASKIKSIYLANSRKVAQMILAQYLKGDDGDYSF
                     TSNVDNMLKGKEGMKSEERRRFAKSNAQNILIQYGMKAPVEFLTVVSDRFGESKLRIQ
                     LLALLSSYVSQQPPYLFQIRSTPLLDNLYQCLIRDKSSFGLSICATVVAMILPHICDI
                     VVDQLPKLFAIYGRLCSWQLELGSEEDDADAASDEDDEKHSKDETCTTNSSDNWQVLN
                     NLIDIQDARGPIITPLFTFLYGLFPVNLICFIRQPNEYLSESGYKRPFDDFWDKHYIQ
                     ELSRPCLELHTLNPSMISMTREQELTDKTRWQFMGSAYDIASLCLSLYNPRQDFNKRP
                     SHQVVSISSTSSRPQFRLPFEEVNNLIDPESQQNADGEIISASNLTSDYDTPELVNPA
                     VKRLSVVNVPPSILSRTSSSFDPTATGGPIREDSLTSPSTATNGRNSFLSPGLPSVEA
                     LLSDHEKLYSRREILPTLEKRDSMSAIPDELRLDDVVSPTDPGPSTANNSVHNLSVDV
                     NNNKPGTNNNNSTNSSLNTLRRGRSGTISSPAFIPTSQNTTSSAIHSPLLLSQPNQVA
                     AAAASSIAAASANVSAPGTGTTSSPNIPISSPTTGPQSAAIVSHEQLEKQFNLTIAFY
                     QRELLLIQNELEFVSFVEHQTQHRFSELRQKLKDSILANAQVDKLITQNKALKAALEK
                     PELEAAKYQKSLKTYKSERQAYEGSLVQRNKDFRTQINNLNQQLEQVKSELEQITTEK
                     KALLESVKSQEITISKMELDLTAAKERTVLFDSLQKAFEELKQKVEVLERQQENTDKS
                     NPQVDVVQGQLEQLRLAYHGLEADKDKIVTAYDKRIEELEKLVADYETRMNRNNGPPS
                     RESSDISQFIESFKKASEVRYNQLNTAYNELVDRFEDLSVRFREVLLNDEEHKARIDQ
                     PVLPKRSLLGYEMVRAEEENVSESNGVTKNIAAQPPQHPHPLVRNTTETRIRGRGGVQ
                     NTSNAPVPNSPGSTQSKRRPFRGYG"
     gene            <625102..>626079
                     /locus_tag="AWJ20_4813"
                     /db_xref="GeneID:30036986"
     mRNA            <625102..>626079
                     /locus_tag="AWJ20_4813"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881908.1"
                     /db_xref="GeneID:30036986"
     CDS             625102..626079
                     /locus_tag="AWJ20_4813"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736339.1"
                     /db_xref="GeneID:30036986"
                     /translation="MSYSNLDLINQVDSVPYTPQPVDAYYEFRSHDSKAVLGYILPEV
                     AKKLNYPDTFTVTGPTANQRGAVTINSSLDSAEKRSEAIAKVLEDLKENKTFQVLQGW
                     RNELYTVYNPTHVPYFLIERAGSGLFGIVTYGVHLVGYQPATETSPLKIWVPRRSYTK
                     ATYPGMLDNTIAGGIGYPCGVHETAIKEAYEEAGLDEEFMEKNLRPAGVVTYFHQVNN
                     HFFDSEASSRSTTTKDEATYQPEVEFIYDVIMAGDVKPRPVDGEVAEFYLMDVETVKQ
                     ELAKGSFKYNCALVMIDFFIRHGILTYENEPDFVNIAQRCHRVLEFPMK"
     gene            <627019..>628272
                     /gene="KTR4"
                     /locus_tag="AWJ20_4814"
                     /db_xref="GeneID:30036987"
     mRNA            <627019..>628272
                     /gene="KTR4"
                     /locus_tag="AWJ20_4814"
                     /product="Ktr4p"
                     /transcript_id="XM_018881909.1"
                     /db_xref="GeneID:30036987"
     CDS             627019..628272
                     /gene="KTR4"
                     /locus_tag="AWJ20_4814"
                     /inference="similar to AA sequence:KEGG_Orthology:K03854"
                     /note="Putative mannosyltransferase involved in protein
                     glycosylation; member of the KRE2/MNT1 mannosyltransferase
                     family of type II membrane proteins with a short
                     cytoplasmic N-terminus, a membrane-spanning region and a
                     highly conserved catalytic lumenal domain; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence ISS] [PMID
                     7975899]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA,IEA]; GO_function: GO:0000030 -
                     mannosyltransferase activity [Evidence IEA]; GO_function:
                     GO:0000030 - mannosyltransferase activity [Evidence ISS]
                     [PMID 7975899]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016757 -
                     transferase activity, transferring glycosyl groups
                     [Evidence IEA]; GO_process: GO:0097502 - mannosylation
                     [Evidence IEA]; GO_process: GO:0006487 - protein N-linked
                     glycosylation [Evidence ISS] [PMID 7975899]; GO_process:
                     GO:0006486 - protein glycosylation [Evidence IEA]"
                     /codon_start=1
                     /product="Ktr4p"
                     /protein_id="XP_018736340.1"
                     /db_xref="GeneID:30036987"
                     /translation="MLVRYLRRPIAIIGLFSVVVLLAMSSYLFDLDLTPYYDRKAYGQ
                     KVAQGDFIPDKQVDLSKGYSAEDPSRNEDAKNPLFDEKLEPDGGLSRLTETDKRVPAT
                     LMSLVRNKEADDLMATIVQIESAFNNKFNYPWTFFNDEEFTEDFKTSALAATGGNCTF
                     VKIEPEDWMEPSWIDVDKARELGIKMKNKDDVQYADLPSYHRMCRWNSGRFFMNPALD
                     NYDYYWRVEPKTDFYCDIDYDIFAYMKENDKVYGFVINLYDSPQSIRTLWPTTKEFFE
                     QNPEYLHPNNALQWVVNTGREGHTKKANGYSTCHFWSNFEIGSLEFFRSKPYQDYFDF
                     LDKNGGFFYERWGDAPVHSLGLAMMADKSKIHYFKDIGYQHFPYFNCPASPKCKGCDA
                     GKFTGIDSLNTESCMSEWFKAAGTG"
     gene            complement(<628441..>629946)
                     /gene="AIP1"
                     /locus_tag="AWJ20_4815"
                     /db_xref="GeneID:30036988"
     mRNA            complement(<628441..>629946)
                     /gene="AIP1"
                     /locus_tag="AWJ20_4815"
                     /product="Aip1p"
                     /transcript_id="XM_018881910.1"
                     /db_xref="GeneID:30036988"
     CDS             complement(628441..629946)
                     /gene="AIP1"
                     /locus_tag="AWJ20_4815"
                     /note="Actin cortical patch component; interacts with the
                     actin depolymerizing factor cofilin; inhibits elongation
                     of aged ADP-actin filaments decorated with cofilin to
                     maintain a high level of assembly-competent actin species;
                     required to restrict cofilin localization to cortical
                     patches; contains WD repeats; protein increases in
                     abundance and relocalizes from cytoplasm to plasma
                     membrane upon DNA replication stress; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IEA];
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     IDA] [PMID 10366597]; GO_component: GO:0005884 - actin
                     filament [Evidence IDA] [PMID 23333351]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0005856 - cytoskeleton
                     [Evidence IEA,IEA]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11914276]; GO_function: GO:0003779 - actin binding
                     [Evidence IEA]; GO_function: GO:0003779 - actin binding
                     [Evidence IPI] [PMID 7719850]; GO_process: GO:0030042 -
                     actin filament depolymerization [Evidence IGI,IPI] [PMID
                     10366597]; GO_process: GO:0051016 - barbed-end actin
                     filament capping [Evidence IMP] [PMID 23333351];
                     GO_process: GO:0006970 - response to osmotic stress
                     [Evidence TAS] [PMID 10652251]"
                     /codon_start=1
                     /product="Aip1p"
                     /protein_id="XP_018736341.1"
                     /db_xref="GeneID:30036988"
                     /translation="MVAKGEYQVIQGRINDLAWDADSQRIIAVGDGKEKYGHCFTADS
                     GNTVGSIAGHSAVVNAVSIRPVRPYRAVTVGDDARLVFYQGPPFQFSLSHQDKHTNFV
                     QDAQFSPNGEFIVSVGSDRKIALYEGKTGEFLSFVEDESNGHKGSIFSVAWSPDSSKF
                     ATASADQTVKLWSVADKKVLKTWSFPAGLENHQVGVVFAGEYIISLSYSGDLNYLQES
                     SDKPVKTVTGHQKTITSLASSGPSKPLVSGSYDGKIVHWDASDITASSSVHSHDGPVV
                     GIVSDGEHLWSVGWDDTLKRVGSDSSVSLFGQPKAVASGSDGIIAVVGESYIQVFDNG
                     KQLAFNTSLEFPAQAVSVSKSLVAVGSSDNSIHLFNRDLSVSNSVKLAPLRSAVTYLA
                     FSPDGEYLAAGDASGKITLYSIPDQSVVTGRWAFHTSRVTSIHWHPSGSHVVAGSADT
                     NIIIYSVANPGKNIKYLGAHKDGINSVLWTSDSTFASAGNDATVKRWRVTL"
     gene            complement(<634464..>634883)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4816"
                     /db_xref="GeneID:30036989"
     mRNA            complement(<634464..>634883)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4816"
                     /product="allantoate permease"
                     /transcript_id="XM_018881911.1"
                     /db_xref="GeneID:30036989"
     CDS             complement(634464..634883)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4816"
                     /note="Allantoate permease; ureidosuccinate permease; also
                     transports dipeptides, though with lower affinity than for
                     allantoate and ureidosuccinate; expression is constitutive
                     but sensitive to nitrogen catabolite repression;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0015124 -
                     allantoate transmembrane transporter activity [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0042936 -
                     dipeptide transporter activity [Evidence IMP] [PMID
                     16429164]; GO_function: GO:0042936 - dipeptide transporter
                     activity [Evidence IGI,IMP] [PMID 17693598]; GO_function:
                     GO:0005215 - transporter activity [Evidence IEA];
                     GO_process: GO:0015719 - allantoate transport [Evidence
                     IMP] [PMID 3275614]; GO_process: GO:0042938 - dipeptide
                     transport [Evidence IMP] [PMID 16429164]; GO_process:
                     GO:0042938 - dipeptide transport [Evidence IGI,IMP] [PMID
                     17693598]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0042939 -
                     tripeptide transport [Evidence IMP] [PMID 16429164]"
                     /codon_start=1
                     /product="allantoate permease"
                     /protein_id="XP_018736342.1"
                     /db_xref="GeneID:30036989"
                     /translation="MSASFLAFSSNHSVQLAGYCLFSMSPLCFICYLSTISSNTAGHT
                     KKVIFSATTLVGYCVGNLIGPQTFIASESPTYKTAKTTIVACYGVSLILIAATYYINR
                     RANRIRDEKNEKLPDDFVNSEFADLTDFQNPEFRYAL"
     gene            complement(<634933..>636057)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4817"
                     /db_xref="GeneID:30036990"
     mRNA            complement(<634933..>636057)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4817"
                     /product="allantoate permease"
                     /transcript_id="XM_018881912.1"
                     /db_xref="GeneID:30036990"
     CDS             complement(634933..636057)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4817"
                     /note="Allantoate permease; ureidosuccinate permease; also
                     transports dipeptides, though with lower affinity than for
                     allantoate and ureidosuccinate; expression is constitutive
                     but sensitive to nitrogen catabolite repression;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0015124 -
                     allantoate transmembrane transporter activity [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0042936 -
                     dipeptide transporter activity [Evidence IMP] [PMID
                     16429164]; GO_function: GO:0042936 - dipeptide transporter
                     activity [Evidence IGI,IMP] [PMID 17693598]; GO_function:
                     GO:0005215 - transporter activity [Evidence IEA];
                     GO_process: GO:0015719 - allantoate transport [Evidence
                     IMP] [PMID 3275614]; GO_process: GO:0042938 - dipeptide
                     transport [Evidence IMP] [PMID 16429164]; GO_process:
                     GO:0042938 - dipeptide transport [Evidence IGI,IMP] [PMID
                     17693598]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0042939 -
                     tripeptide transport [Evidence IMP] [PMID 16429164]"
                     /codon_start=1
                     /product="allantoate permease"
                     /protein_id="XP_018736343.1"
                     /db_xref="GeneID:30036990"
                     /translation="MITEHKANVSKDLGVVEKNVEVEIAEVKDVNLKGADLAMEVAFQ
                     SYGMEIDEATNKRILRKIDMYVCTLMCVVYSIQFLDKVTNSFAAIMGLIPDLHMTGSE
                     YSWIGSAFYLGYLVLEFPAAYLLQRFPIAKTVGIFVILWGFVLCMTSLPTTFGGFLTT
                     RIFLGMLESAVTPAFVLITSQWYKSSEQFTRTAFWVGCNGIGGMIGAAIAYGLAKRQM
                     AGDLPIVAWRLLFIIVGVVTIALGIAFILIIPDTPSKAWFLNEEEKLLVVERIRSNKQ
                     GFGNRKIKMDQVKEAFCDVRLYLNFFVMVLINIPNGGLTNFGSKYHKKKDNQITRFVL
                     TFYRYCADRHGIRHFGCSSDEPSTRSSRGCRTVVVRSFRC"
     gene            complement(<637482..>638501)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4818"
                     /db_xref="GeneID:30036991"
     mRNA            complement(<637482..>638501)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4818"
                     /product="allantoate permease"
                     /transcript_id="XM_018881913.1"
                     /db_xref="GeneID:30036991"
     CDS             complement(637482..638501)
                     /gene="DAL5"
                     /locus_tag="AWJ20_4818"
                     /inference="similar to AA sequence:KEGG_Orthology:K08192"
                     /note="Allantoate permease; ureidosuccinate permease; also
                     transports dipeptides, though with lower affinity than for
                     allantoate and ureidosuccinate; expression is constitutive
                     but sensitive to nitrogen catabolite repression;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0015124 -
                     allantoate transmembrane transporter activity [Evidence
                     IMP,ISS] [PMID 3275614]; GO_function: GO:0042936 -
                     dipeptide transporter activity [Evidence IMP] [PMID
                     16429164]; GO_function: GO:0042936 - dipeptide transporter
                     activity [Evidence IGI,IMP] [PMID 17693598]; GO_function:
                     GO:0005215 - transporter activity [Evidence IEA];
                     GO_process: GO:0015719 - allantoate transport [Evidence
                     IMP] [PMID 3275614]; GO_process: GO:0042938 - dipeptide
                     transport [Evidence IMP] [PMID 16429164]; GO_process:
                     GO:0042938 - dipeptide transport [Evidence IGI,IMP] [PMID
                     17693598]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0042939 -
                     tripeptide transport [Evidence IMP] [PMID 16429164]"
                     /codon_start=1
                     /product="allantoate permease"
                     /protein_id="XP_018736344.1"
                     /db_xref="GeneID:30036991"
                     /translation="MTIQENETAMGPKDLGIVEKNAMVEVAEVKDLNLKTADLAMEVA
                     FQSYGMEIDEATNRKILRKIDLYVCSLMCIVYAVQYLDKVTNSFASIMGLRTDLNITG
                     SQYSWIGSVFYIAYLVFEFPASYSLQRFPIAKTVGAFVIAWGFVLCMTALPTNYGGFL
                     TTRIFLGMLESAVTPAFVLLTSQWYKSEEQFTRTSFWVGCNGLGSIIGSLTAYGLAKR
                     QEAGTLPISGWRLLFVIVGVVTIALGIIFILVIPDVPAKAWFLTEEEKLLVVERIRSN
                     KQGFGNRKFKMDQVKEAFTDVRLYLNFLVMVLIDIPNGGMTNFQSKFCLYFKHFKTKS
                     EKKKD"
     gene            <641504..>642994
                     /gene="UTP15"
                     /locus_tag="AWJ20_4819"
                     /db_xref="GeneID:30036992"
     mRNA            <641504..>642994
                     /gene="UTP15"
                     /locus_tag="AWJ20_4819"
                     /product="Utp15p"
                     /transcript_id="XM_018881914.1"
                     /db_xref="GeneID:30036992"
     CDS             641504..642994
                     /gene="UTP15"
                     /locus_tag="AWJ20_4819"
                     /inference="similar to AA sequence:KEGG_Orthology:K14549"
                     /note="Nucleolar protein; component of the small subunit
                     (SSU) processome containing the U3 snoRNA that is involved
                     in processing of pre-18S rRNA; GO_component: GO:0030686 -
                     90S preribosome [Evidence IDA] [PMID 12150911];
                     GO_component: GO:0005730 - nucleolus [Evidence IEA,IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     12068309]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_component: GO:0033553 - rDNA heterochromatin
                     [Evidence IDA] [PMID 15489292]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0032040 - small-subunit processome [Evidence IDA] [PMID
                     12068309]; GO_component: GO:0034455 - t-UTP complex
                     [Evidence IDA] [PMID 17515605]; GO_function: GO:0030515 -
                     snoRNA binding [Evidence IPI] [PMID 12068309]; GO_process:
                     GO:0000462 - maturation of SSU-rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 12068309]; GO_process: GO:0045943 - positive
                     regulation of transcription from RNA polymerase I promoter
                     [Evidence IMP] [PMID 15489292]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA,IEA]; GO_process: GO:0042254
                     - ribosome biogenesis [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Utp15p"
                     /protein_id="XP_018736345.1"
                     /db_xref="GeneID:30036992"
                     /translation="MSTQAVRIQPVRNPVLPAKTTPELRYWRGFKNPLLVKENNAVNH
                     LHFNPQSPHDFAVTSSTRVQIFSAKTRQVVRTIARFKDTVYSGEFRSDGKLLVAGDAT
                     GLIQVFDANSRSVLVTLLPTQHSTQVTKFHPTELSTLLSASDDRVVRLWDLTSPNPVA
                     SYGDHTDYVRTACFIPQSSLIATGCYDGLVRIYDRRISAEEGPVATHDQGAPVESVLA
                     LNSTTFLSAGDPTVKVWDLAASKKVKELGNFQKTVTCLADAGERGVLAGSLDGHVKVL
                     DSSSPDWSVKFGWKFGGAVLNTGVSPDHKHFVTGLTSGLLSIRTRKTEPKVAQGVKTA
                     KVGNFARMVRGAEYHGELEHRVLDTKSAPSRKLKAYERHLKAFRWSDALDSAFSNDMA
                     PELTTTVLEELKRRGKVIVSLSGRDEDSLEPILKWSVKAVQDTRSIPIVADWVGCIVD
                     MYANLIDRSPVLENLVLQLRKRVALEVERAKEAKRIDGMLELLLSR"
     gene            complement(<643490..>644761)
                     /locus_tag="AWJ20_4820"
                     /db_xref="GeneID:30036994"
     mRNA            complement(<643490..>644761)
                     /locus_tag="AWJ20_4820"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881916.1"
                     /db_xref="GeneID:30036994"
     CDS             complement(643490..644761)
                     /locus_tag="AWJ20_4820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736346.1"
                     /db_xref="GeneID:30036994"
                     /translation="MGTGPSQSEIHKIKLEIKKWEYSFQETHGRKPGYDDIRAIPDIH
                     IKYKTYNRYKSGTSRASKNVDDNDQAAVRKLDKPLKSLAQYDQSTDGVTADSTGYVLT
                     PHGTRSYREDLSIEYISRSPSRRSAEYDEGFKGNAASHRTPSTPQKKKNAEMAAAILA
                     AKIGPTPQMDGRVLGIFEFTSPDAILQTPSAKKQKYNPSFENALLNTPSKKRTKSVAS
                     ANPISPPRSDSPVRAVDSNSHAEPDANLSHTILATPAKSKTSSPFNMETPSKTPTYLN
                     HRISSMADSPIAPRRLGRTLSSMMAELRDIKKEQETGGFDPDDGFDINEIADLNEEDL
                     YSDFNDSQDDTKPKDSTEPGPIYKKKGQKRTTKRVKMKPILNENDPIDESAKRARTLP
                     KKQPENFQRLKLHNSGYKTNKSKFFFGRRSR"
     gene            <645086..>647341
                     /gene="ATP25"
                     /locus_tag="AWJ20_4821"
                     /db_xref="GeneID:30036995"
     mRNA            <645086..>647341
                     /gene="ATP25"
                     /locus_tag="AWJ20_4821"
                     /product="Atp25p"
                     /transcript_id="XM_018881917.1"
                     /db_xref="GeneID:30036995"
     CDS             645086..647341
                     /gene="ATP25"
                     /locus_tag="AWJ20_4821"
                     /note="Mitochondrial protein required for the stability of
                     Oli1p (Atp9p) mRNA; also required for the Oli1p ring
                     formation; YMR098C is not an essential gene; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IDA] [PMID 18216280]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0048255 -
                     mRNA stabilization [Evidence IEA]; GO_process: GO:0048255
                     - mRNA stabilization [Evidence IMP] [PMID 18216280];
                     GO_process: GO:0033615 - mitochondrial proton-transporting
                     ATP synthase complex assembly [Evidence IMP] [PMID
                     18216280]"
                     /codon_start=1
                     /product="Atp25p"
                     /protein_id="XP_018736347.1"
                     /db_xref="GeneID:30036995"
                     /translation="MASRRVIYTLLEPVTRPYFAPYRHNYNQRQQEKRRQALQRKWIS
                     TGVSDGVVELTEEEAALVASGHATNSAGSTSGSGTSTVIVSSSSSNQAGSISSSVSGD
                     NEHSLLRTTSDDIPWYLRNTDTIKATESLQSREPLPDFPFASPRSLENMAKYMIEDLG
                     LVDLQIIDLRHVQPASPFGPNDIMLLCSGKGSRHLTKASQSLIGYVKQNYNQLADTEG
                     ILSSNFLRVYNRRLRKRAQRQGTANREFMAGGDSTGTMVDRTGSWVVLDTKVDGIYIH
                     IFTEERRSEVDLEGYWSQKSKGISELVDLPKSKFEKRFVLPGSRRGFATSIVASNVKA
                     TLAETVGSSSTASVAPTVKAAVADAHINNTPTAHTSKLSVDSTDSAVVEEPVPSESQN
                     YLDELQKWSLAGDYKRCIRLKSFAPELTAEENQKSDTLILKAHLNYLAVNQKTIIFSE
                     ITPTCDIVSSFINAFPTEPMPLQWRLRLIFLQKLHTINEPAFPLNLLVEHITLQQASG
                     VPIEPWDVEMVVATIAYSHQFTNKKVNNLSVAEWEAVCDNKLQLILQVHEVAFRSTGE
                     VLSVSDSLVALLYRLCFSLSKEGKAKSIVPSEALADPTPSTGVPNSYIAGVTGKRAFV
                     DPRATTMMGLFGGEGGAKMTKPIVILIMSVLINGGSWDKFWSFWTNINRYTIVDQDLL
                     AVMVSLVTKTGDQANMIHLLEKYLPTLLTDLERTGVSILPETAEALKASVQYLDPARA
                     RYDFIRNFLGC"
     gene            <648028..>648597
                     /locus_tag="AWJ20_4822"
                     /db_xref="GeneID:30036996"
     mRNA            <648028..>648597
                     /locus_tag="AWJ20_4822"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881918.1"
                     /db_xref="GeneID:30036996"
     CDS             648028..648597
                     /locus_tag="AWJ20_4822"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736348.1"
                     /db_xref="GeneID:30036996"
                     /translation="MDQYNKQAADFVFRANNADSGPDEIDLHGLYVKEAIQALDTRIR
                     AGIQRHESHIKAIVGKGNHSANHVAKIKPAVEELCQTHGIRHEIDPHNSGVIILHLDG
                     QSGPAVNTGNYPQQPPASHGGSASQYYGGNAPQQQPYAPQHQQYQQNYGQQQQQYQQQ
                     PQGQGQNNQNDMLFKIFCGVAKMLFRQCA"
     gene            complement(<648892..>649743)
                     /gene="KTI12"
                     /locus_tag="AWJ20_4823"
                     /db_xref="GeneID:30036997"
     mRNA            complement(<648892..>649743)
                     /gene="KTI12"
                     /locus_tag="AWJ20_4823"
                     /product="Kti12p"
                     /transcript_id="XM_018881919.1"
                     /db_xref="GeneID:30036997"
     CDS             complement(648892..649743)
                     /gene="KTI12"
                     /locus_tag="AWJ20_4823"
                     /inference="similar to AA sequence:KEGG_Orthology:K15456"
                     /note="Protein that plays a role in modification of tRNA
                     wobble nucleosides; protein plays role in tRNA wobble
                     nucleoside modification with Elongator complex; involved
                     in sensitivity to G1 arrest induced by zymocin; interacts
                     with chromatin throughout the genome; also interacts with
                     Cdc19p; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 12139626]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 12139626]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IDA] [PMID 15772087];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0016049 - cell growth [Evidence IPI]
                     [PMID 12139626]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IGI] [PMID 15772087]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0002098 - tRNA wobble uridine modification
                     [Evidence IMP] [PMID 18755837]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Kti12p"
                     /protein_id="XP_018736349.1"
                     /db_xref="GeneID:30036997"
                     /translation="MPLITVSGLPSSGKTTRALQLKAGLERKIAEVNSDLTVYLINDE
                     SLSISKETYRELHSEKATRGAQISAVKRHLGKNTIVIFDNLSYIKGFRYQLFCEAKAL
                     STNACLVHVGAPKDMCVAWNKSRPEGEAWPEDLFDALVFRYEEPNPMSRWDSPLFPIA
                     HEDTEADIPIDEIWDTLVLRKPKPPNAATVLKPVTAGNYLTELDKITTSVVNEIIDLH
                     KTSPGGLVKLDAYDPVVQLPMRLTVASLNRIRRNFVTINKMKPIEVSRIRPHFIEFAI
                     KNLSADM"
     gene            <650295..>651395
                     /gene="MTG1"
                     /locus_tag="AWJ20_4824"
                     /db_xref="GeneID:30036998"
     mRNA            <650295..>651395
                     /gene="MTG1"
                     /locus_tag="AWJ20_4824"
                     /product="putative GTPase MTG1"
                     /transcript_id="XM_018881920.1"
                     /db_xref="GeneID:30036998"
     CDS             650295..651395
                     /gene="MTG1"
                     /locus_tag="AWJ20_4824"
                     /inference="similar to AA sequence:KEGG_Orthology:K06948"
                     /note="Putative GTPase peripheral to the mitochondrial
                     inner membrane; essential for respiratory competence,
                     likely functions in assembly of the large ribosomal
                     subunit, has homologs in plants and animals; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IDA] [PMID 12808030]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_function: GO:0005525 - GTP binding [Evidence IEA,IEA];
                     GO_function: GO:0003924 - GTPase activity [Evidence ISA]
                     [PMID 12808030]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IGI,IMP] [PMID
                     12808030]"
                     /codon_start=1
                     /product="putative GTPase MTG1"
                     /protein_id="XP_018736350.1"
                     /db_xref="GeneID:30036998"
                     /translation="MSTEVPSEPTKHKFVPRPSFPDYNIPLANFHGHHRKALQSMHQT
                     ALQVDLVLELRDSRAPLSSINLLFDKVLGHKNKLVLYTKNDLSGIKNATELYEAWHPH
                     QKFLNIDCRSTADANKVLSAAKQLYDELEPKPPLGLRLLITGMPNAGKSTFLNTLRKV
                     GTGERHKVASTGEMPGVTRSISETIRISRDPNIYIFDTPGVFVPQVKNSEDMLKMCLI
                     NAVKRSHVDPVVLADYLLYRINKQYPDGKPYLKYTGRPTNNIDFLLRSIVKRRLSRRN
                     SATKDNNKAKASNNGDKSKGTKIVDFNENGEALDWIEKWTKGKGPKIVLDDVNEPDCY
                     AKTIEEQQTRLSSFDLGPLKVKSFQKKRLMLR"
     gene            <654564..>654869
                     /gene="POM33"
                     /locus_tag="AWJ20_4825"
                     /db_xref="GeneID:30036999"
     mRNA            <654564..>654869
                     /gene="POM33"
                     /locus_tag="AWJ20_4825"
                     /product="nucleoporin POM33"
                     /transcript_id="XM_018881921.1"
                     /db_xref="GeneID:30036999"
     CDS             654564..654869
                     /gene="POM33"
                     /locus_tag="AWJ20_4825"
                     /codon_start=1
                     /product="nucleoporin POM33"
                     /protein_id="XP_018736351.1"
                     /db_xref="GeneID:30036999"
                     /translation="MAYAANFEFGLVFLLFFKFVTFRKGTTFPFLFYIVFIKARYDQS
                     YYMKSAVKAWEVKIDSVFANPNIPAPLKQAWAQVKDVVKRITSAVTIGKPVAPKKHS"
     gene            <655610..>656128
                     /gene="ADI1"
                     /locus_tag="AWJ20_4826"
                     /db_xref="GeneID:30037000"
     mRNA            <655610..>656128
                     /gene="ADI1"
                     /locus_tag="AWJ20_4826"
                     /product="acireductone dioxygenase (Ni2+-requiring)"
                     /transcript_id="XM_018881922.1"
                     /db_xref="GeneID:30037000"
     CDS             655610..656128
                     /gene="ADI1"
                     /locus_tag="AWJ20_4826"
                     /inference="similar to AA sequence:KEGG_Orthology:K08967"
                     /note="Acireductone dioxygenease involved in the
                     methionine salvage pathway; ortholog of human MTCBP-1;
                     transcribed as polycistronic mRNA with YMR010W and
                     regulated post-transcriptionally by RNase III (Rnt1p)
                     cleavage; ADI1 mRNA is induced in heat shock conditions;
                     GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0010308 - acireductone dioxygenase (Ni2+-requiring)
                     activity [Evidence IMP] [PMID 15938715]; GO_function:
                     GO:0010309 - acireductone dioxygenase [iron(II)-requiring]
                     activity [Evidence IEA,IEA,IEA]; GO_function: GO:0051213 -
                     dioxygenase activity [Evidence IEA]; GO_function:
                     GO:0005506 - iron ion binding [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_process: GO:0019509 - L-methionine
                     salvage from methylthioadenosine [Evidence IEA,IEA,IEA];
                     GO_process: GO:0019509 - L-methionine salvage from
                     methylthioadenosine [Evidence IGI,IMP,ISS] [PMID
                     15938715]; GO_process: GO:0019509 - L-methionine salvage
                     from methylthioadenosine [Evidence IMP] [PMID 18625006];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0009086 -
                     methionine biosynthetic process [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="acireductone dioxygenase (Ni2+-requiring)"
                     /protein_id="XP_018736352.1"
                     /db_xref="GeneID:30037000"
                     /translation="MKIYYHDGLEGDQRLRHDSGKEVTVEELDKLAVKAYHFDDIKDV
                     DKLAESRNYINRDVINVSPEALGGKESYETKIKTFYTEHLHEDEEIRYVLDGEGYFDV
                     RDKSDRWIRCLLTKGDLLILPAGIYHRFTTASNDYIQAMRLFQAEPKWIPHNRPCDNN
                     EYRVEYVKSISV"
     gene            <663078..>665963
                     /gene="VPS53"
                     /locus_tag="AWJ20_4827"
                     /db_xref="GeneID:30037001"
     mRNA            <663078..>665963
                     /gene="VPS53"
                     /locus_tag="AWJ20_4827"
                     /product="Vps53p"
                     /transcript_id="XM_018881923.1"
                     /db_xref="GeneID:30037001"
     CDS             663078..665963
                     /gene="VPS53"
                     /locus_tag="AWJ20_4827"
                     /note="Component of the GARP (Golgi-associated retrograde
                     protein) complex; GARP is required for the recycling of
                     proteins from endosomes to the late Golgi, and for mitosis
                     after DNA damage induced checkpoint arrest; required for
                     vacuolar protein sorting; members of the GARP complex are
                     Vps51p-Vps52p-Vps53p-Vps54p; GO_component: GO:0000938 -
                     GARP complex [Evidence IPI] [PMID 10637310]; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IEA,IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IDA]
                     [PMID 10637310]; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence TAS] [PMID 11689439]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005768 - endosome [Evidence IEA];
                     GO_component: GO:0010008 - endosome membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006896 - Golgi to vacuole transport
                     [Evidence IMP] [PMID 10637310]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0042147 -
                     retrograde transport, endosome to Golgi [Evidence IDA]
                     [PMID 12686613]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Vps53p"
                     /protein_id="XP_018736353.1"
                     /db_xref="GeneID:30037001"
                     /translation="MASFGVANGHSGGSGLGGEDDDPLSLPNYSPVDHLNVLFPTSAN
                     VQRVGDIRDLAQLYGQSLESKLINGRRTSGSTGSSSIEAVSKTLEEVRSLTDQIDSLR
                     TQAASTDQAITAMTLDIKKLDNTKANLIQSITVLKRLQMLTTAYNQLSSLVARRQYKE
                     MSQTLPAVMELMAHFRQFRSISQIATLSKQVSDIQVRISDQIFDDFATVIEHKPGSRT
                     VAGSAGVSGTGTPVLNGSSTGFSGSGAGSGTGSATQTGAPASIVDISATLADACVVLD
                     SLPGSTARDRLISWFCNVQLKEYRTIFRSSDEAGSLENISRRYSYLKRLLKTHSDEYA
                     RYFVPSWNVTEELCKRFCATTREDIQGLLSQVSSTQTNPKESDVQLLLNSLNETLEFE
                     QYLEKKFKYMNPRPASSSSTSSSEPFKFANSVSIAFQPHLNIWIQFQDRALAQKFQEF
                     RAVSRHSQSQGTRSQTGSDDNDQENKDDDDPTVLPSSADLFIFYRSVLTQTAKLSNRE
                     PLLQLSNLFGKWLTVYCSQILRSYIPDRLVTTDDIKTICLVITTADYCFNTTNQLEQK
                     LVDQLDPEFKVGVDLEREKGMFLEVINLCIRNLVRKVEAGCEFAWREMANTNWSKVET
                     VGDQSSYVADLTSNIERDTLAILECMKKETHARMLCDKIVEAVTGDFLQSVVRCRPIS
                     EVSAEQMLLDLYVLKGCFLKLPTLAQKQHDHGSMDINGTDKSSTGIHNNDSGTTNGLT
                     TGSETSTVSSAYTRHVTKSLSRVETILKVILTQVNPAEGLVQNYFYLVGDKSQQNFAK
                     ILELKGITRGGQTRFLEMFNAHLKAHDNLVDESPILSSLQLNPLVGKGTVVGGSRVSS
                     ASHINIGIGGLGGAAGIMGSGSGINLVGSNNSSNNNSGSSSGNPFQNGSHLFDTKGPS
                     ILSKEGFERFTHGAEAPVNKLNENFRNFGRLFRRDGSGSPLGNRNNH"
     gene            complement(<666271..>667101)
                     /gene="PML1"
                     /locus_tag="AWJ20_4828"
                     /db_xref="GeneID:30037002"
     mRNA            complement(<666271..>667101)
                     /gene="PML1"
                     /locus_tag="AWJ20_4828"
                     /product="Pml1p"
                     /transcript_id="XM_018881924.1"
                     /db_xref="GeneID:30037002"
     CDS             complement(666271..667101)
                     /gene="PML1"
                     /locus_tag="AWJ20_4828"
                     /inference="similar to AA sequence:KEGG_Orthology:K13108"
                     /note="Subunit of the RES complex; RES complex is required
                     for nuclear retention of unspliced pre-mRNAs; acts in the
                     same pathway as Pml39p and Mlp1p; GO_component: GO:0070274
                     - RES complex [Evidence IDA] [PMID 15565172];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008380 -
                     RNA splicing [Evidence IEA]; GO_process: GO:0006406 - mRNA
                     export from nucleus [Evidence IMP] [PMID 15565172];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IDA] [PMID 15565172]; GO_process: GO:0051237 -
                     maintenance of RNA location [Evidence IMP] [PMID
                     16162818]"
                     /codon_start=1
                     /product="Pml1p"
                     /protein_id="XP_018736354.1"
                     /db_xref="GeneID:30037002"
                     /translation="MSDGNEGRDRYGRVKREYRDEDWHERQRRGPRNQNRSRSPGRRP
                     GSGARTGANAVPVKREDRGDGGRTRSHERNRDRDRDRDMRREWDRGSRDRSGIRPKEE
                     DLWSNDDSKEAPPSPPPVKPNYSHSGVLTEESKKDSEGNILKYHEPEDATTPPKTPEY
                     RIYVFSESEQGKLIDTIKLNQKSHYLLGRDTKVCDIPVDIKSCSRQHAVIQFRRISKT
                     DRFGDTHHTIKPYIIDLESSYGTQLNGDDVPPSRYVELRNKDLIQFCGHPREYLWIES
                     "
     gene            <667803..>670199
                     /gene="HCA4"
                     /locus_tag="AWJ20_4829"
                     /db_xref="GeneID:30037003"
     mRNA            <667803..>670199
                     /gene="HCA4"
                     /locus_tag="AWJ20_4829"
                     /product="RNA-dependent ATPase HCA4"
                     /transcript_id="XM_018881925.1"
                     /db_xref="GeneID:30037003"
     CDS             667803..670199
                     /gene="HCA4"
                     /locus_tag="AWJ20_4829"
                     /inference="similar to AA sequence:KEGG_Orthology:K14776"
                     /note="DEAD box RNA helicase; high-copy number suppression
                     of a U14 snoRNA processing mutant suggests an involvement
                     in 18S rRNA synthesis; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IC] [PMID 16209945]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0004004 - ATP-dependent RNA helicase activity [Evidence
                     IMP] [PMID 16209945]; GO_function: GO:0004004 -
                     ATP-dependent RNA helicase activity [Evidence IDA] [PMID
                     23153376]; GO_function: GO:0008026 - ATP-dependent
                     helicase activity [Evidence IEA]; GO_function: GO:0003723
                     - RNA binding [Evidence IEA]; GO_function: GO:0008186 -
                     RNA-dependent ATPase activity [Evidence IDA] [PMID
                     18975973]; GO_function: GO:0008186 - RNA-dependent ATPase
                     activity [Evidence IDA] [PMID 23153376]; GO_function:
                     GO:0004386 - helicase activity [Evidence IEA,IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006200 - ATP
                     catabolic process [Evidence IEA]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IMP] [PMID 16209945];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="RNA-dependent ATPase HCA4"
                     /protein_id="XP_018736355.1"
                     /db_xref="GeneID:30037003"
                     /translation="MSSNGHGKRDTNGSKHSVNGKKNAHNKNGGGANNNKSKHVKRQS
                     ENAHIAALETQIKEWDPAEHPNLTKFEQLPLSRATLQGLRSSHFVDMTDIQRQSLMAS
                     LKGEDILGAARTGSGKTLAFLIPVLERLYRQKWNQQDGLGALIISPTRELAIQIFQVL
                     RKIGRAHSLSAGLVIGGKDVQVESERLARLNILIGTPGRLLQHLDQTAGFDVSNLQML
                     VLDEADRILDMGFKKSLDAIIDNLPTTRQTLLFSATQTKTVSDLARLSLSDPRYISVH
                     EEDQTATPKGLEQFYIVSPLDEKLDNMYAFIKSHIKTKMLIFFSSSKQVRFAYESFRK
                     LQPGIPLLHLHGKQKQQARIDVTQKFSSAQYSCLFATDIVARGIDFPAVDWVIQVDAP
                     EDAATYIHRVGRSARFDKKGRALLFVTPSEEKGMISALESRKVPISKLTIREAKKKSI
                     RQDLQALCFQDPELKYLGQKAFISYVRSVYIQKNKDIFNFESLPLEKFAESLGLPGAP
                     NIKIKGGERSKEAKNAPRQLLKLTKEPGSDDEQEGEDKKKEPEKVRTKYDRMFERKNQ
                     NVLSEHYLNLTKTAGDEDDGDDFIAVKRQDHIIDDEEIPNLLEIPTSKRAQKRALSKK
                     LSTKSKGNATKLVFDDEGNAHAIYELEDEEDFKKAGDAAVQKAEFVARESAAMQEKDI
                     EDKQVARDKRVEKKRRRQEIERRALEAEQDESDDGEGGYQVTLGGADDESDYDHNQEP
                     DIDRDYESSDNDEPAAKKPKWFQKDKDSAPVRNGVLEVEEPDTLEDLEALSARLIRGR
                     "
     gene            <671459..>672370
                     /gene="TPP1"
                     /locus_tag="AWJ20_4830"
                     /db_xref="GeneID:30037005"
     mRNA            <671459..>672370
                     /gene="TPP1"
                     /locus_tag="AWJ20_4830"
                     /product="Tpp1p"
                     /transcript_id="XM_018881927.1"
                     /db_xref="GeneID:30037005"
     CDS             671459..672370
                     /gene="TPP1"
                     /locus_tag="AWJ20_4830"
                     /inference="similar to AA sequence:KEGG_Orthology:K08073"
                     /note="DNA 3'-phosphatase; functions in repair of
                     endogenous damage of double-stranded DNA, activity is
                     specific for removal of 3' phosphates at strand breaks;
                     similar to the l-2-haloacid dehalogenase superfamily;
                     homolog of human polynucleotide kinase/3'-phosphatase;
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IC] [PMID
                     11278831]; GO_component: GO:0005634 - nucleus [Evidence
                     IC] [PMID 15222769]; GO_function: GO:0003690 -
                     double-stranded DNA binding [Evidence IDA] [PMID
                     15222769]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0046403 - polynucleotide
                     3'-phosphatase activity [Evidence IEA]; GO_function:
                     GO:0046403 - polynucleotide 3'-phosphatase activity
                     [Evidence IDA] [PMID 11278831]; GO_function: GO:0046403 -
                     polynucleotide 3'-phosphatase activity [Evidence IMP]
                     [PMID 15222769]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA]; GO_process: GO:0006974 - cellular response
                     to DNA damage stimulus [Evidence IEA]; GO_process:
                     GO:0006302 - double-strand break repair [Evidence IGI,IMP]
                     [PMID 11585902]; GO_process: GO:0098506 - polynucleotide
                     3' dephosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="Tpp1p"
                     /protein_id="XP_018736356.1"
                     /db_xref="GeneID:30037005"
                     /translation="MGPKRKAVGTAASFFQSKKLAVAKPTSIVSTSGNDERNVDEDVV
                     LMPGLRWTLNGTLVRAVYTPTNTEEQKGSVPEEEREQTSIPPSHTESETKNAGASSPK
                     RLAIAAFDLDSTLVTTKGRSPFPRDGSDWKWLDTSVRDKLQKLVNRTVVKNGKSENEE
                     FSVNQGADVSTQDASMVDPSTEYVLAIISNQGGVVAENDKKRYLYLKDRVKSIVKDLD
                     TVPLRFYAATKPKKGASDKYRKPLTGMWEALQADLAPVYSVDIEKSFFVGDAAGRRSD
                     FSDSDLKFAQAVGLRFFTPEKFFGLSD"
     gene            complement(<672801..>673370)
                     /gene="RPL9B"
                     /locus_tag="AWJ20_4831"
                     /db_xref="GeneID:30037006"
     mRNA            complement(<672801..>673370)
                     /gene="RPL9B"
                     /locus_tag="AWJ20_4831"
                     /product="ribosomal 60S subunit protein L9B"
                     /transcript_id="XM_018881928.1"
                     /db_xref="GeneID:30037006"
     CDS             complement(672801..673370)
                     /gene="RPL9B"
                     /locus_tag="AWJ20_4831"
                     /inference="similar to AA sequence:KEGG_Orthology:K02940"
                     /note="Ribosomal 60S subunit protein L9B; homologous to
                     mammalian ribosomal protein L9 and bacterial L6; RPL9B has
                     a paralog, RPL9A, that arose from a single-locus
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0022625 - cytosolic
                     large ribosomal subunit [Evidence IDA] [PMID 18782943];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0005840 - ribosome
                     [Evidence IEA,IEA]; GO_function: GO:0019843 - rRNA binding
                     [Evidence IEA]; GO_function: GO:0003735 - structural
                     constituent of ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IDA] [PMID 18782943]; GO_process: GO:0002181 - cytoplasmic
                     translation [Evidence IDA] [PMID 18782943]; GO_process:
                     GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L9B"
                     /protein_id="XP_018736357.1"
                     /db_xref="GeneID:30037006"
                     /translation="MKFIQTDQVLEVPEGVTVDIKSRIVTVTGPRGTLVKNLRHADVT
                     FTKVNDKQIRLTVHHGDRKHVATLRTVKSLVANLITGVTKGYKYKMRYVYAHFPINVN
                     LLEDGKVVEIRNFLGEKRVRTIHVLEGVTVSISSAQKDELILEGNSLENVSQSAADIQ
                     QICRVRNKDIRKFLDGIYVSERGLIEEDA"
     gene            <673083..>673424
                     /locus_tag="AWJ20_4832"
                     /db_xref="GeneID:30037007"
     mRNA            <673083..>673424
                     /locus_tag="AWJ20_4832"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881929.1"
                     /db_xref="GeneID:30037007"
     CDS             673083..673424
                     /locus_tag="AWJ20_4832"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736358.1"
                     /db_xref="GeneID:30037007"
                     /translation="MGIDVSHLVLVTLGDTSDQVGDEGLNSTEGSNVLSVTVVDSKTD
                     LLVVDLGEGNISVTEVLDKSTTGTSNGDDSGLDVDSDALRDFKDLIGLNELHFCAVMG
                     TMSILRRSLNA"
     gene            <674426..>675199
                     /locus_tag="AWJ20_4833"
                     /db_xref="GeneID:30037008"
     mRNA            <674426..>675199
                     /locus_tag="AWJ20_4833"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881930.1"
                     /db_xref="GeneID:30037008"
     CDS             674426..675199
                     /locus_tag="AWJ20_4833"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736359.1"
                     /db_xref="GeneID:30037008"
                     /translation="MLSRSVLAQARTIGSSRIAGRRTGAMASTILQRGLKFQSKQYNP
                     SPGFSVFSEELEQEIRHKLTSLPSSNKVFQNADGTARNPSDEELKVVAELGVLAQGDR
                     ATFLDRFRLSQEQRELLAENSYLLDDYVNNGKRILDKIPVEDPTTGEITWTVIRENQK
                     EGWENLIYYGYVPALLISLFFALFLDKENISDWAMEELRLRAQERYNSGMEEINNSEL
                     SAEERKKQDALIVERIISGDYDRLAGLRKAGSDLPASLL"
     gene            complement(<675471..>677702)
                     /locus_tag="AWJ20_4834"
                     /db_xref="GeneID:30037009"
     mRNA            complement(<675471..>677702)
                     /locus_tag="AWJ20_4834"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881931.1"
                     /db_xref="GeneID:30037009"
     CDS             complement(675471..677702)
                     /locus_tag="AWJ20_4834"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736360.1"
                     /db_xref="GeneID:30037009"
                     /translation="MDRQAGFLGKNERGEGTRPEIEHNTVNASSNVHKASPRNPLDSF
                     DNDISGGPFASSSNYSTTAHPNTTISPQTPPASELETLPTPLPSGDVYHDKGEHSRVT
                     NIDMSASEEASRSATVNSGSVEIKELTEDEDIDDESEEEIGEDDEEYVDIDSSPTKRK
                     SSQRRRSRGSHKVNDGSRPSSPTPSGGRNAVAPKPEPDSGNPLSGLGQSLPRSGPSVP
                     QALPMNWRNPPPEPAGASEFVSLTEQDIETLPESSLRPTLQRATKTIQEYRAALRKYE
                     SLIAHYKLQNKLLTIETHEAAQRHEVETSIAKREVDRLRIETMAAAKAAQNAAAAKAA
                     APSSEIIDDLQSALESYKRRLRKTRTKLQIATDQLEDKDEEIERLRRGLSDMATSFSR
                     ESGPSVTVPTSGPPSHGPVVGPLPGMSSGPPINSPVSMAPGGPVYYANTPGPSQQPPI
                     GPMSPSQNLRTPFTHLPPRQHQRDSSSASDDSGQGLSALEMLASQVLSQQRIPPSPLR
                     RQPQQHENIQQQQLQQQQQQSQQPLLPLPTPSRQRSQGLMSPLEFNEASSVPSLHAVQ
                     AMSPEKRRRESSASTITIPTDGEDEGDEHDVNGTDEEVEDDDDDDYKESAGRDESTAV
                     RRSGRLSREGKRRSGGSAQVFTTGAETDVEESDDSKDDSDIDNGRQGGMRSSRGTRSQ
                     RQNSRQRVPVSSESPNRRSSPGSPKKYIRKERNDTQSSSKPSASSSSSKRMPVGRILD
                     FGN"
     gene            <682334..>683296
                     /gene="GET3"
                     /locus_tag="AWJ20_4835"
                     /db_xref="GeneID:30037010"
     mRNA            <682334..>683296
                     /gene="GET3"
                     /locus_tag="AWJ20_4835"
                     /product="guanine nucleotide exchange factor GET3"
                     /transcript_id="XM_018881932.1"
                     /db_xref="GeneID:30037010"
     CDS             682334..683296
                     /gene="GET3"
                     /locus_tag="AWJ20_4835"
                     /inference="similar to AA sequence:KEGG_Orthology:K01551"
                     /note="Guanine nucleotide exchange factor for Gpa1p;
                     amplifies G protein signaling; subunit of the GET complex,
                     which is involved in Golgi to ER trafficking and insertion
                     of proteins into the ER membrane; has low-level ATPase
                     activity; protein abundance increases in response to DNA
                     replication stress; GO_component: GO:0043529 - GET complex
                     [Evidence IEA]; GO_component: GO:0043529 - GET complex
                     [Evidence IPI] [PMID 16269340]; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA,IEA]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IEA]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IDA] [PMID 12680698];
                     GO_function: GO:0005085 - guanyl-nucleotide exchange
                     factor activity [Evidence IDA] [PMID 18261907];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006200 - ATP
                     catabolic process [Evidence IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0000750 -
                     pheromone-dependent signal transduction involved in
                     conjugation with cellular fusion [Evidence IMP] [PMID
                     18261907]; GO_process: GO:0006620 - posttranslational
                     protein targeting to membrane [Evidence IDA] [PMID
                     20850366]; GO_process: GO:0045048 - protein insertion into
                     ER membrane [Evidence IEA]; GO_process: GO:0045048 -
                     protein insertion into ER membrane [Evidence IMP] [PMID
                     18724936]; GO_process: GO:0046685 - response to
                     arsenic-containing substance [Evidence IEA]; GO_process:
                     GO:0009408 - response to heat [Evidence IMP] [PMID
                     12680698]; GO_process: GO:0010038 - response to metal ion
                     [Evidence IMP] [PMID 12680698]; GO_process: GO:0006890 -
                     retrograde vesicle-mediated transport, Golgi to ER
                     [Evidence IDA,IGI,IMP] [PMID 16269340]; GO_process:
                     GO:0006810 - transport [Evidence IEA]; GO_process:
                     GO:0016192 - vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor GET3"
                     /protein_id="XP_018736361.1"
                     /db_xref="GeneID:30037010"
                     /translation="MSEELNLEPSLQNIIDQKSLRWIFVGGKGGVGKTTTSCSLALQL
                     AKNRENVLLISTDPAHNLSDAFGQKFGKDARPVNGVPNLHAMEIDPNGSIQEFLDQPQ
                     NQAASSMMQDIAFSIPGVDEALSFAEVLKQVKAQSYSVIVFDTAPTGHTLRFLQFPTI
                     LEKALGKISEISGRFGPMLNSLMGASGTNTEDMLAKLESTRETIAEVNKQFQNPDLTT
                     FVCVCIAEFLSLYETERMVQELTSYGIDTHCIVVNQLLFPKTTSECEQCNARYKMQQK
                     YLEQILELYEDFHIVQLPQLTSEVRGLESLQTFSEKLIHPYVPN"
     gene            complement(<683565..>685508)
                     /locus_tag="AWJ20_4836"
                     /db_xref="GeneID:30037011"
     mRNA            complement(<683565..>685508)
                     /locus_tag="AWJ20_4836"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881933.1"
                     /db_xref="GeneID:30037011"
     CDS             complement(683565..685508)
                     /locus_tag="AWJ20_4836"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736362.1"
                     /db_xref="GeneID:30037011"
                     /translation="MVNGTTKISNETVELSSLPSVKQKGEVWLTLGGPKDGDDVKLLL
                     RWVPMVITFSTGETGDGHINVREELIKDLEPFDIKLSSELHQLTKFYMKPTSNSSKLL
                     TALVKCIPIVTFEFSKALKKACEVLSGDDSMETDFYKNFPNAEQYIPDPAMAPNSDRM
                     KLFENKVFIFPQTKERDALLGAITSGGGKAYVYEMTSAHEPPSRIKDFVLSKVKNIDN
                     LVLVGYHTSERSNQEDIDKLLVLNNAAKMIGTRLFAASDFLTVILEADASKLNLRRPD
                     EDGAPVSFTEQPKRLGTASFLETSIRVEAERKPGPIRRRKPQTKQLNIMDLMATTKRE
                     PDMPVLAPNQADSLSMNKVADSMAIDAKDGAVETADSQATAKEPDTHGETRSPSRRKR
                     RERINDDIITQTSTFPPDVTQNAREYKRRKLDLQQASDNKSSNVDDDMFAESVPALIE
                     DEDNNPDEDSSEPKDGHVGVIKKWSGDLDDDSEDSDDDLAGFENLAIVEATLEFRQHL
                     PKPKAPTVKSKRPNFKGFRMKEPRKPPSMKVDYMEAAPTDMLLEQDMSMFANKERYTK
                     RKLPPVESLQNSSRSKRRKETKTQAAENMFVNSDDSLSEDESEVGMNNYSSAISNESR
                     PVHSMDDYDEDDEDELSFRFSKN"
     gene            complement(<686796..>688427)
                     /gene="VPS35"
                     /locus_tag="AWJ20_4837"
                     /db_xref="GeneID:30037012"
     mRNA            complement(<686796..>688427)
                     /gene="VPS35"
                     /locus_tag="AWJ20_4837"
                     /product="Vps35p"
                     /transcript_id="XM_018881934.1"
                     /db_xref="GeneID:30037012"
     CDS             complement(686796..688427)
                     /gene="VPS35"
                     /locus_tag="AWJ20_4837"
                     /inference="similar to AA sequence:KEGG_Orthology:K18468"
                     /note="Endosomal subunit of membrane-associated retromer
                     complex; required for retrograde transport; receptor that
                     recognizes retrieval signals on cargo proteins, forms
                     subcomplex with Vps26p and Vps29p that selects cargo
                     proteins for retrieval; interacts with Ypt7p;
                     GO_component: GO:0005768 - endosome [Evidence IPI] [PMID
                     9700157]; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 22593205]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_component:
                     GO:0030904 - retromer complex [Evidence IEA];
                     GO_component: GO:0030904 - retromer complex [Evidence
                     IMP,IPI] [PMID 9700157]; GO_component: GO:0030906 -
                     retromer complex, inner shell [Evidence IPI] [PMID
                     9700157]; GO_function: GO:0008565 - protein transporter
                     activity [Evidence IMP,IPI] [PMID 9700157]; GO_process:
                     GO:0045053 - protein retention in Golgi apparatus
                     [Evidence IMP] [PMID 8649377]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA,IEA]; GO_process:
                     GO:0042147 - retrograde transport, endosome to Golgi
                     [Evidence IEA]; GO_process: GO:0042147 - retrograde
                     transport, endosome to Golgi [Evidence IPI] [PMID
                     9700157]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Vps35p"
                     /protein_id="XP_018736363.1"
                     /db_xref="GeneID:30037012"
                     /translation="MKELEQDDDGDVTKKLGDVTIGDSQESKPVGDNQTESETGDDKP
                     KATSEDESEGKDNGSGENLFEKFWSHFNSLVQAHPDLPLPDKTALLLGIAKLSLNWYP
                     DRKDYIDRILQYVATIQQQLHADKEAAVNVQELLLSLINFYPDFLTVLSIPGYQPLLS
                     SQPISTQQAIAGSVINAVLKQSKKITELDDVKGVFELVSIVIKDGTASAGHSTEFPPG
                     GTSTKKQTASTPDISNDSEEIVADQSKLAQLVHLVYNKNPDVHAKLLAAAKKALSDGG
                     MRIKYTYPAVVTSAFKLVRRYQRRKSDSEKAAKIGSSFKFIHRLIDELYNSGRSELAL
                     RLYVNVASLADQVNAEEASYEFFAEAFTVYEESVSDSRAQFQALCIIAGALQSTRNFT
                     ADNYDTLVSKCALHASKLLKKPDQCRAVYLASHLWWAVEIPGRTEEELFRDDKRVLEC
                     LQRSLRVADACMDVAVSVELFVEILNRYIYYFDHGNSAVTVRYINGLINLIQTNLNNN
                     ADEKISDSPRKHFERTLEYITQQKSVDDKFQEIVW"
     gene            complement(<688514..>689552)
                     /gene="VPS35"
                     /locus_tag="AWJ20_4838"
                     /db_xref="GeneID:30037013"
     mRNA            complement(join(<688514..688525,688614..>689552))
                     /gene="VPS35"
                     /locus_tag="AWJ20_4838"
                     /product="Vps35p"
                     /transcript_id="XM_018881935.1"
                     /db_xref="GeneID:30037013"
     CDS             complement(join(688514..688525,688614..689552))
                     /gene="VPS35"
                     /locus_tag="AWJ20_4838"
                     /inference="similar to AA sequence:KEGG_Orthology:K18468"
                     /note="Endosomal subunit of membrane-associated retromer
                     complex; required for retrograde transport; receptor that
                     recognizes retrieval signals on cargo proteins, forms
                     subcomplex with Vps26p and Vps29p that selects cargo
                     proteins for retrieval; interacts with Ypt7p;
                     GO_component: GO:0005768 - endosome [Evidence IPI] [PMID
                     9700157]; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 22593205]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_component:
                     GO:0030904 - retromer complex [Evidence IEA];
                     GO_component: GO:0030904 - retromer complex [Evidence
                     IMP,IPI] [PMID 9700157]; GO_component: GO:0030906 -
                     retromer complex, inner shell [Evidence IPI] [PMID
                     9700157]; GO_function: GO:0008565 - protein transporter
                     activity [Evidence IMP,IPI] [PMID 9700157]; GO_process:
                     GO:0045053 - protein retention in Golgi apparatus
                     [Evidence IMP] [PMID 8649377]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA,IEA]; GO_process:
                     GO:0042147 - retrograde transport, endosome to Golgi
                     [Evidence IEA]; GO_process: GO:0042147 - retrograde
                     transport, endosome to Golgi [Evidence IPI] [PMID
                     9700157]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Vps35p"
                     /protein_id="XP_018736364.1"
                     /db_xref="GeneID:30037013"
                     /translation="MSSNPPAPLSPEEQARHLEESLQFIRQQEHQMRKCLETKGKLLD
                     AIRHASTFLAELRSSVLTPKQYYELYIAVFDALRHLGDFLREDHPNHHLADIYELVQY
                     AGNIVPRLYLMITVGTAYMSVPDAPVREIMKDMMEMCRGVQHPIRGLFLRYYLSQGTR
                     DYLPSGEDVNGTNGGVITAAVATTSSDDSAAGPGETKNVADTRSNTSNGNGSETTITG
                     PGSASAVTSAPVIDPELRGNLKDSIQFIITNFIEMNKLWVRLQHQGHSREREKRTKER
                     QELQILVGSNLVRLSQLEGIDKEYYKESILPAILEQVTST"
     gene            complement(<692048..>694123)
                     /locus_tag="AWJ20_4839"
                     /db_xref="GeneID:30037014"
     mRNA            complement(<692048..>694123)
                     /locus_tag="AWJ20_4839"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881936.1"
                     /db_xref="GeneID:30037014"
     CDS             complement(692048..694123)
                     /locus_tag="AWJ20_4839"
                     /inference="similar to AA sequence:KEGG_Orthology:K03351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736365.1"
                     /db_xref="GeneID:30037014"
                     /translation="MDILVFAPESGGIALYRISGQRIWSIPGKRGAGHVIRSSWRDDG
                     KVLAVLYSDGSYQVIRTSNGKPVLSSGSGDSAIDLSWAEGDITANSGDGSKSEWSSSF
                     KLMETDVLDSLPRLQALPTKPGLLIDVKSSENSISNFDDALSVVLTGDKSGSMNLSMF
                     GIFSIDGIPISNSNIKARDQSQHEPSAHFLKINSNPKDISRGTIIVQNDESKAFVYHK
                     FHLGFIQKFGQNYLTEVSVIPAQISILIEYLQESVALLRKEANTIVEANNKFISLESL
                     NHMRGYLFDFLITGTMCKKITKWIESNNEMGYKRWNKTTITSYDVSNKILYENILPAI
                     ERLVVLLSRLRGLAKWKERGVPLGLSGEELDKTIRYAECFFKLTNKCLWEFTDEYEKF
                     RSFALWLELGFESVLDRVVGFSRADEPATVRTTDIMKYITELLPGSVLTSYLTTSTVG
                     VGDEKIDLKQKSDTVNSDSQPLEDHDVSVSQGATSKSTGDASLDSIENLSLANCLENI
                     DSTFSATTTKIESAMKKLISVDVGIPLASSDFNVRQAYFRGTSFVLIYGQDAFLYMVR
                     IHDSGIEVAKIKCENTIIQAEFINESEIILLVVDSDSRYHLQVANYESVAYTALDGKS
                     DLLNQTVATLTHNLDSVDLAPSNTHSFDKDFTPGSFVVNGRSGHELACVLNAERQRYA
                     LIYLHVEQA"
     gene            <694829..>696511
                     /gene="TMA64"
                     /locus_tag="AWJ20_4840"
                     /db_xref="GeneID:30037016"
     mRNA            <694829..>696511
                     /gene="TMA64"
                     /locus_tag="AWJ20_4840"
                     /product="Tma64p"
                     /transcript_id="XM_018881938.1"
                     /db_xref="GeneID:30037016"
     CDS             694829..696511
                     /gene="TMA64"
                     /locus_tag="AWJ20_4840"
                     /inference="similar to AA sequence:KEGG_Orthology:K15027"
                     /note="hypothetical protein that associates with
                     ribosomes; has a putative RNA binding domain; in mammals
                     the corresponding protein, eIF2D, has been shown to
                     possess translation initiation factor activity;
                     GO_component: GO:0005840 - ribosome [Evidence IDA] [PMID
                     16702403]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence ISS]
                     [PMID 10093218]; GO_function: GO:0003743 - translation
                     initiation factor activity [Evidence IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0006413 - translational initiation [Evidence IEA]"
                     /codon_start=1
                     /product="Tma64p"
                     /protein_id="XP_018736366.1"
                     /db_xref="GeneID:30037016"
                     /translation="MQVHSGEKAVLYTDNDGQPVWIALEDGYLIPTLYTAWNAPFLMQ
                     RVCTVKYTLERLQSGADLMIPGIFDPLPENVPPGTVVSISLIDSPNIAVAVGIALVDC
                     SRGKLDTNQKGKAVQLINVIDDKLFQLYRKKVPVPIELDVSVPLLETQDTPGDAENDP
                     VTDKSKISAEGQDSIVNHTAESNVIENVNNGSSKETSQVEEITDTTENINLGENQPET
                     ETDGPENDTNSPSTAEIDDAFRRALLQTLRKAVDSPIEVPIPSSTFLSNYVLLNLPYN
                     HPSVQMKKTSWKKASKFFKVMEKQSLLKGKERGGEFVITSLAGKNNTEVSSFTLFKPR
                     PFEQHKPAASGSGTTSSNKKTYLSAKEYFKPRSMTAPIFEFSKLDPSKYYTADTIRQT
                     LNNYITGNSLSDPKNPKNVKLDRPLTKALGLSPTIESIGRDKISSLLQSNCSQFHHIT
                     SQNDEDLNRQTATTLAKGPIPRITITTEKRAGRKVVTNVTNIEPFHLDPIAFAEELRV
                     ACAGSTSVNAIKEGSDLQQVMIQGHHVAAITKTLELKGIRPAWIDVVDKARR"
     gene            complement(<696676..>698139)
                     /gene="GPI17"
                     /locus_tag="AWJ20_4841"
                     /db_xref="GeneID:30037017"
     mRNA            complement(<696676..>698139)
                     /gene="GPI17"
                     /locus_tag="AWJ20_4841"
                     /product="Gpi17p"
                     /transcript_id="XM_018881939.1"
                     /db_xref="GeneID:30037017"
     CDS             complement(696676..698139)
                     /gene="GPI17"
                     /locus_tag="AWJ20_4841"
                     /inference="similar to AA sequence:KEGG_Orthology:K05291"
                     /note="Transmembrane protein; subunit of the
                     glycosylphosphatidylinositol transamidase complex that
                     adds GPIs to newly synthesized proteins; human PIG-S
                     homolog; GO_component: GO:0042765 - GPI-anchor
                     transamidase complex [Evidence IEA]; GO_component:
                     GO:0042765 - GPI-anchor transamidase complex [Evidence
                     IDA] [PMID 15939668]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IDA] [PMID
                     15075373]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IDA] [PMID 15939668]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0003923 - GPI-anchor transamidase activity [Evidence
                     IMP,ISS] [PMID 11483512]; GO_process: GO:0006506 - GPI
                     anchor biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0016255 - attachment of GPI anchor to
                     protein [Evidence IEA]; GO_process: GO:0016255 -
                     attachment of GPI anchor to protein [Evidence IMP,ISS]
                     [PMID 11483512]"
                     /codon_start=1
                     /product="Gpi17p"
                     /protein_id="XP_018736367.1"
                     /db_xref="GeneID:30037017"
                     /translation="MASEEAIGNIRRRRWIVLSYLLLGGLIGLPIWIWTTSIWRAPLS
                     YEEMDMYDHNIQDLINVKIPVYLNVGTEFPDLVKSTQLVVNRKLEDRGIKQWNLEILS
                     GRGDANSYNVAFRLGEDDEYIISEVSRDVLITYSIDSVSLGVVPELVSIILVDHLFAD
                     ELSLLEDAIGQKKQGLDNSDSSDKIVSYSPNYHLTFSLFYGGGDKISWDISQALDEHF
                     AHLKESYARISNLTIDTQVQYYSDLGCNIHHDEENNQWLLDHNDLSTFVNFAEWSLTS
                     IHSYPTLHFILYIPSPKQSPMIIVDSNTNSFSIPQWGGVQIWNKPEASKSHLTVSDLL
                     PILETFSSQFLGLVGAPVHPKSPVIRLDFLSRLSTIRALISASHTLGSLHRLSQSLPD
                     IAIPQPVLYAVKSALLAIQGSLYSLSTGQFTQAIKLAGDALRQSENAFFEKEMVQQAF
                     FPEEHKVAIYLPLLGPIGIVLLMGTLRCFKEFKTHGW"
     gene            <698456..>699388
                     /gene="MRPL1"
                     /locus_tag="AWJ20_4842"
                     /db_xref="GeneID:30037018"
     mRNA            <698456..>699388
                     /gene="MRPL1"
                     /locus_tag="AWJ20_4842"
                     /product="mitochondrial 54S ribosomal protein MRPL1"
                     /transcript_id="XM_018881940.1"
                     /db_xref="GeneID:30037018"
     CDS             698456..699388
                     /gene="MRPL1"
                     /locus_tag="AWJ20_4842"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; GO_component: GO:0015934 - large ribosomal
                     subunit [Evidence IEA]; GO_component: GO:0005762 -
                     mitochondrial large ribosomal subunit [Evidence IPI] [PMID
                     12392552]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0005840 - ribosome
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0003735 - structural
                     constituent of ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IPI] [PMID 12392552]; GO_process: GO:0032543 -
                     mitochondrial translation [Evidence IC] [PMID 12392552];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRPL1"
                     /protein_id="XP_018736368.1"
                     /db_xref="GeneID:30037018"
                     /translation="MSLARSLLLRSGNAATTTAGLISVSSRPLLQLINPPQPRYGSKK
                     KRDEKKAAKSDGAPSKADAKQLAHQREKVLLRLRQKREETKKATKLRVEAKNASKSSN
                     FMDIETALRYLRAAEVGRSAHATTISLTMRIVAEKGAVPVNTKCRLPKPLDEERIAVF
                     TNSSELAAEARRAGAVLVGGDDIIDQVKQGIINFDKAYATPDIVSRLNQVARILGPKG
                     LMPNAKRGTVTHDIYNALVQASGEMTFKQEGTMLSLPVGRASFTDLEIVSNIVTVTDA
                     IRKFMTDSSAHNKKAYIGKTVITSTTGPSIVVEV"
     gene            <703912..>704730
                     /locus_tag="AWJ20_4843"
                     /db_xref="GeneID:30037019"
     mRNA            <703912..>704730
                     /locus_tag="AWJ20_4843"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881941.1"
                     /db_xref="GeneID:30037019"
     CDS             703912..704730
                     /locus_tag="AWJ20_4843"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736369.1"
                     /db_xref="GeneID:30037019"
                     /translation="MSKETAEYTHGHHESVLRSHTWRTVDNSVKFLVPYLKPDSYVLD
                     VGCGPGTITVDMAKNYTPKGKIIGMEYAGSVLEQAAAHAKENNVTNIEFAVGDVHNLS
                     YPDNTFDIVFAHQVVQHIGNPVVALKEMARVVKPGGVVAIRDSDYAGFFWYPELPALK
                     KWQEVYLKVAKANGAEPNAGRHYHSWAHQAGLDQPKLKLSSSTWFYWTPEERAWWSSL
                     WADRTLKSNFATTVLKHDLGTQDDLEEIAQGWRDWGKDKDAIFNLAHVELIYQK"
     gene            <705691..>707355
                     /gene="PGM2"
                     /locus_tag="AWJ20_4844"
                     /db_xref="GeneID:30037020"
     mRNA            <705691..>707355
                     /gene="PGM2"
                     /locus_tag="AWJ20_4844"
                     /product="phosphoglucomutase PGM2"
                     /transcript_id="XM_018881942.1"
                     /db_xref="GeneID:30037020"
     CDS             705691..707355
                     /gene="PGM2"
                     /locus_tag="AWJ20_4844"
                     /inference="similar to AA sequence:KEGG_Orthology:K01835"
                     /note="Phosphoglucomutase; catalyzes the conversion from
                     glucose-1-phosphate to glucose-6-phosphate, which is a key
                     step in hexose metabolism; functions as the acceptor for a
                     Glc-phosphotransferase; protein abundance increases in
                     response to DNA replication stress; PGM2 has a paralog,
                     PGM1, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     8385141]; GO_component: GO:0005829 - cytosol [Evidence
                     IBA]; GO_function: GO:0016868 - intramolecular transferase
                     activity, phosphotransferases [Evidence IEA]; GO_function:
                     GO:0016853 - isomerase activity [Evidence IEA];
                     GO_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0004614 -
                     phosphoglucomutase activity [Evidence IEA]; GO_function:
                     GO:0004614 - phosphoglucomutase activity [Evidence IMP]
                     [PMID 13887540]; GO_function: GO:0004614 -
                     phosphoglucomutase activity [Evidence IMP] [PMID 2138705];
                     GO_function: GO:0004614 - phosphoglucomutase activity
                     [Evidence IGI,IMP,ISS] [PMID 8119301]; GO_process:
                     GO:0006011 - UDP-glucose metabolic process [Evidence IGI]
                     [PMID 9252577]; GO_process: GO:0005975 - carbohydrate
                     metabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0006874 - cellular calcium ion homeostasis [Evidence
                     IMP] [PMID 10681519]; GO_process: GO:0006874 - cellular
                     calcium ion homeostasis [Evidence IGI,IMP] [PMID
                     15252028]; GO_process: GO:0030003 - cellular cation
                     homeostasis [Evidence IMP] [PMID 15164360]; GO_process:
                     GO:0019388 - galactose catabolic process [Evidence IMP]
                     [PMID 13887540]; GO_process: GO:0019388 - galactose
                     catabolic process [Evidence IMP] [PMID 14264884];
                     GO_process: GO:0019388 - galactose catabolic process
                     [Evidence IGI,IMP] [PMID 8119301]; GO_process: GO:0019255
                     - glucose 1-phosphate metabolic process [Evidence IMP]
                     [PMID 10681519]; GO_process: GO:0019255 - glucose
                     1-phosphate metabolic process [Evidence IGI,IMP,ISS] [PMID
                     8119301]; GO_process: GO:0051156 - glucose 6-phosphate
                     metabolic process [Evidence ISS] [PMID 8119301];
                     GO_process: GO:0006006 - glucose metabolic process
                     [Evidence IEA]; GO_process: GO:0005978 - glycogen
                     biosynthetic process [Evidence IGI] [PMID 9252577];
                     GO_process: GO:0005992 - trehalose biosynthetic process
                     [Evidence IGI] [PMID 9252577]"
                     /codon_start=1
                     /product="phosphoglucomutase PGM2"
                     /protein_id="XP_018736370.1"
                     /db_xref="GeneID:30037020"
                     /translation="MTVVSTKAFEGQKPGTSGLRKKVTVFQQPHYTENFVQAILSSIP
                     EGSEGATLVVGGDGRFYNKEVIQIISEISAANGVKKLIIGQNGLLSTPAASHVIRKRK
                     ATGGIILTASHNPGGPTNDFGIKYNLANGGPAPESVTDKIYEVTKTISEYKTLKGADF
                     PQVNLSKIGAATYGPLEVEIIDTVEDYLLLVKEIFDFDLIKSFLKSNPDFTILFDALN
                     GITGPYGKAIFIDELGLAASSVQNAVPKTDFGGLHPDPNLTYAHTLVERVDKEKTPFG
                     AASDGDGDRNMIYGANSFVSPGDSVAIIAHHADKIPYFRNGGVNGLARSMPTSGAIDL
                     VAKAKGLKCYEVPTGWKFFTALFDSKQLSICGEESFGTGSDHIREKDGLWAIVAWLNI
                     IAGVAKEDPSKASIAAIQHDFWNTYGRTFFTRYDYENVSSEGAAKVVANLKSQIESPS
                     FVGSKVDNLEVTEAGDFSYTDLDGSVSKNQGLYVKFKGGSRIVVRLSGTGSSGATIRL
                     YIERHESDKSLFSQDAQDYLKETISSAVNFLKLKEFVNREEPDVRT"
     gene            complement(<707575..>709068)
                     /gene="YKU80"
                     /locus_tag="AWJ20_4845"
                     /db_xref="GeneID:30037021"
     mRNA            complement(<707575..>709068)
                     /gene="YKU80"
                     /locus_tag="AWJ20_4845"
                     /product="Yku80p"
                     /transcript_id="XM_018881943.1"
                     /db_xref="GeneID:30037021"
     CDS             complement(707575..709068)
                     /gene="YKU80"
                     /locus_tag="AWJ20_4845"
                     /inference="similar to AA sequence:KEGG_Orthology:K10885"
                     /note="Subunit of the telomeric Ku complex
                     (Yku70p-Yku80p); involved in telomere length maintenance,
                     structure and telomere position effect; required for
                     localization of telomerase ribonucleoprotein via
                     interaction with the TLC1 guide RNA; relocates to sites of
                     double-strand cleavage to promote nonhomologous end
                     joining during DSB repair; GO_component: GO:0043564 -
                     Ku70:Ku80 complex [Evidence IEA]; GO_component: GO:0043564
                     - Ku70:Ku80 complex [Evidence IDA] [PMID 8754818];
                     GO_component: GO:0005694 - chromosome [Evidence IEA];
                     GO_component: GO:0000781 - chromosome, telomeric region
                     [Evidence IEA,IEA]; GO_component: GO:0000790 - nuclear
                     chromatin [Evidence TAS] [PMID 10367891]; GO_component:
                     GO:0005724 - nuclear telomeric heterochromatin [Evidence
                     TAS] [PMID 12080091]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA,IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0004003 -
                     ATP-dependent DNA helicase activity [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IDA] [PMID
                     16166630]; GO_function: GO:0003723 - RNA binding [Evidence
                     IDA] [PMID 12975323]; GO_function: GO:0003684 - damaged
                     DNA binding [Evidence IEA]; GO_function: GO:0003684 -
                     damaged DNA binding [Evidence TAS] [PMID 10367891];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0042162 -
                     telomeric DNA binding [Evidence IEA]; GO_function:
                     GO:0042162 - telomeric DNA binding [Evidence IDA] [PMID
                     17656141]; GO_process: GO:0032508 - DNA duplex unwinding
                     [Evidence IEA]; GO_process: GO:0006310 - DNA recombination
                     [Evidence IEA,IEA]; GO_process: GO:0006281 - DNA repair
                     [Evidence IEA]; GO_process: GO:0006974 - cellular response
                     to DNA damage stimulus [Evidence IEA]; GO_process:
                     GO:0006333 - chromatin assembly or disassembly [Evidence
                     IDA] [PMID 11553718]; GO_process: GO:0006342 - chromatin
                     silencing [Evidence IDA,IMP] [PMID 9501103]; GO_process:
                     GO:0007535 - donor selection [Evidence IDA,IMP] [PMID
                     16166630]; GO_process: GO:0007535 - donor selection
                     [Evidence IGI,IMP] [PMID 16809780]; GO_process: GO:0000724
                     - double-strand break repair via homologous recombination
                     [Evidence IMP] [PMID 11016833]; GO_process: GO:0006303 -
                     double-strand break repair via nonhomologous end joining
                     [Evidence IEA]; GO_process: GO:0034502 - protein
                     localization to chromosome [Evidence IGI] [PMID 18716325];
                     GO_process: GO:0000723 - telomere maintenance [Evidence
                     IEA]; GO_process: GO:0000723 - telomere maintenance
                     [Evidence IMP] [PMID 10818099]"
                     /codon_start=1
                     /product="Yku80p"
                     /protein_id="XP_018736371.1"
                     /db_xref="GeneID:30037021"
                     /translation="MICLITNGTGEMDFKKVPDLVKRLKAANIVLRILMIGMKDSGDE
                     LTTFEKEIRQSNIEELQNIERDYYPPDSDGRPDDMYMFAPYEEAYFYVSKPVVQPVGV
                     LRQFKGVLRLGRPTEDSESVKHVIDEENTITIPVYGYPCTRRTRVPTAKSVIVKRKRP
                     DDDGGESEDDEFNDRKVTVHFVRDYYVEKVKDENGEGEQNPDNRIILERQNLLKGYRF
                     GSEIVTFDAETKKELSSIHLSNSPELSIYGFCSAKDVPRWYLMEASDYIVVSPEARKK
                     DQLAMSAMILTLQLDDRVAIARYVAKPEKDAHMVLLSPYVDVDFQALILNILPFSQDY
                     RKFQFPSLLEIKSKSGKILPPDNPQRINREPTTEMNDLMSHYIDEMDLEHAGEPDEDG
                     EPTEYMTCEDTFNPVLHRLRNAIKVAGLTGAKNFVPPVWPELVKYSHPPAGRLDQLKP
                     TTDRLSQLLDIKVVETKKSEKQKVKQEAEASKRVATDTDIKLEDLLS"
     gene            complement(<709547..>711244)
                     /gene="GAL7"
                     /locus_tag="AWJ20_4846"
                     /db_xref="GeneID:30037022"
     mRNA            complement(join(<709547..709550,709779..709792,
                     710159..>711244))
                     /gene="GAL7"
                     /locus_tag="AWJ20_4846"
                     /product="UDP-glucose:hexose-1-phosphate
                     uridylyltransferase"
                     /transcript_id="XM_018881944.1"
                     /db_xref="GeneID:30037022"
     CDS             complement(join(709547..709550,709779..709792,
                     710159..711244))
                     /gene="GAL7"
                     /locus_tag="AWJ20_4846"
                     /inference="similar to AA sequence:KEGG_Orthology:K00965"
                     /note="Galactose-1-phosphate uridyl transferase;
                     synthesizes glucose-1-phosphate and UDP-galactose from
                     UDP-D-glucose and alpha-D-galactose-1-phosphate in the
                     second step of galactose catabolism; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 10993714];
                     GO_function: GO:0008108 - UDP-glucose:hexose-1-phosphate
                     uridylyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0008108 - UDP-glucose:hexose-1-phosphate
                     uridylyltransferase activity [Evidence IMP] [PMID
                     14158615]; GO_function: GO:0008108 -
                     UDP-glucose:hexose-1-phosphate uridylyltransferase
                     activity [Evidence IDA] [PMID 387754]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0016779 - nucleotidyltransferase
                     activity [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0005975 - carbohydrate metabolic process [Evidence
                     IEA]; GO_process: GO:0033499 - galactose catabolic process
                     via UDP-galactose [Evidence IMP] [PMID 14158615];
                     GO_process: GO:0033499 - galactose catabolic process via
                     UDP-galactose [Evidence IDA] [PMID 387754]; GO_process:
                     GO:0006012 - galactose metabolic process [Evidence
                     IEA,IEA,IEA]"
                     /codon_start=1
                     /product="UDP-glucose:hexose-1-phosphate
                     uridylyltransferase"
                     /protein_id="XP_018736372.1"
                     /db_xref="GeneID:30037022"
                     /translation="MQWSEAHRRYNPLRKSWVLCSPHRTQRPWQGQQEKPQVEKRPEY
                     DEKCYLCPGNTRAQGQANPKYEETFVFVNDFSAVKPRDTLPQADGSSAEESEEDELFR
                     AEQATGKCVVICFNPRHDITLAQMTYPQVSGVINAWKKVYTDAVNNPEVRYCQIFENK
                     GAAMGCSNPHPHGQAWTTNIIPEEPDIEHACLAEYAHNHNGKGLLEDYVAKELAILAK
                     AESSGNHAQNRFVDVNDSFIAVIPFWATWPFEVLVVSRRKIGNITQLTEKEQTDFAHI
                     LRNVALRYDNLFQTSFPYSMGIHQSFAEPNIDPKSEPEHLHVHFYPPLLRSATVRKFL
                     VGFEMLGMPQRDVTPESAAAQLRAVDGNATVFV"
     gene            complement(<711932..>712681)
                     /gene="SLD5"
                     /locus_tag="AWJ20_4847"
                     /db_xref="GeneID:30037023"
     mRNA            complement(<711932..>712681)
                     /gene="SLD5"
                     /locus_tag="AWJ20_4847"
                     /product="Sld5p"
                     /transcript_id="XM_018881945.1"
                     /db_xref="GeneID:30037023"
     CDS             complement(711932..712681)
                     /gene="SLD5"
                     /locus_tag="AWJ20_4847"
                     /inference="similar to AA sequence:KEGG_Orthology:K10735"
                     /note="Subunit of the GINS complex (Sld5p, Psf1p, Psf2p,
                     Psf3p); complex is localized to DNA replication origins
                     and implicated in assembly of the DNA replication
                     machinery; GO_component: GO:0031261 - DNA replication
                     preinitiation complex [Evidence IGI,IMP] [PMID 12730134];
                     GO_component: GO:0000811 - GINS complex [Evidence IPI]
                     [PMID 12730134]; GO_component: GO:0000811 - GINS complex
                     [Evidence IPI] [PMID 12768207]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0031298 -
                     replication fork protection complex [Evidence IDA] [PMID
                     16531994]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006260 - DNA replication
                     [Evidence IEA]; GO_process: GO:0006261 - DNA-dependent DNA
                     replication [Evidence IMP] [PMID 12730134]; GO_process:
                     GO:0006261 - DNA-dependent DNA replication [Evidence IMP]
                     [PMID 12768207]; GO_process: GO:0000727 - double-strand
                     break repair via break-induced replication [Evidence IMP]
                     [PMID 20516198]"
                     /codon_start=1
                     /product="Sld5p"
                     /protein_id="XP_018736373.1"
                     /db_xref="GeneID:30037023"
                     /translation="MNDTTDIDDIINNLRDDDISNLHSGIEIQSSLDDSFQQTDLTDL
                     KKAWLAERMSPDILAFQTSLIDRLMDRIRIQAAYIEENSMADFHNSGDIKMKLLIVES
                     ELERIKFLVRGYLRTRLSKIDKYTIYIIQSGENQQEGNADQFDLRLLLSPQEIQYMER
                     HHRILLNLYNTQFLSALPAQLQRLDDSSGGISMVEEPDLDKPVFIRVLETVERPIRVG
                     LDEITLEKGNIYVLRYSAISKYLIGGEVELI"
     gene            <713518..>715242
                     /locus_tag="AWJ20_4848"
                     /db_xref="GeneID:30037024"
     mRNA            <713518..>715242
                     /locus_tag="AWJ20_4848"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881946.1"
                     /db_xref="GeneID:30037024"
     CDS             713518..715242
                     /locus_tag="AWJ20_4848"
                     /inference="similar to AA sequence:KEGG_Orthology:K10415"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736374.1"
                     /db_xref="GeneID:30037024"
                     /translation="MKDAGTDTSLDMVVTEVFEIAPKSTTISYNKEVQTSEDWASGTN
                     TKSASGIEDYDEFDYSVNMAQRKQLEDKIRTELEELYKKENEEVLKNNRTLSNDEPGL
                     NANGTPDVSRPTILSDKEASQISARQDFENFWSQSWKVINRAAEEDTNYNILRNYAES
                     QNSDAQQQSRNSLTEITHLYSKDSVGRAVTYIDWSPKFPELIAAAYTEKSSDPHATKG
                     LIQIFNLHAPNQPEYTLTAQSDILVVKFSPFDSNLIFGAAYNGQVLAWDLRSKGSRPL
                     LSSQLSGKAHTHPVYSLEIIGTQNAYTLITASTDGTVCTWTPDMLAKPQEKITLQTNS
                     SSLRNDEAAPTSLAIPTRDQAQFLIGTEEGAIYQCYRFGQAGSRPGIDHRKSYRGHTG
                     PVTSVDLHPSSGPVDFGNYLLSSGNDWSIKIWLVSLISSHGSNLSSTASSAPANRGEI
                     IRPILDIKRDDVVYDISWNPNHPSIFAAVDGTGHVEVWNLLTDTEVPVVRAKPSNIEK
                     NIVGSNYLKRPLNRVSWEKTSEARRLAVGGLNGSITILELDTTLIGSSPKPEHWAQLK
                     RLFEQLES"
     gene            complement(<715649..>717979)
                     /locus_tag="AWJ20_4849"
                     /db_xref="GeneID:30037025"
     mRNA            complement(<715649..>717979)
                     /locus_tag="AWJ20_4849"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881947.1"
                     /db_xref="GeneID:30037025"
     CDS             complement(715649..717979)
                     /locus_tag="AWJ20_4849"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736375.1"
                     /db_xref="GeneID:30037025"
                     /translation="MVKQPYRGVRPRPLKLNRIGRSAFDDIHLLGGIGHKWRIGGDSG
                     NPVNSGSKSGYSSDPESESSRSSWPYFNRSLFKVSSPTAALNMIPKWMKAVKLSVPSS
                     SRAYGWWHTSNWHPLLNHKPHASHSMPDPIFESVWSCKKPQVTYHEFKYHPRTGGKGR
                     SAIWLKYNISNESSLRNLREEEERYQKEQESTSNETDYDAIDLISLKKKVRTDESQNA
                     AYSVEPVDTINASETPLSTRGGGSRKAEMASGESSKSGGGLGSGDNSGGDGRGKKQPP
                     PVTLQSDPTAQLSKKQRKRARAAAAAAQASNNFTAKDIDETLEASTDELYQTGADVES
                     KPLSQLRKPIQVPTESMEQPEVSSWSSESVPVEPLANETVNNGVETDALSSDSINPIT
                     SSTVSDPLHDNSSASDRLSTGQVYDSTTLSESESNESPEISSKVDEDETSHVSTNGTT
                     GFPLHTASVDATENITLPTEPVSPVEHKSESTGGFDLHANAYPVDNEKNIHDTFSPLS
                     GPDSQPSGPHRIDTVTAGDLLEGLQLKGKYKDSTKDFERLLSLVETEKHDSEKRKSFT
                     NPVRITREGESPSDVENLFNEPKPISTFAPPLEMQDIHHLQDALKEAKADEEKHAQEM
                     FRIENAMDYTKSVSSKRPRSIESGNFFTPVNRTIASATHRKPGAAYEYIIVTPNQKFI
                     RTRTLPFKDDNPRRDLFSALSEMSDPALYVKTIAKLEKANWKCIGGGGPGRLLVFERE
                     YNPIKRFSKLLLKLTGSFLGLVSLAAAVAVMIESPF"
     gene            <719318..>720154
                     /gene="MUM2"
                     /locus_tag="AWJ20_4850"
                     /db_xref="GeneID:30037027"
     mRNA            <719318..>720154
                     /gene="MUM2"
                     /locus_tag="AWJ20_4850"
                     /product="Mum2p"
                     /transcript_id="XM_018881949.1"
                     /db_xref="GeneID:30037027"
     CDS             719318..720154
                     /gene="MUM2"
                     /locus_tag="AWJ20_4850"
                     /note="Protein essential for meiotic DNA replication and
                     sporulation; cytoplasmic protein; subunit of the MIS
                     complex which controls mRNA methylation during during the
                     induction of sporulation; also interacts with Orc2p, which
                     is a component of the origin recognition complex;
                     GO_component: GO:0036396 - MIS complex [Evidence IDA,IPI]
                     [PMID 22685417]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_function: GO:0005515 - protein
                     binding [Evidence IPI] [PMID 22685417]; GO_process:
                     GO:0080009 - mRNA methylation [Evidence IGI,IMP] [PMID
                     22685417]; GO_process: GO:0007126 - meiotic nuclear
                     division [Evidence IEA]; GO_process: GO:0007126 - meiotic
                     nuclear division [Evidence IMP] [PMID 22685417];
                     GO_process: GO:2000221 - negative regulation of
                     pseudohyphal growth [Evidence IMP] [PMID 22685417];
                     GO_process: GO:0006279 - premeiotic DNA replication
                     [Evidence IGI] [PMID 11238403]; GO_process: GO:0006279 -
                     premeiotic DNA replication [Evidence IMP] [PMID 9504908];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="Mum2p"
                     /protein_id="XP_018736376.1"
                     /db_xref="GeneID:30037027"
                     /translation="MNAQLSRYTAGNQAGQGTNSQTGQTGQGQNNGHQGKMISTGGNV
                     NTSNQYSSTNFYNSLTPKSSFDSIGSLHSLGSNVSSVPVGLASNPWVSGSFGSFSIPP
                     PLPPSSGRSENSNSYHDSFNFAPADLSFVNDIDPPNEYSSSPSLNLSNAQKQPFKTLN
                     NKPRGNHNNNSLGNSQFSNASTHQLHLDPVIENEFRNMAKSLEEKEALISDLKLQLES
                     LVTAVAVCGSVNDKAVQEVISEMKMDATEIAHRITIRLKTLKSENEQLGVSNIIIRFT
                     VC"
     gene            complement(<720467..>722287)
                     /locus_tag="AWJ20_4851"
                     /db_xref="GeneID:30037028"
     mRNA            complement(<720467..>722287)
                     /locus_tag="AWJ20_4851"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881950.1"
                     /db_xref="GeneID:30037028"
     CDS             complement(720467..722287)
                     /locus_tag="AWJ20_4851"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736377.1"
                     /db_xref="GeneID:30037028"
                     /translation="MEGLEFASNFSFNRCSPQLSASGEYVAYVYGSRLVIRFTDTLAT
                     KNVIQLPREFAQNIFLIRWDGCLKHSPEQRVAVATRNEIRTFSIKKHSTAGESMAPDN
                     LAGHSVILSGKDEIANVQWLSADTPNNIGQIVRLAVFTRFHLDVKIWSSNGVEMEIRS
                     PKFARLVSETPNLSMDGLSNRFSVVSRFTTYDVLYNCRINATVADNELVTPLSEALDI
                     VDLKWSPSGLWLAAIDNPIAGYDVHLWAADGTFVRTFHDIPGFISPNVNTTPSSRRKE
                     DMLRDTPSAAFPTCLEWVNVFSDPGVRDLELLLVGDSENRVSLFDIKTCQPTSILIHG
                     SVYKNCCLWEEYLSPDSHQFEYRMVRLPFIFTNSGANTSNSKMNEHERNIISGVISMD
                     ISDNGQLLATRVHSYPNLVWIWSIANPQSPDLLAIISHSYTIKSITWKSESMTPLLLI
                     TPLDSKSIGLWSYDSQLEPKIIDLSSQFESSIMGVSIIEKPDSNEILRLLAWTKNSFS
                     IGGSVQDENDTGDAEDEGQDANDMVTKQQNSKYTSYQRSSVPRLNHHQSSRMELLSPT
                     LPQDDDTHVKLLADIVQQSEWIQDTNSVPVEDTFHNKIKH"
     gene            complement(<722631..>723776)
                     /gene="ARO3"
                     /locus_tag="AWJ20_4852"
                     /db_xref="GeneID:30037029"
     mRNA            complement(<722631..>723776)
                     /gene="ARO3"
                     /locus_tag="AWJ20_4852"
                     /product="3-deoxy-7-phosphoheptulonate synthase ARO3"
                     /transcript_id="XM_018881951.1"
                     /db_xref="GeneID:30037029"
     CDS             complement(722631..723776)
                     /gene="ARO3"
                     /locus_tag="AWJ20_4852"
                     /inference="similar to AA sequence:KEGG_Orthology:K01626"
                     /note="3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP)
                     synthase; catalyzes the first step in aromatic amino acid
                     biosynthesis and is feedback-inhibited by phenylalanine or
                     high concentration of tyrosine or tryptophan;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0003849 -
                     3-deoxy-7-phosphoheptulonate synthase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003849 -
                     3-deoxy-7-phosphoheptulonate synthase activity [Evidence
                     IDA] [PMID 2880280]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0009073 - aromatic amino acid family biosynthetic
                     process [Evidence IEA,IEA]; GO_process: GO:0009058 -
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008652 - cellular amino acid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0009423 - chorismate
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0009423 - chorismate biosynthetic process [Evidence
                     TAS] [PMID 1943992]; GO_process: GO:0006950 - response to
                     stress [Evidence IEA]"
                     /codon_start=1
                     /product="3-deoxy-7-phosphoheptulonate synthase ARO3"
                     /protein_id="XP_018736378.1"
                     /db_xref="GeneID:30037029"
                     /translation="MFLDNTHLGDRSRLEDWRIRGYNPLVSPDLLQHDIPLTTKSKEN
                     IVKGREDTCKILDGKDDRLLVVVGPCSIHDPKAALEYCQKLASVVPELSSDLHIVMRA
                     YLEKPRTTVGWKGLINDPDIDGSFQINKGLRISRELFVKLTEQLPIAGEMLDTISPQF
                     LSDLFSVGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLDVAVDAVRAAANPHHFL
                     SVTKPGVVAIVGTDGNDDSFVILRGGKNGTNFDAASVAAAKEKLEKAGLVTDSRPGPR
                     IMIDCSHGNSSKNHNNQPIVAEAVAEQIRNGETGICGVMIESNINAGRQNVPPAEEGG
                     KDALKYGVSITDACIDWETTYKTLKNLAEAVRTRREANSHKKAKIDA"
     gene            <725223..>726275
                     /locus_tag="AWJ20_4853"
                     /db_xref="GeneID:30037030"
     mRNA            <725223..>726275
                     /locus_tag="AWJ20_4853"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881952.1"
                     /db_xref="GeneID:30037030"
     CDS             725223..726275
                     /locus_tag="AWJ20_4853"
                     /inference="similar to AA sequence:KEGG_Orthology:K16576"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736379.1"
                     /db_xref="GeneID:30037030"
                     /translation="MSSSQSRSVPLVNRSPAKRPVSSTPRSPLASPNKSPSKSRSGRL
                     SRAVSRLSVSDSIDIFESPSVLLEISQTVVKAGFPGDAVPQVTYHTDIPLWNRPDDES
                     ADIPPVRLYLLNVLQEILIQSLLVTPKSISVFVLESPLISNTFKQLIGQVLLLDLQVK
                     SVTFQPLAVNAVVGAGASCGLVIDLGWDEAAMIPVYDLRELSSKARFTTRSTKKLFHK
                     YRDTALAESKPFTTWREFRHQTLASTFSTSEITELAQELFIKQNEPYPDDDNLSLPLV
                     ISKLIGSLDANLRGPCSENIVFTGGLQLPPEIYISIINEVQTSWPKARLIHSIGSWAG
                     ASAYLSSIIAYHSQLH"
     gene            complement(<726495..>728198)
                     /gene="PWP1"
                     /locus_tag="AWJ20_4854"
                     /db_xref="GeneID:30037031"
     mRNA            complement(<726495..>728198)
                     /gene="PWP1"
                     /locus_tag="AWJ20_4854"
                     /product="Pwp1p"
                     /transcript_id="XM_018881953.1"
                     /db_xref="GeneID:30037031"
     CDS             complement(726495..728198)
                     /gene="PWP1"
                     /locus_tag="AWJ20_4854"
                     /inference="similar to AA sequence:KEGG_Orthology:K14791"
                     /note="Protein with WD-40 repeats involved in rRNA
                     processing; associates with trans-acting ribosome
                     biogenesis factors; similar to beta-transducin
                     superfamily; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005730 - nucleolus [Evidence IPI] [PMID 15588312];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IMP,ISS] [PMID 15588312]"
                     /codon_start=1
                     /product="Pwp1p"
                     /protein_id="XP_018736380.1"
                     /db_xref="GeneID:30037031"
                     /translation="MISATSWVPRGFAAEFPVKYDLNDEEVERISHLAKLQLKDAQEA
                     LEEAEAEGADVNADADAEVTEAADENVDVAVKSEKKSVKFNASNEDGDAEVEEDDDLK
                     EYDLENYDNDEDEGEGEKMGMFNGVQSLAYYEPGEKDPYITLPNAEDEDEEREELQIL
                     PSDNLILATKTEDDISYLEVYVYNENSESKNDEEDAIDEPTLYVHHDLMLPSFPLCVE
                     WIGYQAGNKVQASGPDRVGNFAAIGTFEPEIEVWNLDVVDSAYPDLILGQRPDNANDH
                     LSVGPSKKSKKKQKKINSKLRNDQYHVDAVLSLSANKLHRNLLASGSADTTVKLWDLN
                     NGVCAKSFQFHDNKVSTVAFNPVEGSILLSGGYDATAIVSDLRVSGSEGQRKWKVDGD
                     IEGGLWASNGNEFYISTEHGRIHKFDARQEGKSLWTLQAHDDGITSFDVNKFIDGYMV
                     TASTDKSTKLWNLSPASGPSLILSRDLDIGKVFSVGFAPDKEAVGHVVAAGSQGIVRV
                     WDTLSNRTVRGSFGKQVSTLRKESAKEVIVGVTEDDEEEDDDEAGADAAENGGDSDEE
                     M"
     gene            <730157..>732340
                     /gene="MSS4"
                     /locus_tag="AWJ20_4855"
                     /db_xref="GeneID:30037032"
     mRNA            <730157..>732340
                     /gene="MSS4"
                     /locus_tag="AWJ20_4855"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018881954.1"
                     /db_xref="GeneID:30037032"
     CDS             730157..732340
                     /gene="MSS4"
                     /locus_tag="AWJ20_4855"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018736381.1"
                     /db_xref="GeneID:30037032"
                     /translation="MGLRKLCRKFRHPFERDESVITTHHSFNDGVVASKSMPPDHLRT
                     RQNSSVEGIRSSYPNCQAFLAKYGTKDQAPRDNSRIGIIENPRNSYPNCEKLAYYSKR
                     SACGNLAQTGSTSRPYRHKDFDLIKTPQSPTGSIDSKKTLNPETFWPTTVVNHLIFEQ
                     NGYEEFIAKGMNSDLGTKGNNSEFEMDSTHSSGAENLHLIWSTPSQVSLVTVDQSSTS
                     SVSTVCSEEIVHQNVSQITEQVIKASNASDSLDSEETLHSLVNHGDKPVCEVVTMPSN
                     NDTDGSCTSESSQNFSELTKEESTSDKPTSPPVRPVRPRVCPFLLQPEIDEMIAKERG
                     ELVTSSVLRCGQSNLSDTYELPSATSASILEAATREYPPRFGSVDAALNPEVVKFDED
                     KKTMLMKRAQAKIDSLKRKLGLKSNPVAPKKYLIFLGIYSSLVENPPIIHPEVRVQFF
                     LPGHKTFNVSPDAVVQCHFPSVYENIRTLRGSYFPEYLNSFLFDHHALHVKSPGKTDS
                     DFYFTADRKYVIKTIQRKEHNTLMGESFMKDYYSHIQENPESLIPTYLGHFTLRTLGK
                     DTHFVVMKNLVGTDVDTVYDLKGIKHRKRSEATSAMNGRDINKDGDWVENQEIIFMGK
                     DKRKKLLTQLASDVALLEKYNIMEYSLLVGIHKDPQSSEIRHAMGMIDSLSPYGVSKA
                     LKSNISRIVHHHSSLNIINPRDYGKRFLNFIGSTVVLERGRPMTY"
     gene            <734400..>735878
                     /gene="NMT1"
                     /locus_tag="AWJ20_4856"
                     /db_xref="GeneID:30037033"
     mRNA            <734400..>735878
                     /gene="NMT1"
                     /locus_tag="AWJ20_4856"
                     /product="glycylpeptide N-tetradecanoyltransferase NMT1"
                     /transcript_id="XM_018881955.1"
                     /db_xref="GeneID:30037033"
     CDS             734400..735878
                     /gene="NMT1"
                     /locus_tag="AWJ20_4856"
                     /inference="similar to AA sequence:KEGG_Orthology:K00671"
                     /note="N-myristoyl transferase; catalyzes the
                     cotranslational, covalent attachment of myristic acid to
                     the N-terminal glycine residue of several proteins
                     involved in cellular growth and signal transduction;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     1544917]; GO_function: GO:0004379 - glycylpeptide
                     N-tetradecanoyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0004379 - glycylpeptide
                     N-tetradecanoyltransferase activity [Evidence IMP] [PMID
                     8955162]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0016746 - transferase
                     activity, transferring acyl groups [Evidence IEA];
                     GO_process: GO:0018008 - N-terminal peptidyl-glycine
                     N-myristoylation [Evidence TAS] [PMID 10570244];
                     GO_process: GO:0006499 - N-terminal protein myristoylation
                     [Evidence IEA]; GO_process: GO:0001302 - replicative cell
                     aging [Evidence IMP] [PMID 10921902]"
                     /codon_start=1
                     /product="glycylpeptide N-tetradecanoyltransferase NMT1"
                     /protein_id="XP_018736382.1"
                     /db_xref="GeneID:30037033"
                     /translation="MSGSEKTESREESAGASQPSEVVAKGNAGSNSGKPVTAVSSADT
                     KPPKTTGMRLEDLFKLLSMPDPKAEPKPMDEYKFWKTQPVTKFDDAIDAEGPIDSKTV
                     DDVSKEPSPLPAGFEWSTIDISQPDKVQEIYDLLYANYIEDDDETFRFKYSPAFLDWG
                     LKPPGWVKDWNVGVRVKDTGKLIGFISGIPGTLRLRTTNPDIKVAEINFLCVHKKLRS
                     KRLAPVLIREVTRRVNLTGVWQALYTAGALLPSPITTARYYHRSINWPKLHDVGFTGL
                     PSNSTPAKQVAKYALPSKPTLETLRPMTVEDVSEVHELLDTFLNRYELVPKFTEQETA
                     HWLLDSVHASEHDKVIYSYVVTDSENKITDFVSFYGLESTVLGNSKYDSINVAYLFYY
                     ATTAGLGDNKSSDNESVLKSRLFVLIQNALILAKAKNFDVFNALSVQDNALFLEDLKF
                     GAGDGFLNYYLFNYKAFPIHGGISKREKSLERKPGGIGVIMF"
     gene            complement(<736235..>736729)
                     /gene="COX5A"
                     /locus_tag="AWJ20_4857"
                     /db_xref="GeneID:30037034"
     mRNA            complement(<736235..>736729)
                     /gene="COX5A"
                     /locus_tag="AWJ20_4857"
                     /product="cytochrome c oxidase subunit Va"
                     /transcript_id="XM_018881956.1"
                     /db_xref="GeneID:30037034"
     CDS             complement(736235..736729)
                     /gene="COX5A"
                     /locus_tag="AWJ20_4857"
                     /inference="similar to AA sequence:KEGG_Orthology:K02263"
                     /note="Subunit Va of cytochrome c oxidase; cytochrome c
                     oxidase is the terminal member of the mitochondrial inner
                     membrane electron transport chain; Cox5Ap is predominantly
                     expressed during aerobic growth while its isoform Vb
                     (Cox5Bp) is expressed during anaerobic growth; COX5A has a
                     paralog, COX5B, that arose from the whole genome
                     duplication; GO_component: GO:0016021 - integral component
                     of membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005751 - mitochondrial
                     respiratory chain complex IV [Evidence IPI] [PMID
                     1331058]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0004129 -
                     cytochrome-c oxidase activity [Evidence IEA,IEA];
                     GO_function: GO:0004129 - cytochrome-c oxidase activity
                     [Evidence IMP] [PMID 1847916]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_process:
                     GO:1902600 - hydrogen ion transmembrane transport
                     [Evidence IEA,IEA]; GO_process: GO:0006123 - mitochondrial
                     electron transport, cytochrome c to oxygen [Evidence IDA]
                     [PMID 1331058]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit Va"
                     /protein_id="XP_018736383.1"
                     /db_xref="GeneID:30037034"
                     /translation="MLRGFRSVARPSLARAAAPVARRQAHAISNPTLVNLESRWEAMS
                     EEERSDIVAQLAERQKGSWAELTVAEKRAAWYISYGAWGPRKPIHAPGDAGRIVKGIA
                     AVILGAATLFTTIRLLSPSLPHTMNKEWQEAANEKLAEKNANPFTGYNQVQSPSKGPS
                     DDDE"
     gene            <740999..>742726
                     /gene="MUP1"
                     /locus_tag="AWJ20_4858"
                     /db_xref="GeneID:30037035"
     mRNA            <740999..>742726
                     /gene="MUP1"
                     /locus_tag="AWJ20_4858"
                     /product="Mup1p"
                     /transcript_id="XM_018881957.1"
                     /db_xref="GeneID:30037035"
     CDS             740999..742726
                     /gene="MUP1"
                     /locus_tag="AWJ20_4858"
                     /note="High affinity methionine permease; integral
                     membrane protein with 13 putative membrane-spanning
                     regions; also involved in cysteine uptake; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0005887 - integral component of plasma membrane
                     [Evidence ISS] [PMID 8893857]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA,IEA]; GO_function: GO:0000102 -
                     L-methionine secondary active transmembrane transporter
                     activity [Evidence IDA] [PMID 8893857]; GO_function:
                     GO:0015171 - amino acid transmembrane transporter activity
                     [Evidence IEA]; GO_process: GO:0003333 - amino acid
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006865 - amino acid transport [Evidence IEA];
                     GO_process: GO:0042883 - cysteine transport [Evidence IDA]
                     [PMID 11330701]; GO_process: GO:0044690 - methionine
                     import [Evidence IGI,IMP] [PMID 8893857]; GO_process:
                     GO:0015821 - methionine transport [Evidence IDA] [PMID
                     11330701]; GO_process: GO:0000101 - sulfur amino acid
                     transport [Evidence IMP] [PMID 8893857]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mup1p"
                     /protein_id="XP_018736384.1"
                     /db_xref="GeneID:30037035"
                     /translation="MASETSSLLSRQTGSQQHLEVGAVSNHANINRGNNSNASGNSSD
                     SGKGNGNSNGKLYREDHMEEEFDTQTIASYDSVYNSDIDNGVPFDPEHGHAHRKTLGI
                     PTATFLMLNKMIGTGIFSIPSSVYELTGSVGWSLVLWIFGGLIAYSGLNVYLEFGVEI
                     PKSGSEKNYLERVFRRPKHLALVTFAVSYLCLSHSTSNSYAFGLYIQLAAGVKETSES
                     YTRVIAVITVLSCILLHGIFPRAGRYLFNALGFFKVVVLGIITMSGFLVLIGAIKLDN
                     PPDNFTNMFQNDGMGGDVYSISIALLRVFFSYRGWDNCNTVMGEIRNPAHTMGIAGPL
                     AIGMVMFFYCFCNIAYFAVVSKQEIADSGVIVAGKFCQIIFGDSVAARVLPFFIALSN
                     LGNILVVSYAASRVTAELGKHYLIPFSPIISSYKPFNTPFVGLLMHASLTVILLVVPP
                     PGRVYEFVVDLSTYPITFISFSVTAGLIYLQFNRVKENWGNKPGSYHAPLYHSVAYLL
                     TNLFLIIVPWIPPPYELKPGSFPYYAVPLGGIIIMTAGPLYWLHWRNSENAARLDAEI
                     EKGLYLQTS"
     gene            complement(<742984..>745986)
                     /gene="PSK2"
                     /locus_tag="AWJ20_4859"
                     /db_xref="GeneID:30037036"
     mRNA            complement(<742984..>745986)
                     /gene="PSK2"
                     /locus_tag="AWJ20_4859"
                     /product="serine/threonine protein kinase PSK2"
                     /transcript_id="XM_018881958.1"
                     /db_xref="GeneID:30037036"
     CDS             complement(742984..745986)
                     /gene="PSK2"
                     /locus_tag="AWJ20_4859"
                     /inference="similar to AA sequence:KEGG_Orthology:K08286"
                     /codon_start=1
                     /product="serine/threonine protein kinase PSK2"
                     /protein_id="XP_018736385.1"
                     /db_xref="GeneID:30037036"
                     /translation="MLNELRKTLIDNQAHSSQQQLHQQHQQQQQQKQPNILSLNQLLM
                     ADQAFGSLHGSASTATLSILGNLTSSSLKTAANGGQLNSNLVNEHLDAFSALLDEAAE
                     LLPVPIDSHGGAGWSSTMPRSVSNPPLILQGSPVVNTTGSIAAIGSGVTGGATPSIGA
                     TSGSTDLRAVLDLESAKKKRVAAGLGESSPQLQNQLLSALSMAYIDMPRPLVFQRGHS
                     TVNFASITNSVSTLNLAILPSSAQGNNSSSVNITPVQPISSKYASNYSVFTTEFKSPY
                     KILSANDMACLLLGLSQVDLKKRSIFDILEDNYGQYVENIINNGLNGGQPKSVFICGH
                     ILPIVKSNGIHSLASFWVRSHNGFISWVLNEVIADKIYLKVSTLDWKLLSITGDNYKI
                     FTPQLTLPEDEPKLREMSLKDLIPGLSDIDVESLEKWNADFPGYKYHTVQAHSANMPC
                     FAKLKSYDDFEATAEISITSMPLMAGVIVIDRWCTVVDYNEYFVGTLLGYGRDSNKVL
                     RGAPVTSIIPRFTDYLEKVFASYQLGTDGNPLPIGLVIPEQAFRKVAALDPNQTNDGD
                     LPRLYPVTDICAVTLQGSHIHVDIQLRVVSNTHFALWVSYSRDIQGLHSEYEMPSQLS
                     LLDNVLEYRANLKKSGSGGGSSSNSRSSTAGSGESVSAESNTLTPMDSEDSLVTPKAA
                     EQSDAQLSSSETNDKNGHETDGSKPPAKKNQAVPDALSTTNRRPPVEIGARRRQKSLK
                     DFNIVQKLGEGAYGKVLLVQYPVEPKDVVVLKCVIKERILVDTWTRDRKLGTIPNEIK
                     IMNNLNALPHKNIVRLIDFFEDDLYYHIEMERHGNPGTDLFDLIELKPDMPVEECRQM
                     FKQVTSAVVHLHTHGIIHRDIKDENIIVDEHGDVKLIDFGSAALTRQGPFDVFVGTID
                     YAAPEVLSGMPYEGKPQDVWALGILLYTIMYKENPFYNVDEIMEGDLRLPYIPSESCV
                     DLIQKILERDIRNRPNIHTIWEHEWLQN"
     gene            <752760..>756962
                     /gene="MON2"
                     /locus_tag="AWJ20_4860"
                     /db_xref="GeneID:30037038"
     mRNA            <752760..>756962
                     /gene="MON2"
                     /locus_tag="AWJ20_4860"
                     /product="Mon2p"
                     /transcript_id="XM_018881960.1"
                     /db_xref="GeneID:30037038"
     CDS             752760..756962
                     /gene="MON2"
                     /locus_tag="AWJ20_4860"
                     /note="Protein with a role in endocytosis and vacuole
                     integrity; peripheral membrane protein; interacts with and
                     negatively regulates Arl1p; localizes to the endosome;
                     member of the Sec7p family of proteins; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IEA]; GO_component:
                     GO:0000139 - Golgi membrane [Evidence IEA]; GO_component:
                     GO:0005829 - cytosol [Evidence TAS] [PMID 12052896];
                     GO_component: GO:0005768 - endosome [Evidence IDA] [PMID
                     12052896]; GO_component: GO:0019898 - extrinsic component
                     of membrane [Evidence IDA] [PMID 12052896]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005802 - trans-Golgi network [Evidence IDA] [PMID
                     16301316]; GO_function: GO:0005085 - guanyl-nucleotide
                     exchange factor activity [Evidence IGI,IPI,ISS] [PMID
                     12052896]; GO_process: GO:0006895 - Golgi to endosome
                     transport [Evidence IMP] [PMID 16301316]; GO_process:
                     GO:0006897 - endocytosis [Evidence IMP] [PMID 12052896];
                     GO_process: GO:0006623 - protein targeting to vacuole
                     [Evidence IMP] [PMID 12134085]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IMP,ISS] [PMID 11169758]"
                     /codon_start=1
                     /product="Mon2p"
                     /protein_id="XP_018736386.1"
                     /db_xref="GeneID:30037038"
                     /translation="MIFTDLCNLTEKQKPVFLKKFNHLPETFGLELLESILTNHSDIF
                     LKHVEFAYILRTRVVPLLLRAFSEKREFSVTVRVTRILYLLLRRQLPILKVEGEVILS
                     LLTHMVDEDAAPYWKRLLCMEVFQGVCSEFSLVQEIYQEYDAQEGTRRAIIKCLIAAF
                     GKISLERKDVIGYGPVSMPFRLPDNAATASTSGLHDENDPVDYSDVVGISLKTSVARV
                     PCIDLLDKSEPPIVPDTYLYYLVLVCINSLCEGLTRKVFTQSPSSSSSNADMPVKFIK
                     ECWHELLSCYNTFFHATIDIDLYHSLVRSVQKLTHSAGFLDISEPMDAFMSLIGSFSV
                     LVLEDVDGGRKSASGPSSSSSPSVAATATSMARNLLSVESIVGTLGSIREHQRSTSNA
                     GLPQNTSASPAPTHPPTNPGGQNTAGRSPGSPTSRNILCFRALLNLAHSLGPKLSTSW
                     DIVFRTIQLADSLANGSGKKRARQVQGSQVFSQLSEFSAVDTSFRRLLDSSKEFSESA
                     LLDMIASICRISEATLGIAKPGLSGDLFFALDLLREIGNTNMNRLVSSSDKTWPKLTD
                     HLLKVIDTRSVEVLARSHSADVLNDLITKASTAAVTSSTVNSDAQRKVISTLKSEIDR
                     VVKVQIPSEDSSIASTESDIHVSAIDTLNKVLDLCGGKFIDGWDLVFEIIDTVFTPLS
                     STGSSSSLSSMAVGSSGTKEIDRASRLVKSGFESMTLICNDFLIVLPEKCLINLVSTL
                     SKFSKQESDLNISFTSISFFWTVSDHLRNVLLEKGAAHNDFKSPISDSEKLSEVASNG
                     EFPLNIFALWTMSLLRLAITVGDTRAQVRNGSIQILFRILDSNGSTLPVGVWKTVQTI
                     VTPVVMKVRPPATNDKDVIASWTETISLILNGFSSLYSSFIGQFVKQDDFSLLWKTLI
                     NYLQALIDTDASHLSLPVYTALNSVLVNFSKNQNISIPAESIEEAWEFWTSQHIPESP
                     VDTKLTQEALTVFVQIHQPLQALSSQKDCSYEKIAKTIKILEQCTSFAHIPHLYSDRD
                     HMSPLQTKSLERIESIDISDVKVASLILEILSGFVLLAFSTSETKSQDPSSKRPTYIS
                     LAAESLQLLKTKFSIVLRADYDELCNNQTIEKIFSSLLVLMEKKFDCPLLAEKKGNKP
                     KQMWQTGTEIFLYILEALLDSNFDIQLSQEHITAIWDVVLKCGLAIITNKSTSSLQYE
                     PEYEKFDHSSYIKFISLVERGSTTSDDFWSRLLRGIFESSAIYYRGKINKEYYRIGDP
                     DVSVLRLVRDPFYGSTERPILKSRVNLSHLCLRELFRLSYKPPKNTALVVQQSSKFLN
                     WRVAITLHQYVADQPLRGRMPMPNVTRDELVKLLNLVYEYHDDKSLSQQFELVCKCIS
                     VSNKDKEILDLLEKCLLTIHRK"
     gene            complement(<757091..>760846)
                     /gene="CHS3"
                     /locus_tag="AWJ20_4861"
                     /db_xref="GeneID:30037039"
     mRNA            complement(<757091..>760846)
                     /gene="CHS3"
                     /locus_tag="AWJ20_4861"
                     /product="chitin synthase CHS3"
                     /transcript_id="XM_018881961.1"
                     /db_xref="GeneID:30037039"
     CDS             complement(757091..760846)
                     /gene="CHS3"
                     /locus_tag="AWJ20_4861"
                     /inference="similar to AA sequence:KEGG_Orthology:K00698"
                     /note="Chitin synthase III; catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin; required for
                     synthesis of the majority of cell wall chitin, the chitin
                     ring during bud emergence, and spore wall chitosan;
                     contains overlapping di-leucine and di-acidic signals that
                     mediate, respectively, intracellular trafficking by AP-1
                     and trafficking to plasma membrane by exomer complex;
                     requires AP-3 complex for its intracellular retention;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 15470103]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 8909536]; GO_component:
                     GO:0045009 - chitosome [Evidence IDA] [PMID 8970154];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     9008706]; GO_component: GO:0000131 - incipient cellular
                     bud site [Evidence IDA] [PMID 15470103]; GO_component:
                     GO:0000131 - incipient cellular bud site [Evidence IDA]
                     [PMID 9008706]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 15755916]; GO_function: GO:0004100 - chitin
                     synthase activity [Evidence IEA]; GO_function: GO:0004100
                     - chitin synthase activity [Evidence IMP] [PMID 9760183];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016758 - transferase activity, transferring hexosyl
                     groups [Evidence IEA]; GO_process: GO:0030476 - ascospore
                     wall assembly [Evidence IMP] [PMID 1293886]; GO_process:
                     GO:0034221 - fungal-type cell wall chitin biosynthetic
                     process [Evidence TAS] [PMID 7565410]"
                     /codon_start=1
                     /product="chitin synthase CHS3"
                     /protein_id="XP_018736387.1"
                     /db_xref="GeneID:30037039"
                     /translation="MPKSSSNATIGQYEHDGIGRKRSLVRPERSRIDPDHPQYHYTQV
                     AAQQAGRIQVQAAPSGADPAVYEHPHTRDIPMTDLSRSQSPNEKQEYDADGGDVYVDA
                     KGGRNVYGLNDENGGEDNYEDNPYENGNKSYDDTNPYGVKNDMDHYGPSNLNDNDTDQ
                     VEPLNADDGPGSGKGGAREMSRKMSEKKAANKPLPGAKKPTSFWHAYCKIVTFWAPAP
                     VLKLFGMRTKDRQMAWREKMGLITVIMYVAAFVAYLTFGFTTTVCNNNLVRLRNNEVN
                     QGYLIINGRAYEMETFKHPEAVGIPKDTNILYPPVNAAGQDASFLFQNVNGNCRGLIT
                     PKADSKIPHDNKGNVAWYFPCQTFSQNGTTQPNFTFPHYNGYACHTSGKARQEYFGLK
                     AAAEVYFTWDDIKNSTRKLVVYNGAVLDLSLLNFIDKSNLNYPSEFTMLQKDSTIMGA
                     DITQLMSHGRDGQIAKCLSEVIKVGYIDTENIGCIASQVVLYVSLVFIIGLVGIKFLF
                     ACYFKWFISGRQGAFYMDRKQLEKHNQEIEDWSNNIYSQGPIKKAPAPPRRKDRNSKF
                     LKGNDKAINRQSVTMMSQIPVTSTSKLVPGGSIYGMNLGNNDASRNSFLLNNNASSDV
                     VGDNSFLQGDTSYRGAGGLMLEDSYSDYPPNAMPAEQQSQVYSGGPGSYDYLVPQPPV
                     DFQPFGFPLAHTICLVTAYSESIDGLRTTLDSIATTDYPNSHKLILIICDGIIKGSGN
                     DMSTPEIALSMMTDFAEPMDQVKPYSYVSVVSGAKRHNMAKVYSGFYKYDDSTVDVAK
                     QQRVPIMTIVKCGTPAEEGTAKPGNRGKRDSQIILMSFLQRVMFDERMTELEFEIFNG
                     MYKITGIAPDFYEIVLMVDADTKVFPDSITHMVAQMVKDPEVMGLCGETKIANKTESW
                     VSMIQVFEYFISHHQAKAFESVFGGVTCLPGCFCMYRIKAPKGDDGFWIPILANPDIV
                     ERYAENVVDTLHKKNLLLLGEDRFLSTLMLRTFPKRKQIFVPKAACKTIVPAEFKVLL
                     SQRRRWINSTVHNLMELVLVRDLCGVFCISMQFVVFVDLVSTLVLPAAITFTLYVVII
                     AIVRKPTPTMSLILLALILGLPGVLIVITASRLSYVLWMIIYLFSLPIWNFVLPMNAY
                     WKFDDFSWGDTRTIEGGDKGGHDETSGEFDSSQIIMKRWRDFQRERSRNIYPQSSGWG
                     EGTVSMLSSSSLNAPMSLNSHTMDHASPTTSNLGSEFVQRPEDMTQF"
     gene            complement(<763153..>763563)
                     /locus_tag="AWJ20_4862"
                     /db_xref="GeneID:30037040"
     mRNA            complement(<763153..>763563)
                     /locus_tag="AWJ20_4862"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881962.1"
                     /db_xref="GeneID:30037040"
     CDS             complement(763153..763563)
                     /locus_tag="AWJ20_4862"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736388.1"
                     /db_xref="GeneID:30037040"
                     /translation="MATSTRYRRQAPTSSEIISSTTISNSEAEEVLTQYLDSITTKDS
                     VSHQLTRLQRSLRGLPSLLQDPEEFVDGEDQADVNMDINMDADALPNGTVKPASDGKI
                     SKEQRKKLKKERRKQEKKERASKPKADENDDMSE"
     gene            complement(<764663..>766093)
                     /gene="MSD1"
                     /locus_tag="AWJ20_4863"
                     /db_xref="GeneID:30037041"
     mRNA            complement(<764663..>766093)
                     /gene="MSD1"
                     /locus_tag="AWJ20_4863"
                     /product="aspartate--tRNA ligase MSD1"
                     /transcript_id="XM_018881963.1"
                     /db_xref="GeneID:30037041"
     CDS             complement(764663..766093)
                     /gene="MSD1"
                     /locus_tag="AWJ20_4863"
                     /inference="similar to AA sequence:KEGG_Orthology:K01876"
                     /note="Mitochondrial aspartyl-tRNA synthetase; required
                     for acylation of aspartyl-tRNA; yeast and bacterial
                     aspartyl-, asparaginyl-, and lysyl-tRNA synthetases
                     contain regions with high sequence similarity, suggesting
                     a common ancestral gene; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA]; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IMP,ISS] [PMID 2668951]; GO_function: GO:0005524
                     - ATP binding [Evidence IEA,IEA]; GO_function: GO:0004812
                     - aminoacyl-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004815 - aspartate-tRNA ligase activity
                     [Evidence IEA]; GO_function: GO:0004815 - aspartate-tRNA
                     ligase activity [Evidence IMP,ISA] [PMID 2668951];
                     GO_function: GO:0016874 - ligase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA,IEA]; GO_process: GO:0070146 -
                     mitochondrial aspartyl-tRNA aminoacylation [Evidence IGI]
                     [PMID 10710420]; GO_process: GO:0070146 - mitochondrial
                     aspartyl-tRNA aminoacylation [Evidence IMP] [PMID
                     2668951]; GO_process: GO:0006418 - tRNA aminoacylation for
                     protein translation [Evidence IEA]; GO_process: GO:0006412
                     - translation [Evidence IEA]"
                     /codon_start=1
                     /product="aspartate--tRNA ligase MSD1"
                     /protein_id="XP_018736389.1"
                     /db_xref="GeneID:30037041"
                     /translation="MEIETPLLFKSTPEGASEFLVPTRRKGLMYALPQSPQQYKQLLM
                     ASGVHGYYQIARCFRDEDLRADRQPEFTQLDLEMSFASGQDIRRVVETVVQNVWSGVL
                     DIPMYTLTADGKYLEKVDSDSPNAFRSLSYNSAISRFGIDKPDLRSSLEIIDLSDSAK
                     AIESPEYPIIEALVIRPEVNGSFTQEQIDFLSDEKSYKARIPKIALITESDLASIEQT
                     VERILPPSVVNITDKTRFYRELSLQTGDIVAFSTRQQLSYENPTPLGRFRQLAIEQFP
                     NQYLRTGADGQPLITPDDFVATWVDDFPLFNPVETTQPEVNTSNSTTSTRVDYPKFDL
                     TSYVSTHHPFTMVHMDDYELLSTAPLQARGQHYDLVINGVEVGGGSTRIHDTKLQKYI
                     FEEILNITNSKALFGHLLEAFDTGCPPHAGLAIGFDRMTAMLSRTSSIRDVIAFPKTI
                     TGADPLIGSPSKVKPSQLGPYHIRTM"
     gene            <767860..>768792
                     /gene="RPN11"
                     /locus_tag="AWJ20_4864"
                     /db_xref="GeneID:30037042"
     mRNA            <767860..>768792
                     /gene="RPN11"
                     /locus_tag="AWJ20_4864"
                     /product="proteasome regulatory particle lid subunit
                     RPN11"
                     /transcript_id="XM_018881964.1"
                     /db_xref="GeneID:30037042"
     CDS             767860..768792
                     /gene="RPN11"
                     /locus_tag="AWJ20_4864"
                     /inference="similar to AA sequence:KEGG_Orthology:K03030"
                     /note="Metalloprotease subunit of 19S regulatory particle;
                     part of 26S proteasome lid; couples the deubiquitination
                     and degradation of proteasome substrates; involved,
                     independent of catalytic activity, in fission of
                     mitochondria and peroxisomes; protein abundance increases
                     in response to DNA replication stress; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 19773362];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 19773362]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 15210724]; GO_component: GO:0000502 -
                     proteasome complex [Evidence IEA]; GO_component:
                     GO:0008541 - proteasome regulatory particle, lid
                     subcomplex [Evidence IDA] [PMID 11742986]; GO_component:
                     GO:0008541 - proteasome regulatory particle, lid
                     subcomplex [Evidence IDA] [PMID 9741626]; GO_component:
                     GO:0034515 - proteasome storage granule [Evidence IDA]
                     [PMID 18504300]; GO_function: GO:0008234 - cysteine-type
                     peptidase activity [Evidence IEA]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IEA]; GO_function:
                     GO:0008237 - metallopeptidase activity [Evidence ISS]
                     [PMID 12183636]; GO_function: GO:0008233 - peptidase
                     activity [Evidence IEA]; GO_function: GO:0004843 -
                     ubiquitin-specific protease activity [Evidence IMP] [PMID
                     12183636]; GO_function: GO:0004843 - ubiquitin-specific
                     protease activity [Evidence IMP] [PMID 12353037];
                     GO_process: GO:0000266 - mitochondrial fission [Evidence
                     IMP] [PMID 19773362]; GO_process: GO:0016559 - peroxisome
                     fission [Evidence IMP] [PMID 19773362]; GO_process:
                     GO:0043161 - proteasome-mediated ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 12183636];
                     GO_process: GO:0016579 - protein deubiquitination
                     [Evidence IMP] [PMID 12183636]; GO_process: GO:0016579 -
                     protein deubiquitination [Evidence IGI] [PMID 14581483];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome regulatory particle lid subunit
                     RPN11"
                     /protein_id="XP_018736390.1"
                     /db_xref="GeneID:30037042"
                     /translation="MDHIQRLLGQGGGMGAHPGVDSPVVDNSETVYISSLALLKMLKH
                     GRAGVPMEVMGLMLGEFVDDFTVHVIDVFAMPQSGTGVSVEAVDDVFQTRMMDMLKQT
                     GRDQMVVGWYHSHPGFGCWLSSVDINTQQSFEQLNPRAVAVVVDPIQSVKGKVVIDAF
                     RLINPASLMMGQEPRQTTSNLGHLNKPSIQALIHGLNRHYYSININYKKTPLEETMLL
                     NLHKSDWSSGLALKDYTVHDHDNHDAVKQMVKLADQYTARVKEEKELTEDQLKTRYVG
                     KQDPKKHLEDTVNQRLEENIVSILAGNVDTASFH"
     gene            complement(<769241..>771364)
                     /gene="SSE2"
                     /locus_tag="AWJ20_4865"
                     /db_xref="GeneID:30037043"
     mRNA            complement(<769241..>771364)
                     /gene="SSE2"
                     /locus_tag="AWJ20_4865"
                     /product="adenyl-nucleotide exchange factor SSE2"
                     /transcript_id="XM_018881965.1"
                     /db_xref="GeneID:30037043"
     CDS             complement(769241..771364)
                     /gene="SSE2"
                     /locus_tag="AWJ20_4865"
                     /inference="similar to AA sequence:KEGG_Orthology:K09485"
                     /note="Member of the heat shock protein 70 (HSP70) family;
                     may be involved in protein folding; localized to the
                     cytoplasm; SSE2 has a paralog, SSE1, that arose from the
                     whole genome duplication; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0000774 - adenyl-nucleotide exchange factor activity
                     [Evidence IDA] [PMID 16688212]; GO_function: GO:0005516 -
                     calmodulin binding [Evidence IEA]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_process:
                     GO:0006457 - protein folding [Evidence ISS] [PMID
                     8406043]; GO_process: GO:0042026 - protein refolding
                     [Evidence IGI] [PMID 16688211]; GO_process: GO:0006950 -
                     response to stress [Evidence IEA]"
                     /codon_start=1
                     /product="adenyl-nucleotide exchange factor SSE2"
                     /protein_id="XP_018736391.1"
                     /db_xref="GeneID:30037043"
                     /translation="MSTPFGIDFGNYSSVIGVARNRGIDVVVNEVSNRATPSLVGFGV
                     KNRYLGEAARSNEISNLKNTVGSLKRILGRKSDDPALEIEKKFITSELVDVEGLAGVK
                     VRFQGEQKTFNSIQLAAMYLNKLKHITTTEIKGNVSDVVIAVPVWYSEVQRRAAADAA
                     IIAGLNPVRIVNDLTAAAVGYGVFKNSELPEDKPRNVAIVDFGHASYSVSIAAFKKGE
                     LKILATAYNRDFGGRDVDLAIANHFGKIFQEKYKIDIHSNPKAFSRVLTQAERLKKIL
                     SANTSAPFNIESLMNDIDVSASMTREELEEYIQPFLAQIPEPIERALKDAKLTPADLD
                     SIEVIGGSSRIPSVKEKLVEVFGGKSLSFTLNQDEAVARGAAFICAIHSPTVRVRPFK
                     FEDLNIYSVTYSWEKVEGEDVNELEVFPAGGWFPNSKVITLFRTADFDLEARYTHPET
                     LEKGINAWIGKWAVKGVKPSENGEAVAVKVKLRQDPSGFYTVESAYTAEERTVEEEIP
                     FEGELKEGEEAPEPQYKTVKKWFKKDDLTIVHTHTGLDDAAQAKLLEIESQLTSEDKL
                     VADTEDRKNALEEYIYDIRGKIDDLYKDFASDDEKARLREKADAAEEWLYGDGDDATK
                     AQYIAKYEELASIGNVIRGRYLSKIEEERQAKQAAQEAEKQRIMAEKLQAQKAAQAAA
                     QAEAAAKAAEEAGSQDADGDVSIEN"
     gene            complement(<771842..>773323)
                     /gene="NPL4"
                     /locus_tag="AWJ20_4866"
                     /db_xref="GeneID:30037044"
     mRNA            complement(<771842..>773323)
                     /gene="NPL4"
                     /locus_tag="AWJ20_4866"
                     /product="Npl4p"
                     /transcript_id="XM_018881966.1"
                     /db_xref="GeneID:30037044"
     CDS             complement(771842..773323)
                     /gene="NPL4"
                     /locus_tag="AWJ20_4866"
                     /inference="similar to AA sequence:KEGG_Orthology:K14015"
                     /note="Substrate-recruiting cofactor of the
                     Cdc48p-Npl4p-Ufd1p segregase; assists Cdc48p in the
                     dislocation of misfolded, polyubiquitinated ERAD
                     substrates that are subsequently delivered to the
                     proteasome for degradation; also involved in the regulated
                     destruction of resident ER membrane proteins, such as
                     HMG-CoA reductase (Hmg1/2p) and cytoplasmic proteins
                     (Fbp1p); role in mobilizing membrane bound transcription
                     factors by regulated ubiquitin/proteasome-dependent
                     processing (RUP); GO_component: GO:0034098 -
                     Cdc48p-Npl4p-Ufd1p AAA ATPase complex [Evidence IDA] [PMID
                     11598205]; GO_component: GO:0034098 - Cdc48p-Npl4p-Ufd1p
                     AAA ATPase complex [Evidence IDA] [PMID 11733065];
                     GO_component: GO:0036266 - Cdc48p-Npl4p-Vms1p AAA ATPase
                     complex [Evidence IDA] [PMID 21070972]; GO_component:
                     GO:0000837 - Doa10p ubiquitin ligase complex [Evidence
                     IDA] [PMID 16873066]; GO_component: GO:0000839 - Hrd1p
                     ubiquitin ligase ERAD-L complex [Evidence IDA] [PMID
                     16873065]; GO_component: GO:0000839 - Hrd1p ubiquitin
                     ligase ERAD-L complex [Evidence IDA] [PMID 16873066];
                     GO_component: GO:1990112 - RQC complex [Evidence IDA]
                     [PMID 23178123]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0031965 - nuclear membrane [Evidence IEA];
                     GO_component: GO:0042175 - nuclear outer
                     membrane-endoplasmic reticulum membrane network [Evidence
                     IDA] [PMID 11598205]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0048471 -
                     perinuclear region of cytoplasm [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0071712 - ER-associated misfolded
                     protein catabolic process [Evidence IMP] [PMID 11740563];
                     GO_process: GO:0071712 - ER-associated misfolded protein
                     catabolic process [Evidence IMP] [PMID 11813000];
                     GO_process: GO:0030433 - ER-associated ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 11739805];
                     GO_process: GO:0071629 - cytoplasm-associated proteasomal
                     ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 18812321]; GO_process: GO:0051028 - mRNA
                     transport [Evidence IEA]; GO_process: GO:0072671 -
                     mitochondria-associated ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 21070972];
                     GO_process: GO:0051228 - mitotic spindle disassembly
                     [Evidence IMP] [PMID 14636562]; GO_process: GO:0070651 -
                     nonfunctional rRNA decay [Evidence IMP] [PMID 22505030];
                     GO_process: GO:1900182 - positive regulation of protein
                     localization to nucleus [Evidence IMP] [PMID 11598205];
                     GO_process: GO:1900182 - positive regulation of protein
                     localization to nucleus [Evidence IMP] [PMID 11733065];
                     GO_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 20206597]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0030970 -
                     retrograde protein transport, ER to cytosol [Evidence IMP]
                     [PMID 11740563]; GO_process: GO:1990116 -
                     ribosome-associated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 23358411]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Npl4p"
                     /protein_id="XP_018736392.1"
                     /db_xref="GeneID:30037044"
                     /translation="MCRHGDKGMCDYCMPLEPFDSGYQQEKNIKHLSYHAYLRKLNAD
                     SNKSSIANGHGGTKGTRSGVAGSSSSYMSPLSEPFFGVAKNCPSGHPPWPQGICSKCQ
                     PSAITLQQQQFRMVDHVEFADSSIVNSFIESWRLTGAQRIGYLYGRYVPYEVVPLGIK
                     AVVEAIYEPPQSDEIDGVSLTLPWNEESLVDRVAAGLSADNSTSASGSTTGSTTGSAS
                     GSQSGSGQHTLGLQKIGVIYTDLLDAGKGDGSVVCKRHVDSYFLSSLEIAFAADLQNQ
                     HPNPSRWSDTGNFSSKFVTCVITGNSKGEIDISSYQVSTNAEAMRKADLIEPSANPSV
                     MRIKEPTKTRYVPEIFYKRVNEYKLTVSENAKPAFPVEYLLVTLTHGFPDSPKPLLTS
                     PTPFPIENRQHVGVLQDFRAIANHLNLKTGTSINNQTELSSDMSRISDFHLLVYLVGL
                     GILSSDEEKLLLRAAASHSPDDGYLLTQTPGWQTLLTITRESV"
     gene            complement(<774150..>776045)
                     /gene="bdc1"
                     /locus_tag="AWJ20_4867"
                     /db_xref="GeneID:30037045"
     mRNA            complement(<774150..>776045)
                     /gene="bdc1"
                     /locus_tag="AWJ20_4867"
                     /product="bromodomain containing protein 1, Bdc1"
                     /transcript_id="XM_018881967.1"
                     /db_xref="GeneID:30037045"
     CDS             complement(774150..776045)
                     /gene="bdc1"
                     /locus_tag="AWJ20_4867"
                     /codon_start=1
                     /product="bromodomain containing protein 1, Bdc1"
                     /protein_id="XP_018736393.1"
                     /db_xref="GeneID:30037045"
                     /translation="MSTSLLNLLFAQTIYGQILRDREEERLAQANGDAKSRSSSSSPA
                     PQSGTATGKPNQFVKLSQDLRSHPLNTNFNLTPQACQALYNALLPSNPPRPTVEMLQP
                     LLAKLYESYKRDMTLSIQKSEQDYQTKLKEMELIASGKWDNELLKEAERDKSQQQQQQ
                     QQQQQQQQLRLQKQLEIQQKQEQERKAQLQAQAQAAKPLASTDNKHDSVAESDAESES
                     GSEEESDQEPEASTPKPSNSVSDGKSVATSTAVDNKSKHPDEDEEAGEDEEEEEEEEE
                     EGEEENEKEGADVEEGEEEELEEEDTTLKSSLKGPSDEVDEGTVKQETQEKADKPDAS
                     VKTETGDNNEGEEKEDEDEDVEMADLEADADADAEESEVPAKDNVKKEHATDKEDTQE
                     VEDEEEEVEEGDEEEEPETVEQEAKSAPPQKPVEDDEEAEEEAEEAEDADEEEAEEAE
                     DETEVPDETRRTTRQSRRNKQEPATTTTSSSKRKRTPSPSPARPSRRFQTLVNPLISD
                     IMSNKSASFFSHPVNPNDAPAYYDLIYSPTDLRTIKSMVKEGKIRDTAELERELEKMF
                     ANAVMYNGWDSDISMWAREMQHDTETMLALFRSAERRGRARSNSATPSGADDEPSNTN
                     SAKRRKK"
     gene            <777130..>777489
                     /gene="SEC66"
                     /locus_tag="AWJ20_4868"
                     /db_xref="GeneID:30037046"
     mRNA            <777130..>777489
                     /gene="SEC66"
                     /locus_tag="AWJ20_4868"
                     /product="Sec63 complex subunit SEC66"
                     /transcript_id="XM_018881968.1"
                     /db_xref="GeneID:30037046"
     CDS             777130..777489
                     /gene="SEC66"
                     /locus_tag="AWJ20_4868"
                     /inference="similar to AA sequence:KEGG_Orthology:K12273"
                     /codon_start=1
                     /product="Sec63 complex subunit SEC66"
                     /protein_id="XP_018736394.1"
                     /db_xref="GeneID:30037046"
                     /translation="MKAAILKWAAEDIRQMIRMNDSKQYLTVLHQRGSVGDDIWKRFT
                     MSEKFLQLELEDIRREAEAIHPNWTQQLFQTASEIAQNEGLRKRINEFPAQQQEYRQA
                     FEALRENSIKELTSEKN"
     gene            complement(<780196..>784647)
                     /gene="SMY2"
                     /locus_tag="AWJ20_4869"
                     /db_xref="GeneID:30037047"
     mRNA            complement(<780196..>784647)
                     /gene="SMY2"
                     /locus_tag="AWJ20_4869"
                     /product="Smy2p"
                     /transcript_id="XM_018881969.1"
                     /db_xref="GeneID:30037047"
     CDS             complement(780196..784647)
                     /gene="SMY2"
                     /locus_tag="AWJ20_4869"
                     /note="GYF domain protein; involved in COPII vesicle
                     formation; interacts with the Sec23p/Sec24p subcomplex;
                     overexpression suppresses the temperature sensitivity of a
                     myo2 mutant; similar to S. pombe Mpd2; SMY2 has a paralog,
                     SYH1, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0000932 - cytoplasmic mRNA
                     processing body [Evidence IDA] [PMID 17804396];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 17973654]; GO_component: GO:0019898 -
                     extrinsic component of membrane [Evidence IDA] [PMID
                     17973654]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006888 - ER to Golgi
                     vesicle-mediated transport [Evidence IGI,IPI] [PMID
                     17973654]"
                     /codon_start=1
                     /product="Smy2p"
                     /protein_id="XP_018736395.1"
                     /db_xref="GeneID:30037047"
                     /translation="MSKSSALSLGPEWYVSSQCCLAPLVARSSSGGGLPPAAGAPPQT
                     LVAPASQELVGFVDGIDSSEARGAGGSGAQPQPPEARLFVELTGIRTRLKSGSSKVLK
                     DDKTANGNNNSPNGPEKVKLPWSGIAAGAASSANSIASGSSNSSNGGGVAAAGPGLAG
                     ASSASGPSFAAAASALKRKTSGTNVSPSVTSSAGSATASGSAGAASGAGAGRNSGASG
                     ISDINNSAAGGGVFAISAAAGGSGLFGMRKSSSGDDSDATSQSSLSGKRVGSTSTTTA
                     TTTNTHANSGLSTGNISSPVTGLGAITGSGLAGSVPYKVGGTRVAVSLEDSVQGVTAG
                     ASDSAAGAAGASGSGSSSNGPKSEPVVLRANAGAKKYSSKEMLAIWDRIKNSKEFRES
                     KRIAVTELTENSDPASAPASGSGSANTITTNTSFNTNIGNNGQQRGYHNRYHHGNNNT
                     NNNNNNGGGVGGGSKLFTPFGRYKNPNDLYYSNMTNMPVNYDTPPKQRPYRDGDDRNA
                     HVHGSSHGTGHGSSQGSGTGTGTGTTVDDIGRKSGGVSLTSVTGAGGAATTETGLRSG
                     GTGNGSRLMDTINSASSKVADDAFFSSLVSSGARSDSGGQVAQNQPQAPAPTTSIASN
                     ILPASIASDSWSPFGNFSITPSSARNDLSSHPSDTALSRIGSGTNLLGISKPGSTPTA
                     SAVAGGSTASDFFSSPIKRVGTPLSNAAMAATPPPGIPSPQPNPPLILPENVQWVYKD
                     PSGVEQGPFSGKLMHDWYTGNWLKEDLLIKRIGETDYITLHDFKLKIGNFTEPFRVPL
                     PPVLPPSLPPPFGQQQQQPSPFGHGIPYFDDLQRDVFRQHHHQAQQPLQLPNQHQQFG
                     GAAPVIPSAWGASGSPVVSPGPMSPISPWGQPIQPVHQPATHSQSNFFQDQPLHSQLA
                     PVLSHSSQDTSAAAATAASVANSAVGSPVQEPSSGPLGQSLWKGLDSVQRDLSSSGSV
                     ADIINNAENLSLNDDIKAQTQAEPVSEETSTGASSTKSEDNSESKRELTKAEIKKAKK
                     KAKAELQSAAAAAVAAAAAERAEKANNKQEHSEPTASTDDDSADQTTKTATSSVESTP
                     VTSGSNSTHAATSTVASTGSTGHGHTLTLSTTTSPTATAAPALAPWAKKDTKPKALSL
                     KEIQELEASERAKQTAKQQELVQQQLLAARLAGGVSSSSTSGPILPSGAKWASSMNSA
                     ASPKKTLAEIQREEELAAAAAAKKKAQALAQAQAQTISSPIAGTTASTGVPTGASGAT
                     PTISPIAASLPFGKKYAEIVTPGAPSSVRPGVSSATSSSLATGLSSTGAPAWTTVGPG
                     GRKVSSPATTGVAASIAAGGSSPLKRAISSTTLRPAAAPVPTAPRVLTASDEFLQWCK
                     GALQDLNAGINQTELLSILLSLPATPDSKEIIAETIYSNSSTMDGRRFADEFLKKRNV
                     ADKEKSGETWSDVLQRNATAPPKPVENDGWNPAFKVVKKKNKRADQF"
     gene            <785371..>787437
                     /gene="SAD1"
                     /locus_tag="AWJ20_4870"
                     /db_xref="GeneID:30037049"
     mRNA            <785371..>787437
                     /gene="SAD1"
                     /locus_tag="AWJ20_4870"
                     /product="Sad1p"
                     /transcript_id="XM_018881971.1"
                     /db_xref="GeneID:30037049"
     CDS             785371..787437
                     /gene="SAD1"
                     /locus_tag="AWJ20_4870"
                     /inference="similar to AA sequence:KEGG_Orthology:K12847"
                     /note="Conserved zinc-finger domain protein involved in
                     pre-mRNA splicing; critical for splicing of nearly all
                     intron-containing genes; required for assembly of U4 snRNA
                     into the U4/U6 particle; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 10022888]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0005681 - spliceosomal complex [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0008270
                     - zinc ion binding [Evidence IEA]; GO_process: GO:0008380
                     - RNA splicing [Evidence IEA]; GO_process: GO:0006397 -
                     mRNA processing [Evidence IEA]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IDA] [PMID
                     10022888]; GO_process: GO:0000245 - spliceosomal complex
                     assembly [Evidence IDA] [PMID 24681967]; GO_process:
                     GO:0006511 - ubiquitin-dependent protein catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Sad1p"
                     /protein_id="XP_018736396.1"
                     /db_xref="GeneID:30037049"
                     /translation="MGNGDETRAADEAALVDTEISAVESVEQNGSEIQLEHEHEHQHE
                     HEHEHEINNSFEKAGSVKEIENGDTTEMRTRKRRLNEEKNDDDENETIHTNGSVPGTS
                     TPDSSEARGAVGSGAKPQPPEVRRHPSNSQSKIEEEQKEEEEEEEGVWPVRPVRQVQE
                     PSSSMLYLDTVDRSRLDFDFEKICSVSLSVVNVYACLCCGKYFQGRGKSSYAFVHSVD
                     VDHHVFINLQTLKIYVLPEGYEVKTTALDDIKYVIDPWYTADEIKSLDTVALNSSFDL
                     THKQYYPGYIGINNIKANDYANVVIQILSHVSPVRDFFLTLGQGRATGSSQSNGSSAS
                     ISMANSMANSTNGTSQAGSSELASRLSTLIRKIWNPRAFRAHVSPHELLQSVSSASKK
                     QFTSTQQSDPFLFFTWLLNRLTAELTVGPTNTRFSRDSSPGTPTAAITTAVSTTTTKD
                     QQPVKKKLKPTSTRSSKPIKPRGIIQKTFQGTLLVEQQQLPRTLPSGASADTFLPNEP
                     IKTTETPFLCLTLDLPPIPLFKESTQDGAPVIPQVTLKSLLNKYNGTTVTTDEITKTM
                     KKYKLTRVPEFLVLRIKRITRNLLGDADERNPTVVSFSPTNLDMAPYLTSSSTTSPSS
                     TRYNLIANVVCEWDGNTPRWKIQLLDKSRDRWLQIENLLVEPIQRELLFLSESHLQIW
                     QRQSPL"
     gene            complement(<788160..>788480)
                     /gene="UMP1"
                     /locus_tag="AWJ20_4871"
                     /db_xref="GeneID:30037050"
     mRNA            complement(<788160..>788480)
                     /gene="UMP1"
                     /locus_tag="AWJ20_4871"
                     /product="Ump1p"
                     /transcript_id="XM_018881972.1"
                     /db_xref="GeneID:30037050"
     CDS             complement(788160..788480)
                     /gene="UMP1"
                     /locus_tag="AWJ20_4871"
                     /inference="similar to AA sequence:KEGG_Orthology:K11599"
                     /note="Chaperone required for correct maturation of the
                     20S proteasome; short-lived chaperone; may inhibit
                     premature dimerization of proteasome half-mers; degraded
                     by proteasome upon completion of its assembly;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11922673]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 11922673]; GO_component: GO:0000502 -
                     proteasome complex [Evidence IEA]; GO_function: GO:0003674
                     - molecular_function [Evidence ND]; GO_process: GO:0006974
                     - cellular response to DNA damage stimulus [Evidence IDA]
                     [PMID 10975253]; GO_process: GO:0043248 - proteasome
                     assembly [Evidence IGI] [PMID 17431397]; GO_process:
                     GO:0043248 - proteasome assembly [Evidence IMP] [PMID
                     9491890]; GO_process: GO:0006511 - ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 9491890]"
                     /codon_start=1
                     /product="Ump1p"
                     /protein_id="XP_018736397.1"
                     /db_xref="GeneID:30037050"
                     /translation="MRSIAAEMNGNHPLQSRLEKWNETQLEFKLDGYRRTYGAGEPIR
                     RAMELQIVKDTSVLPKIVTGPSRPLHLDILEGRDDAVDWDEVYTGPESTLDFHSELEK
                     RMNV"
     gene            <789365..>790984
                     /gene="PTC5"
                     /locus_tag="AWJ20_4872"
                     /db_xref="GeneID:30037051"
     mRNA            <789365..>790984
                     /gene="PTC5"
                     /locus_tag="AWJ20_4872"
                     /product="type 2C protein phosphatase PTC5"
                     /transcript_id="XM_018881973.1"
                     /db_xref="GeneID:30037051"
     CDS             789365..790984
                     /gene="PTC5"
                     /locus_tag="AWJ20_4872"
                     /inference="similar to AA sequence:KEGG_Orthology:K01102"
                     /note="Mitochondrial type 2C protein phosphatase (PP2C);
                     involved in regulation of pyruvate dehydrogenase activity
                     by dephosphorylating the serine 133 of the Pda1p subunit;
                     localizes to the intermembrane space and is imported via
                     the presequence pathway and processed by the inner
                     membrane protease (Imp1p-Imp2p); acts in concert with
                     kinases Pkp1p and Pkp2p and phosphatase Ptc6p;
                     GO_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IEA]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IDA] [PMID
                     22984289]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16643908];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004741 - [pyruvate
                     dehydrogenase (lipoamide)] phosphatase activity [Evidence
                     IEA]; GO_function: GO:0004741 - [pyruvate dehydrogenase
                     (lipoamide)] phosphatase activity [Evidence ISS] [PMID
                     16643908]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA]; GO_function: GO:0004721 -
                     phosphoprotein phosphatase activity [Evidence IEA];
                     GO_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IEA]; GO_function:
                     GO:0004722 - protein serine/threonine phosphatase activity
                     [Evidence IDA,ISS] [PMID 10580002]; GO_process: GO:0043085
                     - positive regulation of catalytic activity [Evidence IMP]
                     [PMID 18180296]; GO_process: GO:0006470 - protein
                     dephosphorylation [Evidence IEA]; GO_process: GO:0006470 -
                     protein dephosphorylation [Evidence IDA] [PMID 10580002];
                     GO_process: GO:0050790 - regulation of catalytic activity
                     [Evidence IMP] [PMID 16643908]"
                     /codon_start=1
                     /product="type 2C protein phosphatase PTC5"
                     /protein_id="XP_018736398.1"
                     /db_xref="GeneID:30037051"
                     /translation="MSNPRVANDSPGPGGPGITGPSQAAGPVRLASNSAKQSISMLTP
                     AQVSSRLRENEESYLVDRGKGVLRYDVAQLPSNNPIEDDRSERVVQVPLIVEPSGSTS
                     SGSNSNSGSGNGVSEKSEVASGGETGENGETMVSSDWMFWGVYDGHSGWTTSAFLRDH
                     LVAYVLNELDKVYEKSSPNSMYRLVPSPEVIDEAIQQGFLALDDEIVNKRVARLLESS
                     GSSKASATELIAPALSGSCGLLAFYDTFSKNLRVAVTGDSRAVLGSRDSYGNWTATAL
                     STDQTGSNIDEANRVRSEHPGEENTAIRNGRVLGSLEPTRAFGDARYKWARDIQHKIA
                     QRFFGRRIPSELKTPPYVTAKPVVTTTKVNPENGDFLVMGSDGVFEMLSNEEVVSLVV
                     QWLKAKRPEYLETTLKSSQSDGSGLFSKLFGSGKRSDRDDGALVEDISSNKEAQKQPI
                     RRRNGVPVRFTVQDDNAATHIIRNALGGADQDQVSMLVSIPSPLARNYRDDLTVTVVF
                     FGHDSTPSNDAGSIKVNQAGTRNGIRARSRL"
     gene            complement(<791263..>792141)
                     /locus_tag="AWJ20_4873"
                     /db_xref="GeneID:30037052"
     mRNA            complement(<791263..>792141)
                     /locus_tag="AWJ20_4873"
                     /product="glucose-6-phosphate 1-epimerase"
                     /transcript_id="XM_018881974.1"
                     /db_xref="GeneID:30037052"
     CDS             complement(791263..792141)
                     /locus_tag="AWJ20_4873"
                     /inference="similar to AA sequence:KEGG_Orthology:K01792"
                     /note="Glucose-6-phosphate 1-epimerase (hexose-6-phosphate
                     mutarotase); likely involved in carbohydrate metabolism;
                     GFP-fusion protein localizes to both the nucleus and
                     cytoplasm and is induced in response to the DNA-damaging
                     agent MMS; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0030246 -
                     carbohydrate binding [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0047938 - glucose-6-phosphate 1-epimerase
                     activity [Evidence IEA]; GO_function: GO:0047938 -
                     glucose-6-phosphate 1-epimerase activity [Evidence IDA]
                     [PMID 16857670]; GO_function: GO:0016853 - isomerase
                     activity [Evidence IEA,IEA]; GO_process: GO:0005975 -
                     carbohydrate metabolic process [Evidence IEA]; GO_process:
                     GO:0044262 - cellular carbohydrate metabolic process
                     [Evidence IC] [PMID 16857670]"
                     /codon_start=1
                     /product="glucose-6-phosphate 1-epimerase"
                     /protein_id="XP_018736399.1"
                     /db_xref="GeneID:30037052"
                     /translation="MASYIKETETEIVLTHPRDSSTSVRILKYGATILSWKVKGQEQL
                     WLSEKAILDGSKAVRGGIPLVFPVFGKSEGHETSQLPQHGFARNSVWEFLGQVESDPL
                     TVQFGLGPENISETARCQWPHDFTLIFTVSLPSEDSLSTSLEVENTDKQPWEFNVLFH
                     TYFRIPDITQTHVEGLTGTQVTDKVSKTNYAGNEAKITIAGEVDRVYSSPSTPDSVAI
                     VSGSKTLFNVQNLQNLKDVVVWNPWTEKANGLADFSPKDGFKNMICVETGSVSKYQTV
                     APGAKWSASQTLKSHL"
     gene            <793841..>795592
                     /gene="SIT1"
                     /locus_tag="AWJ20_4874"
                     /db_xref="GeneID:30037053"
     mRNA            <793841..>795592
                     /gene="SIT1"
                     /locus_tag="AWJ20_4874"
                     /product="Sit1p"
                     /transcript_id="XM_018881975.1"
                     /db_xref="GeneID:30037053"
     CDS             793841..795592
                     /gene="SIT1"
                     /locus_tag="AWJ20_4874"
                     /inference="similar to AA sequence:KEGG_Orthology:K08197"
                     /note="Ferrioxamine B transporter; member of the ARN
                     family of transporters that specifically recognize
                     siderophore-iron chelates; transcription is induced during
                     iron deprivation and diauxic shift; potentially
                     phosphorylated by Cdc28p; GO_component: GO:0016023 -
                     cytoplasmic membrane-bounded vesicle [Evidence IDA] [PMID
                     10748025]; GO_component: GO:0005768 - endosome [Evidence
                     IEA]; GO_component: GO:0005768 - endosome [Evidence IDA]
                     [PMID 19469713]; GO_component: GO:0010008 - endosome
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0015344 -
                     siderophore uptake transmembrane transporter activity
                     [Evidence IMP,ISS] [PMID 9884238]; GO_process: GO:0006879
                     - cellular iron ion homeostasis [Evidence IDA,IMP] [PMID
                     9884238]; GO_process: GO:0006811 - ion transport [Evidence
                     IEA]; GO_process: GO:0055072 - iron ion homeostasis
                     [Evidence IEA]; GO_process: GO:0015891 - siderophore
                     transport [Evidence IMP] [PMID 9884238]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IMP] [PMID
                     9884238]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Sit1p"
                     /protein_id="XP_018736400.1"
                     /db_xref="GeneID:30037053"
                     /translation="MVSDSVEEKSRDGPEGYQPSYEGFDQQAEKEKSIGVRKVEIYSS
                     QYKLVGKIFVFFSVFLVSYAYGLDSNIRYVYQATATSSYAEHSLLSTVNVIKAVIGAA
                     GQPVYARLSDVFGRLELFIAAILFYVVGTIIESQAYDVQRFAGGAILFQVGYTGIVLL
                     MELIVADFSFLNWRLVASFVPALPFIINTWISGNITGDMGLRWSWGIGMWAIIFPVAS
                     IPLLICLIHMRYRAHKSGQMDAIKAEETDFQRLGFWGFMKHLFWQLDVVGIILLIAVF
                     ALILVPFTIAGGVEEEWKKAKIIAPLVIGFCCIPVFAVWEFKYAPIPLVPMKHLRNRT
                     VYSAVCIAVLINFIWYMQGDYMYTVLVVAVNQSTTSANRITSLYSFVSVITGTILGLI
                     VARLRYLKGFIVFGTCMWLLSMGLLIHYRGGTDSKSGIIGSMCVLGFGAGLFTYPVQV
                     MIQASVKHEHMAIITSLYLASYNIGSALGGSVSGAIWTQILPKELSKRLSDPALVTAA
                     YGSPFTFIISYPWGTPERMAVVEAYKHVQKILLIVGTCLCVPLIFFALIIDNYKLESV
                     QSLPGAEKDGESESLSS"
     gene            <799253..>800890
                     /locus_tag="AWJ20_4875"
                     /db_xref="GeneID:30037054"
     mRNA            <799253..>800890
                     /locus_tag="AWJ20_4875"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881976.1"
                     /db_xref="GeneID:30037054"
     CDS             799253..800890
                     /locus_tag="AWJ20_4875"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736401.1"
                     /db_xref="GeneID:30037054"
                     /translation="MIVIGEENAVGWSTKVAIVGSGPSALSLSFILNGNIPYYDPVPY
                     GPHPDESLHYCLLNYTAGNDLGKSLLDAVADEHIISYMESSYESFFSDQTLPVNLLID
                     ALSASDESSFMNCHSKECRIKWVHESAKYVPHIVIGSSPRPGGQWGSYEFDSKDQLSL
                     SYAEMLSLPGYSFSQYYMDTYGTTPADFYRPPRHQVADYYAMYPGKVGISENIVSNTL
                     VTCVDRASHTGSFVISMRQCEGAVHKQCLLAADKVVLATGVYESPLESLKSASPKGIN
                     ENNGTNTTDLTDVNSNGEYGRHDKTFYNLTNALVHNNSTSNSNSNSNSFDKHHFSFTI
                     VPPLSTPPSEGARASQNKTCLIIGTGVSAAEAVNNSIALGYSVIHIYKWYDEKGSPCV
                     FRRYPKELYPDYCKVFRMMKQRKVAGLYEGLPNAQILDISPDGMVEIKLEDGSTVCRT
                     VSSVRACTGRTGSLSYLCNPVLDRSIESTIRTMPITKKTLRDKYIDKNDQSLCVGENV
                     YAIGSLCGDTVVRFMLGASFSVAGELVDSSSAKSVGS"
     gene            complement(<800776..>801924)
                     /locus_tag="AWJ20_4876"
                     /db_xref="GeneID:30037055"
     mRNA            complement(<800776..>801924)
                     /locus_tag="AWJ20_4876"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881977.1"
                     /db_xref="GeneID:30037055"
     CDS             complement(800776..801924)
                     /locus_tag="AWJ20_4876"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736402.1"
                     /db_xref="GeneID:30037055"
                     /translation="MASAKGKGVPSQFKDLRNQLKKDENSAESLMELVLRHGPVKMLV
                     NQDPGILHVLCTERPVLSVDRALEILSDLVSVRGDSEFEEVSLERIGSAGSDSEKLVG
                     VSWVILRNAVSDKRFTEAFKVVDLVKRYEQQQRQRRRGIVGSSKVIINYISTVLGGKR
                     SGASASASASASASSESAKASKSKSISASASAVVAAATLVPSLALYILSGPAALLVPI
                     VYSSIALSYFVRWHLLPYPFYLPNLFGSISGSLLTWAPSVGPIYRAQRQLELDMVNRI
                     VVGYSELVDINTSNYHVHHSREMPPVELENLINSQLLSRSMRLKPTHDEAMYQEYWQS
                     AGQNLEWVEPDQDPTDLALDESTSSPATEKLAPSINRTTVSPHKLPIA"
     gene            complement(<802480..>802965)
                     /gene="VPS21"
                     /locus_tag="AWJ20_4877"
                     /db_xref="GeneID:30037056"
     mRNA            complement(<802480..>802965)
                     /gene="VPS21"
                     /locus_tag="AWJ20_4877"
                     /product="Rab family GTPase VPS21"
                     /transcript_id="XM_018881978.1"
                     /db_xref="GeneID:30037056"
     CDS             complement(802480..802965)
                     /gene="VPS21"
                     /locus_tag="AWJ20_4877"
                     /inference="similar to AA sequence:KEGG_Orthology:K07889"
                     /note="Endosomal Rab family GTPase; required for endocytic
                     transport and sorting of vacuolar hydrolases; required for
                     endosomal localization of the CORVET complex; required
                     with YPT52 for MVB biogenesis and sorting; involved in
                     autophagy and ionic stress tolerance; geranylgeranylation
                     required for membrane association; protein abundance
                     increases in response to DNA replication stress; mammalian
                     Rab5 homolog; VPS21 has a paralog, YPT53, that arose from
                     the whole genome duplication; GO_component: GO:0005768 -
                     endosome [Evidence IEA]; GO_component: GO:0010008 -
                     endosome membrane [Evidence IEA]; GO_component: GO:0005770
                     - late endosome [Evidence IMP] [PMID 11872141];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0031966 - mitochondrial membrane
                     [Evidence IEA]; GO_component: GO:0005741 - mitochondrial
                     outer membrane [Evidence IDA] [PMID 16407407];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0005525 -
                     GTP binding [Evidence IEA,IEA]; GO_function: GO:0003924 -
                     GTPase activity [Evidence IDA] [PMID 11210571];
                     GO_function: GO:0003924 - GTPase activity [Evidence IMP]
                     [PMID 8163546]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006895 - Golgi to
                     endosome transport [Evidence IGI,IMP] [PMID 22748138];
                     GO_process: GO:0006895 - Golgi to endosome transport
                     [Evidence IGI,IMP] [PMID 23612966]; GO_process: GO:0006897
                     - endocytosis [Evidence IMP] [PMID 8163546]; GO_process:
                     GO:0032511 - late endosome to vacuole transport via
                     multivesicular body sorting pathway [Evidence IGI] [PMID
                     22748138]; GO_process: GO:0036258 - multivesicular body
                     assembly [Evidence IGI] [PMID 22748138]; GO_process:
                     GO:0036010 - protein localization to endosome [Evidence
                     IGI] [PMID 23264632]; GO_process: GO:0006623 - protein
                     targeting to vacuole [Evidence IMP] [PMID 8163546];
                     GO_process: GO:0015031 - protein transport [Evidence
                     IEA,IEA]; GO_process: GO:0007264 - small GTPase mediated
                     signal transduction [Evidence IEA]; GO_process: GO:0006810
                     - transport [Evidence IEA]; GO_process: GO:0000011 -
                     vacuole inheritance [Evidence IMP] [PMID 1493335]"
                     /codon_start=1
                     /product="Rab family GTPase VPS21"
                     /protein_id="XP_018736403.1"
                     /db_xref="GeneID:30037056"
                     /translation="MYYRNAQSALVVYDVTKPASFVKARHWVNELKAQASPGIVIALV
                     GNKVDLVESDEDGSSGDAANGDGSAGSEGGSESARKVAIEEGKALAENEDLLFFETSA
                     KSGLNVRQVFLAIANKIPQESGRRVATAVNGARTGADAGGRVDLNTPATASSSPSACN
                     C"
     gene            complement(<806682..>808730)
                     /locus_tag="AWJ20_4878"
                     /db_xref="GeneID:30037057"
     mRNA            complement(<806682..>808730)
                     /locus_tag="AWJ20_4878"
                     /product="hypothetical protein"
                     /transcript_id="XM_018881979.1"
                     /db_xref="GeneID:30037057"
     CDS             complement(806682..808730)
                     /locus_tag="AWJ20_4878"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736404.1"
                     /db_xref="GeneID:30037057"
                     /translation="MSTAVDNGAQGSAAQNEIQSGSGVSVGAGGAGGADGTGGTGGKG
                     SIGETKGGGVQNEQIGLANGSGAGAGIIKSTSGSPALSGPLAPRTTFDLEPNPFEQSF
                     ASNATSTGSKSVSPANISGTAGVVVGAGGAGGAGIGIGAGIGGISGISGAAGGANGGA
                     NGGLGPLAPSIIGTTGTGQQIVATPGGRRHILPPVTALASPSALLSNPGSPGSSAWAN
                     SLKSGPLSPAMLQAPQSTEGTTPGGSVSVTGGLRLGAVPTLTSMIRTGLTPGGSGSMF
                     PTTPGPTTAAILGLTGPQPDGGLLAGHLLPNGAPVSQGQSPAQTQQQQQQQQQQQQGH
                     QAHLHGQNVANQNHGQTYPQRGIPANVAGAATGPTGLHQDQANAAANGLFMLSQTNGG
                     PGGPPGGHGNANSRGKGGADSSNARDGSSGGKSGSAGAAKTSNNNEKKGVKRSRKPDP
                     KDNAKERDTKAAKTKSKNTSTTARDTGIKNEQSDDNLDSDQDDDNDDDQNDTSNNSNG
                     SSNNKKSKQSVDEKRKSFLERNRVAALKCRQRKKQWLSDLQNKVEYLGTENEKLASQL
                     AMMADQVNGLKTVLLAHRDCGVPLPPNLLNMLMNERVMDPNMGDFRTTAAASAANGAQ
                     GTTQPPPNLGLLPTGLNTGIQNVPGDVALAQAHAQAQAQAHAQQQGLPQVNYRTVWPL
                     "
     gene            <811385..>813019
                     /gene="ICL1"
                     /locus_tag="AWJ20_4879"
                     /db_xref="GeneID:30037058"
     mRNA            <811385..>813019
                     /gene="ICL1"
                     /locus_tag="AWJ20_4879"
                     /product="isocitrate lyase 1"
                     /transcript_id="XM_018881980.1"
                     /db_xref="GeneID:30037058"
     CDS             811385..813019
                     /gene="ICL1"
                     /locus_tag="AWJ20_4879"
                     /inference="similar to AA sequence:KEGG_Orthology:K01637"
                     /note="Isocitrate lyase; catalyzes the formation of
                     succinate and glyoxylate from isocitrate, a key reaction
                     of the glyoxylate cycle; expression of ICL1 is induced by
                     growth on ethanol and repressed by growth on glucose;
                     GO_component: GO:0005575 - cellular_component [Evidence
                     ND]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0004451 - isocitrate lyase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004451 -
                     isocitrate lyase activity [Evidence IMP,ISS] [PMID
                     1551398]; GO_function: GO:0016829 - lyase activity
                     [Evidence IEA]; GO_process: GO:0019752 - carboxylic acid
                     metabolic process [Evidence IEA]; GO_process: GO:0006097 -
                     glyoxylate cycle [Evidence IEA,IEA]; GO_process:
                     GO:0006097 - glyoxylate cycle [Evidence TAS] [PMID
                     11092862]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0006099 - tricarboxylic
                     acid cycle [Evidence IEA]"
                     /codon_start=1
                     /product="isocitrate lyase 1"
                     /protein_id="XP_018736405.1"
                     /db_xref="GeneID:30037058"
                     /translation="MSVNIKAEEQAFQDEVAQLNAWWKEPRWAQTKRVYPAEEIARKR
                     GTLLPKYSSSTQADKLYKLLQEHDKNKTASFTYGALDPVQVTQMAKFLDTIYVSGWQS
                     SSTASTSNEPSPDLADYPMDTVPNKVEHLWFAQQFHDRKQREDRLSVPLSQREKLPYV
                     DYLRPIIADADTGHGGLTAIVKLTKMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPI
                     QEHINRLIAIRASADIFGSNLLAIARTDSEAATLLTSTIDYRDHYFIVGSTNPNIPPL
                     VDVMVEAEQRGVVGAELQKVEDNWIAQAKLKLFHEAVVDEINAGSYSNKKELTDKFLS
                     AVGPLTNQSNNQARQLAKKLLGKDVYFDWEKPRVREGYYRYRGGTQCAVNRARAYAPY
                     CDLIWMESKLPDYAQAKEFADGVKAAYPNKWLAYNLSPSFNWTTAMSPSDQRTYIDRL
                     AKLGYVWQFITLAGLHTNALISHNFAKRYSEIGMQAYGGDIQQPELDSGVDVVKHQKW
                     SGAEYVDNILKMITGGVTSTAAMGAGVTEDQFKSKA"
     gene            <816619..>818925
                     /gene="RGD1"
                     /locus_tag="AWJ20_4880"
                     /db_xref="GeneID:30037060"
     mRNA            <816619..>818925
                     /gene="RGD1"
                     /locus_tag="AWJ20_4880"
                     /product="Rgd1p"
                     /transcript_id="XM_018881982.1"
                     /db_xref="GeneID:30037060"
     CDS             816619..818925
                     /gene="RGD1"
                     /locus_tag="AWJ20_4880"
                     /note="GTPase-activating protein (RhoGAP) for Rho3p and
                     Rho4p; possibly involved in control of actin cytoskeleton
                     organization; GO_component: GO:0030479 - actin cortical
                     patch [Evidence IDA] [PMID 10931290]; GO_component:
                     GO:0005933 - cellular bud [Evidence IDA] [PMID 10931290];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_component: GO:0005628 - prospore
                     membrane [Evidence IDA] [PMID 24390141]; GO_function:
                     GO:0005096 - GTPase activator activity [Evidence IEA];
                     GO_function: GO:0005100 - Rho GTPase activator activity
                     [Evidence IDA,IGI] [PMID 10526184]; GO_function:
                     GO:0080025 - phosphatidylinositol-3,5-bisphosphate binding
                     [Evidence IDA,IMP] [PMID 18845541]; GO_function:
                     GO:0032266 - phosphatidylinositol-3-phosphate binding
                     [Evidence IDA,IMP] [PMID 18845541]; GO_function:
                     GO:0005546 - phosphatidylinositol-4,5-bisphosphate binding
                     [Evidence IDA] [PMID 21215255]; GO_function: GO:0070273 -
                     phosphatidylinositol-4-phosphate binding [Evidence
                     IDA,IMP] [PMID 18845541]; GO_function: GO:0010314 -
                     phosphatidylinositol-5-phosphate binding [Evidence
                     IDA,IMP] [PMID 18845541]; GO_process: GO:0007231 -
                     osmosensory signaling pathway [Evidence IGI] [PMID
                     10590461]; GO_process: GO:0043547 - positive regulation of
                     GTPase activity [Evidence IEA]; GO_process: GO:0001101 -
                     response to acid [Evidence IMP] [PMID 16087742];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Rgd1p"
                     /protein_id="XP_018736406.1"
                     /db_xref="GeneID:30037060"
                     /translation="MDSSNTPAANNGRSASNGSRLSNNTTTSSDEGDSNVSNNAPSTA
                     PTGSALTGPPITGPGIRKTSTVSTIGGGTGGSTSAGPASSIAPTTTTFNSSDTATTYS
                     LPQPASSSYLLEDARLREILMSDVGTEALLKRLKQSIHAAKELSSFLKKSSNLENEHM
                     GQVRKLASSAISEFAKPEYRQGTFAGQLNQLIKVNERSCDAARSFTTALVTMQKELAN
                     LSATVDKSRKSIKESALRHERQLLEAEQQAEKAKSKYDSLAEEFDKVRTGDPTKNKFG
                     FMHSKGAQHEEELHKKVQTAESDYKQKVENAQRLRSEQINKNRPAAIKQLKDLILECD
                     SAMSFQLQKYANLHEILALNRGFIVAPLKPNGAANGNLTMKEMAAKIDNELDLYNYVI
                     GVPKTVSRLNRPLVQFQRHSTLAGAYPTGSIGNTTSSVPQSFQNNTTSPPPPISKAPG
                     AGIGGTVGAGIGAGVGAGAGLAAGLASGPNGPGSAGAGAGAPTAPAALNSHTAIGPSP
                     VLPPVATSEPFSVYPGNDTISPSSTIETQAVSTTASNFDTSAGPVPTVGQPGSGYPPG
                     TVHSRPSFGTPLDVLLDYEEATVPRVVFQCIQAVDNFGLEVEGIYRTSGNNNQVQEIK
                     RLFDLDAASVDLLHPTHGLNDIHSVAGALKLYFRELPDPLLTGQFHDEFVAAAKLPAG
                     DERRDGVHRIVNELPDPNYTTLRHLIFHLYRVQTREASNRMSISNLAIVWGPTLMSSS
                     LNNPEDMALEASVIETILVNAYTIFDAD"
     gene            complement(<819143..>821929)
                     /gene="CUL3"
                     /locus_tag="AWJ20_4881"
                     /db_xref="GeneID:30037061"
     mRNA            complement(<819143..>821929)
                     /gene="CUL3"
                     /locus_tag="AWJ20_4881"
                     /product="cullin CUL3"
                     /transcript_id="XM_018881983.1"
                     /db_xref="GeneID:30037061"
     CDS             complement(819143..821929)
                     /gene="CUL3"
                     /locus_tag="AWJ20_4881"
                     /inference="similar to AA sequence:KEGG_Orthology:K10609"
                     /note="Ubiquitin-protein ligase; forms a complex with
                     Elc1p that polyubiquitylates monoubiquitylated RNA
                     polymerase II to trigger its proteolysis; cullin family
                     member with similarity to Cdc53p and human CUL3;
                     GO_component: GO:0031463 - Cul3-RING ubiquitin ligase
                     complex [Evidence IDA] [PMID 16675952]; GO_component:
                     GO:0031463 - Cul3-RING ubiquitin ligase complex [Evidence
                     IMP] [PMID 17296727]; GO_component: GO:0031461 -
                     cullin-RING ubiquitin ligase complex [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0031625 - ubiquitin
                     protein ligase binding [Evidence IEA]; GO_function:
                     GO:0004842 - ubiquitin-protein transferase activity
                     [Evidence IDA] [PMID 12676951]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence IDA]
                     [PMID 16675952]; GO_process: GO:0016567 - protein
                     ubiquitination [Evidence IEA]; GO_process: GO:0042787 -
                     protein ubiquitination involved in ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 17296727];
                     GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     IC] [PMID 12676951]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     ISS] [PMID 9531531]"
                     /codon_start=1
                     /product="cullin CUL3"
                     /protein_id="XP_018736407.1"
                     /db_xref="GeneID:30037061"
                     /translation="MPKRKASSLWSPSSSPNSLKKTSSSGKVYAKAANIRTSTDLPTS
                     STSLPGSGSGSSSPLFEMQSSFPGPDLPISNQSSINNSRKLQNAIVGNRLLYGRAKPQ
                     TTRRLVIKSSSTTSDDSSTGNDNGKGKEPISGSGRARKMSSDAATKYYEETMEKLKTA
                     LEDILSPGLVGVAGIDKSELIPDSRGISQEELYRGVENLYRYNKAAILADLCLNTIEK
                     YAKKLPDVLQPHLESLTAHPLVRPMFGLDSELSSASASSNSSAHSLLDTNTPDAQAVS
                     HLYPFLRALDRLWKSWSQKIILVRNIFFYLDRAYLLPPQNKKKPIWDTGVDWFSKLIL
                     QDDVFNTIILTSISQIVNSYRVSLQSELSVVENISRMLASFKDDRSLLENEILSSAKE
                     LTNKDIDIKTIGIESFVDMLLNQITIEQRLGESLNFSTKFISTMVDNMKALLLKSRYK
                     DVFANLKVLLDKTDYERFQSLYTFSRELDLDTELLAAFRGYVINEGTSVLENNSAKST
                     KKGGSNLILSLLELYHRCLEIVRRGTKFPEPYELVDSNYEDAFRRAFAEFLNKDRSGM
                     VAEKLAKYADELLRSGIKACSEKELDEKFDELILIFRCVQGKDVFEAFYKKDFAKRLL
                     QSKSGGLDFEKSMISKLKVECGPSFTSRLETMIKDMELSKTYATEFREQAKSSKVKSI
                     AFNANILTQGHWPTLPETKIVLPPALVEYEKEFEKYYLAGKARRKLSWQHGLGNCIVK
                     ANFPRGTKELVLNLIQAVVLLQFNTFKDGVTTDEQVSYSQMKQSTQLDDSTLRRTLQS
                     LACGKVRILVKDPATREVDENDTFKVNLEFSSPVYKIKVSQIAAAEAGPKEAKKIHED
                     VNRDRQMEIQAAIIRLMKARKKLKHVELVQQTIDQIKERGLPNVQDIKKNIEKLLERE
                     YLERVDNTDTYIYV"
     gene            <825460..>826128
                     /gene="TRS33"
                     /locus_tag="AWJ20_4882"
                     /db_xref="GeneID:30037062"
     mRNA            <825460..>826128
                     /gene="TRS33"
                     /locus_tag="AWJ20_4882"
                     /product="Trs33p"
                     /transcript_id="XM_018881984.1"
                     /db_xref="GeneID:30037062"
     CDS             825460..826128
                     /gene="TRS33"
                     /locus_tag="AWJ20_4882"
                     /note="Core component of transport protein particle
                     (TRAPP) complexes I-III; TRAPP complexes are related
                     multimeric guanine nucleotide-exchange factor for the
                     GTPase Ypt1p, regulating ER-Golgi traffic (TRAPPI),
                     intra-Golgi traffic (TRAPPII), endosome-Golgi traffic
                     (TRAPPII and III) and autophagy (TRAPPIII); GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IEA,IEA];
                     GO_component: GO:1990070 - TRAPPI protein complex
                     [Evidence IDA] [PMID 11239471]; GO_component: GO:1990071 -
                     TRAPPII protein complex [Evidence IDA] [PMID 11239471];
                     GO_component: GO:1990072 - TRAPPIII protein complex
                     [Evidence IDA] [PMID 20375281]; GO_component: GO:0005801 -
                     cis-Golgi network [Evidence IDA] [PMID 19843283];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA,IEA]; GO_component: GO:0000407 - pre-autophagosomal
                     structure [Evidence IEA]; GO_component: GO:0005802 -
                     trans-Golgi network [Evidence IDA] [PMID 19843283];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006888 - ER to Golgi vesicle-mediated
                     transport [Evidence IGI] [PMID 9564032]; GO_process:
                     GO:0006914 - autophagy [Evidence IEA]; GO_process:
                     GO:0006461 - protein complex assembly [Evidence IGI] [PMID
                     19843283]; GO_process: GO:0006810 - transport [Evidence
                     IEA]; GO_process: GO:0016192 - vesicle-mediated transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Trs33p"
                     /protein_id="XP_018736408.1"
                     /db_xref="GeneID:30037062"
                     /translation="MESDSPYINGTNKLVAASSLDFLLIEIVPLAQSIVQQLIEDAGA
                     RPGRPGSSSSANGGGAGGAGGSNVSGGISGTSSSPANSSMTADENLDDVYYRIEGYGH
                     RVGLGLSQIFTKDRPWFTDQLDIMKFVCKELWVILYKKQIDNLKTNHRGTYVLTDTQF
                     KYCSRMGTAYGPKETLRRATPYLWFPAGVIRGALSALGIDAAVTFDADQLPKVTFNIQ
                     TSPT"
     gene            complement(<826385..>827491)
                     /gene="OCA1"
                     /locus_tag="AWJ20_4883"
                     /db_xref="GeneID:30037063"
     mRNA            complement(<826385..>827491)
                     /gene="OCA1"
                     /locus_tag="AWJ20_4883"
                     /product="putative tyrosine protein phosphatase OCA1"
                     /transcript_id="XM_018881985.1"
                     /db_xref="GeneID:30037063"
     CDS             complement(826385..827491)
                     /gene="OCA1"
                     /locus_tag="AWJ20_4883"
                     /inference="similar to AA sequence:KEGG_Orthology:K18043"
                     /codon_start=1
                     /product="putative tyrosine protein phosphatase OCA1"
                     /protein_id="XP_018736409.1"
                     /db_xref="GeneID:30037063"
                     /translation="MSIPSQSNGELASGQNNPAISSSIESQQQKSSGVSGAIDRTNGL
                     TNTNALHSGADTTAPTTSTTSTTYSSSTRTNKTNTDSLLNTGTGSTNTLTDSITNTIG
                     SVIAVADTGSSVVPNTSTEHNTTILLDQNTTTTNDSGTGSRNNGSSNNITTSTTSNST
                     TNDSTISSNTTSSNNTTVDKSSTTLAEIRRPPPVRLVPPLNFALAERQLYRSGQPAPI
                     NFPFLRGLNLKTIVWLAVEDPSDAFLGFADNNEIEFHHLGLVTEGGNPWDQLTESSIV
                     SALDIIMNVNNYPLLVCCGMGRHRTGTVIGCLRRVQGWNFASISDEYRRFVGAKGGRV
                     LIELHIEAFDTKSVHINLDYAPDWFKKTLPPPGA"
     gene            complement(<829550..>830287)
                     /gene="RAS1"
                     /locus_tag="AWJ20_4884"
                     /db_xref="GeneID:30037064"
     mRNA            complement(<829550..>830287)
                     /gene="RAS1"
                     /locus_tag="AWJ20_4884"
                     /product="Ras family GTPase RAS1"
                     /transcript_id="XM_018881986.1"
                     /db_xref="GeneID:30037064"
     CDS             complement(829550..830287)
                     /gene="RAS1"
                     /locus_tag="AWJ20_4884"
                     /inference="similar to AA sequence:KEGG_Orthology:K07827"
                     /note="GTPase involved in G-protein signaling in adenylate
                     cyclase activation; plays a role in cell proliferation;
                     localized to the plasma membrane; homolog of mammalian RAS
                     proto-oncogenes; relative distribution to the nucleus
                     increases upon DNA replication stress; RAS1 has a paralog,
                     RAS2, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 20162532];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 3513173]; GO_function: GO:0005525 - GTP binding
                     [Evidence IEA,IEA]; GO_function: GO:0003924 - GTPase
                     activity [Evidence IDA] [PMID 14674766]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IMP] [PMID
                     6327067]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_process: GO:0006184 - GTP catabolic
                     process [Evidence IEA]; GO_process: GO:0007189 - adenylate
                     cyclase-activating G-protein coupled receptor signaling
                     pathway [Evidence IDA] [PMID 3891097]; GO_process:
                     GO:0045762 - positive regulation of adenylate cyclase
                     activity [Evidence IGI] [PMID 2981630]; GO_process:
                     GO:0045762 - positive regulation of adenylate cyclase
                     activity [Evidence IGI] [PMID 3891097]; GO_process:
                     GO:0097271 - protein localization to bud neck [Evidence
                     IGI] [PMID 12782684]; GO_process: GO:0001302 - replicative
                     cell aging [Evidence IMP] [PMID 8034612]; GO_process:
                     GO:0007165 - signal transduction [Evidence IEA];
                     GO_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Ras family GTPase RAS1"
                     /protein_id="XP_018736410.1"
                     /db_xref="GeneID:30037064"
                     /translation="MLVREYKLVVVGGGGVGKSALTIQLIQSQFVDEYDPTIEDSYRK
                     QCLIDDEVVILDVLDTAGQEEYSAMREQYMRTGEGFLIVYSVTSRSSFDEVKNFHQQI
                     LRVKDQDAFPIVIIGNKIDLENERQVSFEEGQQLADSLGCPFLETSAKRRINVDDSFY
                     ALVTEVRKFNRGDSGSERTGSIKSKPSRPNNTSRSGTTTLNHEAAYYSGNTIGGGPTN
                     MAARSKRDPGTRYDEKPDNDGCCCIIS"
     gene            complement(<838397..>840295)
                     /gene="PHO23"
                     /locus_tag="AWJ20_4885"
                     /db_xref="GeneID:30037065"
     mRNA            complement(<838397..>840295)
                     /gene="PHO23"
                     /locus_tag="AWJ20_4885"
                     /product="Pho23p"
                     /transcript_id="XM_018881987.1"
                     /db_xref="GeneID:30037065"
     CDS             complement(838397..840295)
                     /gene="PHO23"
                     /locus_tag="AWJ20_4885"
                     /note="Component of the Rpd3L histone deacetylase complex;
                     involved in transcriptional regulation of PHO5; affects
                     termination of snoRNAs and cryptic unstable transcripts
                     (CUTs); C-terminus has similarity to human candidate tumor
                     suppressor p33(ING1) and its isoform ING3; GO_component:
                     GO:0033698 - Rpd3L complex [Evidence IDA] [PMID 16286007];
                     GO_component: GO:0033698 - Rpd3L complex [Evidence IDA]
                     [PMID 16286008]; GO_component: GO:0033698 - Rpd3L complex
                     [Evidence IDA] [PMID 16314178]; GO_component: GO:0033698 -
                     Rpd3L complex [Evidence IDA] [PMID 19040720];
                     GO_component: GO:0070210 - Rpd3L-Expanded complex
                     [Evidence IDA] [PMID 19040720]; GO_component: GO:0000118 -
                     histone deacetylase complex [Evidence IDA] [PMID
                     12672825]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 11914276]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0035064 -
                     methylated histone binding [Evidence IDA] [PMID 16728974];
                     GO_function: GO:0035064 - methylated histone binding
                     [Evidence IDA] [PMID 17142463]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IEA]; GO_process: GO:0016568 -
                     chromatin modification [Evidence IEA,IEA]; GO_process:
                     GO:0016568 - chromatin modification [Evidence IMP,IPI,ISS]
                     [PMID 10805724]; GO_process: GO:0061188 - negative
                     regulation of chromatin silencing at rDNA [Evidence IMP]
                     [PMID 16286008]; GO_process: GO:0061186 - negative
                     regulation of chromatin silencing at silent mating-type
                     cassette [Evidence IMP] [PMID 16286008]; GO_process:
                     GO:0031939 - negative regulation of chromatin silencing at
                     telomere [Evidence IMP] [PMID 16286008]; GO_process:
                     GO:0031939 - negative regulation of chromatin silencing at
                     telomere [Evidence IMP] [PMID 16314178]; GO_process:
                     GO:0031939 - negative regulation of chromatin silencing at
                     telomere [Evidence IMP] [PMID 19372273]; GO_process:
                     GO:0016479 - negative regulation of transcription from RNA
                     polymerase I promoter [Evidence IMP] [PMID 19270272];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 17210643]; GO_process: GO:0061408 - positive
                     regulation of transcription from RNA polymerase II
                     promoter in response to heat stress [Evidence IMP] [PMID
                     20398213]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Pho23p"
                     /protein_id="XP_018736411.1"
                     /db_xref="GeneID:30037065"
                     /translation="MEEQEQEVAYRGGGRLGKRNAAGQLTRAAPTDIYPGLNDMSDAL
                     EAIPMDIVRHFTLLKEIDAKCVGTTPLLGELIVEFLSLPVPSPATLQAALAASSSFGS
                     NEMQGQEPTNPAAAGSATGSGVAPGNAPVNGENDTSNSINNGNNNNNNNGDGNPANNN
                     SNGNNGDNSSNIGNNVQESQTDGASNNTANSGNTSAEPAVTGSNVLTVSEEEIASIVK
                     REELLAQIRRLINELVPCLEEKMHVAGVAADAMARHVARIDYDFDLICNNEIPERIQV
                     GSANHPAFIAETRLANEQQKGNQTSRSESRREAMAAKKAAAAADGLTGSAATGSGGAK
                     GGRNSTPVAGKGSGSAVSSAGSTTAGGAGSAFGSGATSGRGRGAGKNNGSASAGGNVS
                     ANGGAAGSGSVSSNYGNGLSHSNTPAPKRRKGAASAGNTTAGQPSALSNNSSNATAYN
                     SYNYEYQQSYAGQPGTNNGPGRPAGSNNGSAAAGNAGQTNQYNEYANGAGNTGTGSYN
                     GQGYNSNSNENSVIDGYEGSKYENEESISRPTTPAGGNGRRGGRQRTRTVGANSNSSS
                     ANAKDDGEPVYCYCQQVSFGEMVGCDGPECKREWFHLPCIGLSSPPKGQWFCEDCAAK
                     YKKPAVKR"
     gene            <840788..>842791
                     /gene="AEP3"
                     /locus_tag="AWJ20_4886"
                     /db_xref="GeneID:30037066"
     mRNA            <840788..>842791
                     /gene="AEP3"
                     /locus_tag="AWJ20_4886"
                     /product="Aep3p"
                     /transcript_id="XM_018881988.1"
                     /db_xref="GeneID:30037066"
     CDS             840788..842791
                     /gene="AEP3"
                     /locus_tag="AWJ20_4886"
                     /note="Peripheral mitochondrial inner membrane protein;
                     may facilitate use of unformylated tRNA-Met in
                     mitochondrial translation initiation; stabilizes the
                     bicistronic AAP1-ATP6 mRNA; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0019898 - extrinsic component of membrane [Evidence
                     IDA] [PMID 14742425]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005743 - mitochondrial
                     inner membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence IDA]
                     [PMID 14742425]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0016071 -
                     mRNA metabolic process [Evidence IMP] [PMID 14742425];
                     GO_process: GO:0070124 - mitochondrial translational
                     initiation [Evidence IGI] [PMID 19843529]"
                     /codon_start=1
                     /product="Aep3p"
                     /protein_id="XP_018736412.1"
                     /db_xref="GeneID:30037066"
                     /translation="MKNVSGQVLFPVARSLRRSFLVHRRTASTSTHGQHVPEKSDPTS
                     DLVADVGKSATDSLEKTEKLPEKESLQSPNLLQLSPDLPKFYQKLNDELRRYHQLMPL
                     RTSAGDETQSHSQNTLSTLLTMEQEAKIELDQTANANERERQKKKEKEHRQLSRQTQI
                     NASPTYIQSIIEVLTSMRTALTSSNNEMVLERKFTSKPLPKFPTQWSREGLVAYLQQL
                     TQYQHTNSKYSSPNGLISSIVKDLLRVNNPSTMNHLSTEAFNIGISYHARISDIRSCR
                     QLFQDMLSSGISVNTDTYNILLMSCRYRLGNVNDNWKVHPLRVVDGFLKQMRSKGIPA
                     NIDTWNIVLGTVPEGSNKSRVLTEMSKKNVPLSRRGLATCVGDIVQQVGPKLAMVYLD
                     KQLEKYNVGIDTVNTIISGLLNDDKLKADKAGIKFTPSVETVDVAWKYLHYAISKWDL
                     TPSTSVLNTFGRFFAANGKLDWFIGLYSAMVSHPEWNIQPNCITYQYLLEAAVRVPFH
                     PYKYEMVETINRISYKVPRTKQYQNWLLRAKTQFDYYNSLNLLSKNTFSMNRHATPET
                     TQNFVQAQHILKWADQTFKPDYTNVLPRLQIAKLLNLFPSDIPAEETQQHTRQSRRVY
                     SQTTKQFRATTSTQETATKQRLIRKGPYQKYIDDLEEEGLIEG"
     gene            <846302..>849751
                     /gene="NCR1"
                     /locus_tag="AWJ20_4887"
                     /db_xref="GeneID:30037067"
     mRNA            <846302..>849751
                     /gene="NCR1"
                     /locus_tag="AWJ20_4887"
                     /product="Ncr1p"
                     /transcript_id="XM_018881989.1"
                     /db_xref="GeneID:30037067"
     CDS             846302..849751
                     /gene="NCR1"
                     /locus_tag="AWJ20_4887"
                     /inference="similar to AA sequence:KEGG_Orthology:K12385"
                     /note="Vacuolar membrane protein; transits through the
                     biosynthetic vacuolar protein sorting pathway, involved in
                     sphingolipid metabolism; cells lacking Ncr1p exhibit high
                     levels of long chain bases (LCB), similar to the
                     accumulation of high amounts of lipids observed in
                     patients with Neimann-Pick C, a disease caused by
                     loss-of-function mutations in NPC1, the functional
                     ortholog of Ncr1p; GO_component: GO:0000329 - fungal-type
                     vacuole membrane [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 16138904]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0008158 -
                     hedgehog receptor activity [Evidence IEA]; GO_function:
                     GO:0046624 - sphingolipid transporter activity [Evidence
                     IMP] [PMID 14970192]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0006869 -
                     lipid transport [Evidence IEA]; GO_process: GO:0007165 -
                     signal transduction [Evidence IEA]; GO_process: GO:0006665
                     - sphingolipid metabolic process [Evidence IEA];
                     GO_process: GO:0006665 - sphingolipid metabolic process
                     [Evidence IMP] [PMID 14970192]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ncr1p"
                     /protein_id="XP_018736413.1"
                     /db_xref="GeneID:30037067"
                     /translation="MNFPWLNKTDEDSRDPEGVKRSDVDMHSCGDEDERYRCACSDCS
                     VACPELEPVRDGGKGRLAVSRCTLFGGRVLCFSLAVWVVYVILLSFLLMGLWGYRLVR
                     GRVVKANESLSLLYDDGEIDSEDEYEDDFYQRPAFLRRHSIGTRRTSDGLEEDDDYDD
                     DDDDANDNRRVANVIYNPRHHHSTAPYKLNTVLQDGFSRLGLICASFPAVVISFSLLV
                     VVILSFGLIRFQLEIDPVKLWVSPTSLEYSEKQHFDSNFGPFYRAQQMYLVNDTGPVL
                     SDYGTLQWWFSVEERIGRLRSSHYGVSYNDLCLKPLGDACVIQSVTQYFGGDINAVPE
                     NWQDKLQSCADSPVSCLPPFQQPLKKEMVFGGYIGDDVITSKALVISLVVENSDDPEK
                     LAVAQEWEELLEMFLFSVQKEAAYRGLRLSFNVEISLEKELNKSSNTDVRIVVLSYVF
                     MFLYASLALGSVTPQLSRRYLVKSKFSLGLFGIFVVLLSVISSVGLFSYFGIKCTLII
                     AEVIPFLILAVGVDNIFLLTHGLETVNLTHPNLSIEERLALALGHVGPSILLSTLCEV
                     SAFALGASVAMPAVRNFAIYSAGAVFFNSLLQMTMFMSALSLDQRRSEDDRADCFPCI
                     RIPRISGISRPSFSSFTARVLSSPSIFDGQPGPLPSGNHGGTNVFSDIIRKKYAPYIL
                     SPQVKPIVIAIFTGWLAISLSLLPHIELGLDQRLAVPSDSYLVDYFNDLYDYFGSGPP
                     VYFVTHDFKVTDRSSQQALCGRFSTCKEFSLMNILEQERKRPAVSYINDPAASWIDDF
                     LQWLNPDLDDCCRFKKGTNETEVCAPHASPRTCEVCYLDKKWDITMGGLPNGDEEFLK
                     YFNIWIEAPSDPCPLGGKAPYSHSVVVDDDSSSISTSNFRTAHTPLRSQSDFINAYAS
                     ARRIAQSIEDHTGVPTYPYSTFYIFFAQYSTIIYDTFRLLSVALFITFILSTILLGSI
                     RTAFSVCIVVACIVTNIGGIMALWDISLNAVSLVNLVICVGIGIEFCIHVARAYTFTP
                     RMDIAGYTAVSKEMRAFNALTGVGGSVFGGIALTKLIGVCVLAFTRSKIFEVYYFRMW
                     TALVLVASTHSLVFLPVVLTYIGGRGYLIDGGDEGVPGDLASRLYGSEENYGTEPEED
                     FLD"
     gene            complement(<850029..>850099)
                     /locus_tag="AWJ20_4888"
                     /db_xref="GeneID:30037068"
     tRNA            complement(<850029..>850099)
                     /locus_tag="AWJ20_4888"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:30037068"
     gene            <850799..>851839
                     /gene="HMT1"
                     /locus_tag="AWJ20_4889"
                     /db_xref="GeneID:30037069"
     mRNA            <850799..>851839
                     /gene="HMT1"
                     /locus_tag="AWJ20_4889"
                     /product="protein-arginine omega-N methyltransferase HMT1"
                     /transcript_id="XM_018881990.1"
                     /db_xref="GeneID:30037069"
     CDS             850799..851839
                     /gene="HMT1"
                     /locus_tag="AWJ20_4889"
                     /inference="similar to AA sequence:KEGG_Orthology:K11434"
                     /note="Nuclear SAM-dependent mono- and asymmetric
                     methyltransferase; modifies hnRNPs, including Npl3p and
                     Hrp1p, affecting their activity and nuclear export;
                     methylates U1 snRNP protein Snp1p and ribosomal protein
                     Rps2p; interacts genetically with genes encoding
                     components of Rpd3(L) and this interaction is important
                     for Rpd3 recruitment to the subtelomeric region;
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     8668183]; GO_function: GO:0008168 - methyltransferase
                     activity [Evidence IEA,IEA]; GO_function: GO:0035242 -
                     protein-arginine omega-N asymmetric methyltransferase
                     activity [Evidence IDA,IMP] [PMID 8647869]; GO_function:
                     GO:0035241 - protein-arginine omega-N
                     monomethyltransferase activity [Evidence IDA,IMP] [PMID
                     8647869]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0006406 - mRNA export from
                     nucleus [Evidence IGI] [PMID 10952997]; GO_process:
                     GO:0006406 - mRNA export from nucleus [Evidence IGI] [PMID
                     8668183]; GO_process: GO:0032259 - methylation [Evidence
                     IEA]; GO_process: GO:0060567 - negative regulation of
                     DNA-templated transcription, termination [Evidence IMP]
                     [PMID 20053728]; GO_process: GO:0018216 -
                     peptidyl-arginine methylation [Evidence IMP] [PMID
                     18515076]; GO_process: GO:0018216 - peptidyl-arginine
                     methylation [Evidence IMP] [PMID 20035717]; GO_process:
                     GO:0018216 - peptidyl-arginine methylation [Evidence IDA]
                     [PMID 22997150]; GO_process: GO:0018216 -
                     peptidyl-arginine methylation [Evidence IDA,IMP] [PMID
                     8647869]; GO_process: GO:0032968 - positive regulation of
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IMP] [PMID 20053728]; GO_process: GO:0006479 -
                     protein methylation [Evidence IEA]"
                     /codon_start=1
                     /product="protein-arginine omega-N methyltransferase HMT1"
                     /protein_id="XP_018736414.1"
                     /db_xref="GeneID:30037069"
                     /translation="MSDSMTDVSPAPEASNGDLNYSDQHYFNSYDHFGIHEEMLKDDV
                     RTTSYRNAIYQNRHMFKDKVVLDVGCGTGILSMFAARSGAKHVIGVDMSNIIHMARKI
                     VDLNGFSNKITLLHGKMEEVELPYPKVDIIISEWMGYFLLYESMLDTVLIARDKYLVE
                     GGLIFPDKATIYAAAIEDGDYKEEKIGFWNDVYGFDYSPFQELALADPLVDTVELRAV
                     ITDPCPIFDLDLYTITIEDLAFSREFSLKARRDDIAHAIVAWFDIEFSKCHKPIKFST
                     GPHAKYTHWKQTVFYLADEVLIKNGEYITGRLTSGPNSENPRNLDITITHKLETEDEK
                     RKSEGEAHYVMK"
     gene            complement(<852123..>855020)
                     /gene="VHC1"
                     /locus_tag="AWJ20_4890"
                     /db_xref="GeneID:30037071"
     mRNA            complement(<852123..>855020)
                     /gene="VHC1"
                     /locus_tag="AWJ20_4890"
                     /product="Vhc1p"
                     /transcript_id="XM_018881992.1"
                     /db_xref="GeneID:30037071"
     CDS             complement(852123..855020)
                     /gene="VHC1"
                     /locus_tag="AWJ20_4890"
                     /inference="similar to AA sequence:KEGG_Orthology:K14429"
                     /note="Vacuolar membrane cation-chloride cotransporter
                     (CCC); likely mediates K+ and Cl- cotransport into the
                     vacuole; has a role in potassium homeostasis and salt
                     tolerance; similar to mammalian electroneutral
                     Na(+)-(K+)-C1- cotransporter family; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 19001347]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0031166 - integral
                     component of vacuolar membrane [Evidence IDA] [PMID
                     23022132]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0015379 - potassium:chloride
                     symporter activity [Evidence IMP,ISA] [PMID 23022132];
                     GO_process: GO:0055075 - potassium ion homeostasis
                     [Evidence IGI] [PMID 23022132]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]; GO_process:
                     GO:0034486 - vacuolar transmembrane transport [Evidence
                     IMP] [PMID 23022132]"
                     /codon_start=1
                     /product="Vhc1p"
                     /protein_id="XP_018736415.1"
                     /db_xref="GeneID:30037071"
                     /translation="MDSKFGGAAYTGLSWSTFKDNFFPRFTSGAAGSQLPGKENFQDM
                     FGIFFPATSGIFAGASMSGDLKAPSKSIPKGTLWGLLVTFICYCLVILSIGSTVSRDL
                     LYRDLEIIRNSNLSPMLIIMGEFSTSLFSALMGVVGAAKLLQAIARDNLLPYTSWFGK
                     GYSTDDNPLPAIFLSYILTQITLLFDINQIAVFITMAYLMTFVVTNLACFLLKIASAP
                     NFRPSFKYFNSTSAGLGAALCVLSMFVADGISASAMICVIAMLFLTIHYISPPKPWGD
                     VSQTLIYHQVRKYLLRLRQDHVKFWRPQILLLVDDPRTSWSLIHFCNHLKKGGLYILG
                     HVMVTQDFTQSFPEMKKQQNSWMKLRDVSNIKGFVQIGAGPNVVWGARNVYLGSGLGG
                     MKPNITVLGFFELKNHYPSRHNNSHCRGDESLTGQHRSDEAIQIEDLPTDSCRKEPSI
                     TVTEWVHIIEDLLTMQANIAIAKGFPRLEFPTKESLNASLSDTKGYIDLYPIQMSAQI
                     VDENGAMSALSTNFDTYTLILQLGAILHTVPVWKKNHILRVVVFVEFGEDVASEESRI
                     KLLLEKLRINAEVLVLCLSAGNVCAYETIIHGKPDTSGRVHRLLGEDEWWIELQEARS
                     SNIDHGIHINSNVGDLIPDENLGNEANHQLRKIIDAKKRRHTVSELQRLGVSFSMHTN
                     NLMKSNLTKHGYDSDSSSSDSEVEFEDADDSLEMAEPRLFVRRRASSGGSLPGSTRPV
                     FTTPSQPTSEVARQIAAAALSAKQTKPSLIRTNSGTGSIKSKKLKPHFLGNTMPDTRV
                     VEEPEAGRRSIMFDETSTAPSSNRPSRPSSIKSGLSGLSTNKVTFDEQPAAALSQKSP
                     LSTMTSQKVSSSSNTSLTLTDTGVPEDEERDLSFNDLPAKAQHVILNDMMNQTSKDSV
                     VIFSTLPAPSPGTHKSEDESLEYVESLELWCQDLPPMILLHSQSMTVTTAL"
     gene            complement(<855368..>856006)
                     /gene="VHC1"
                     /locus_tag="AWJ20_4891"
                     /db_xref="GeneID:30037072"
     mRNA            complement(<855368..>856006)
                     /gene="VHC1"
                     /locus_tag="AWJ20_4891"
                     /product="Vhc1p"
                     /transcript_id="XM_018881993.1"
                     /db_xref="GeneID:30037072"
     CDS             complement(855368..856006)
                     /gene="VHC1"
                     /locus_tag="AWJ20_4891"
                     /note="Vacuolar membrane cation-chloride cotransporter
                     (CCC); likely mediates K+ and Cl- cotransport into the
                     vacuole; has a role in potassium homeostasis and salt
                     tolerance; similar to mammalian electroneutral
                     Na(+)-(K+)-C1- cotransporter family; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 19001347]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0031166 - integral
                     component of vacuolar membrane [Evidence IDA] [PMID
                     23022132]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0015379 - potassium:chloride
                     symporter activity [Evidence IMP,ISA] [PMID 23022132];
                     GO_process: GO:0055075 - potassium ion homeostasis
                     [Evidence IGI] [PMID 23022132]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]; GO_process:
                     GO:0034486 - vacuolar transmembrane transport [Evidence
                     IMP] [PMID 23022132]"
                     /codon_start=1
                     /product="Vhc1p"
                     /protein_id="XP_018736416.1"
                     /db_xref="GeneID:30037072"
                     /translation="MAPGGLSAGGKSSRPGTGSDVSSEISRSTSPKIALDDSVLLSAN
                     AIHGLDSRGGDSSDYDTVTSKTGLLHRKSKVKYGSTGGESFEPSHSLNRSITVVEEQQ
                     EKLHRNSQYSKMNTLEGVFVPTVLNVLSILMFLRFGFILGQTGILGMMVLLLASYGVN
                     LLTTLSISAISTNGTVRGGGAYYMISRSLGPEFGGSIGVIFYIGQVLNRCVL"
     gene            complement(<857008..>858786)
                     /gene="ABD1"
                     /locus_tag="AWJ20_4892"
                     /db_xref="GeneID:30037073"
     mRNA            complement(<857008..>858786)
                     /gene="ABD1"
                     /locus_tag="AWJ20_4892"
                     /product="Abd1p"
                     /transcript_id="XM_018881994.1"
                     /db_xref="GeneID:30037073"
     CDS             complement(857008..858786)
                     /gene="ABD1"
                     /locus_tag="AWJ20_4892"
                     /inference="similar to AA sequence:KEGG_Orthology:K00565"
                     /note="Methyltransferase; catalyzes the transfer of a
                     methyl group from S-adenosylmethionine to the GpppN
                     terminus of capped mRNA; nuclear protein that relocalizes
                     to the cytosol in response to hypoxia; GO_component:
                     GO:0016591 - DNA-directed RNA polymerase II, holoenzyme
                     [Evidence IPI] [PMID 11018011]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 22932476]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IPI] [PMID 11018011];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22932476]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0004482 - mRNA
                     (guanine-N7-)-methyltransferase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004482 - mRNA
                     (guanine-N7-)-methyltransferase activity [Evidence
                     IDA,ISS] [PMID 7623811]; GO_function: GO:0008168 -
                     methyltransferase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0006370 - 7-methylguanosine mRNA capping
                     [Evidence IEA,IEA]; GO_process: GO:0006370 -
                     7-methylguanosine mRNA capping [Evidence IDA] [PMID
                     7623811]; GO_process: GO:0036265 - RNA
                     (guanine-N7)-methylation [Evidence IEA,IEA]; GO_process:
                     GO:0006397 - mRNA processing [Evidence IEA]; GO_process:
                     GO:0032259 - methylation [Evidence IEA]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IMP] [PMID 14967145]"
                     /codon_start=1
                     /product="Abd1p"
                     /protein_id="XP_018736417.1"
                     /db_xref="GeneID:30037073"
                     /translation="MYDPARDAWNASTENSADEKDLEKVPNVGGDGDESGDTEDEAPV
                     RIETRGIETHDQNNDDYDGSTEQPESLVDRENNGKSRTSTGKAVIEAVEAVAEAAVDT
                     LTKAASATAAVLAEPVLSELDGEVIDEKNSQSASSTASQKSTVDEREKRADVKKQRSP
                     SPTSPPKELKKPSQRADVGERDREALEPDEKLNRTSANGGEKKENISEDSNNSEFRST
                     SRTTESTESKEETHSTSQKSTIDDKETTDNVKRQRSPSPASPPRKLKKPSRRSDVGER
                     DRKAQELREKLDKAAADDIRAHYNERPNKSIEERTQSPIIKLRSFNNLIKSVLIQIFS
                     RPRQVVLDIGCGKGGDLQKWSKQRISGLIGVDIADISIEQAKERYEHLRQKSFWADFC
                     VGDAFERTIEDIVHPDAFPVDFVSSQFTIHYSFENEQRARTMLSNVSRALKPGGTFIG
                     TTPDSDRLLEHISKLPAGVREWGNSAYRIQFEDEPPKSNDDLKDIFGYKYNFFLDDAV
                     TNVVEFMVPFEAFTELAKEYGLRLVLRRNFLDFFNDELASRRGRDRILFFCRILKVYK
                     EDGTPGIEGDQREAAGIYTVFAFEKE"
     gene            complement(<865737..>866093)
                     /gene="CMC1"
                     /locus_tag="AWJ20_4893"
                     /db_xref="GeneID:30037074"
     mRNA            complement(<865737..>866093)
                     /gene="CMC1"
                     /locus_tag="AWJ20_4893"
                     /product="COX assembly mitochondrial protein"
                     /transcript_id="XM_018881995.1"
                     /db_xref="GeneID:30037074"
     CDS             complement(865737..866093)
                     /gene="CMC1"
                     /locus_tag="AWJ20_4893"
                     /inference="similar to AA sequence:KEGG_Orthology:K18171"
                     /codon_start=1
                     /product="COX assembly mitochondrial protein"
                     /protein_id="XP_018736418.1"
                     /db_xref="GeneID:30037074"
                     /translation="MSSTPATAHTNLSSETSSTTATSASSGRKVPAWMLAPYEEKEVR
                     ARCQEQADRMCADKFLAFGRCSEKNQLLFSWKCAEQKKAMIDCVAYWGSTEKFEEVQD
                     RYITEKQEKLRKEGRL"
     gene            <866778..>867416
                     /gene="spc24"
                     /locus_tag="AWJ20_4894"
                     /db_xref="GeneID:30037075"
     mRNA            <866778..>867416
                     /gene="spc24"
                     /locus_tag="AWJ20_4894"
                     /product="spindle pole body protein Spc24"
                     /transcript_id="XM_018881996.1"
                     /db_xref="GeneID:30037075"
     CDS             866778..867416
                     /gene="spc24"
                     /locus_tag="AWJ20_4894"
                     /inference="similar to AA sequence:KEGG_Orthology:K11557"
                     /codon_start=1
                     /product="spindle pole body protein Spc24"
                     /protein_id="XP_018736419.1"
                     /db_xref="GeneID:30037075"
                     /translation="MSDELGNYFPLIQSTMEHFEIQEDIDTCDRTEQMFQRIQEKRKK
                     ITDESYDTLRALSRKLELAKAKTDPSEKSAAHREATQRLVQLDREKFALAKSLNELEQ
                     SNTSSQTTLDILRQELEDLKDADSIEETSSQYVDNAAVLKLKFYRSLGLRFSDDEDET
                     GLGSGKTSADGQSASTGLRVFIQSSTENRVHVFSIDKNYSSQFVANYIWDHM"
     gene            complement(<867689..>869290)
                     /locus_tag="AWJ20_4895"
                     /db_xref="GeneID:30037076"
     mRNA            complement(<867689..>869290)
                     /locus_tag="AWJ20_4895"
                     /product="Uncharacterized protein YKL098W"
                     /transcript_id="XM_018881997.1"
                     /db_xref="GeneID:30037076"
     CDS             complement(867689..869290)
                     /locus_tag="AWJ20_4895"
                     /codon_start=1
                     /product="Uncharacterized protein YKL098W"
                     /protein_id="XP_018736420.1"
                     /db_xref="GeneID:30037076"
                     /translation="MVGSFASLCEQVSVEYENFDVNVLIALVVAAVGRRHLVIQSKRV
                     SATREVLQTLARDVLGFREDRATVVVHCNADTTWHQLAKSILVNGNKFSHETECEIAG
                     SGSPNLFGDGNGSGNVNNEESVKREGVNGSPNINDEGSVHPNVSVPTFLIIENLDKTA
                     KLVQTMMISTLVERKLVVNKKSYPLPEDFVLVIIGHGHNLVPHLRDYMLLEHVVETDD
                     DHGLNADQPAHTGQMSSAVGAGINSDNVGGGSANVSAGGSGNGSTSATAGTGNGIGGI
                     GISTGSTESVNTPLTDIDRRGMSDPQLVQPVTRASESNSVLTPKGYYSGGGEDDSYRR
                     HSETAIVNATTQQGSGLYPGKHDLSALTKSNTNISNKSTSSFGVGVVSRRPTLPDFSP
                     PPGLHSSDNADTLSFQNLLSSMADKIPLITIAANIQRYMQDIVVALRTHRLVRSGVSP
                     QAVKDFHYLVRALSVLHDYEFVTPSIVSISARKLFPLRIQLCEPTDEPSLSYGGDIDL
                     VTQWMNKWDEDLVIEEILANVPCAM"
     gene            <869640..>870392
                     /gene="UTP11"
                     /locus_tag="AWJ20_4896"
                     /db_xref="GeneID:30037077"
     mRNA            <869640..>870392
                     /gene="UTP11"
                     /locus_tag="AWJ20_4896"
                     /product="Utp11p"
                     /transcript_id="XM_018881998.1"
                     /db_xref="GeneID:30037077"
     CDS             869640..870392
                     /gene="UTP11"
                     /locus_tag="AWJ20_4896"
                     /inference="similar to AA sequence:KEGG_Orthology:K14769"
                     /note="Subunit of U3-containing Small Subunit (SSU)
                     processome complex; involved in production of 18S rRNA and
                     assembly of small ribosomal subunit; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 12068309];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0032040 - small-subunit
                     processome [Evidence IEA]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 12068309];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0000480 - endonucleolytic cleavage in
                     5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000447 - endonucleolytic cleavage in ITS1
                     to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 15489292]; GO_process:
                     GO:0000472 - endonucleolytic cleavage to generate mature
                     5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
                     [Evidence IMP] [PMID 15489292]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA,IEA]; GO_process: GO:0042254
                     - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Utp11p"
                     /protein_id="XP_018736421.1"
                     /db_xref="GeneID:30037077"
                     /translation="MVALTHNIAKKQHRERAQPTERRKWGLLEKKKDYKLRSQDFHKK
                     ENHLKLLRRKATERNPDEFYHSMVNKKTDNRGILITERGNEVLSNGAAQLLKTQDSSY
                     VRTLTSGEIRKIEKLETELTFGGQGEHTVFVDSDSQAKSFDAAEYFGTHKSLLNRREN
                     RLRKNQLEEQDLSKTTLIPTDVDERTEQKLRKQKMAKYKELDQRLERQQQLSQVQQQM
                     DLQRELMKKGDKKKIITKDGKQTWKWKNVRKR"
     gene            complement(<871443..>873332)
                     /gene="HAS1"
                     /locus_tag="AWJ20_4897"
                     /db_xref="GeneID:30037078"
     mRNA            complement(<871443..>873332)
                     /gene="HAS1"
                     /locus_tag="AWJ20_4897"
                     /product="ATP-dependent RNA helicase HAS1"
                     /transcript_id="XM_018881999.1"
                     /db_xref="GeneID:30037078"
     CDS             complement(871443..873332)
                     /gene="HAS1"
                     /locus_tag="AWJ20_4897"
                     /inference="similar to AA sequence:KEGG_Orthology:K13179"
                     /note="ATP-dependent RNA helicase; involved in the
                     biogenesis of 40S and 60S ribosome subunits; localizes to
                     both the nuclear periphery and nucleolus; highly enriched
                     in nuclear pore complex fractions; constituent of 66S
                     pre-ribosomal particles; GO_component: GO:0030686 - 90S
                     preribosome [Evidence IDA] [PMID 12150911]; GO_component:
                     GO:0005635 - nuclear envelope [Evidence IDA] [PMID
                     10684247]; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 10684247]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 15049817]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     11583614]; GO_component: GO:0030687 - preribosome, large
                     subunit precursor [Evidence IDA] [PMID 17443350];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0004004 - ATP-dependent RNA helicase
                     activity [Evidence IDA] [PMID 15718299]; GO_function:
                     GO:0008026 - ATP-dependent helicase activity [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence IDA]
                     [PMID 15718299]; GO_function: GO:0008186 - RNA-dependent
                     ATPase activity [Evidence IDA] [PMID 15718299];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0003676 - nucleic acid
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006200
                     - ATP catabolic process [Evidence IEA]; GO_process:
                     GO:0000463 - maturation of LSU-rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 23788678]; GO_process: GO:0000462 - maturation of
                     SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15049817];
                     GO_process: GO:0006364 - rRNA processing [Evidence IEA];
                     GO_process: GO:0006364 - rRNA processing [Evidence IMP]
                     [PMID 15242642]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IMP] [PMID 15049817];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IMP] [PMID 23788678]; GO_process:
                     GO:0042274 - ribosomal small subunit biogenesis [Evidence
                     IMP] [PMID 15049817]; GO_process: GO:0042274 - ribosomal
                     small subunit biogenesis [Evidence IMP] [PMID 23788678];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase HAS1"
                     /protein_id="XP_018736422.1"
                     /db_xref="GeneID:30037078"
                     /translation="MSRKEKSVAVKSKKPRSSLSNGKSSSVKKTKAVEHSKKVASLKK
                     SRKQKEESPEESDIENDEDEVEDAEVEELDQEFDEVEGLLDVEAEENEDDEEEENEDD
                     EEENDDDEEEEEDEEKENGDENEFEDENGNITAPSKSAIVASSGSASGPDPTLFSELK
                     LSENTAKAITEMGFKKMTSVQARAIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLYS
                     LKFKPRNGTGVIIISPTRELALQIFGVARELMAHHTQTLGIVIGGANRRAEAEKLVKG
                     VNLIVATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPQRDD
                     RQSMLFSATQTTKVEDLARISLRPGPLYINVDSEKETSTADGLEQGYVVCDSDKRFLL
                     LFSFLRRNKNKKVIVFLSSCNCVKFYGELLNYIDLPVLDLHGKQKQQKRTNTFFEFCN
                     AKQGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTQGKGKSLMFLT
                     PSELGFLRYLKAAKVPLNEYEFPASKIANVQGQLEKLVSSNYWLNQSAKDGYRAYLQA
                     YSSHHLKTVYQIDKLDLVKVAKSFGFNIPPKVNITIGASGRAPKKNNGQNDYKKRKFN
                     NSSRR"
     gene            <875646..>877121
                     /gene="SUV3"
                     /locus_tag="AWJ20_4898"
                     /db_xref="GeneID:30037079"
     mRNA            <875646..>877121
                     /gene="SUV3"
                     /locus_tag="AWJ20_4898"
                     /product="Suv3p"
                     /transcript_id="XM_018882000.1"
                     /db_xref="GeneID:30037079"
     CDS             875646..877121
                     /gene="SUV3"
                     /locus_tag="AWJ20_4898"
                     /inference="similar to AA sequence:KEGG_Orthology:K17675"
                     /note="ATP-dependent RNA helicase; component of the
                     mitochondrial degradosome along with the RNase Dss1p; the
                     degradosome associates with the ribosome and mediates RNA
                     turnover; also required during splicing of the COX1
                     AI5_beta intron; GO_component: GO:0000262 - mitochondrial
                     chromosome [Evidence IDA] [PMID 21911497]; GO_component:
                     GO:0045025 - mitochondrial degradosome [Evidence IDA]
                     [PMID 12426313]; GO_component: GO:0005759 - mitochondrial
                     matrix [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004004 -
                     ATP-dependent RNA helicase activity [Evidence IDA] [PMID
                     12426313]; GO_function: GO:0004004 - ATP-dependent RNA
                     helicase activity [Evidence IDA] [PMID 17658549];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0008859 - exoribonuclease II activity
                     [Evidence IDA] [PMID 17658549]; GO_function: GO:0004386 -
                     helicase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0016817 - hydrolase activity, acting on
                     acid anhydrides [Evidence IEA]; GO_function: GO:0003676 -
                     nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0000372 - Group I intron splicing [Evidence
                     IGI] [PMID 20064926]; GO_process: GO:0006264 -
                     mitochondrial DNA replication [Evidence IMP] [PMID
                     21911497]; GO_process: GO:0000957 - mitochondrial RNA
                     catabolic process [Evidence IMP] [PMID 12426313]"
                     /codon_start=1
                     /product="Suv3p"
                     /protein_id="XP_018736423.1"
                     /db_xref="GeneID:30037079"
                     /translation="MKSARIPCNLVTGEEVIEEFDETGRPAGLCSGTVEMMDINRQMD
                     VAVLDEIQMIDDAERGWAWTQAFLAVQAREIHLCGDPNTEELVRKLAAQAGDELEVVN
                     YTRLSPLEIEKRELGDDLQKLQPGDCLVFFSKRHILAAKNIIEAETGDKCAVIYGSLP
                     AETRSKQAELFNDPDSDVKYLVASDAIGMGLNLAVRRIIFSRVRKFNGHELIKLPIAQ
                     VKQIAGRAGRFQTAPSKDSRDTRSTGNVGYVTSLHAHDREYIEQCLALPSPPVKQAAF
                     FPSDTIIQEFAHFIGPQSPYHQMLARLEASIKLPPLYKFVDLSNMITTSKIFANIRGL
                     LLEEMMTLAKAPVSSTDERVKSAFYSFCLVIANGQSKTITEIPNTGVGYLGMSVIPNA
                     RPSDTFESIHRVLSLYLWLSYRFPTHFLDRTGAMQLKELCETKINDLLKKSPSISRIV
                     GRKKAKSFKATALHDDSEPLNHLQPPSPRRPRAPTRRYSSF"
     gene            <877948..>878958
                     /gene="ARP2"
                     /locus_tag="AWJ20_4899"
                     /db_xref="GeneID:30037080"
     mRNA            <877948..>878958
                     /gene="ARP2"
                     /locus_tag="AWJ20_4899"
                     /product="actin-related protein 2"
                     /transcript_id="XM_018882001.1"
                     /db_xref="GeneID:30037080"
     CDS             877948..878958
                     /gene="ARP2"
                     /locus_tag="AWJ20_4899"
                     /inference="similar to AA sequence:KEGG_Orthology:K17260"
                     /note="Essential component of the Arp2/3 complex; Arp2/3
                     is a highly conserved actin nucleation center required for
                     the motility and integrity of actin patches; involved in
                     endocytosis and membrane growth and polarity; required for
                     efficient Golgi-to-ER trafficking in COPI mutants;
                     GO_component: GO:0005885 - Arp2/3 protein complex
                     [Evidence IEA]; GO_component: GO:0005885 - Arp2/3 protein
                     complex [Evidence IDA] [PMID 10377407]; GO_component:
                     GO:0030479 - actin cortical patch [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005856 - cytoskeleton [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 11248049]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0005524 -
                     ATP binding [Evidence IDA,IMP] [PMID 15657399];
                     GO_function: GO:0016887 - ATPase activity [Evidence IMP]
                     [PMID 16862144]; GO_function: GO:0003779 - actin binding
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006200 - ATP
                     catabolic process [Evidence IMP] [PMID 16862144];
                     GO_process: GO:0034314 - Arp2/3 complex-mediated actin
                     nucleation [Evidence IEA]; GO_process: GO:0034314 - Arp2/3
                     complex-mediated actin nucleation [Evidence IMP] [PMID
                     16862144]; GO_process: GO:0032258 - CVT pathway [Evidence
                     IMP] [PMID 18287533]; GO_process: GO:0007015 - actin
                     filament organization [Evidence IMP] [PMID 10377407];
                     GO_process: GO:0030476 - ascospore wall assembly [Evidence
                     IMP] [PMID 17118118]; GO_process: GO:0051654 -
                     establishment of mitochondrion localization [Evidence IMP]
                     [PMID 16107558]; GO_process: GO:0000001 - mitochondrion
                     inheritance [Evidence IMP,IPI] [PMID 11248049];
                     GO_process: GO:0030833 - regulation of actin filament
                     polymerization [Evidence IEA]"
                     /codon_start=1
                     /product="actin-related protein 2"
                     /protein_id="XP_018736424.1"
                     /db_xref="GeneID:30037080"
                     /translation="MCGDEASAVRSALQVSYPMENGIIRNWEDMGHLWDYSFYERMKI
                     DPRGRKILLTEPPLNPVANREKMVGTMFEKYGFNGVYVAIQAVLALYAQGLSSGVVVD
                     SGDGVTHIVPVYESVVLNHLTRRLDIAGRDITRNLINLLLRRGYAFNRTADFETVRQI
                     KEKFCYVSYDLEYDDRLANETTALMETYELPDGRTIKLGPERFQAPECLFQPHLVDSE
                     QPGVAEFLFNTIQAADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWLTRVLNG
                     DPERLSKFKVRIEDPPRRRHMVFLGGAVLANIMHDKEHMWISKAEWEEHGANILSKLG
                     PR"
     gene            complement(<879174..>880973)
                     /locus_tag="AWJ20_4900"
                     /db_xref="GeneID:30037083"
     mRNA            complement(<879174..>880973)
                     /locus_tag="AWJ20_4900"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882004.1"
                     /db_xref="GeneID:30037083"
     CDS             complement(879174..880973)
                     /locus_tag="AWJ20_4900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736425.1"
                     /db_xref="GeneID:30037083"
                     /translation="MKDLITDFTSGVRLIQLLEIIGNEPLGRYNPNPRLNVQKAENIN
                     TALAFIKHRGILLHNIGAGDIIEGNLKLILGLLWILILRFTISEINEEGLSAKEGLLL
                     WCQRKTAGYPGVNIKDFSSSWTDGLAFCALMDRHRPDLIDFDELDKSNHKKNVSLAFK
                     LAAEEVGIPQLLDVEDICDVKSPDERSVMTYVAYWFHAFSALDKIETAGRRLEKFVDV
                     TSSALTMQHNFEKRMKVLIQSIKKTQESWAKSEFSGTYSDAKLQSSRFSEYKKTTKRE
                     WITEKSELASLLGNIRTKLATYGLREYVPPEGLRLQDLEQIWRELISAEATRSRAINN
                     TMRQIKEKLRKNFADTANELSLSLDTVSLKISDLEGELEKQLEGITILSDQLKPLDRM
                     LADLKKLDDQCLEANVEENDYTVYSLNELEYELGLAKQSVVKKLAFIENQIVARSMTN
                     LTPIQLEEFESVFRFFDKGQRNSLQESEFSGALASLGLVYSEEEMHQVFVVASGGNSR
                     VSFEEFIKFMVEVTEDQQTAEQVYQSFFDIANGKPYVTELDLQNSLIPDSMIDELKNS
                     MPLAKGANESEEEGVSLDYVTYMSQLTGVNGHK"
     gene            complement(<882712..>882801)
                     /locus_tag="AWJ20_4901"
                     /db_xref="GeneID:30037084"
     tRNA            complement(<882712..>882801)
                     /locus_tag="AWJ20_4901"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:30037084"
     gene            <884710..>885375
                     /gene="hus1"
                     /locus_tag="AWJ20_4902"
                     /db_xref="GeneID:30037085"
     mRNA            <884710..>885375
                     /gene="hus1"
                     /locus_tag="AWJ20_4902"
                     /product="checkpoint clamp complex protein Hus1"
                     /transcript_id="XM_018882005.1"
                     /db_xref="GeneID:30037085"
     CDS             884710..885375
                     /gene="hus1"
                     /locus_tag="AWJ20_4902"
                     /inference="similar to AA sequence:KEGG_Orthology:K10903"
                     /codon_start=1
                     /product="checkpoint clamp complex protein Hus1"
                     /protein_id="XP_018736426.1"
                     /db_xref="GeneID:30037085"
                     /translation="MYRAIRSFDTGGRGIGSISLKLRRQNKTPLLRVSFEQSMGIGDS
                     TYVQHEFPVRLVRVDERKAIEEPQCPPPDLYLELPNALSEINRVIDKFKALGTHVRIR
                     VNKLGHISFEVHGDGLRVESTFKYGKVVLAVDDENNTTQPPELEQDPYSNEPANDPSV
                     TVMLKDLSNVLRITTVVKRIVVGVCNEYALILYCYLDRDPDKHDDSGDEEVLTYYMSH
                     FDV"
     gene            complement(<885684..>886841)
                     /gene="SER1"
                     /locus_tag="AWJ20_4903"
                     /db_xref="GeneID:30037086"
     mRNA            complement(<885684..>886841)
                     /gene="SER1"
                     /locus_tag="AWJ20_4903"
                     /product="O-phospho-L-serine:2-oxoglutarate transaminase"
                     /transcript_id="XM_018882006.1"
                     /db_xref="GeneID:30037086"
     CDS             complement(885684..886841)
                     /gene="SER1"
                     /locus_tag="AWJ20_4903"
                     /inference="similar to AA sequence:KEGG_Orthology:K00831"
                     /note="3-phosphoserine aminotransferase; catalyzes the
                     formation of phosphoserine from 3-phosphohydroxypyruvate,
                     required for serine and glycine biosynthesis; regulated by
                     the general control of amino acid biosynthesis mediated by
                     Gcn4p; protein abundance increases in response to DNA
                     replication stress; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0004648 -
                     O-phospho-L-serine:2-oxoglutarate aminotransferase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004648 -
                     O-phospho-L-serine:2-oxoglutarate aminotransferase
                     activity [Evidence IMP,ISS] [PMID 8017107]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA]; GO_function: GO:0008483 - transaminase
                     activity [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0006564 - L-serine biosynthetic process [Evidence
                     IEA,IEA]; GO_process: GO:0006564 - L-serine biosynthetic
                     process [Evidence IMP,ISS] [PMID 8017107]; GO_process:
                     GO:0008652 - cellular amino acid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0009113 - purine nucleobase
                     biosynthetic process [Evidence IMP] [PMID 10509016];
                     GO_process: GO:0009070 - serine family amino acid
                     biosynthetic process [Evidence IMP] [PMID 1326413]"
                     /codon_start=1
                     /product="O-phospho-L-serine:2-oxoglutarate transaminase"
                     /protein_id="XP_018736427.1"
                     /db_xref="GeneID:30037086"
                     /translation="MVLNKLDRAPPHYFGAGPALLPTEVLQQAAVELIQYQNLGIGLG
                     EMSHRSSQAIDIINTTKQKVTQLLDVPDTHEVFFAQGGGTGGFAAVAGNLLAAHAHKT
                     GKKGVANYIVTGSWSQKAAEEAERLGADVNIVVDARKFTPNGKYGVIPAQSDWKFTPN
                     AEDIAYVYYCDNETVGGVEFHAPPEVPEGVELVADMSSNFLSKPVDVSKFGLIFGGAQ
                     KNIGIAGISLYIIKKSLLQHASLEQLRQLQVPIIPIFLDFPTLVKNNSAYNTLSIFAL
                     RIVQLNVEHLLAKGGLKAQGEESKRKAAKIYALLDKHPEIYKSPVAPTARSNMNIVFT
                     IPGDGKEETFIKEAAIWGLTGLKGHRSVGGIRVSNCKSTGDVLPPAAGAPP"
     gene            <888611..>889315
                     /locus_tag="AWJ20_4904"
                     /db_xref="GeneID:30037087"
     mRNA            <888611..>889315
                     /locus_tag="AWJ20_4904"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882007.1"
                     /db_xref="GeneID:30037087"
     CDS             888611..889315
                     /locus_tag="AWJ20_4904"
                     /inference="similar to AA sequence:KEGG_Orthology:K13119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736428.1"
                     /db_xref="GeneID:30037087"
                     /translation="MESNGGLVSLKELRRRKEEAKRLAAGGVNVPTEEIKPAEEATNS
                     QDRSTSSPAASTDSGERKRELTSDNSTITTTKSRFKKRKQVFSKLSFANDEDEEDDNE
                     RDNGPSRPVSKLKRDPTIDTSNLKTKKQILKDRELLNKEKNSEAQKHAIIREQVVNFP
                     FVYYDGSETASFVEIKKGDPVWMILEKTRKGFKKFHRGTVDDIMLVKHNVIIPHVSPP
                     PLLLHHTSIYSLNLFY"
     gene            complement(<889958..>890764)
                     /gene="BUD23"
                     /locus_tag="AWJ20_4905"
                     /db_xref="GeneID:30037088"
     mRNA            complement(<889958..>890764)
                     /gene="BUD23"
                     /locus_tag="AWJ20_4905"
                     /product="Bud23p"
                     /transcript_id="XM_018882008.1"
                     /db_xref="GeneID:30037088"
     CDS             complement(889958..890764)
                     /gene="BUD23"
                     /locus_tag="AWJ20_4905"
                     /inference="similar to AA sequence:KEGG_Orthology:K19306"
                     /note="Methyltransferase; methylates residue G1575 of 18S
                     rRNA; required for rRNA processing and nuclear export of
                     40S ribosomal subunits independently of methylation
                     activity; diploid mutant displays random budding pattern;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005730 - nucleolus [Evidence
                     IDA] [PMID 18332120]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0008757 -
                     S-adenosylmethionine-dependent methyltransferase activity
                     [Evidence ISS] [PMID 9873020]; GO_function: GO:0008168 -
                     methyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0016435 - rRNA (guanine) methyltransferase
                     activity [Evidence IMP] [PMID 18332120]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0000282 - cellular bud site selection
                     [Evidence IMP] [PMID 11452010]; GO_process: GO:0000447 -
                     endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
                     5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     18332120]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0032259 - methylation
                     [Evidence IEA]; GO_process: GO:0070476 - rRNA
                     (guanine-N7)-methylation [Evidence IMP] [PMID 18332120];
                     GO_process: GO:0000056 - ribosomal small subunit export
                     from nucleus [Evidence IMP] [PMID 18332120]"
                     /codon_start=1
                     /product="Bud23p"
                     /protein_id="XP_018736429.1"
                     /db_xref="GeneID:30037088"
                     /translation="MSRPEYTAPPEVFYNDDESKKYTTSTRVQHIQAEMTLRALELLN
                     VPPSQHILDIGCGSGLSGEILSEEGHSWIGMDISTSMIANAVDREVEGDLFLADMGSG
                     IPFRAGSFDAAISISAIQWLCNADTSTANPKKRLMTFFQTLYASLKRGGKVVCQFYPS
                     NDKQTDAILNAAKMTGFAGGLVVDDAESKKNKKYYLVLAAGQTDADQEINLDGVKMDA
                     SAMVTSKKRRNKKDESRKDYIMRKKELMRKRGKTIAKDSKFTARKRGPKF"
     gene            complement(<892332..>893027)
                     /gene="VMA4"
                     /locus_tag="AWJ20_4906"
                     /db_xref="GeneID:30037089"
     mRNA            complement(<892332..>893027)
                     /gene="VMA4"
                     /locus_tag="AWJ20_4906"
                     /product="H(+)-transporting V1 sector ATPase subunit E"
                     /transcript_id="XM_018882009.1"
                     /db_xref="GeneID:30037089"
     CDS             complement(892332..893027)
                     /gene="VMA4"
                     /locus_tag="AWJ20_4906"
                     /inference="similar to AA sequence:KEGG_Orthology:K02150"
                     /note="Subunit E of the V1 domain of the vacuolar
                     H+-ATPase (V-ATPase); V-ATPase is an electrogenic proton
                     pump found throughout the endomembrane system; V1 domain
                     has eight subunits; required for the V1 domain to assemble
                     onto the vacuolar membrane; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence TAS]
                     [PMID 11717306]; GO_component: GO:0000329 - fungal-type
                     vacuole membrane [Evidence IDA] [PMID 23708375];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0033178 -
                     proton-transporting two-sector ATPase complex, catalytic
                     domain [Evidence IEA]; GO_component: GO:0005774 - vacuolar
                     membrane [Evidence IEA]; GO_component: GO:0000221 -
                     vacuolar proton-transporting V-type ATPase, V1 domain
                     [Evidence IDA] [PMID 16774922]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA]; GO_function: GO:0046961 -
                     proton-transporting ATPase activity, rotational mechanism
                     [Evidence IEA]; GO_function: GO:0046961 -
                     proton-transporting ATPase activity, rotational mechanism
                     [Evidence TAS] [PMID 10224039]; GO_function: GO:0046961 -
                     proton-transporting ATPase activity, rotational mechanism
                     [Evidence TAS] [PMID 9442887]; GO_process: GO:0015991 -
                     ATP hydrolysis coupled proton transport [Evidence IEA];
                     GO_process: GO:0006811 - ion transport [Evidence IEA];
                     GO_process: GO:0015992 - proton transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0007035 - vacuolar acidification [Evidence
                     TAS] [PMID 10224039]; GO_process: GO:0007035 - vacuolar
                     acidification [Evidence TAS] [PMID 9442887]"
                     /codon_start=1
                     /product="H(+)-transporting V1 sector ATPase subunit E"
                     /protein_id="XP_018736430.1"
                     /db_xref="GeneID:30037089"
                     /translation="MPANQALSDDQVAGELQKMVEFIKKEADEKAKEIELKANEEYEI
                     DKATVVRSETASIDHLYERKYKQSELSQQIAKSTIANQIRLKVLRAKEDALSEILEEA
                     AQKLKTVANDKAKYETVLDGLIQEGLFALMDDKISLRVREADVGLVEKAIPSAIKAFE
                     EKTSHTGTQVSIDKDNFLPKDSAGGVIIVNSTGKIDVDNTLEERLKLLSETSLPQIRL
                     ALFGASASRKHFD"
     gene            <894757..>895827
                     /locus_tag="AWJ20_4907"
                     /db_xref="GeneID:30037090"
     mRNA            <894757..>895827
                     /locus_tag="AWJ20_4907"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882010.1"
                     /db_xref="GeneID:30037090"
     CDS             894757..895827
                     /locus_tag="AWJ20_4907"
                     /inference="similar to AA sequence:KEGG_Orthology:K14715"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736431.1"
                     /db_xref="GeneID:30037090"
                     /translation="MITSLGIGILVGTSLIVIIPEGADAMYSIGLAQGTGSAVDAFGG
                     DKGMTGDGTEMDSGAGGGGGGGLDSRKSIGLALIAGYLLMYLIDKLPSSWDGLWSLIR
                     HRRGGRNRFNMGIDMSSLRFTSLGSGGGTGGVGGGVGGGRSSDSIERGLGSGGSGGSG
                     GSGGHGLSGGGLGGGSGGGVGGGGGEVKSTSTAIGLIIHAIADGVALGASVSTESSAL
                     ETIIFLAIMIHKAPASFGLTTVLIGSGVDLDKVKRDLIAFAAAAPVGAILTYFLISIL
                     GSNDSELIQWWTGVLLVFSGGTFLYVAVHAMSELHDVNSPINSLEYSSSSSPTPIEPS
                     MDLLLSSVGMLVPLVTFFVPDV"
     gene            <899325..>900770
                     /gene="CSR1"
                     /locus_tag="AWJ20_4908"
                     /db_xref="GeneID:30037091"
     mRNA            <899325..>900770
                     /gene="CSR1"
                     /locus_tag="AWJ20_4908"
                     /product="Csr1p"
                     /transcript_id="XM_018882011.1"
                     /db_xref="GeneID:30037091"
     CDS             899325..900770
                     /gene="CSR1"
                     /locus_tag="AWJ20_4908"
                     /note="Phosphatidylinositol transfer protein; has a
                     potential role in regulating lipid and fatty acid
                     metabolism under heme-depleted conditions; interacts
                     specifically with thioredoxin peroxidase; may have a role
                     in oxidative stress resistance; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     12869188]; GO_component: GO:0005768 - endosome [Evidence
                     IEA,IEA]; GO_component: GO:0005768 - endosome [Evidence
                     IDA] [PMID 10848624]; GO_component: GO:0005768 - endosome
                     [Evidence IDA] [PMID 12869188]; GO_component: GO:0005811 -
                     lipid particle [Evidence IDA] [PMID 17803462];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005628 -
                     prospore membrane [Evidence IDA] [PMID 24390141];
                     GO_function: GO:0008525 - phosphatidylcholine transporter
                     activity [Evidence IDA] [PMID 10848624]; GO_function:
                     GO:0008526 - phosphatidylinositol transporter activity
                     [Evidence IDA] [PMID 10848624]; GO_process: GO:0043001 -
                     Golgi to plasma membrane protein transport [Evidence IGI]
                     [PMID 10848624]; GO_process: GO:0006893 - Golgi to plasma
                     membrane transport [Evidence IGI] [PMID 16126894];
                     GO_process: GO:0016042 - lipid catabolic process [Evidence
                     IEA]; GO_process: GO:0006629 - lipid metabolic process
                     [Evidence IEA]; GO_process: GO:0006869 - lipid transport
                     [Evidence IEA]; GO_process: GO:0045717 - negative
                     regulation of fatty acid biosynthetic process [Evidence
                     IDA,IGI,IMP] [PMID 17803462]; GO_process: GO:1901352 -
                     negative regulation of phosphatidylglycerol biosynthetic
                     process [Evidence IGI] [PMID 12869188]; GO_process:
                     GO:0046488 - phosphatidylinositol metabolic process
                     [Evidence IGI] [PMID 16262726]; GO_process: GO:0009395 -
                     phospholipid catabolic process [Evidence IEA]; GO_process:
                     GO:0015914 - phospholipid transport [Evidence IDA] [PMID
                     10848624]; GO_process: GO:2001247 - positive regulation of
                     phosphatidylcholine biosynthetic process [Evidence IGI]
                     [PMID 12869188]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Csr1p"
                     /protein_id="XP_018736432.1"
                     /db_xref="GeneID:30037091"
                     /translation="MTPTTSYPELNMTSSNVVRTFTASSRMSHISFGSSNSDLTPSNR
                     SILSESSDSTPLPEDYVIKVKQMYAHILVYTGDAPKSTIPGLMASTTKNFDHRAQNVL
                     KSHLYKISPDKFKTTYRNVVRAENFDIILLRYLKKRKFNVLKALALFADFMVWRVKFA
                     IDELNERGDEGALASGDEGFILQYKLGKAVFNQGRDKAGRPLVIVRVQRHNPKAQSDA
                     AMNRFIAKVFEDAKLLLLGYNESGAAIFDLTDFTISNMDYSAVKMINSCYKFYVGLLG
                     HVYIYNAPSIFLTIWKAIKVWLDPSLVARVTFTKNLSKHITADNLPPDMEGTQPHIYE
                     YKQVVPGENRKMKDLETIDRLQTTRGELFDLLSDLTVLWIKAPENTQLTHNLAKQRAL
                     VLDDLRRNYYQLDPYIRGRTVYDRDGTFGAIVPELTEGYAESEAAGIVLSQSASSIVT
                     AVNNPPPDSSPRASHSPKHMHTKVSLVPLIV"
     gene            <903030..>905768
                     /gene="APL5"
                     /locus_tag="AWJ20_4909"
                     /db_xref="GeneID:30037092"
     mRNA            <903030..>905768
                     /gene="APL5"
                     /locus_tag="AWJ20_4909"
                     /product="Apl5p"
                     /transcript_id="XM_018882012.1"
                     /db_xref="GeneID:30037092"
     CDS             903030..905768
                     /gene="APL5"
                     /locus_tag="AWJ20_4909"
                     /inference="similar to AA sequence:KEGG_Orthology:K12396"
                     /note="Delta adaptin-like subunit of the clathrin
                     associated protein complex; functions in transport of
                     alkaline phosphatase to the vacuole via the alternate
                     pathway; suppressor of loss of casein kinase 1 function;
                     the clathrin associated protein complex is also known as
                     AP-3; GO_component: GO:0030123 - AP-3 adaptor complex
                     [Evidence IMP] [PMID 9250663]; GO_component: GO:0005794 -
                     Golgi apparatus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0030665 - clathrin-coated vesicle membrane [Evidence
                     IEA]; GO_component: GO:0031410 - cytoplasmic vesicle
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0030117 - membrane coat
                     [Evidence IEA]; GO_function: GO:0005515 - protein binding
                     [Evidence IPI] [PMID 10559961]; GO_function: GO:0008565 -
                     protein transporter activity [Evidence IEA]; GO_process:
                     GO:0006896 - Golgi to vacuole transport [Evidence IMP]
                     [PMID 9335339]; GO_process: GO:0006886 - intracellular
                     protein transport [Evidence IEA]; GO_process: GO:0006623 -
                     protein targeting to vacuole [Evidence IMP] [PMID
                     17895371]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA,IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Apl5p"
                     /protein_id="XP_018736433.1"
                     /db_xref="GeneID:30037092"
                     /translation="MAIMKLTYLEMYGNDMSWASFHVLEVMSSAKFQQKRVGYLAAAQ
                     SFRANTDVLMLTTNLLKKDLGSANPLEVSTSLSAAASIVTPSLAHDLSPDILKMLNHS
                     RPYIRKKAVLAMYKVFLQYPEALPGAFPRLKDKLEDADPSVVSATVNVICELAKQTSG
                     TGSEITKTYLSLAPQLYELLTTSKNNWMLIKILKLFSALAPTEPRLKPKLLPPIIQLM
                     RTTTAMSLLYECINCIVSGDMLDEDDYEVAELCVSKLRTFLEEHDQNLKYVGLLALGK
                     IVVKHPQFVINLQDVILECADDKDLTIRDCVLDLIPGIVTENNIYHIVNKLMDQLRAS
                     RGILSPGSAGVAAGAGGTSAEDNKNNSALDNHNSRIIESIISVCSKDTYSLVPDFEWY
                     TTILVELVQLGTDNVGWRIGDQLRNIAIRVKSMRGVIVEASVRLLMNYQLMTHMPSVV
                     KFVVWIVGEYASLVPNVHELLTQLITSRYGDEEAELGYMANSGISGTFGMFTTFGSAV
                     SGGAGGNTSSSHGNGRHGPGSNSPSNAQFGTVEASIQAVVKLYSNWAGQANWPSGFHF
                     QVLEATNQLITYLEHYSTAISYEVQERAVGFLELVKVAKEAIEQLPDNSETPPLLLTL
                     AIPSMFNGYELNPVAQNSQRKIPLPEDLDLDTEIYPAYALSDIEDDYEIEDEASTLVD
                     GTTILIEDTPLTEQDLERKRLERLERQRDDPFYIPISSGNQTPLENSRSNTPTPGIAI
                     ANAGGSGSQPSSYTPGSHISSASQPSKFMPPPRRTKVEIIQDEKIDGVDDVDETTTTT
                     VKTKSKTSKSRSKPLFKIESRLTKLDLNPETSTTTDQAATLEVQKLRQQLLNESSSKP
                     AASSDEILVTHKKIKKKKPKSTTGEAGEATPKKKKKKKVTSSEPPAAAEPAPETMY"
     gene            <906218..>907750
                     /gene="RAD52"
                     /locus_tag="AWJ20_4910"
                     /db_xref="GeneID:30037094"
     mRNA            <906218..>907750
                     /gene="RAD52"
                     /locus_tag="AWJ20_4910"
                     /product="recombinase RAD52"
                     /transcript_id="XM_018882014.1"
                     /db_xref="GeneID:30037094"
     CDS             906218..907750
                     /gene="RAD52"
                     /locus_tag="AWJ20_4910"
                     /inference="similar to AA sequence:KEGG_Orthology:K10873"
                     /note="Protein that stimulates strand exchange; stimulates
                     strand exchange by facilitating Rad51p binding to
                     single-stranded DNA; anneals complementary single-stranded
                     DNA; involved in the repair of double-strand breaks in DNA
                     during vegetative growth and meiosis and UV induced sister
                     chromatid recombination; GO_component: GO:0000228 -
                     nuclear chromosome [Evidence IDA] [PMID 12766777];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11459964]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 22842922]; GO_function: GO:0000150 -
                     recombinase activity [Evidence IDA] [PMID 15205482];
                     GO_process: GO:0006277 - DNA amplification [Evidence IMP]
                     [PMID 23271978]; GO_process: GO:0000730 - DNA recombinase
                     assembly [Evidence IDA] [PMID 11459983]; GO_process:
                     GO:0006310 - DNA recombination [Evidence IEA,IEA];
                     GO_process: GO:0006281 - DNA repair [Evidence IEA,IEA];
                     GO_process: GO:0000733 - DNA strand renaturation [Evidence
                     IDA] [PMID 9619627]; GO_process: GO:0006974 - cellular
                     response to DNA damage stimulus [Evidence IEA];
                     GO_process: GO:0000727 - double-strand break repair via
                     break-induced replication [Evidence IMP] [PMID 17096599];
                     GO_process: GO:0000724 - double-strand break repair via
                     homologous recombination [Evidence IMP] [PMID 17096599];
                     GO_process: GO:0000724 - double-strand break repair via
                     homologous recombination [Evidence IMP] [PMID 24190138];
                     GO_process: GO:0045002 - double-strand break repair via
                     single-strand annealing [Evidence IGI] [PMID 11606529];
                     GO_process: GO:0000709 - meiotic joint molecule formation
                     [Evidence IGI,IMP] [PMID 18313389]; GO_process: GO:0006301
                     - postreplication repair [Evidence IMP] [PMID 7038396];
                     GO_process: GO:0000722 - telomere maintenance via
                     recombination [Evidence IMP] [PMID 11238918]"
                     /codon_start=1
                     /product="recombinase RAD52"
                     /protein_id="XP_018736434.1"
                     /db_xref="GeneID:30037094"
                     /translation="MPNYGDQHLSNGSRYGTNGGGGYLPNNNRSWSNGNASGSGTGSS
                     GNGGAAVNGTNFTIKESNHIRQQLGKQLGPEYISHRPGGGGLKVPYLEGWKVINLANE
                     VFGFNGWSSEIINHEIDYCDEIRDGRFNLGMSAKIRVTLRDGTYREDVGYGQVENARS
                     KGMAFDKCKKEATTDGLKRALRLFGNALGNCLYDSSYTRNISRVKVSMPPFDESQLIR
                     RPEIVTMQKAAAAAKAAREAAEAAELEELAALNTSTKPSIKSEASTVAASSTPQNGLA
                     AKGTNLTAVGTGNNGATSRIANNSGSGQPSLPSLPTKAFAKPDGSGVDSSSTAVSGSL
                     DFMPAGFLDSDDMFDDHEFAEIDGLPYIAPREEPVPAPARVPLNIKADTSIDTTANIT
                     ANTTADLTSNTTANTTANITNESGTTTNKPNKESEDHTASPVQFFSARAALAVQKDMI
                     PENSQFDPSFQSPSLRRTVPNKSVPIKKSSVNPLSQDPQPPTLASDRTPEPDSRKRMR
                     LD"
     gene            complement(<907976..>908749)
                     /gene="GCD7"
                     /locus_tag="AWJ20_4911"
                     /db_xref="GeneID:30037095"
     mRNA            complement(<907976..>908749)
                     /gene="GCD7"
                     /locus_tag="AWJ20_4911"
                     /product="translation initiation factor eIF2B subunit
                     beta"
                     /transcript_id="XM_018882015.1"
                     /db_xref="GeneID:30037095"
     CDS             complement(907976..908749)
                     /gene="GCD7"
                     /locus_tag="AWJ20_4911"
                     /inference="similar to AA sequence:KEGG_Orthology:K03754"
                     /note="Beta subunit of the translation initiation factor
                     eIF2B; the guanine-nucleotide exchange factor for eIF2;
                     activity subsequently regulated by phosphorylated eIF2;
                     first identified as a negative regulator of GCN4
                     expression; GO_component: GO:0005851 - eukaryotic
                     translation initiation factor 2B complex [Evidence
                     IDA,IGI,IPI] [PMID 8336705]; GO_component: GO:0005851 -
                     eukaryotic translation initiation factor 2B complex
                     [Evidence IMP] [PMID 8441423]; GO_component: GO:0005851 -
                     eukaryotic translation initiation factor 2B complex
                     [Evidence IDA,IPI] [PMID 8506384]; GO_component:
                     GO:0032045 - guanyl-nucleotide exchange factor complex
                     [Evidence IPI] [PMID 8336705]; GO_component: GO:0032045 -
                     guanyl-nucleotide exchange factor complex [Evidence IDA]
                     [PMID 8506384]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0030234 - enzyme regulator activity [Evidence IGI]
                     [PMID 8164676]; GO_function: GO:0030234 - enzyme regulator
                     activity [Evidence IGI,IPI] [PMID 8887689]; GO_function:
                     GO:0030234 - enzyme regulator activity [Evidence IMP]
                     [PMID 9032257]; GO_function: GO:0005085 -
                     guanyl-nucleotide exchange factor activity [Evidence IPI]
                     [PMID 8336705]; GO_function: GO:0005085 -
                     guanyl-nucleotide exchange factor activity [Evidence IDA]
                     [PMID 8506384]; GO_function: GO:0003743 - translation
                     initiation factor activity [Evidence IEA]; GO_function:
                     GO:0003743 - translation initiation factor activity
                     [Evidence IGI,IPI] [PMID 8336705]; GO_process: GO:0044237
                     - cellular metabolic process [Evidence IEA]; GO_process:
                     GO:0006417 - regulation of translation [Evidence IEA];
                     GO_process: GO:0006446 - regulation of translational
                     initiation [Evidence IGI] [PMID 8164676]; GO_process:
                     GO:0006446 - regulation of translational initiation
                     [Evidence IDA] [PMID 8506384]; GO_process: GO:0006446 -
                     regulation of translational initiation [Evidence IGI,IPI]
                     [PMID 8887689]; GO_process: GO:0006446 - regulation of
                     translational initiation [Evidence IMP] [PMID 9032257];
                     GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0006413 - translational initiation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="translation initiation factor eIF2B subunit
                     beta"
                     /protein_id="XP_018736435.1"
                     /db_xref="GeneID:30037095"
                     /translation="MFGLLSVDPSATSNSPTKALTNEEARKAHRDTKADIIEGIQELI
                     EEISNIDDSIAGMSVDMIHENEVLLTASPNSKTVLEFLLRASQKRTFTVLVTEGFPNE
                     VTASHEFALTLSKAGIHTVIIPDTATSAVMSRVGKVIIGTRAVLANGGCVSSSGVALV
                     CEAAKDYRVPVLAVTGLYKLSPLYPFDIDQLIEVGDTGKVIGFNDTGLMDKIGVMNPV
                     YDYVAPEHIDIYVTNIGGFSPSFTYRIILDHYSNQDVSL"
     gene            <909623..>910453
                     /locus_tag="AWJ20_4912"
                     /db_xref="GeneID:30037096"
     mRNA            <909623..>910453
                     /locus_tag="AWJ20_4912"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882016.1"
                     /db_xref="GeneID:30037096"
     CDS             909623..910453
                     /locus_tag="AWJ20_4912"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736436.1"
                     /db_xref="GeneID:30037096"
                     /translation="MTYFFVKAIPGVQDFGVHVASLASLTVADLISQINSRLPPAVAK
                     STYVSMQNGSIISQNRNQKLSEVFPDDPEYLLLRLNGCLCGGKGGFGSMLRDMGKKKR
                     KKGPRREEEMDSFKTLDGRSMKSIRQAKELLAHLDKLPEMEKQKIEKKRAKLLSIIDS
                     ANRATNSASSSKFSDTDYLETCEKLVSDVRQAVMNHSEESLSDSASVSSETSKSSKSS
                     VTDSEISSKSTSLKGKEKTTQKTPNIQITSSEEVVVATSRPKAMNFFEDEDYDEDDDE
                     "
     gene            <911509..>912012
                     /gene="JEN1"
                     /locus_tag="AWJ20_4913"
                     /db_xref="GeneID:30037097"
     mRNA            <911509..>912012
                     /gene="JEN1"
                     /locus_tag="AWJ20_4913"
                     /product="Jen1p"
                     /transcript_id="XM_018882017.1"
                     /db_xref="GeneID:30037097"
     CDS             911509..912012
                     /gene="JEN1"
                     /locus_tag="AWJ20_4913"
                     /inference="similar to AA sequence:KEGG_Orthology:K08178"
                     /note="Monocarboxylate/proton symporter of the plasma
                     membrane; transport activity is dependent on the pH
                     gradient across the membrane; mediates high-affinity
                     uptake of carbon sources lactate, pyuvate, and acetate,
                     and also of the micronutrient selenite, whose structure
                     mimics that of monocarboxylates; expression and
                     localization are tightly regulated, with transcription
                     repression, mRNA degradation, and protein endocytosis and
                     degradation all occurring in the presence of glucose;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 17710650];
                     GO_function: GO:0015144 - carbohydrate transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015355 - secondary active monocarboxylate
                     transmembrane transporter activity [Evidence IMP] [PMID
                     17710650]; GO_function: GO:0097079 - selenite:proton
                     symporter activity [Evidence IMP] [PMID 20861301];
                     GO_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA]; GO_process: GO:0034219 -
                     carbohydrate transmembrane transport [Evidence IEA];
                     GO_process: GO:0035879 - plasma membrane lactate transport
                     [Evidence IMP] [PMID 10198029]; GO_process: GO:0035879 -
                     plasma membrane lactate transport [Evidence IMP] [PMID
                     17710650]; GO_process: GO:0006849 - plasma membrane
                     pyruvate transport [Evidence IMP] [PMID 17710650];
                     GO_process: GO:0097080 - plasma membrane selenite
                     transport [Evidence IMP] [PMID 20861301]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Jen1p"
                     /protein_id="XP_018736437.1"
                     /db_xref="GeneID:30037097"
                     /translation="MSSQSYSPYVEDEKPDLSVGALVRYLASRPSTLFTLPESDTKRL
                     NPIPPLRAMKLRHWNWYMMGFLAWTVDAMDFFVVSASASAIAESLNVTIVKITWGMTL
                     VLMFRSVGAVIFGTISDTWGRKWSYIACCLCFVALEIGMGFITSYKQFLAVRALFGIS
                     MGGKSSR"
     gene            <912067..>913065
                     /gene="JEN1"
                     /locus_tag="AWJ20_4914"
                     /db_xref="GeneID:30037098"
     mRNA            <912067..>913065
                     /gene="JEN1"
                     /locus_tag="AWJ20_4914"
                     /product="Jen1p"
                     /transcript_id="XM_018882018.1"
                     /db_xref="GeneID:30037098"
     CDS             912067..913065
                     /gene="JEN1"
                     /locus_tag="AWJ20_4914"
                     /inference="similar to AA sequence:KEGG_Orthology:K08178"
                     /note="Monocarboxylate/proton symporter of the plasma
                     membrane; transport activity is dependent on the pH
                     gradient across the membrane; mediates high-affinity
                     uptake of carbon sources lactate, pyuvate, and acetate,
                     and also of the micronutrient selenite, whose structure
                     mimics that of monocarboxylates; expression and
                     localization are tightly regulated, with transcription
                     repression, mRNA degradation, and protein endocytosis and
                     degradation all occurring in the presence of glucose;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 17710650];
                     GO_function: GO:0015144 - carbohydrate transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015355 - secondary active monocarboxylate
                     transmembrane transporter activity [Evidence IMP] [PMID
                     17710650]; GO_function: GO:0097079 - selenite:proton
                     symporter activity [Evidence IMP] [PMID 20861301];
                     GO_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA]; GO_process: GO:0034219 -
                     carbohydrate transmembrane transport [Evidence IEA];
                     GO_process: GO:0035879 - plasma membrane lactate transport
                     [Evidence IMP] [PMID 10198029]; GO_process: GO:0035879 -
                     plasma membrane lactate transport [Evidence IMP] [PMID
                     17710650]; GO_process: GO:0006849 - plasma membrane
                     pyruvate transport [Evidence IMP] [PMID 17710650];
                     GO_process: GO:0097080 - plasma membrane selenite
                     transport [Evidence IMP] [PMID 20861301]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Jen1p"
                     /protein_id="XP_018736438.1"
                     /db_xref="GeneID:30037098"
                     /translation="MYGTAAATSLENIPPESISMMSGLFLPGYNLGYIFAIIFYRAFQ
                     YTHGGEGWRSLCWFTAGPAALLAIWRLCFPEGEYFSKLKEKREFEKLNAVGRWNDAKV
                     AIANYWVVFVYLIFLMSGMNFMSHGTMDLYPTLLVTQAKLGTDAKTVVMVVSNLGAIA
                     GGLIFGQLSEILGRRLCISVCCLLGGAFVYPAFLGANENTLMAGSTLLMAAVFGAWGQ
                     ITIHLFELSPPRYRTLAAGLAYQLGNLASSASATIEATIGARFPIGDKPGVYNYGLVM
                     CIFSGAVFGYVLIVIFLGPERFHRDLYEQVRTDDEKIYTLDDEKAETHHIDSVGRV"
     gene            <913920..>914177
                     /locus_tag="AWJ20_4915"
                     /db_xref="GeneID:30037099"
     mRNA            <913920..>914177
                     /locus_tag="AWJ20_4915"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882019.1"
                     /db_xref="GeneID:30037099"
     CDS             913920..914177
                     /locus_tag="AWJ20_4915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736439.1"
                     /db_xref="GeneID:30037099"
                     /translation="MDQDVMVPWVLQNKVNKKKNQLKEAAAEPETAPEPPKPEEPPVV
                     WNRYYHLYKQGELEEDVVTAKGRVVESGYERDNWWAIISKE"
     gene            complement(<914375..>915817)
                     /gene="PRP8"
                     /locus_tag="AWJ20_4916"
                     /db_xref="GeneID:30037100"
     mRNA            complement(<914375..>915817)
                     /gene="PRP8"
                     /locus_tag="AWJ20_4916"
                     /product="U4/U6-U5 snRNP complex component PRP8"
                     /transcript_id="XM_018882020.1"
                     /db_xref="GeneID:30037100"
     CDS             complement(914375..915817)
                     /gene="PRP8"
                     /locus_tag="AWJ20_4916"
                     /inference="similar to AA sequence:KEGG_Orthology:K12856"
                     /note="Component of U4/U6-U5 snRNP complex; involved in
                     second catalytic step of splicing; participates in
                     spliceosomal assembly through its interaction with U1
                     snRNA; largest and most evolutionarily conserved protein
                     of the spliceosome; mutations in its human ortholog,
                     PRPF8, cause Retinitis pigmentosa and missplicing in
                     Myelodysplastic syndrome; GO_component: GO:0046540 - U4/U6
                     x U5 tri-snRNP complex [Evidence IDA] [PMID 10377396];
                     GO_component: GO:0046540 - U4/U6 x U5 tri-snRNP complex
                     [Evidence IDA] [PMID 10449419]; GO_component: GO:0046540 -
                     U4/U6 x U5 tri-snRNP complex [Evidence IDA] [PMID
                     17934474]; GO_component: GO:0005682 - U5 snRNP [Evidence
                     IDA] [PMID 11720284]; GO_component: GO:0005682 - U5 snRNP
                     [Evidence IDA] [PMID 11720285]; GO_component: GO:0005682 -
                     U5 snRNP [Evidence IDA] [PMID 17934474]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 17934474];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0030529 - ribonucleoprotein
                     complex [Evidence IEA]; GO_component: GO:0005681 -
                     spliceosomal complex [Evidence IEA,IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0030619 - U1 snRNA binding [Evidence IDA] [PMID
                     23393194]; GO_function: GO:0030620 - U2 snRNA binding
                     [Evidence IDA] [PMID 23393194]; GO_function: GO:0030623 -
                     U5 snRNA binding [Evidence IEA]; GO_function: GO:0030623 -
                     U5 snRNA binding [Evidence IDA] [PMID 23393194];
                     GO_function: GO:0030623 - U5 snRNA binding [Evidence IDA]
                     [PMID 9848662]; GO_function: GO:0017070 - U6 snRNA binding
                     [Evidence IEA]; GO_function: GO:0017070 - U6 snRNA binding
                     [Evidence IDA] [PMID 23393194]; GO_function: GO:0003729 -
                     mRNA binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0003676 - nucleic acid binding [Evidence IEA];
                     GO_function: GO:0097157 - pre-mRNA intronic binding
                     [Evidence IDA] [PMID 23393194]; GO_function: GO:0000386 -
                     second spliceosomal transesterification activity [Evidence
                     IMP] [PMID 17626844]; GO_process: GO:0008380 - RNA
                     splicing [Evidence IEA]; GO_process: GO:0000350 -
                     generation of catalytic spliceosome for second
                     transesterification step [Evidence IMP] [PMID 22408182];
                     GO_process: GO:0000389 - mRNA 3'-splice site recognition
                     [Evidence IMP] [PMID 10628969]; GO_process: GO:0006397 -
                     mRNA processing [Evidence IEA]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IEA]; GO_process:
                     GO:0000244 - spliceosomal tri-snRNP complex assembly
                     [Evidence IMP] [PMID 17934474]; GO_process: GO:0000244 -
                     spliceosomal tri-snRNP complex assembly [Evidence IDA]
                     [PMID 23393194]"
                     /codon_start=1
                     /product="U4/U6-U5 snRNP complex component PRP8"
                     /protein_id="XP_018736440.1"
                     /db_xref="GeneID:30037100"
                     /translation="MLDPLEVHMLDFPNISIRPSELQLPFQDAMKIEKLADTILKATE
                     PKMLLYNLYDDWLIDNKTEPGTAFSRLILILRALHVNQEKAKLILRPDRSVLTEEHHL
                     WPSFTTEQWINVENQLSDLILNDYGKKNNVNVASLTQHEIRDLILGQEIKAPSLKRQE
                     MADIDQQRQDQQSQLTALKTKTQNVHGDEMVVVTTSNYEQESFSSKTDWRNRAIASTS
                     INLRTKHIYVSSEDIRDDSQNYTYILPKNILKKFTQISDLRAQVGGFLYGVSPPDNPQ
                     IKEIRVIALVPQVGNANSVQLPLKLPSTGGSEPLLKGLEPLGWIHTQAQETPVLSAID
                     VTTQAKIMDANSGAAGGWDSNAITMTVSFTPGSVTLSAFSLKPEGYEWGSRNRDIAAI
                     NPLGYSTKFGEKCQLLLSDRINGYFLVPEDSVWNYAFMGAAWSANAAYELKIDVPLPY
                     YHELHRPIHFTSFNDLEDNVIELDKQDVFA"
     gene            complement(<916027..>921720)
                     /gene="PRP8"
                     /locus_tag="AWJ20_4917"
                     /db_xref="GeneID:30037101"
     mRNA            complement(<916027..>921720)
                     /gene="PRP8"
                     /locus_tag="AWJ20_4917"
                     /product="U4/U6-U5 snRNP complex component PRP8"
                     /transcript_id="XM_018882021.1"
                     /db_xref="GeneID:30037101"
     CDS             complement(916027..921720)
                     /gene="PRP8"
                     /locus_tag="AWJ20_4917"
                     /inference="similar to AA sequence:KEGG_Orthology:K12856"
                     /note="Component of U4/U6-U5 snRNP complex; involved in
                     second catalytic step of splicing; participates in
                     spliceosomal assembly through its interaction with U1
                     snRNA; largest and most evolutionarily conserved protein
                     of the spliceosome; mutations in its human ortholog,
                     PRPF8, cause Retinitis pigmentosa and missplicing in
                     Myelodysplastic syndrome; GO_component: GO:0046540 - U4/U6
                     x U5 tri-snRNP complex [Evidence IDA] [PMID 10377396];
                     GO_component: GO:0046540 - U4/U6 x U5 tri-snRNP complex
                     [Evidence IDA] [PMID 10449419]; GO_component: GO:0046540 -
                     U4/U6 x U5 tri-snRNP complex [Evidence IDA] [PMID
                     17934474]; GO_component: GO:0005682 - U5 snRNP [Evidence
                     IDA] [PMID 11720284]; GO_component: GO:0005682 - U5 snRNP
                     [Evidence IDA] [PMID 11720285]; GO_component: GO:0005682 -
                     U5 snRNP [Evidence IDA] [PMID 17934474]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 17934474];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0030529 - ribonucleoprotein
                     complex [Evidence IEA]; GO_component: GO:0005681 -
                     spliceosomal complex [Evidence IEA,IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA,IEA]; GO_function:
                     GO:0030619 - U1 snRNA binding [Evidence IDA] [PMID
                     23393194]; GO_function: GO:0030620 - U2 snRNA binding
                     [Evidence IDA] [PMID 23393194]; GO_function: GO:0030623 -
                     U5 snRNA binding [Evidence IEA]; GO_function: GO:0030623 -
                     U5 snRNA binding [Evidence IDA] [PMID 23393194];
                     GO_function: GO:0030623 - U5 snRNA binding [Evidence IDA]
                     [PMID 9848662]; GO_function: GO:0017070 - U6 snRNA binding
                     [Evidence IEA]; GO_function: GO:0017070 - U6 snRNA binding
                     [Evidence IDA] [PMID 23393194]; GO_function: GO:0003729 -
                     mRNA binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0003676 - nucleic acid binding [Evidence IEA];
                     GO_function: GO:0097157 - pre-mRNA intronic binding
                     [Evidence IDA] [PMID 23393194]; GO_function: GO:0000386 -
                     second spliceosomal transesterification activity [Evidence
                     IMP] [PMID 17626844]; GO_process: GO:0008380 - RNA
                     splicing [Evidence IEA]; GO_process: GO:0000350 -
                     generation of catalytic spliceosome for second
                     transesterification step [Evidence IMP] [PMID 22408182];
                     GO_process: GO:0000389 - mRNA 3'-splice site recognition
                     [Evidence IMP] [PMID 10628969]; GO_process: GO:0006397 -
                     mRNA processing [Evidence IEA]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IEA]; GO_process:
                     GO:0000244 - spliceosomal tri-snRNP complex assembly
                     [Evidence IMP] [PMID 17934474]; GO_process: GO:0000244 -
                     spliceosomal tri-snRNP complex assembly [Evidence IDA]
                     [PMID 23393194]"
                     /codon_start=1
                     /product="U4/U6-U5 snRNP complex component PRP8"
                     /protein_id="XP_018736441.1"
                     /db_xref="GeneID:30037101"
                     /translation="MSGRNPGAPPGFPGAGKRPNGGPPPPPPPPGGAGVKRKPGTGGL
                     APPPPPPPSGGKRRTANGSHPPPPPPPPSRPPPAEKREEERRLRALERKRKWQQLQKQ
                     KYGAKQGKATFVHSTKVDMPPEHLRKIIRDHGDLSTKRVAADKRSYLGALKFIPHAVV
                     KLMENMPQPWEQVREVKVLYHITGAITFVNEVPRVIEPVYTAQWATMWTMMRREKRDR
                     RHFKRMRFPPFDDEEPPISWSENIEIAEPGDAIQMELDQEEDSPVYEWFYDHRPLIED
                     PKYVPGPAYKKWNLELPQMANLYRLASPLVADIATRNDLYLFDKKSFFTAKALNTAIP
                     GGPKFEPLYKDVDEDNEDFGEFNAIDRIIFRNPIRTEYKIAFPHLYNSLPRSVQIDWY
                     HDPQDVHIKTEDPDLPAYYYDPAINPITARRREIDEQEADDLILDDDLEEEEEEEEEE
                     EKEGEQRSTGFTLGDDFETFLENVPLTTDNTSHAIALWWAPFPFNRRSGTMVRAQDVA
                     LVKNWYVQHAPDGNPVKVRVSYQKLLKTYVLNALKTKPPSNQKKRYLLKSLKNTKFFQ
                     QTTIDWVEAGLQLCRQGFTMLNLLIHRKGLTYLHLDYNFNLKPIKTLTTKERKRSRFG
                     NAFHLMREILRVVKLIVDAHVQYRLGNVDAYQLADGLHYTLNHLGQLTGIYRYKYKVM
                     HQIRTCKDLKHVIYYRFNSVIGKGPGCGFWQPAWRVWLFFLRGTIPLLERWLGNLLAR
                     QFEGRHSKAVAKTITKQRVESYYDLELRASVLNDILDMIPEGIKQNKAKTIIQHLSEA
                     WRCWKANIPWKVPGLPAPIENIILRYVKAKADGWISVAHYNRERIKRGTTVEKTVAKK
                     NLGRLTRLWLKSEQERQHNFSKDGPYVAPEDAVAIFSTMVHWLESRKFSPIPFPPLSY
                     KHDTKLLVLALEGLKESYSVKNRLNQSQREELALIEQAYDNPHECLSRIKRFLLTQRV
                     FKEVGLDMMDYYSHILPVYEIDPLEKITDAYLDQYLWYEADKRHLFPNWIKPSDSEVP
                     PLLVYKWCQGINNLQDVWDVSEGQCNVMLQTTLSKMAEKIDFTLLNRLLRLIVDSNIA
                     DYITAKNNVALSYKDMTHVNQYGLIRGLQFSSFVMQYYGLVLDLLLLGLPRASELAGP
                     PQQPNDFLQFKDEETEVNHPIRLYIRYVDKVHILFRFRATEARDLIQRFLTENPDPNF
                     ENVVGYNNKKCWPRDSRMRLMRHDVNLGRAVFWEMKNRLPRSLTTFEWEDTFASVYSR
                     DNPNLLFSMVGFEVRILPKSRVENDIQIRDSVWNLTNEETKERTAYAFLRVTDEDIAK
                     FNNRIRQILMSSGSTTFTKIANKWNTALISLFTYYREAAVASENLLDTLVKCETKIQT
                     RVKIGLNSKMPSRFPPAVFYTPKELGGLGMLSASHILIPTSDLRWSKQTDTGITHFRS
                     GMTHQDDQLIPNIFRYIASWESEFIDSQNVWAEYAMKRQEASQQNRRLTLEDLEDRWD
                     RGLPRINTLFQKDRHTLAYDKGHRIRTQFRQYSLAKVNPFWWTSQRHDGKLWNLNAYR
                     TDVIQALGGIETILEHTLFKGTGFDNWEGLFWEKASGFEDSMKFKKLTNAQRSGLNQI
                     PNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHE
                     SIIFDICHVLDAEMDTLQIENVNKESIHPRKSYKMNSSAADIVLHSTYKWSVSGPSLL
                     NDSKDVMDFATANKFWLDIQLRYGDYDSHDISRYTRAKFLDYTSDGISIYPSPTGAMI
                     GVDLAYNMYDAYGNWFPGLKPLMQQAMSKIMKANPALFVLRERIRKGLQLYQSQPQEA
                     FLNSNNYSELFGKDVQFFIDDSNVYRVTVHKTFEGNLTTKPINGAIFIFNPRTGK"
     gene            complement(<926261..>927481)
                     /gene="STS1"
                     /locus_tag="AWJ20_4918"
                     /db_xref="GeneID:30037102"
     mRNA            complement(<926261..>927481)
                     /gene="STS1"
                     /locus_tag="AWJ20_4918"
                     /product="Sts1p"
                     /transcript_id="XM_018882022.1"
                     /db_xref="GeneID:30037102"
     CDS             complement(926261..927481)
                     /gene="STS1"
                     /locus_tag="AWJ20_4918"
                     /inference="similar to AA sequence:KEGG_Orthology:K11888"
                     /note="Protein required for localizing proteasomes to the
                     nucleus; involved in cotranslational protein degradation;
                     mediates interaction between nuclear import factor Srp1p
                     and the proteasome; Sts1p and Srp1p couple proteasomes to
                     nascent polypeptides emerging from the ribosome for
                     cotranslational degradation; involved in
                     ubiquitin-mediated protein degradation; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 10913188];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0007059 - chromosome segregation
                     [Evidence IMP] [PMID 8065366]; GO_process: GO:0071630 -
                     nucleus-associated proteasomal ubiquitin-dependent protein
                     catabolic process [Evidence IEA]; GO_process: GO:0071630 -
                     nucleus-associated proteasomal ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 21075847];
                     GO_process: GO:0031144 - proteasome localization [Evidence
                     IEA]; GO_process: GO:0031144 - proteasome localization
                     [Evidence IMP] [PMID 21075847]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Sts1p"
                     /protein_id="XP_018736442.1"
                     /db_xref="GeneID:30037102"
                     /translation="MVVSAVLPPRTGWGFEFASSSESASQVQDRPGGQFGSPVFGLAG
                     ENNSGVSAGATGFAGAATAPSTPTLRSGKRKMNSMDRYDSDEDHNIENDNDNDVYDEY
                     DEHRNFASHSQSRLNGGGPSGTRSVPGSAFRGSNSSVLNSEMDLFSSSFQKRLSTGVS
                     NRLKAHATGSKVSKRARTHTAMGHPLPIGRILESLDKKNLRSIIENLCQTHPYLVGEI
                     SNLAPRITVSTAIEHLKNLLSAVYNSLPFKGDQRGDYAYLRVRPAVEEFLSALSDYTS
                     NFLPPTESQPSNTLAFLDSATDLLHQLPVWSNPVNNHHQWVCYDDIASAWIVAIREAS
                     KRAGGLGLVHDGWQVKLDKHNEKSDDRLKDAVACIRNELSWLNSNNDEANSTPKQNIF
                     SIYNPHSQTPSMWT"
     gene            <928588..>930895
                     /gene="THS1"
                     /locus_tag="AWJ20_4919"
                     /db_xref="GeneID:30037103"
     mRNA            join(<928588..928674,928835..>930895)
                     /gene="THS1"
                     /locus_tag="AWJ20_4919"
                     /product="threonine--tRNA ligase THS1"
                     /transcript_id="XM_018882023.1"
                     /db_xref="GeneID:30037103"
     CDS             join(928588..928674,928835..930895)
                     /gene="THS1"
                     /locus_tag="AWJ20_4919"
                     /inference="similar to AA sequence:KEGG_Orthology:K01868"
                     /note="Threonyl-tRNA synthetase; essential cytoplasmic
                     protein; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IMP] [PMID 2995918]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004812 -
                     aminoacyl-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0016876 - ligase activity, forming
                     aminoacyl-tRNA and related compounds [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_function: GO:0004829 - threonine-tRNA ligase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004829 -
                     threonine-tRNA ligase activity [Evidence ISA] [PMID
                     2995918]; GO_function: GO:0004829 - threonine-tRNA ligase
                     activity [Evidence IDA] [PMID 8143729]; GO_process:
                     GO:0002181 - cytoplasmic translation [Evidence IMP] [PMID
                     10471698]; GO_process: GO:0043039 - tRNA aminoacylation
                     [Evidence IEA]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IEA];
                     GO_process: GO:0006435 - threonyl-tRNA aminoacylation
                     [Evidence IEA]; GO_process: GO:0006435 - threonyl-tRNA
                     aminoacylation [Evidence ISA] [PMID 2995918]; GO_process:
                     GO:0006435 - threonyl-tRNA aminoacylation [Evidence IDA]
                     [PMID 8143729]; GO_process: GO:0006412 - translation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="threonine--tRNA ligase THS1"
                     /protein_id="XP_018736443.1"
                     /db_xref="GeneID:30037103"
                     /translation="MAAAGVSELIEKVADATIAPKKGPPALYPAEPKFSFIDERLKFF
                     DELKKAQDEEIAKKERKPIKITLKDGSVREGTAWETSPADIAKEISKSLFEKTVISKV
                     NGELWDLERPFEEDSKLELLDFDSEDGKKVFWHSSAHVLGEACECHFGAHLCVGPPTD
                     DGFFYEMSIDNGDRAVSSADFPAVEAVTKRAVKDKQRFERLVVSKENLLKMFAYNKYK
                     QTLIQSKIPDGTSSTVYRCGPLIDLCRGPHVPHTGRIKSIKLLKNSASYFLGDSANDS
                     LQRIYGVSFPDKKQLDEHLKFLEEAAKRDHRKIGKDQELFMFHDMSPGSCFWLPHGAR
                     IYNTLGDFLRTEYRKRGYEEVITPNMYNAKLWETSGHWANYKENMFTFDVEKEKFGLK
                     PMNCPGHCLMFKARERSYRELPWRVADFGVIHRNEFSGALSGLTRVRRFQQDDAHIFC
                     RQDQIEAEITGIFEFLKHVYGVFGFDFKMELSTRPEKYVGQLETWNDAEAKLASALDS
                     WGAKWELNPGDGAFYGPKIDIMISDALKRWHQCATIQLDFQLPDRFGLQFRGADVTDA
                     AGEVQHYDRPVMIHRALYGSFERMIAILTEHFFGKWPLWLSPRQVLVVPVGVKYFDYA
                     QKVRDYFHENGFFADVDVGPNTLQKKVRQGQLQQYNYLLVVGEEEESSNTVNIRKRDD
                     PSKHGKTETVSLEDAVAKMKQLVASKSLVDNVF"
     gene            complement(<931120..>932925)
                     /gene="SIF2"
                     /locus_tag="AWJ20_4920"
                     /db_xref="GeneID:30037105"
     mRNA            complement(<931120..>932925)
                     /gene="SIF2"
                     /locus_tag="AWJ20_4920"
                     /product="Sif2p"
                     /transcript_id="XM_018882025.1"
                     /db_xref="GeneID:30037105"
     CDS             complement(931120..932925)
                     /gene="SIF2"
                     /locus_tag="AWJ20_4920"
                     /inference="similar to AA sequence:KEGG_Orthology:K04508"
                     /note="WD40 repeat-containing subunit of Set3C histone
                     deacetylase complex; complex represses early/middle
                     sporulation genes; antagonizes telomeric silencing; binds
                     specifically to the Sir4p N-terminus; GO_component:
                     GO:0070210 - Rpd3L-Expanded complex [Evidence IDA] [PMID
                     19040720]; GO_component: GO:0034967 - Set3 complex
                     [Evidence IDA] [PMID 11711434]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 9651685]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0016568 - chromatin modification [Evidence IEA];
                     GO_process: GO:0016575 - histone deacetylation [Evidence
                     IDA] [PMID 11711434]; GO_process: GO:0031939 - negative
                     regulation of chromatin silencing at telomere [Evidence
                     IMP,IPI] [PMID 9651685]; GO_process: GO:0045835 - negative
                     regulation of meiosis [Evidence IPI] [PMID 11711434];
                     GO_process: GO:0032874 - positive regulation of
                     stress-activated MAPK cascade [Evidence IMP] [PMID
                     18487345]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IMP] [PMID
                     19379692]"
                     /codon_start=1
                     /product="Sif2p"
                     /protein_id="XP_018736444.1"
                     /db_xref="GeneID:30037105"
                     /translation="MGEEEEKRLRELESQNSSNNHKPDEKVSAIEAENGSANAKSITQ
                     NSTQDHENGETDESQVATNKSHHARDHHKVGLLGNVKSNSLALHTLRPSYSLEGSQTS
                     QFNPVKSNLVAYGTVEGARILSYKEKSRSPQTVDADKDVEMKDIDSTSAVAVAVTDAS
                     NSKATSNTDSKIDDSNAISTNKPTDETSKKDNSEANSNSNTNSSLITETIVLTHAPNE
                     DKEITALTWSPNGTILATGSFDGKIRIWTSEGKLRSLLALHRAPILAIRFNPGGRLLG
                     SVDCTGTVIVWEVSNGEIREFHGEKDLANSLTNHQPVAQSETSITSSNLQTQQPHSQT
                     QSPTHQYPSQSPSLSSHGQDASKFTANNVETETESDQPNGGDLTWIDDTTYVTTGQSQ
                     SILVYKLGEQQPLLRLSAHTQSINSLQFEPSTKLLASASDDYTVRIWHGISPVSIMTL
                     AGHTAPVIDIKWLSGSALEHSSLPLLISSSIDSTIRIWDIAKGTCISLLKLHDSPLFT
                     TELSPNNRYIASGSAGGELVVWDIQEVLKYDANSHQTDSIVCRPIGRHKLDQSPSDPV
                     PTDTTVSSLSWSPASDGLFVGYTTVSEIIPFSLII"
     gene            <934139..>936700
                     /gene="EXO84"
                     /locus_tag="AWJ20_4921"
                     /db_xref="GeneID:30037106"
     mRNA            <934139..>936700
                     /gene="EXO84"
                     /locus_tag="AWJ20_4921"
                     /product="Exo84p"
                     /transcript_id="XM_018882026.1"
                     /db_xref="GeneID:30037106"
     CDS             934139..936700
                     /gene="EXO84"
                     /locus_tag="AWJ20_4921"
                     /note="Exocyst subunit with dual roles in exocytosis and
                     spliceosome assembly; subunit of the the exocyst complex
                     which mediates polarized targeting and tethering of
                     post-Golgi secretory vesicles to active sites of
                     exocytosis at the plasma membrane (PM) prior to
                     SNARE-mediated fusion; required for exocyst assembly and
                     targeting the complex to specific sites on the bud tip PM;
                     associates the U1 snRNP; role in pre-mRNA splicing and
                     prespliceosome formation; possible Cdc28 substrate;
                     GO_component: GO:0005933 - cellular bud [Evidence IEA];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IEA]; GO_component: GO:0005935 - cellular bud neck
                     [Evidence IDA] [PMID 10438536]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 10438536];
                     GO_component: GO:0031410 - cytoplasmic vesicle [Evidence
                     IEA]; GO_component: GO:0000145 - exocyst [Evidence IDA]
                     [PMID 10438536]; GO_component: GO:0000131 - incipient
                     cellular bud site [Evidence IDA] [PMID 10438536];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_component: GO:0005628 - prospore
                     membrane [Evidence IDA] [PMID 24390141]; GO_component:
                     GO:0030133 - transport vesicle [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0006893 - Golgi to plasma membrane
                     transport [Evidence IMP] [PMID 10438536]; GO_process:
                     GO:0006893 - Golgi to plasma membrane transport [Evidence
                     IMP] [PMID 15788396]; GO_process: GO:0001927 - exocyst
                     assembly [Evidence IMP] [PMID 15788396]; GO_process:
                     GO:0051601 - exocyst localization [Evidence IMP] [PMID
                     15788396]; GO_process: GO:0006887 - exocytosis [Evidence
                     IEA]; GO_process: GO:0006887 - exocytosis [Evidence
                     IGI,IMP] [PMID 10438536]; GO_process: GO:0006887 -
                     exocytosis [Evidence IMP] [PMID 15788396]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA]; GO_process:
                     GO:0000245 - spliceosomal complex assembly [Evidence
                     IMP,IPI] [PMID 11425851]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0090522 - vesicle
                     tethering involved in exocytosis [Evidence IC] [PMID
                     10438536]"
                     /codon_start=1
                     /product="Exo84p"
                     /protein_id="XP_018736445.1"
                     /db_xref="GeneID:30037106"
                     /translation="MSELPALSLRKHRQTMISDAKRPDLSQFAGIPGQQPASQDSTLQ
                     LPTVGIKDREKVGKLVKKRLSSRPTPQMYGKDAGSAPAMPVNAHDLILEVSNNDYPLP
                     PKQRYNNNHAGGIDKASVNRDDFDGDERTGARTGPGSGTTGNFYPVPLGPGSGIPPGD
                     KTEGTKGLGPGHGPVKTAPDLPSKDYPDREYPSQPGHGVPYGQNDRRHLASTAIPIQN
                     DRKPFLAPDFDAKTFISDNLSNATDVEISEFAKKLSSLKEDLVQEKKDEMYSNYQKFL
                     LVGRTISGLNTDLETLRKILNDLNLATSALKDDAARHLSLNNNNSSSTQLNRNMSLSA
                     NESKMSGLSDSSGTSSGPGAGSSLSPSSAGYDRRASVLAMEEFWQRNLTSLFRHVEGA
                     QKYLPIIPGRHVIKEQGGWYELNAATWKPLQPAHMFLLNDNLLIATKKRSREHNSASV
                     QPTRALIANQCWSLLDIDVTEVKSYPQIGQRVLQRAISIKFESMTYVYRAEKSENHDV
                     FLQEFRRVRDELYQLKNSRRTNGLHSHTRSASGSSFNNIPPPSPSTGGGAGVGPIRRH
                     NGVARSDSLSLLPSSASSSSKSALVREVDQTLSELDLKIAHRQFSAVVDMILKSKPRF
                     QQVSDTLSAETSVPIPRPSTPKSSSNLTVGSGAGAGAGTATGPAGSSYTQFTGDILPI
                     DKLEARITTTADLLLQRLSEEYLSRKELGEFVKMLTQLDAADSAKTTLMNMRHFVIQR
                     RIKQVPFQGDIPGYIRQVAFITFQLIVSTVEIYRACFPDPQDSSTIAVWAKAEVDSYS
                     MLFARQLHNVNPSTATYQQCCDITRDESACLKTVNLDFSFMLDYMFDATAAKRKH"
     gene            complement(<937041..>938000)
                     /gene="TRI1"
                     /locus_tag="AWJ20_4922"
                     /db_xref="GeneID:30037107"
     mRNA            complement(<937041..>938000)
                     /gene="TRI1"
                     /locus_tag="AWJ20_4922"
                     /product="Tri1p"
                     /transcript_id="XM_018882027.1"
                     /db_xref="GeneID:30037107"
     CDS             complement(937041..938000)
                     /gene="TRI1"
                     /locus_tag="AWJ20_4922"
                     /inference="similar to AA sequence:KEGG_Orthology:K15223"
                     /note="Non-essential sumoylated hypothetical protein;
                     similar to components of human SWI/SNF complex including
                     SMRD3; green fluorescent protein (GFP)-fusion protein
                     localizes to the cytoplasm, nucleus and nucleolus; TRI1
                     has a paralog, UAF30, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0008150 - biological_process [Evidence
                     ND]; GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Tri1p"
                     /protein_id="XP_018736446.1"
                     /db_xref="GeneID:30037107"
                     /translation="MNEALTIGQAILGVSDLSVISSKRIRRSLQELLNQDLTAYKKEL
                     DNVIVERFVLIQEKRNHADTNSEDGQKTGVQNPRNGTDHEKPSNGHSSNGTDSHKNSQ
                     KNHQSQTTNGTARKTVASGPGSDPLSSPNSSLSDSSSAVTGLNTPAKSVSSKTTTASK
                     SSKPKPSVKRSVDDDAEMAAKLHAELNRPSLRRETRQPASKRSRKTKKRRADDDSDED
                     KPKRKANPNNPFMRPVVLSPALSTVLGETEMPRPHIVKALWKYIKEHKLQNPENMKEI
                     ICDDTLRPVFGSSKCGTPASGGWGSAPDPVAPLAPLESVARGL"
     gene            complement(<938658..>941835)
                     /gene="CAB2"
                     /locus_tag="AWJ20_4923"
                     /db_xref="GeneID:30037108"
     mRNA            complement(join(<938658..940304,940996..>941835))
                     /gene="CAB2"
                     /locus_tag="AWJ20_4923"
                     /product="phosphopantothenate--cysteine ligase CAB2"
                     /transcript_id="XM_018882028.1"
                     /db_xref="GeneID:30037108"
     CDS             complement(join(938658..940304,940996..941835))
                     /gene="CAB2"
                     /locus_tag="AWJ20_4923"
                     /inference="similar to AA sequence:KEGG_Orthology:K01922"
                     /note="Subunit of the CoA-Synthesizing Protein Complex
                     (CoA-SPC); subunits of this complex are: Cab2p, Cab3p,
                     Cab4p, Cab5p, Sis2p and Vhs3p; probable
                     phosphopantothenoylcysteine synthetase (PPCS), which
                     catalyzes the second step of coenzyme A biosynthesis from
                     pantothenate; null mutant lethality is complemented by E.
                     coli coaBC (encoding a bifunctional enzyme with PPCS
                     activity); GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14690591]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14690591]; GO_function: GO:0016874 -
                     ligase activity [Evidence IEA]; GO_function: GO:0004632 -
                     phosphopantothenate--cysteine ligase activity [Evidence
                     IEA]; GO_function: GO:0004632 -
                     phosphopantothenate--cysteine ligase activity [Evidence
                     ISS] [PMID 11923312]; GO_process: GO:0015937 - coenzyme A
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0015937 - coenzyme A biosynthetic process [Evidence
                     ISS] [PMID 11923312]; GO_process: GO:0015937 - coenzyme A
                     biosynthetic process [Evidence IGI] [PMID 19266201]"
                     /codon_start=1
                     /product="phosphopantothenate--cysteine ligase CAB2"
                     /protein_id="XP_018736447.1"
                     /db_xref="GeneID:30037108"
                     /translation="MIHTSGPKAETAVDREAPEFPPAQSTDEDSYFKHNDEPSYLASL
                     QVQVAEFIKIHKDRKIALVTSGGTTVPLENNTVRFIDNFSAGTRGSTSAEYFLEAGYA
                     VIFLHRQFSLLPYSRHYSHSTNCFLDYMVEGNDNHSVQVDKKYEEQMLQVLKKYQYAK
                     RNKLLLLVPFTTVNQYLFTLRMISQELGQQKAQNRSTTLFYLAAAVSDFFLPRSRVAD
                     HKIQSQGTGKLVVDLDPVPKFLKRLVDEWTPGAMIVSFKLETDSSLLIGKARGALERY
                     SHQLGKKGDEVDQAEIERQVKAAVAAKEYFSELLERNASRHVQVRAIRAVGGGARSTR
                     REFLNQQFEPIFQARNLSSLLSAVDTVYDNLAGLGIYENVTVALDETKEKVNGNGVRG
                     LDNLDPFAGLFGNDSGRAYDNNERRNSGSKLELDAVVKLAQAKRFYAKTGTDLGNGEG
                     NGYANMTFKNIFGGAEILSLDATMGTRTRSSYIANFSTPVLSVLPPQWRLETVAYMTS
                     RTIPWASNEQLVRGMSTKIKSVPSLLKRPGQTPSPQQELGFEAVWRTIACSPGASSSV
                     RDEAGNSLKASIFHSIAYDTRDSILLATHGNYYKFSHELAGLGGIGNAFYKTSFESQH
                     NWLLFASPPTTSSSSSEPSTISSQQTTEPVSRTSLHIGTKAGLLWMLARPSSNSDTPP
                     PSNLMDRFYLGGPNDVRGFYSSGIGPRDQSDSLGGEALLAAGVSLLTPIPKIKRTTPL
                     RFHTFLNAGNLLALDRIGSSTTTAPTTSSILSSTAAELLNTPSISTGVGLLYCHPAAR
                     FELNITFPLIARRNEATRKGIQFGVGLSFL"
     gene            <949197..>950243
                     /gene="PUB1"
                     /locus_tag="AWJ20_4924"
                     /db_xref="GeneID:30037109"
     mRNA            <949197..>950243
                     /gene="PUB1"
                     /locus_tag="AWJ20_4924"
                     /product="Pub1p"
                     /transcript_id="XM_018882029.1"
                     /db_xref="GeneID:30037109"
     CDS             949197..950243
                     /gene="PUB1"
                     /locus_tag="AWJ20_4924"
                     /inference="similar to AA sequence:KEGG_Orthology:K13201"
                     /note="Poly (A)+ RNA-binding protein; abundant
                     mRNP-component protein that binds mRNA and is required for
                     stability of many mRNAs; component of glucose deprivation
                     induced stress granules, involved in P-body-dependent
                     granule assembly; protein abundance increases in response
                     to DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 8413212]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 8413213];
                     GO_component: GO:0000932 - cytoplasmic mRNA processing
                     body [Evidence IDA] [PMID 23222640]; GO_component:
                     GO:0010494 - cytoplasmic stress granule [Evidence IDA]
                     [PMID 18981231]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 8413212]; GO_function: GO:0003723 -
                     RNA binding [Evidence IEA]; GO_function: GO:0003729 - mRNA
                     binding [Evidence IDA] [PMID 15964806]; GO_function:
                     GO:0003729 - mRNA binding [Evidence IDA] [PMID 23222640];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA,IMP]
                     [PMID 8413212]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA,IMP] [PMID 8413213]; GO_function: GO:0003676
                     - nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0008266 - poly(U) RNA binding [Evidence
                     IDA] [PMID 8413213]; GO_process: GO:0000184 -
                     nuclear-transcribed mRNA catabolic process,
                     nonsense-mediated decay [Evidence IDA] [PMID 10892745];
                     GO_process: GO:0043488 - regulation of mRNA stability
                     [Evidence IMP] [PMID 15964806]; GO_process: GO:0034063 -
                     stress granule assembly [Evidence IMP] [PMID 18981231]"
                     /codon_start=1
                     /product="Pub1p"
                     /protein_id="XP_018736448.1"
                     /db_xref="GeneID:30037109"
                     /translation="MVNNHEIKINWAFQTQQAIKDLDFFNIFVGDLSSDVNDELLSQT
                     FNHFPSLVEARVMWDMTTGRSRGYGFVSFKDEADATTALETMDGKLIGSRAIRLNWAQ
                     QKVGGMAGGPGGGPGGYQNQQGHHHHHHHHHPHSHHQQPYYNNSGGRQGGGSGRRGGP
                     GGASGGPGGGYGPGGGYGGGPGGGGGGAGGYGGAGGSYGSSGGSYGGSGGYSGPNSGI
                     SVGPSHSGTSSGAASVSSSSDSGQVPAGAMTYDMVFHATPNWQTTVYVGNLAPYTPPN
                     DLLSVLQSFGYIVDFKFQPERGYAFVKFDTHERAAMAIVQLSGYQFNGRLLKCGWGKD
                     RNNSHSNYQPYRQY"
     gene            <951662..>953401
                     /gene="UBP1"
                     /locus_tag="AWJ20_4925"
                     /db_xref="GeneID:30037110"
     mRNA            <951662..>953401
                     /gene="UBP1"
                     /locus_tag="AWJ20_4925"
                     /product="Ubp1p"
                     /transcript_id="XM_018882030.1"
                     /db_xref="GeneID:30037110"
     CDS             951662..953401
                     /gene="UBP1"
                     /locus_tag="AWJ20_4925"
                     /inference="similar to AA sequence:KEGG_Orthology:K11870"
                     /note="Ubiquitin-specific protease; removes ubiquitin from
                     ubiquitinated proteins; cleaves at the C terminus of
                     ubiquitin fusions irrespective of their size; capable of
                     cleaving polyubiquitin chains; GO_component: GO:0005737 -
                     cytoplasm [Evidence IC] [PMID 1429680]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 15635103];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 15635103]; GO_function: GO:0008234 -
                     cysteine-type peptidase activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0008233 - peptidase activity
                     [Evidence IEA]; GO_function: GO:0004843 -
                     ubiquitin-specific protease activity [Evidence IDA] [PMID
                     1429680]; GO_process: GO:0016579 - protein
                     deubiquitination [Evidence IDA] [PMID 1429680];
                     GO_process: GO:0016579 - protein deubiquitination
                     [Evidence IDA] [PMID 2050695]; GO_process: GO:0006508 -
                     proteolysis [Evidence IEA]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Ubp1p"
                     /protein_id="XP_018736449.1"
                     /db_xref="GeneID:30037110"
                     /translation="MLSDTIKGSMDMASASMKYLYDKAATKVLGPMPFDESELTEAEK
                     ANGIEEMRMYNVGGIYNEGNTCFMNSVVQSFASLQYLEEFLDDSLGIPRTQRVLPELK
                     KPVIPESASDGLTENAGETGTSIASTANDNSGLNGSLESADTLNGGSGNYEQGGQSDK
                     VESRAGTLPETQLKLHQPSTNGYFSLPRNESQRPMTPGTAKVSLLKTLLSLMSQLNEK
                     KPSSHTYTTTQLIKSISYVLGKDADVLTGYDQEDAQEFFQQILSCLEKEVKKTPTSNT
                     AWEQRRLRESSVETNASIDNETNGSANSASSNNSSNNNNNEKLLTPFDGVFATRVGCV
                     KCGEMEGIRRGTLSSVDLSLQNGGDDFELEGLLAEYCAMETISGVECYRCSLNAYKTE
                     LETRLENQTVGALRNLYATRVEELKSALSDLVIDEAKYAKLKPTKLKELGDKTKQTMF
                     AMPCADIMMIHINRSVFDLNTGYSRKNYAPVRFPVQLDMSPFIVDTNDPVNRDPSKPM
                     AHIASGRRYLYNLKATVIHYGSHNFGHYVCFRKCEQGFWWRISDHSVDLTTEHEVLRT
                     QGVFMLFYERDHE"
     gene            complement(<954209..>955822)
                     /gene="GUT1"
                     /locus_tag="AWJ20_4926"
                     /db_xref="GeneID:30037111"
     mRNA            complement(<954209..>955822)
                     /gene="GUT1"
                     /locus_tag="AWJ20_4926"
                     /product="glycerol kinase"
                     /transcript_id="XM_018882031.1"
                     /db_xref="GeneID:30037111"
     CDS             complement(954209..955822)
                     /gene="GUT1"
                     /locus_tag="AWJ20_4926"
                     /inference="similar to AA sequence:KEGG_Orthology:K00864"
                     /note="Glycerol kinase; converts glycerol to
                     glycerol-3-phosphate; glucose repression of expression is
                     mediated by Adr1p and Ino2p-Ino4p; derepression of
                     expression on non-fermentable carbon sources is mediated
                     by Opi1p and Rsf1p; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 17054397]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0004370 - glycerol kinase activity [Evidence IEA,IEA];
                     GO_function: GO:0004370 - glycerol kinase activity
                     [Evidence IMP,ISS] [PMID 8358828]; GO_function: GO:0016301
                     - kinase activity [Evidence IEA]; GO_function: GO:0000166
                     - nucleotide binding [Evidence IEA]; GO_function:
                     GO:0016773 - phosphotransferase activity, alcohol group as
                     acceptor [Evidence IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0005975 - carbohydrate metabolic process [Evidence
                     IEA]; GO_process: GO:0019563 - glycerol catabolic process
                     [Evidence IEA]; GO_process: GO:0006071 - glycerol
                     metabolic process [Evidence IEA]; GO_process: GO:0006071 -
                     glycerol metabolic process [Evidence TAS] [PMID 8358828];
                     GO_process: GO:0006072 - glycerol-3-phosphate metabolic
                     process [Evidence IEA]; GO_process: GO:0016310 -
                     phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="glycerol kinase"
                     /protein_id="XP_018736450.1"
                     /db_xref="GeneID:30037111"
                     /translation="MSPEPTVLEVAGELQMASIDRDAFKNVSDVPVDEEQYVLALDQG
                     TTSARVIVFSSESVPVASHQVELNQHYPHPGWVEHDPMELIRACRECIDKVGDKLDAK
                     RIPRKNVKALGITNQRETTVLWDKRNGQPVYNAIVWSDTRTEGTVVRLEQKPNADKVP
                     KICGLHISTYFAAVKVRWILDNVPKAREVYEEGCLCFGTVDSWILYNFTNGARHITDA
                     TNASRSMFMNIQTLEYDAELVDFFDVPKLNLPDVVSSSEIYGYFSDDDAAFPSLPISG
                     CLGDQSSALVGHLGFDKGDAKNTYGTGCFLLYNTGNDPVTSENGLLTTIAFQLKGQKP
                     VYALEGSIAVAGSIIKWFRNNLGLIETSEQMSDLAGQVKDSAGVYFVTAFSGLFAPYW
                     RRDARGTIVGLTAYTTRAHIARAAIEATCFQTRAILESMSRDSGVPFHKLLVDGGMSS
                     SAVAMQIQSDILGMEVVRPGMREPTALGAAIVAGLATGVWNDLDHVRSKLQKRRTITS
                     FTGSLTEKERDEQYRMWGRAVEKACGWVE"
     gene            complement(<961417..>962115)
                     /locus_tag="AWJ20_4927"
                     /db_xref="GeneID:30037112"
     mRNA            complement(<961417..>962115)
                     /locus_tag="AWJ20_4927"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882032.1"
                     /db_xref="GeneID:30037112"
     CDS             complement(961417..962115)
                     /locus_tag="AWJ20_4927"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736451.1"
                     /db_xref="GeneID:30037112"
                     /translation="MDQYIYNPPPPPPPPAPGSGVGSARKTNSRGNQTNSINSYHNRA
                     DSRQHPYKKPNIGAATSFGAASGSAMGGASGGGSVKMDGDLSSISPEIREAAKDIENW
                     IAERRKKWPSAQRIVEKEKEDQQRQEREKKRHEFRLEHEGASSTAITASSTSSSSTKP
                     LCRYFLKGKCKAGTKCQYSHDKTNPSTSTPKYKRFEAPDRSSLFKKLVQTDLDRENSR
                     ILDFLVYLGETGVL"
     gene            <963337..>963648
                     /gene="FMP37"
                     /locus_tag="AWJ20_4928"
                     /db_xref="GeneID:30037113"
     mRNA            <963337..>963648
                     /gene="FMP37"
                     /locus_tag="AWJ20_4928"
                     /product="Mpc1p"
                     /transcript_id="XM_018882033.1"
                     /db_xref="GeneID:30037113"
     CDS             963337..963648
                     /gene="FMP37"
                     /locus_tag="AWJ20_4928"
                     /codon_start=1
                     /product="Mpc1p"
                     /protein_id="XP_018736452.1"
                     /db_xref="GeneID:30037113"
                     /translation="MCTTHFWGPVSNFGIPVAAIMDLKKDPTLISGPMTGSLIVYSLV
                     FMRYATAVTPWNPLLFGCHVVNEIAQIGQGARFVNYWYLGGKDKATTAPAAPAASSEE
                     K"
     gene            complement(<963887..>964933)
                     /locus_tag="AWJ20_4929"
                     /db_xref="GeneID:30037114"
     mRNA            complement(<963887..>964933)
                     /locus_tag="AWJ20_4929"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882034.1"
                     /db_xref="GeneID:30037114"
     CDS             complement(963887..964933)
                     /locus_tag="AWJ20_4929"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736453.1"
                     /db_xref="GeneID:30037114"
                     /translation="MKNYLELMAQRAEIFEITFGAEHVQLSSYTTGIYTSESTILRQP
                     LNTQMIMRLDQIEALAVEENMSLGIRLKEFRVFISLLDSLSPQSLFEAYFFKAGYPML
                     FSLSDQAVISLPVQQLNPGGDSTGGGGPAKAVPRGIDISFVFLTTGPSTGSDIGTTST
                     TSHLPSDSDAIVESRNVSIIRRGISRAAAASDTMTTSGSTTTAAESIIGARSMSTVTD
                     TDSLTSGGRNHNHNRRAYNFDGDDPSGSLTASGSMLVDSAHELNNNNNDDYEIQPSVR
                     WNDNDDHELMAPDQTMHQQQPQPSTTESSLFVYQENDDEEEALDHELLTFASQLDAIG
                     PTQNKSQAHGLFDD"
     gene            complement(<965985..>967706)
                     /locus_tag="AWJ20_4930"
                     /db_xref="GeneID:30037116"
     mRNA            complement(<965985..>967706)
                     /locus_tag="AWJ20_4930"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882036.1"
                     /db_xref="GeneID:30037116"
     CDS             complement(965985..967706)
                     /locus_tag="AWJ20_4930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736454.1"
                     /db_xref="GeneID:30037116"
                     /translation="MSWADEKKGVEAQLPVPVLEPRVESRETQKKKKKTWSLIFSVVA
                     GVIFVGLFRSIVSSGFWPHFRLRFPHHCHGSDGDESGDLVWKELAKGSNVLHANITLP
                     LDYNDRSAGNVTVALNKIPATHKDGSLGSILLNPGGPGGSGTNLLYRRGADISEIVEG
                     RYDIIGFDPRGINWTSPNFYCGVGDKQISGFNAISNELLSTHGDNVSYGEQLAYGKLQ
                     GLACSSDDSGKYISTALVSTDMLHISRALGDEKLNYWGFSYGSILGNTFAQMYPESVG
                     RMIVDGVMDAEDYYAGTWFSNLENTDNVTRTFYEACSASTNCPIEGSPDEIEHLFGDL
                     ITKLKFEPATVFDIESGSVGLVTYSGFLSSFFATLYSPVVWNRFANVTLDLLNGNALP
                     FYQMYLAPGPDADSLADSAGYATLCGDASNATYPKTVTSPEALKNLVATLRKSSKWWS
                     DNWLIASGCFGYKQTPVMLWDGPFQKVNASMLLIGNTYDPVTPISAARKMATFYTDSA
                     VIHQSGVGHCSLAQKSSCTAELVRNWFNNGVLPPPNTVCPTDEVPFETAQEATVTDLF
                     IPRFFSV"
     gene            complement(<968037..>968618)
                     /gene="GEP4"
                     /locus_tag="AWJ20_4931"
                     /db_xref="GeneID:30037117"
     mRNA            complement(<968037..>968618)
                     /gene="GEP4"
                     /locus_tag="AWJ20_4931"
                     /product="Gep4p"
                     /transcript_id="XM_018882037.1"
                     /db_xref="GeneID:30037117"
     CDS             complement(968037..968618)
                     /gene="GEP4"
                     /locus_tag="AWJ20_4931"
                     /inference="similar to AA sequence:KEGG_Orthology:K01094"
                     /note="Mitochondrial phosphatidylglycerophosphatase (PGP
                     phosphatase); dephosphorylates
                     phosphatidylglycerolphosphate to generate
                     phosphatidylglycerol, an essential step during cardiolipin
                     biosynthesis; null mutant is sensitive to tunicamycin,
                     DTT; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IDA] [PMID 20485265];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0008962 -
                     phosphatidylglycerophosphatase activity [Evidence IEA];
                     GO_function: GO:0008962 - phosphatidylglycerophosphatase
                     activity [Evidence IDA,IGI,IMP] [PMID 20485265];
                     GO_process: GO:0032049 - cardiolipin biosynthetic process
                     [Evidence IMP] [PMID 20485265]; GO_process: GO:0006629 -
                     lipid metabolic process [Evidence IEA]; GO_process:
                     GO:0006655 - phosphatidylglycerol biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008654 - phospholipid
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0046838 - phosphorylated carbohydrate dephosphorylation
                     [Evidence IMP] [PMID 20485265]"
                     /codon_start=1
                     /product="Gep4p"
                     /protein_id="XP_018736455.1"
                     /db_xref="GeneID:30037117"
                     /translation="MNVSGTVNALRLFYNPWQFLPQITVSTFNQIPIPIPSANGKKPI
                     RVVILDKDNCFAEPHKNVVWPEYEQHFAKLKEAYPDGVLIVSNTAGSGDDVGYKQAEL
                     LEQNTGIKVLHHTSKKPGCHSEIMDYLRTQNLATDASEVAVVGDRLMTDVLMANLMGS
                     TSVWIRDGVVPPTSVLSRVEYALYDSLANKDQK"
     gene            complement(<972542..>973846)
                     /locus_tag="AWJ20_4932"
                     /db_xref="GeneID:30037118"
     mRNA            complement(<972542..>973846)
                     /locus_tag="AWJ20_4932"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882038.1"
                     /db_xref="GeneID:30037118"
     CDS             complement(972542..973846)
                     /locus_tag="AWJ20_4932"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736456.1"
                     /db_xref="GeneID:30037118"
                     /translation="MISQHSDIVGKSRAARRVDVDFGFSRGPGGSSSSSGSGAGGNNS
                     GFGSQLSTIPPGLSVGGNNTGGSARGSGGAIIGVASGASAASGLGAGVGGGSNGSYPP
                     SRTTTPALDPESFPTLGSSVQSSNSSSSNSRLPASVTAYHANLPPSDNSPEMLKRRLE
                     ERARQYLNYDTSKMAKFQELTSKYKDGQLDSKMVVFEYNRLFDIKPAQLELLIQDLAV
                     LYKNLPSKRNALISAFDDWKSKQAFPALALASSASTSPSFSSSSGLSHSLPGSKTNLS
                     SSWVSANRATPGSIKTSLASSSHFPSLSGATPSAAKPPPVSSSSPGNLSPVSATAKSF
                     STASLIGSAKVIPRASPSPAAAAKLSDSSFPSLPAAKPKRLPPVRAKTTSTPGPSVWT
                     SGLSATPVDDSPPLSSSTPPPTSNKKKGKGKQVLFRLGAFEN"
     gene            complement(<975920..>979045)
                     /gene="CRZ1"
                     /locus_tag="AWJ20_4933"
                     /db_xref="GeneID:30037119"
     mRNA            complement(<975920..>979045)
                     /gene="CRZ1"
                     /locus_tag="AWJ20_4933"
                     /product="DNA-binding transcription factor CRZ1"
                     /transcript_id="XM_018882039.1"
                     /db_xref="GeneID:30037119"
     CDS             complement(975920..979045)
                     /gene="CRZ1"
                     /locus_tag="AWJ20_4933"
                     /codon_start=1
                     /product="DNA-binding transcription factor CRZ1"
                     /protein_id="XP_018736457.1"
                     /db_xref="GeneID:30037119"
                     /translation="MTDSFQPELVLHQAADTLRAQAPVSGERHLFSVRKISTEPRMVV
                     GDETRDGVSRGGLRTGAVVTNETITTVTADSGSVPTAPLFPETQKGSLKSSHEESTAA
                     TKARGEPPVKAFTTNPVSISTESTEVPVPVTVPVSTSTATSPLASRPISPTPATSKST
                     PSPLLATAVSGQGSDSSSGSSSGSTTETSKPPAVSSTTATATAESSERTTSINIEAEP
                     KTSAALSPNLGSGPTEDSTSKPLAPTPTLIQKPLKTTTSTDKSDAITTTTSNSDSNAG
                     SLAASSGLTSTGTDITDSNPVTSSDSVKSPESPSKSPISNTPASKLSPLDTPVINSET
                     VPSTSHDSATPSTAGPTAGSLVHPTAGAPAEMSTFMHDTGDSAVPSATATRSGSATPS
                     TTSTGNSSTTTASINPNINTSEDATIVRSDPDSKSLSPTSTTTTSTTPGKHACPYCPQ
                     TYTRNHNLKSHLLTHSYERPFTCETCSSKFRRLHDLKRHLKLHTGEKPFICEKCGRRF
                     ARGDALIRHLKSSGQCAGVRRASFVGDVDTGSSGASVAASAGEENIAASSTGVNPGSD
                     SRGLGSRPDIFDHRNGTGLTVGSISGLKGQELVSHKGDISHFPGDGHASSTSSSGSSR
                     GPVLVHQFSSGHGHTSSHGNSPTSSGASQGPQGPHGSHSQSPVPLPISASSSDSSSRP
                     NKVLLLSSSNYSQAVPAPVLVTIQPNNTGPGSSSLPGMEESRLFIHAKPGLIGPRFEP
                     PASLISYPSHSSSSNNNSHNSQGLPGSRPPAPPVLNHKPLMVDSRSLPPITGTRSYGY
                     KQPGDLSQQASASATAGASAGASAGASAPSSSVQHQPIAPAPPQLPASTQTTTISSPV
                     QSDRIQSVQSSTSNHRPGQLQTAVSGHPPAPAPSVHPTNHSLPRENSRIDPVPLQPQT
                     LSQSHSHLQPQQQQKPQQVQMSTGHSILPQNEHLSPSQTHVPRPPSQPQLSFTRHNPS
                     PSAADAPAPSTSISFTHTPPLPGTSHEPTDESSTDSLLRVVKILESRVRMLEERLHVT
                     EGRLSFMESQR"
     gene            <982375..>984192
                     /gene="GID7"
                     /locus_tag="AWJ20_4934"
                     /db_xref="GeneID:30037120"
     mRNA            <982375..>984192
                     /gene="GID7"
                     /locus_tag="AWJ20_4934"
                     /product="glucose-induced degradation complex subunit
                     GID7"
                     /transcript_id="XM_018882040.1"
                     /db_xref="GeneID:30037120"
     CDS             982375..984192
                     /gene="GID7"
                     /locus_tag="AWJ20_4934"
                     /note="Subunit of GID Complex that binds directly to
                     central component Vid30p; GID complex is involved in
                     proteasome-dependent catabolite inactivation of
                     fructose-1,6-bisphosphatase; Gid7p contains six WD40
                     repeats; computational analysis suggests that Gid7p and
                     Moh1p have similar functions; GO_component: GO:0034657 -
                     GID complex [Evidence IDA] [PMID 18508925]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0045721 - negative
                     regulation of gluconeogenesis [Evidence IMP] [PMID
                     12686616]; GO_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IMP] [PMID 12686616]"
                     /codon_start=1
                     /product="glucose-induced degradation complex subunit
                     GID7"
                     /protein_id="XP_018736458.1"
                     /db_xref="GeneID:30037120"
                     /translation="MTAIPMNRTRDSNNSSSTSNNSNGNSASSTSNGNSKLASTTGIE
                     ANGNGNNQNGNSTIASSASITSTESTAATLSERDSSAKNTSGIGTEVLSPTYFGFDKK
                     ETTRLLIQSLHDLGYHDIGKSLENASGYTIESPQVVDLRNAVLSGEWDNAEQILLAGS
                     IEVPNPSDINSMIFLIRKQRYLEILEKDDREEALWFLRNQLSPVNGNGHKEELHFLSK
                     LAMFSLDDIKADAHWDGVNGKSRQLLLESLQEHLSPSIMIPPHRLATLLHQAKSSQLK
                     ASDYYLGDESSATSDFSLYKDYVGDRTKFPNVTTHILKDHFDEVWYLAFSNDGKYLAS
                     SSADKRVFIWDVEDNFKLHRRLEGHHKGVVFFSWSPNDKYIVSCGQDSHAIVWDVQKG
                     EKVSQASHDEAVDSCAWSHDNRSFITGSPDKKMILWDLDGREIHTWTNIRAQSMAVTP
                     DGNRLIVICSDMIIHVFDLRTYEMITQISVSNKILTSISVSRDSRYAVISVAPEEIHL
                     WDLETYRLVRKYVGQLQDEFVIRSSFGGLNENFILSGSEDSHVYIWNRDNANLIEALP
                     GHTGTVNCVQWRPGHPAMFASAGDDSTIRIWQPASRQDL"
     gene            complement(<984745..>986340)
                     /gene="ALO1"
                     /locus_tag="AWJ20_4935"
                     /db_xref="GeneID:30037121"
     mRNA            complement(<984745..>986340)
                     /gene="ALO1"
                     /locus_tag="AWJ20_4935"
                     /product="D-arabinono-1,4-lactone oxidase"
                     /transcript_id="XM_018882041.1"
                     /db_xref="GeneID:30037121"
     CDS             complement(984745..986340)
                     /gene="ALO1"
                     /locus_tag="AWJ20_4935"
                     /inference="similar to AA sequence:KEGG_Orthology:K00107"
                     /note="D-Arabinono-1,4-lactone oxidase; catalyzes the
                     final step in biosynthesis of
                     dehydro-D-arabinono-1,4-lactone, which is protective
                     against oxidative stress; GO_component: GO:0031307 -
                     integral component of mitochondrial outer membrane
                     [Evidence IDA] [PMID 16689936]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0031966 -
                     mitochondrial membrane [Evidence IEA]; GO_component:
                     GO:0005741 - mitochondrial outer membrane [Evidence IDA]
                     [PMID 16407407]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 10094636]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003885 -
                     D-arabinono-1,4-lactone oxidase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003885 -
                     D-arabinono-1,4-lactone oxidase activity [Evidence IDA]
                     [PMID 10094636]; GO_function: GO:0008762 -
                     UDP-N-acetylmuramate dehydrogenase activity [Evidence
                     IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0050660 - flavin adenine
                     dinucleotide binding [Evidence IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA,IEA];
                     GO_function: GO:0016614 - oxidoreductase activity, acting
                     on CH-OH group of donors [Evidence IEA]; GO_function:
                     GO:0016899 - oxidoreductase activity, acting on the CH-OH
                     group of donors, oxygen as acceptor [Evidence IEA];
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]; GO_process: GO:0034599 - cellular response to
                     oxidative stress [Evidence IMP] [PMID 10094636];
                     GO_process: GO:0070485 - dehydro-D-arabinono-1,4-lactone
                     biosynthetic process [Evidence IMP] [PMID 10094636];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="D-arabinono-1,4-lactone oxidase"
                     /protein_id="XP_018736459.1"
                     /db_xref="GeneID:30037121"
                     /translation="MADRLAPFSFANRTHRTWAGTFRCKPQLYIQPRTAEEIRDAVVE
                     AKRLNKTLMLTGSGHSPSTLTMSDEWIMNLDIFNKVLSIERHESGKFADVTVEAGIRI
                     YQLTEILAAEGLAIQNLGSISEQSAAGIISTGTHGSSAYHGLVSEQIVKFTLLCSGKA
                     DPETIECSPGDNLDLFRAGLLSVGKLGIITHVTLRVVPAYNLKSRQQIVSFDRFVDEL
                     WPTVWTSSEFIRVWWYPYSDRCVLWRADKCKQEEPLREPINNFYGTTLGRFFYESLLW
                     LAVKVYPSLTPSIERWVFKHQYGFEESINSEGNVAVQRSDLALNMDCLFSQFVNEWAM
                     PLTEGPKVLRQLETIIKDAAKNNSFYVHAPFEVRISNTAVSGSTDTINPDNYSVPHLG
                     TVPGNTVRPLLDGTPKLGAATTPITYDKLTLYLNATVYRPFGFDCPIDKWYRTFEDTV
                     AAVGGKPHWAKNFLGTFDDKPASTLTDGEMRGLKPTMDSWFGDDLTLFKTLRETHDPQ
                     GTFLSGRHWAEINGFVSSVTDIV"
     gene            <986836..>988308
                     /locus_tag="AWJ20_4936"
                     /db_xref="GeneID:30037122"
     mRNA            <986836..>988308
                     /locus_tag="AWJ20_4936"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882042.1"
                     /db_xref="GeneID:30037122"
     CDS             986836..988308
                     /locus_tag="AWJ20_4936"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736460.1"
                     /db_xref="GeneID:30037122"
                     /translation="MNRARKRRRDEPWHQLRRGTTERSGGDMRSVREERKGGSGDGSS
                     GSSLSRHGSSNDITVRDITIDSTGNSGWQRDAVPADLPDEKDAIEKRVARARVRAAIE
                     KSSDRENSMNTGSNADHGAVNPRETNSGNSETSPRNGVESLRSIAARSVASHSRDIRR
                     MLLRNSNVSWELGWKLVWEWIRLMGLDSYPLFTLFLKEFGTKRDFHCHHRQTVPVADI
                     TGYRAGSKRDVFLDSRLLPSINTKHRIEYIPYGGVSGVVSLVQSISQYNLSMEIGNNI
                     VLLDLSGLRIPRESLNDMCLSLTSLKSLAGLDVSGCGILESSNILTLWRVAMTSGAWT
                     NLRLLCLGDSYLNSTTMSVYQTLFDTSLAYIEGPSNYTPDETKWVHGRNLTGISPRFT
                     VNYSLAFKYRFLSSSANINEPRVRLPKATVLQEFILTRDESSPPWLSKRPSFNCRDCY
                     IRKPTSSSPPTLPSKPASKSKLTIRKDKLRGPLTAQGFLF"
     gene            <994711..>996717
                     /gene="PHO84"
                     /locus_tag="AWJ20_4937"
                     /db_xref="GeneID:30037123"
     mRNA            <994711..>996717
                     /gene="PHO84"
                     /locus_tag="AWJ20_4937"
                     /product="phosphate transporter PHO84"
                     /transcript_id="XM_018882043.1"
                     /db_xref="GeneID:30037123"
     CDS             994711..996717
                     /gene="PHO84"
                     /locus_tag="AWJ20_4937"
                     /codon_start=1
                     /product="phosphate transporter PHO84"
                     /protein_id="XP_018736461.1"
                     /db_xref="GeneID:30037123"
                     /translation="MPDRSHHNPIPGEIPVPHGVQEYDTVDGRIINDIDDFQYTDKSE
                     KEIFAYLLQPADAYTPEGVYWADLPFGKKVSFVTSVDSAEAKKELKTIGRMFKEDPLS
                     PVAWYFRNCVLPGAGLGLEGYVLFSIGNVSSLFSAAWPECWGSKATVCNKNWIAAVSY
                     LEIVGIIFGQVIVGFIGDGIGRKWGLIQDASIMFIGLIMLTASWGVTLNGWVICYAWS
                     LFFYSVGVGGEYPMTATSGMERGTRSVFTSADDRLHRGRKVLQAFLMQGWGQFFNQVI
                     LILLLLIFHHGSGNPPYSKVAVQWTFRIAFAIPAIGTLWLVYYRAYKMPYPSKDLEAV
                     KKKSKVTGYDVESLKLVLKYFGPRLLATTGAWFANDVFFYGNKLFQGQFIAVIAPNDK
                     SVILGWLYNLINIGVSLAGYYLAAFLIDNKLYGRNRMMQVGFLMDFILFVIPAFHYKY
                     YTAPENVAKFQTMYFLSSFFNQFGPNAVTFLVAAEVYPTQVRATAHGISAACGKLGAL
                     FASVVYSYISVQTRFYLVPWFGLAGMLVTFVFMPDTTGLDLREQDRRFQFIREGRDHE
                     YHGIAVHPQHLSLWERFRGVGKNYNPELDYKQKVDELRSDWEERQKLKAAEGDNASND
                     EELTGDYSPDVHQYFVRTSPLLTANKQGVEDNLKLPEAATNEKL"
     gene            complement(<998023..>998436)
                     /gene="CUS2"
                     /locus_tag="AWJ20_4938"
                     /db_xref="GeneID:30037124"
     mRNA            complement(<998023..>998436)
                     /gene="CUS2"
                     /locus_tag="AWJ20_4938"
                     /product="Cus2p"
                     /transcript_id="XM_018882044.1"
                     /db_xref="GeneID:30037124"
     CDS             complement(998023..998436)
                     /gene="CUS2"
                     /locus_tag="AWJ20_4938"
                     /inference="similar to AA sequence:KEGG_Orthology:K13093"
                     /note="Putative checkpoint factor in transcription; binds
                     to U2 snRNA and Prp11p; may be involved in U2 snRNA
                     folding; contains two RNA recognition motifs (RRMs);
                     GO_component: GO:0005686 - U2 snRNP [Evidence TAS] [PMID
                     11804584]; GO_component: GO:0005681 - spliceosomal complex
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IMP,ISS] [PMID 9710584]; GO_function: GO:0003676
                     - nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0008380 - RNA splicing [Evidence IEA];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IGI,IPI] [PMID 9710584]"
                     /codon_start=1
                     /product="Cus2p"
                     /protein_id="XP_018736462.1"
                     /db_xref="GeneID:30037124"
                     /translation="MDRKLADWDDDEPKAISKRWEKVIVLKNAFTLDELQDASTAFDI
                     KQDIMEGCEDIGPVTSVTLYDLEPEGIATVKFQEKDDAVTCIEVMNGRYFGGKQLEAF
                     PYDGKIKYRKSKKDGEDDKEQERLDKFGSWLNKGE"
     gene            complement(<998592..>999323)
                     /gene="CUS2"
                     /locus_tag="AWJ20_4939"
                     /db_xref="GeneID:30037125"
     mRNA            complement(<998592..>999323)
                     /gene="CUS2"
                     /locus_tag="AWJ20_4939"
                     /product="Cus2p"
                     /transcript_id="XM_018882045.1"
                     /db_xref="GeneID:30037125"
     CDS             complement(998592..999323)
                     /gene="CUS2"
                     /locus_tag="AWJ20_4939"
                     /inference="similar to AA sequence:KEGG_Orthology:K13093"
                     /note="Putative checkpoint factor in transcription; binds
                     to U2 snRNA and Prp11p; may be involved in U2 snRNA
                     folding; contains two RNA recognition motifs (RRMs);
                     GO_component: GO:0005686 - U2 snRNP [Evidence TAS] [PMID
                     11804584]; GO_component: GO:0005681 - spliceosomal complex
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IMP,ISS] [PMID 9710584]; GO_function: GO:0003676
                     - nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0008380 - RNA splicing [Evidence IEA];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA];
                     GO_process: GO:0000398 - mRNA splicing, via spliceosome
                     [Evidence IGI,IPI] [PMID 9710584]"
                     /codon_start=1
                     /product="Cus2p"
                     /protein_id="XP_018736463.1"
                     /db_xref="GeneID:30037125"
                     /translation="MGHTTDPIAKVNFPPIPKGTPSDSLEWAKDPRIAYSQVTGKWIF
                     EDVDNGDEYEFNEEVRSWVPILEEEDIKSQQQAYQPPSKRSPDREDESKHEDTSTNGS
                     KRTKKPKLDQPSHKERKPTGIYLSNLPKDVTYEELDTTFSKYGVIAEDLNTGNKKIKI
                     YRDDKDQPKGDALIVYFKPESVPLAIEMMDNSELRPGEPGRNPNGKIAVQLAEYKHSE
                     DNHEKPKLNAKEKLKIQKKLQKLNE"
     gene            complement(<999602..>1001269)
                     /gene="TPO3"
                     /locus_tag="AWJ20_4940"
                     /db_xref="GeneID:30037127"
     mRNA            complement(<999602..>1001269)
                     /gene="TPO3"
                     /locus_tag="AWJ20_4940"
                     /product="Tpo3p"
                     /transcript_id="XM_018882047.1"
                     /db_xref="GeneID:30037127"
     CDS             complement(999602..1001269)
                     /gene="TPO3"
                     /locus_tag="AWJ20_4940"
                     /note="Polyamine transporter of the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; specific for spermine; localizes to the
                     plasma membrane; TPO3 has a paralog, TPO2, that arose from
                     the whole genome duplication; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IMP] [PMID
                     11171066]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 12562762]; GO_function: GO:0015297 -
                     antiporter activity [Evidence IEA]; GO_function:
                     GO:0000297 - spermine transmembrane transporter activity
                     [Evidence IMP] [PMID 11171066]; GO_process: GO:0000296 -
                     spermine transport [Evidence IMP] [PMID 11171066];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tpo3p"
                     /protein_id="XP_018736464.1"
                     /db_xref="GeneID:30037127"
                     /translation="MSSDNSLTEERQIGGYGDITHHYDLTKKISRENNPMEDNDVDPM
                     YEPPHNYDILRVKSHPDPTHQELNADDPWKYPVDAETGFRIVTFVPDDKDDPRTWSKT
                     RKWFITLALGVVCFTVAFSSAAVTGAMVGPNAPGATFNVSDEVVILTVTLFVIGFGVG
                     PLLFAPLSEEVGRRPIYVVTLALAVIFIIPCAVAQNIGTLLVGRFIDGIFFSAPLTII
                     GGSLADMWVNSERGVAMAIFSAAPFLGPAAGPLVGGFVGDNAGWRWIYYVMLIFAFCV
                     YVFSTISIPETHHNTLLAKRAKKLIKLTGDTRYKTAKQLVPKSFAETAKVTLQRPPQL
                     LCEIIVFLVTIYMAVLYGLLYMFFFAYPVIFMEGKGWSASLTGLTFIPIIVGVLISTA
                     ISPYVNSDYVRRANAYLDKGEVPPAELRLIPMMVGCWFVPIGLFIYAWTSYPTISWVG
                     PTLAGLPCGFGFILIYNSATNYIVDSYQHYAASALAAKTFVRSFWGASVPLFTIQMYH
                     RLGYEWAGSLLAFISLACCIIPYLFFFYGAKIRERSKYAYTPEVTKN"
     gene            complement(<1003096..>1003914)
                     /locus_tag="AWJ20_4941"
                     /db_xref="GeneID:30037128"
     mRNA            complement(<1003096..>1003914)
                     /locus_tag="AWJ20_4941"
                     /product="hydrophobic surface binding protein A"
                     /transcript_id="XM_018882048.1"
                     /db_xref="GeneID:30037128"
     CDS             complement(1003096..1003914)
                     /locus_tag="AWJ20_4941"
                     /codon_start=1
                     /product="hydrophobic surface binding protein A"
                     /protein_id="XP_018736465.1"
                     /db_xref="GeneID:30037128"
                     /translation="MKFTTLVLTSLLSSYALADVGSLVSAIKQLQTDVETTDKDVKGF
                     DKSQGINGALSIQSTEGNIEKDVDSVTSEVNGLGDLSDSDVSQIADAIKSVSSAVTGL
                     LSDLTSKASDLISVGTQSIVAGDLSSLSGKTYELESAAYKKVPCANAAEIASDFAQIN
                     SGFDAAFKAYSAQASGSPPAAPSGCASSAAAGGSSAAAATSAAPASSAAATSAAAPAS
                     SAAAESSAPASTSAAAPATESASSSAPAVAEGGAAGLKAGALGAAAAGVAALLL"
     gene            complement(<1010664..>1012022)
                     /locus_tag="AWJ20_4942"
                     /db_xref="GeneID:30037129"
     mRNA            complement(<1010664..>1012022)
                     /locus_tag="AWJ20_4942"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882049.1"
                     /db_xref="GeneID:30037129"
     CDS             complement(1010664..1012022)
                     /locus_tag="AWJ20_4942"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736466.1"
                     /db_xref="GeneID:30037129"
                     /translation="MATTGASDFSIIALLTPPGAAPGTGLSGVIAGANTMFAAAGGAE
                     GLGPVIIDQVIGELQGLFGDYPNSTDIAPSAIFLAIFAILGAAHLYIFLKDYSRGHRF
                     WISFGLFIYCVFRVIGFACRISWAKDVLRINTGIVSVVFSQVSVLYMNVLCMILGHRI
                     FTWRHPETGAASWFNAIISVIYLLICGVVAMAIVGQAIPYLYFLSPENWARYQKVVKA
                     AAILNLLYALAGLALVTLAYTFKPGSIDHRLWRMPKMQAKDFLPPTIQPTWIESTGLF
                     YFPRRGSQIPILKGDRLEKAIRVIPSREAPASGLTNSHSPDHTSGPSIRTAVIVVVSL
                     SLILTMNVAFRVAAVFTVKPRGGGTPGSHLNAWVFHNYVFYIWYGAFEVIVNLILLLS
                     RVDLRFYIPDMARKRRADEPLPNHQYENDEVKLTASNNEVSDVENHPQYDGQYNTHNL
                     AE"
     gene            complement(<1016263..>1019097)
                     /gene="STE11"
                     /locus_tag="AWJ20_4943"
                     /db_xref="GeneID:30037130"
     mRNA            complement(<1016263..>1019097)
                     /gene="STE11"
                     /locus_tag="AWJ20_4943"
                     /product="mitogen-activated protein kinase kinase kinase
                     STE11"
                     /transcript_id="XM_018882050.1"
                     /db_xref="GeneID:30037130"
     CDS             complement(1016263..1019097)
                     /gene="STE11"
                     /locus_tag="AWJ20_4943"
                     /inference="similar to AA sequence:KEGG_Orthology:K11228"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase kinase
                     STE11"
                     /protein_id="XP_018736467.1"
                     /db_xref="GeneID:30037130"
                     /translation="MCLSFGNFPEPLLAGYIVQVLNGLRFLHEQGTIHRDIKGANILT
                     DKEGKIKLADFGVATQSVVGTLSRDKSVVGTPYWMAPEVIEVNGATAASDIWSLGCTI
                     VELLTGKPPNYHLDPMSAMYAIVSKEIPLPEGISSELKDFLLECFQKDPNLRVSAKAL
                     QKHPWLKKHSPSMASSNTKYEEAIKTVKIHNSPKRATSTTLGDDIFSPVPRAEGGKRQ
                     SPVRNSLFNVSPAKRRTSLVQKGDPPLAKNLAKQFSENWHDDDDEFADLEGDLNADRL
                     QAVLSSKFASRQPPKPDFKLESEPMQRQTSQTSQVSLESQLSDISLTDESRVSQSNGK
                     SRSSDIHGYAETNENDYTNDFEDVGTFDTMALSPFIKESPDIRGQSTKESPPSVQEPP
                     PSAAVSMESTTTADTDNPFLKIESEDVVEADPELRMAHTRLEQVISTMENASNSADLK
                     NTTEELLDILRNFPETRTTFFKSSGLSLAYTVLRDSTSKTVVVNIVHLLLVIAKDEAN
                     ANALDDFWLLGGMQVVIRLLSRRKIFQVRSGAATLIEQCCNDSLLSLQSFMACGGLKY
                     LYELLEEDCQKERVLVRVALTMLKEILQTITSSVLRKSIYKNLCEDGVMNSLVSIPGP
                     NNASKDLVDLTLNLLLSMSQDSIVRANIGLNYGRKLLSKYDKVQEQKDKLSILKFVKN
                     ISQEQSHLEPNQEVSIISLLVTILQQATDKASTAIKKDVLNQAVPALFNICRLNGSRQ
                     EKAAEFGLVPILTNILQDTSIQSRDNVRQLALQMLCDMTHAGKLSREELNRNNCLELL
                     LTYVPDPYWQRDIYDALGAWLRGDINIQHKLATPPAVDTLLDGLKTNINGISYGDLMN
                     SFGSMIRLSPLLCKSMPLSKFYSIIRGGLLSTDPLVIVNVLRVLNIVVETTGATVLDA
                     KLRDQLKKHAKTNNSKLARQLASDLLGPGV"
     gene            <1023031..>1025604
                     /gene="RAD16"
                     /locus_tag="AWJ20_4944"
                     /db_xref="GeneID:30037131"
     mRNA            <1023031..>1025604
                     /gene="RAD16"
                     /locus_tag="AWJ20_4944"
                     /product="DNA repair protein RAD16"
                     /transcript_id="XM_018882051.1"
                     /db_xref="GeneID:30037131"
     CDS             1023031..1025604
                     /gene="RAD16"
                     /locus_tag="AWJ20_4944"
                     /inference="similar to AA sequence:KEGG_Orthology:K15083"
                     /note="Nucleotide excision repair (NER) protein; binds
                     damaged DNA during NER; binds DNA in an ATP-dependent
                     manner (with Rad7p) during NER; required for NER of
                     non-transcribed chromatin; subunit of Nucleotide Excision
                     Repair Factor 4 (NEF4) and the Elongin-Cullin-Socs (ECS)
                     ligase complex; GO_component: GO:0031463 - Cul3-RING
                     ubiquitin ligase complex [Evidence IDA] [PMID 16675952];
                     GO_component: GO:0000113 - nucleotide-excision repair
                     factor 4 complex [Evidence IDA] [PMID 9497356];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA,IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0008094 - DNA-dependent ATPase activity
                     [Evidence IDA] [PMID 9497356]; GO_function: GO:0003684 -
                     damaged DNA binding [Evidence IDA] [PMID 9497356];
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA,IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA,IEA]; GO_function: GO:0003676 -
                     nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0004842 - ubiquitin-protein transferase
                     activity [Evidence IDA] [PMID 16675952]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0006281 - DNA repair [Evidence IEA]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0000715 -
                     nucleotide-excision repair, DNA damage recognition
                     [Evidence IDA,IMP] [PMID 15177043]; GO_process: GO:0042787
                     - protein ubiquitination involved in ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 16675952]"
                     /codon_start=1
                     /product="DNA repair protein RAD16"
                     /protein_id="XP_018736468.1"
                     /db_xref="GeneID:30037131"
                     /translation="MSSGSALSTPPSSIEDDEDWLSMPMSSRQAADLLGVVDSNNGSG
                     TKRKRPAAKKKSPRQVARDALNSAVNGEEFRLTPEPTAKKTPRKPRMKVASSSEDADF
                     EEDNSEVTRPRSARSRRKPRIVEASDNDNDDEDDDDEEYKEKSDNSADSEEEVVKEEE
                     IDELQGEDDNVETAAVVPAPRRRQRRGGKREPRAPKLPRHVVMYNRLNEGLHEFHPEL
                     KTIFEDMKNRPEIKPEQIPQPEGMACELLPFQREGLNWLIKQEQGMYKGGILADEMGM
                     GKTIQTVALLMTDPSDAPPTLVVAPTVALMQWKHEIDLHTQGKLSVLLYHGQNRSSDE
                     SVIQQHRIVLTTYAVLESVFRRQVLGFTRKGSEKKVRQKSPLHQIHWNRIVLDEAHNI
                     KDRQSNTARAVFNMKANYRLCLSGTPLQNRIGEIYSLMRFLGIEPFSKYYCSKCDCES
                     HTWNFGSSYHCEICNHVVMHHVNFFNHSLLKHIQRYGFKDEGGVAMGRLRSVLSQIML
                     RRTKMERADDLGLPPRVVEIRRDYFNEEEKDLYSSVYSESNRKFNTYVAANVVLNNYA
                     NIFTLITRMRQISDHPDLVLRRTIGNSEDADAINRLVCKICDDEAEEAIQSKCHHTFC
                     RLCIKEYVEGWTGDQSELECPVCHLQLTIDLTAPAIQADESLVKKGSIVNRINMTGGW
                     RSSTKIEALVEELYKLRSDRQTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSP
                     TQRDNIIRHFMETPSVEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVH
                     RIGQHRPVKITRLVIEDSIESRIIELQEKKAQMIQATIESDDGAMNKLTPADMQFLFQ
                     N"
     gene            <1025830..>1025916
                     /locus_tag="AWJ20_4945"
                     /db_xref="GeneID:30037132"
     tRNA            <1025830..>1025916
                     /locus_tag="AWJ20_4945"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:30037132"
     gene            complement(<1026316..>1027365)
                     /gene="SOR1"
                     /locus_tag="AWJ20_4946"
                     /db_xref="GeneID:30037133"
     mRNA            complement(<1026316..>1027365)
                     /gene="SOR1"
                     /locus_tag="AWJ20_4946"
                     /product="L-iditol 2-dehydrogenase SOR1"
                     /transcript_id="XM_018882052.1"
                     /db_xref="GeneID:30037133"
     CDS             complement(1026316..1027365)
                     /gene="SOR1"
                     /locus_tag="AWJ20_4946"
                     /inference="similar to AA sequence:KEGG_Orthology:K05351"
                     /note="Sorbitol dehydrogenase; expression is induced in
                     the presence of sorbitol or xylose; GO_component:
                     GO:0005575 - cellular_component [Evidence ND];
                     GO_function: GO:0003939 - L-iditol 2-dehydrogenase
                     activity [Evidence IEA]; GO_function: GO:0003939 -
                     L-iditol 2-dehydrogenase activity [Evidence IDA,ISS] [PMID
                     8125328]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IEA]; GO_process: GO:0019318 -
                     hexose metabolic process [Evidence IEP] [PMID 8125328];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="L-iditol 2-dehydrogenase SOR1"
                     /protein_id="XP_018736469.1"
                     /db_xref="GeneID:30037133"
                     /translation="MSNPSFVLQKVNEVSFEDRPVPEIKDPHYVKIAVKKTGICGSDV
                     HYYTHGAIGDFVVKAPMVLGHESAGVIVEVGSEVKNLKVGDRVAMEPGVPSRYSDEYK
                     SGRYNLCPCMAFAATPPYDGTLAKYYLLPEDYCVKLPDHVSLDEGALVEPLAVGVHSS
                     KLADVRPGSKVAVFGAGPVGLLITAVASAFGASSVTVIDIVQNRLDLAKELGATHTVL
                     ASIKDTSDETAKKVVAATGAQPDIVLDASGAESSINAAISAIKPGGTYVQVGMGKPNV
                     NFPIANVIGKELTIKGSFRYGYGDYPLAVELISSGKVNVKKLISHTVKFEEAKEAFEL
                     VMSGKAVKVIIDGPQ"
     gene            <1030449..>1032098
                     /gene="LYP1"
                     /locus_tag="AWJ20_4947"
                     /db_xref="GeneID:30037134"
     mRNA            <1030449..>1032098
                     /gene="LYP1"
                     /locus_tag="AWJ20_4947"
                     /product="lysine permease"
                     /transcript_id="XM_018882053.1"
                     /db_xref="GeneID:30037134"
     CDS             1030449..1032098
                     /gene="LYP1"
                     /locus_tag="AWJ20_4947"
                     /inference="similar to AA sequence:KEGG_Orthology:K03293"
                     /codon_start=1
                     /product="lysine permease"
                     /protein_id="XP_018736470.1"
                     /db_xref="GeneID:30037134"
                     /translation="MASTSVNPQPSFGSEIGTTDSKNKNGLSNLSERSFGEPEMGYIV
                     KSEDRLSRSLSARQVQMIAIAGVIGTGLFLGTGKSLAEAGPASLLIAYFIIGIVVYLT
                     MNALGEMATYVPVAGSFCTYATRYVDEAFGFALLWNYWFNDAVSTASDLTALQLVFAY
                     WTDFPSWIIALIFWVFLICANLIHVKVYGELEYWLALLKVVTIVIFMIISIVVNAGAN
                     TQHEYLGFHYWYIGDAPFVNNFKGFASVFVTASFAYGGTESIAITAGETKNPSRVMPR
                     VVKTVFWRILFFYVLTVLFIGINVPYNYPNLSTGGTALSPFTITFQLVGSKAAGSFMN
                     AVIVTSVISAGNHALFAGTRLLYTLGVEGFAPKIFTVLTPHKVPYVALLATASISGLC
                     FGASFIGTGTLWAWLQNLVGVSNQLAWLSIGVTAIRFRQALNKQGKTHLLKFKNWTYP
                     WGPWIVVVGVTVIILVQGWSAFAPWSVSSFFSYYIELFIMPVMYIFWKIVKRTKFVKL
                     EDMDLDTDRYVETEEDLAEMEYEDSLTGWRRVVNYLKGFVV"
     gene            complement(<1032380..>1035931)
                     /gene="CHS3"
                     /locus_tag="AWJ20_4948"
                     /db_xref="GeneID:30037135"
     mRNA            complement(<1032380..>1035931)
                     /gene="CHS3"
                     /locus_tag="AWJ20_4948"
                     /product="chitin synthase CHS3"
                     /transcript_id="XM_018882054.1"
                     /db_xref="GeneID:30037135"
     CDS             complement(1032380..1035931)
                     /gene="CHS3"
                     /locus_tag="AWJ20_4948"
                     /inference="similar to AA sequence:KEGG_Orthology:K00698"
                     /note="Chitin synthase III; catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin; required for
                     synthesis of the majority of cell wall chitin, the chitin
                     ring during bud emergence, and spore wall chitosan;
                     contains overlapping di-leucine and di-acidic signals that
                     mediate, respectively, intracellular trafficking by AP-1
                     and trafficking to plasma membrane by exomer complex;
                     requires AP-3 complex for its intracellular retention;
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 15470103]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 8909536]; GO_component:
                     GO:0045009 - chitosome [Evidence IDA] [PMID 8970154];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     9008706]; GO_component: GO:0000131 - incipient cellular
                     bud site [Evidence IDA] [PMID 15470103]; GO_component:
                     GO:0000131 - incipient cellular bud site [Evidence IDA]
                     [PMID 9008706]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0043332 - mating
                     projection tip [Evidence IDA] [PMID 19053807];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 15755916]; GO_function: GO:0004100 - chitin
                     synthase activity [Evidence IEA]; GO_function: GO:0004100
                     - chitin synthase activity [Evidence IMP] [PMID 9760183];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_function:
                     GO:0016758 - transferase activity, transferring hexosyl
                     groups [Evidence IEA]; GO_process: GO:0030476 - ascospore
                     wall assembly [Evidence IMP] [PMID 1293886]; GO_process:
                     GO:0034221 - fungal-type cell wall chitin biosynthetic
                     process [Evidence TAS] [PMID 7565410]"
                     /codon_start=1
                     /product="chitin synthase CHS3"
                     /protein_id="XP_018736471.1"
                     /db_xref="GeneID:30037135"
                     /translation="MTEKKDVASSEHKAEVEGNSSLKSGSKSKTSGPGHCKAVLSSGA
                     TAIAIAKARATAKARARARSKLRTNSRSVSTTNFPTDYYYHLWPVSSVASSVSHNTVL
                     TGDLRPSGEADRTAETRSEDISDGISEGISMGISEGKSKGTSESLAEGSLDTIDGVGE
                     RKEENQISKIQAMPVSADAVTGDKPASTGSSTNKSAKDPTEITKLSFSAPEMTANSKS
                     TAGPRHAPGYPSYFVERFETASAISQPPGPKMSINSQPLNKRLIKSKRAELEFNVGPC
                     SESSAHIIWTGYCNLISCFVRPIMLRWCGIKSHQQQVAWREKIGLFSVIVLITCTVGV
                     FTFGFNEMVCGHNSNVPRIHFSSIPPDTVVIHGRLFNMTTFNHNPKFLRPAPWSSNSF
                     TLTGVSSIPIDASLLFQNVNGHCRPHIKPSRSSQVAHDSDLRVPWYLPCKLLTINDNR
                     IVDFYVPTISSSAYKQLSFIKKYSPEACHTSKYSRERLYEMNSVSDIYYTWKDIDSSP
                     RNIAVLFNDVLDLDRLKLLPPEDWELSKALSQFVSLDASQGLPVSDISKYFVADPSLF
                     KLAKCLTEIAKVGVIDVESVGCISSQIVLYVALMFIFSIVLIKFTFALYFEWFVSWRM
                     GIKGVSSTSWVFWFIWSLFRAKEKIGTGENSGKSDISLSNSERQYSLKSSESKSSSSL
                     SNSSVSQTPMETRSESTAFSQMHMFPSTCESLDDQMYVVCLVTVYSESEDGLRLSLDS
                     LASTDYPDCRKLLLVVCDGLVTGANNDRMTSEIALSLMEDVAVPFHEVPDLSYISVGY
                     GKRRINMAQVHCGYYAHVPSDSSKPKRRVPMICVVKCGLEEERQTSSKPGNRGKRDSQ
                     LILMGFFQKLCMGDRKTDLENEIHYCIEHVYGINPQLFEAILMVDADTKVYEDSLGHM
                     VATLVADSTVIGLCGETKIANKWESWITMIQVFEYFISHHLTKSFESVFGGVTCLPGC
                     FSMYRIKAPPKSGHVLLLLVSPAVVSRYSDNIVNTVHRKNLLLLGEDRYLTTLMLKAF
                     PVHKLIFVPQAKCKTIVPSKFKGLLDQRRRWINSTIHNLLELLLVQELCGVFCFSMQF
                     VVLIDLIGTVTLPAALVFTVYLLIACIYRHPPPVVPLMLLALILGIPGVLILVTAHQW
                     IYVLWMLIYLISLPVWNFILPLNACKLTAWVLRHNRD"
     gene            <1037460..>1038506
                     /gene="URH1"
                     /locus_tag="AWJ20_4949"
                     /db_xref="GeneID:30037136"
     mRNA            <1037460..>1038506
                     /gene="URH1"
                     /locus_tag="AWJ20_4949"
                     /product="trifunctional uridine nucleosidase/nicotinamide
                     riboside hydrolase/nicotinic acid riboside hydrolase"
                     /transcript_id="XM_018882055.1"
                     /db_xref="GeneID:30037136"
     CDS             1037460..1038506
                     /gene="URH1"
                     /locus_tag="AWJ20_4949"
                     /inference="similar to AA sequence:KEGG_Orthology:K01240"
                     /note="Uridine nucleosidase (uridine-cytidine
                     N-ribohydrolase); cleaves N-glycosidic bonds in
                     nucleosides; involved in the pyrimidine salvage and
                     nicotinamide riboside salvage pathways; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0016798 - hydrolase
                     activity, acting on glycosyl bonds [Evidence IEA];
                     GO_function: GO:0016799 - hydrolase activity, hydrolyzing
                     N-glycosyl compounds [Evidence IEA]; GO_function:
                     GO:0070635 - nicotinamide riboside hydrolase activity
                     [Evidence IDA] [PMID 19001417]; GO_function: GO:0070636 -
                     nicotinic acid riboside hydrolase activity [Evidence IDA]
                     [PMID 19001417]; GO_function: GO:0050263 -
                     ribosylpyrimidine nucleosidase activity [Evidence IDA]
                     [PMID 11872485]; GO_function: GO:0050263 -
                     ribosylpyrimidine nucleosidase activity [Evidence IDA]
                     [PMID 12111094]; GO_function: GO:0045437 - uridine
                     nucleosidase activity [Evidence IEA]; GO_function:
                     GO:0045437 - uridine nucleosidase activity [Evidence IDA]
                     [PMID 19001417]; GO_process: GO:0034356 - NAD biosynthesis
                     via nicotinamide riboside salvage pathway [Evidence IGI]
                     [PMID 19001417]; GO_process: GO:0006216 - cytidine
                     catabolic process [Evidence IMP] [PMID 23670538];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0019358 - nicotinate nucleotide salvage
                     [Evidence IGI] [PMID 17482543]; GO_process: GO:0046135 -
                     pyrimidine nucleoside catabolic process [Evidence IDA]
                     [PMID 11872485]; GO_process: GO:0046135 - pyrimidine
                     nucleoside catabolic process [Evidence IDA] [PMID
                     12111094]; GO_process: GO:0008655 - pyrimidine-containing
                     compound salvage [Evidence IMP] [PMID 11872485];
                     GO_process: GO:0006218 - uridine catabolic process
                     [Evidence IMP] [PMID 23670538]"
                     /codon_start=1
                     /product="trifunctional uridine nucleosidase/nicotinamide
                     riboside hydrolase/nicotinic acid riboside hydrolase"
                     /protein_id="XP_018736472.1"
                     /db_xref="GeneID:30037136"
                     /translation="MSLILPKIPLWIDCDPGHDDAIGLLLGSGLDQYHLVGVSTVHGN
                     ASLGNTTSNAISILTAFKRLDVNVYPGAEKPLVRKLNVADSIHGRSGLDGTAFLPMPS
                     FDAQPDHTAVAAMAKAIETYPGTLAIAALGPLTNIALLAMNYPDLLPSLRLLSIMGGG
                     LGLGNWTKFAEFNIWCDAHAAQIVFSDTTLIPKTLLVPLNLTHQAIATDEILEQIQKS
                     RQLDRRSVLRQMLYELMIYFAGTYKKKFGFKNGPPVHDAVAVAAILPFYSDNSTERSE
                     HSNDPPAADLDLRFARYQVHVVEEGPQEGMLVFEPDSDNGIMIAQEMNFTEFWRLVLD
                     AVDNVESSTSLLVS"
     gene            complement(<1038815..>1043804)
                     /gene="GAL11"
                     /locus_tag="AWJ20_4950"
                     /db_xref="GeneID:30037138"
     mRNA            complement(join(<1038815..1043134,1043463..1043527,
                     1043699..>1043804))
                     /gene="GAL11"
                     /locus_tag="AWJ20_4950"
                     /product="Gal11p"
                     /transcript_id="XM_018882057.1"
                     /db_xref="GeneID:30037138"
     CDS             complement(join(1038815..1043134,1043463..1043527,
                     1043699..1043804))
                     /gene="GAL11"
                     /locus_tag="AWJ20_4950"
                     /note="Subunit of the RNA polymerase II mediator complex;
                     associates with core polymerase subunits to form the RNA
                     polymerase II holoenzyme; affects transcription by acting
                     as target of activators and repressors; forms part of the
                     tail domain of mediator; GO_component: GO:0070847 - core
                     mediator complex [Evidence IDA] [PMID 9891034];
                     GO_component: GO:0016592 - mediator complex [Evidence
                     IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_function: GO:0001102 - RNA polymerase II
                     activating transcription factor binding [Evidence IDA]
                     [PMID 20308326]; GO_function: GO:0001128 - RNA polymerase
                     II transcription coactivator activity involved in
                     preinitiation complex assembly [Evidence IDA] [PMID
                     8378310]; GO_function: GO:0001104 - RNA polymerase II
                     transcription cofactor activity [Evidence IEA];
                     GO_function: GO:0001135 - RNA polymerase II transcription
                     factor recruiting transcription factor activity [Evidence
                     IMP] [PMID 15254252]; GO_function: GO:0001088 -
                     TFIIE-class binding transcription factor activity
                     [Evidence IDA] [PMID 8790357]; GO_function: GO:0001095 -
                     TFIIE-class transcription factor binding [Evidence IDA]
                     [PMID 8790357]; GO_function: GO:0001097 - TFIIH-class
                     transcription factor binding [Evidence IDA] [PMID
                     10973956]; GO_process: GO:0051123 - RNA polymerase II
                     transcriptional preinitiation complex assembly [Evidence
                     IDA] [PMID 12482986]; GO_process: GO:0000122 - negative
                     regulation of transcription from RNA polymerase II
                     promoter [Evidence IMP] [PMID 11470794]; GO_process:
                     GO:0045944 - positive regulation of transcription from RNA
                     polymerase II promoter [Evidence IDA] [PMID 8187178];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 9891034]; GO_process: GO:0006357 - regulation
                     of transcription from RNA polymerase II promoter [Evidence
                     IEA]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Gal11p"
                     /protein_id="XP_018736473.1"
                     /db_xref="GeneID:30037138"
                     /translation="MDFNRTGMTFNGMAGAGNNQGQAQAPGQSSNTTQPVGRWGSPVG
                     FFGVVVKVLTECRQQQQQQQPNQSQMDPSGLLGMLPNQGAASSQFMSGAGGAGANAGA
                     GANDTNNFNIQMMRNAAATAGGGAGAGATGMEMTPQMQAAFKQFIQQQQQQQQQQQQQ
                     QQNQGQNQGQNPTAQQLQQQFQQQQQQKNGQFQQHKLQGQVQNALNSGANVNSAAAQR
                     TQQQQQQFFRQQQQYNQQQQQQQQQQQQQGQGQQQQQPQQQQQLQNMYQTLRGANGGG
                     PGQVQGQVPQNQNQGQLPTTTGPGANPLAMTREQQFQFLAMQRQQQQQQQQAQAQAQA
                     QAQAQQNQNLNRSPQVNIGNGQTVNPMTQQNIAGAASAGAGIPGAGLGVNGGGGAATG
                     VAPNTGAPPNAVNAAAILGPNAMKTAEIPQALLNRIPGLPPNVNTWLQITELLRNGQL
                     PKSIMPEIRYVHGMHQKWLIHVKNKQLQAQAAAANGGAGAGPAGQRQIPGATTTGVPS
                     GTGLGATAANGNPAAAGAGGQMGLGANQQLSTADAMMSQLGQLNRNYPGQPSSQTLGM
                     QNPANAAAVAANQAQLRKTELQQQQLLQTQPQQNQGQQQQQQQAQQQQPSLQQQQYFL
                     AAQAQARAARAKNSVASNVTNAAKPAMINAQQSPNQMFANLPKAAGAATSSGPGGSVG
                     SVAGSGATGAGNQFQQWDPNNANFNRPQVSPQMTQMSPQQHQQQLFQNQLDFSGGAAG
                     VGNNAGGATGVAGTVVPNAPAPVLGPGVAPGLAVAGGATGAPQQRAQMPQQRDADRMK
                     LRQIFEEAANIPIRLQNFTDTLSAEEKRQVAEQIKLMIHMYQKIDQLVPLFYFITKNE
                     NATRRLIQLKFMYKEQMEALQKGIYMTSPQILEKTKLEINRYFFFVRDNLQNPQRQQG
                     LAQRQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQLQKGLIPGQIGTQLPGQVQAPGAG
                     AGGAGAGGLMNQIPGQANASAAANSMDPQQMFVAQNFGGSMNANLQQQLPQQSVDVNQ
                     FAQGNLMNQQNNLGPAGLQQQQHLQPQLQQQQQQQHSFVNQPVNQSPQMTKKELAAAA
                     RKKQASTATAATTGAPVTTTMGPTGPGAAVAGANAGNYQAPGAVHTPSGVPAYVKPGL
                     TQDQLKLPGPGRKRKLPPGSSQTTALSPEEVKSGNTPKLSPASLPRGRSSSTGEPSLK
                     KEKLDPNSLTPQQKNALKAMQKKKELADSDPVAYFLTSLGEVLDIPEEDVVNGISKSQ
                     NGGTTPSGTGVSATGPNNGPGSNEMKKLPTYLGRTSTSGPSGGAGGGVTPNALLRTPL
                     PFSAAKTPGAVAGGSGLTGGSTIKPGSTNDHLTGSSESGTLKTSSSPNTGLAPAWTGN
                     VQAVAIRTAFQSIEAVKIGDMPFLASPKEDNNNNTTATTSSSDSSHTSGDSVSSIDAT
                     AVDEKEPVVLPIDGLDDGKQLKFDGWDDLSGVNIWDYDDALLSLGKDDATLRKEFWTV
                     ST"
     gene            complement(<1048115..>1050901)
                     /gene="YVC1"
                     /locus_tag="AWJ20_4951"
                     /db_xref="GeneID:30037139"
     mRNA            complement(<1048115..>1050901)
                     /gene="YVC1"
                     /locus_tag="AWJ20_4951"
                     /product="Yvc1p"
                     /transcript_id="XM_018882058.1"
                     /db_xref="GeneID:30037139"
     CDS             complement(1048115..1050901)
                     /gene="YVC1"
                     /locus_tag="AWJ20_4951"
                     /note="Vacuolar cation channel; mediates release of Ca(2+)
                     from the vacuole in response to hyperosmotic shock;
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IDA] [PMID 11427713]; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 11781332];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 20035756]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0005227 - calcium activated cation channel
                     activity [Evidence IDA] [PMID 1700419]; GO_function:
                     GO:0005262 - calcium channel activity [Evidence IEA];
                     GO_function: GO:0005262 - calcium channel activity
                     [Evidence IDA] [PMID 11781332]; GO_function: GO:0005216 -
                     ion channel activity [Evidence IEA]; GO_function:
                     GO:0005267 - potassium channel activity [Evidence IDA]
                     [PMID 1700419]; GO_function: GO:0005272 - sodium channel
                     activity [Evidence IDA] [PMID 1700419]; GO_function:
                     GO:0005244 - voltage-gated ion channel activity [Evidence
                     IDA] [PMID 1700419]; GO_process: GO:0070588 - calcium ion
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006816 - calcium ion transport [Evidence IEA];
                     GO_process: GO:0030003 - cellular cation homeostasis
                     [Evidence IDA,IMP] [PMID 11427713]; GO_process: GO:0030003
                     - cellular cation homeostasis [Evidence IDA,IMP] [PMID
                     11781332]; GO_process: GO:0006811 - ion transport
                     [Evidence IEA,IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Yvc1p"
                     /protein_id="XP_018736474.1"
                     /db_xref="GeneID:30037139"
                     /translation="MDTEETTLLLPRFQPSALDSIPIYNIVLDIYDLISARVDTALKY
                     DQLRSPQVHSFLIKPLVADLRDGLCAGTLYGLMANSIQFTKESSSYAAMAGVMATRAM
                     ICEIVAIKLLKDFDEDDLMNALTYDFYPLARGMPENSSTSQSTQSQLIPRWQRLSTLE
                     LAIKAEAKRFLAHPVVIQVLEEIWNGSIMFQTSMHKLHRVKFANEEEVLASQFGRRGA
                     GIRYNYSDASILKLSRLRVPRYRHLLNLASFCVLLGLYLMVLSSHSMKISTQEIVFAL
                     WSLGFILDEIVGFTDVGFTLYILSLWNLFDLMILLQLIGYACCRINAIRLNATGQIDD
                     AKKMLTLSYDILATVAIFLFPRLFSIFDNNESFSRMVIAVRKMSIDLAISWLVIVMLS
                     SGFWIAFTLAFARNVFSSNQVAFDLMRILFGFTPVVWENWKYYSPIGRTILLFYLFIT
                     HFVVMTLLFAVLSNSFSEIVANSREEHQYLCAVNTISMIKSESSTLFSYSPPLNLIEW
                     LVRPFFYILPLRQFLILNRTLVKITHFPVLYTIFIYERLYLRLVQIREKVKKDSQNQY
                     RKKQEERLKALVTQLSSADDEIRSGSATPRKTRKKGKPVSTPVPVPGAVSHTEAVKKH
                     QLMSKKISKYDLLDEVFKRPYKGTIKVRPKKPKIDLDVDINDSISRPQRNRDMSRLFH
                     SRAGSSWTSTRPPGTEIYSDPEDTTARPYYESDAIDDEEWPGSYIPNTFERHLSGNSS
                     IVRRLNDRTSPYLLPTVPSSTVLNKFHNEDNSAQNTRRRLPITSRGRLFSSTSSLFRQ
                     DSTMLGISPTRSTSSILRRANIHGAVRNRKWGPDHVSDHGKVKRSTNHDDEDNDDDDD
                     YIVAKSDADVEDEPDQDDEDDRDDGEPTSLAAFNANPVDLWQMQEQIMNRIDSLEGLF
                     KNIDKKLSQIASQN"
     gene            <1052006..>1052797
                     /gene="SPS19"
                     /locus_tag="AWJ20_4952"
                     /db_xref="GeneID:30037140"
     mRNA            <1052006..>1052797
                     /gene="SPS19"
                     /locus_tag="AWJ20_4952"
                     /product="Sps19p"
                     /transcript_id="XM_018882059.1"
                     /db_xref="GeneID:30037140"
     CDS             1052006..1052797
                     /gene="SPS19"
                     /locus_tag="AWJ20_4952"
                     /inference="similar to AA sequence:KEGG_Orthology:K18337"
                     /note="Peroxisomal 2,4-dienoyl-CoA reductase; auxiliary
                     enzyme of fatty acid beta-oxidation; homodimeric enzyme
                     required for growth and sporulation on petroselineate
                     medium; expression induced during late sporulation and in
                     the presence of oleate; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 9268358];
                     GO_component: GO:0005777 - peroxisome [Evidence IEA,IEA];
                     GO_function: GO:0008670 - 2,4-dienoyl-CoA reductase
                     (NADPH) activity [Evidence IEA]; GO_function: GO:0008670 -
                     2,4-dienoyl-CoA reductase (NADPH) activity [Evidence
                     IDA,ISS] [PMID 9268358]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_process:
                     GO:0030437 - ascospore formation [Evidence IEP,IMP] [PMID
                     7969036]; GO_process: GO:0009062 - fatty acid catabolic
                     process [Evidence IDA,ISS] [PMID 9268358]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence IEA];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="Sps19p"
                     /protein_id="XP_018736475.1"
                     /db_xref="GeneID:30037140"
                     /translation="MSGLLANKVAAITGGSSGIGRAIALEFAKNGAKVVINYYPNEQE
                     TSRAISLGNEIKQLFPNTTEPVYSSVPGDIGDPATGKALVAKAVDEFGKLDVFVSNAG
                     ICPFHEFTTMPEEVYYRTVKTNLDGAFFSTQAAANQMKLQGTGGSIIGISSISALVGG
                     EFQTHYTTTKAGVLSLMQSTAVALGKYNIRCNALLPGTIETDINKDDLKDQSKRDYFN
                     KRIPLGRLGEPSDLAGPAVFLASDLSKYVTGSQILVDGGLFVNLQ"
     gene            <1055821..>1058106
                     /locus_tag="AWJ20_4953"
                     /db_xref="GeneID:30037141"
     mRNA            <1055821..>1058106
                     /locus_tag="AWJ20_4953"
                     /product="hypothetical protein"
                     /transcript_id="XM_018882060.1"
                     /db_xref="GeneID:30037141"
     CDS             1055821..1058106
                     /locus_tag="AWJ20_4953"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736476.1"
                     /db_xref="GeneID:30037141"
                     /translation="MASANSRGETLLSSSPSNVISGTSYKGFPGNEQDEDDKDHFHQA
                     NVSIGSESNRTSRSLTSPVLSQHQLHHDPHVLHDLPSQHDFTYNSHIYSIGQASPQSP
                     GFSRRSETGSHSSESSLSFTRDTPKRYSKPSLDRRRLSINTLLTNNERLESALELEEM
                     ECHKLEKTLQDHKIKLSNSLLLQSQLEDDLVKRDEQIGLLQKQAKDARKTRIELETEL
                     SEEVKKYINEKQMWLSKEEEYEEKLSNCNTKIKSLSENLEVARLEFENLKFSGGSSRS
                     AAPSVKNVEASQPISDSGANKFIERMKKESEMAQQQMEMVTREYQARYNRIKSEMEQV
                     QEVNKRLIEENEGFQLLLAEKTILGGFSLADELDQDVNQDVFISEDDETENQQKLSDT
                     EASSSFESDSDLETPVSKRRPVRNSSLPNYAKDEAVTNAEGVDDIDPLDTDDDNIRSL
                     DIPSDSSPTSDSKKSESKTPPSLSTNAKRQVYQLQFEKTSLQNYNRALKSSLERLVSR
                     LLEYREFEKVVEDHNVLNKRSITSFQDRVVSLSNQHPPTLDVPRQRLNSASAPASTAS
                     NQRGHSFTSSISSGFSSVMGRSKGANSISGPSGNIQGHHSHSSSNPLFHMNPPTTPSG
                     IVPRPYRGTLRPSSTWSSMLFAASPSTPTSPNINRDSRQFSTTSTNSESTAPRSPSST
                     SSLVSSSSAASISSGCSGTLSVIDPTILPLSDNKHLVRTTTRSQKQLRPLRLVVAPTD
                     ANSNPAPPLQSASSQSSGWFS"
     gene            <1058423..>1060684
                     /gene="GCN20"
                     /locus_tag="AWJ20_4954"
                     /db_xref="GeneID:30037142"
     mRNA            <1058423..>1060684
                     /gene="GCN20"
                     /locus_tag="AWJ20_4954"
                     /product="putative AAA family ATPase GCN20"
                     /transcript_id="XM_018882061.1"
                     /db_xref="GeneID:30037142"
     CDS             1058423..1060684
                     /gene="GCN20"
                     /locus_tag="AWJ20_4954"
                     /inference="similar to AA sequence:KEGG_Orthology:K06158"
                     /note="Positive regulator of the Gcn2p kinase activity;
                     forms a complex with Gcn1p; proposed to stimulate Gcn2p
                     activation by an uncharged tRNA; GO_component: GO:0005829
                     - cytosol [Evidence IPI] [PMID 9234705]; GO_component:
                     GO:0022626 - cytosolic ribosome [Evidence IDA] [PMID
                     9234705]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0016887 - ATPase activity
                     [Evidence IEA]; GO_function: GO:0016887 - ATPase activity
                     [Evidence ISS] [PMID 7621831]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_process: GO:0006200 - ATP catabolic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0006448 - regulation of
                     translational elongation [Evidence IMP,IPI] [PMID
                     9234705]"
                     /codon_start=1
                     /product="putative AAA family ATPase GCN20"
                     /protein_id="XP_018736477.1"
                     /db_xref="GeneID:30037142"
                     /translation="MPSLPDQVRQSVPAIDPIVAEYAAGYVQHISESTSDPVFANNLD
                     IDGEVEFISSLLKDAGGDPSSVDSLYEKLIEELKKIYAASASKPYIDSASRKLDRDTL
                     LSAQKHNTNRFGAGGGSDGMDLDLLSGRKVESRVDKKKLEKAEKKIAAKLAKRAAKMT
                     AVGYEASKLLNIDDKEDYDTFFLTVNPLELGASQGKSKDIKIENFDLYVGAGQRILSN
                     TSLTLAYGRRYGVVGQNGIGKSTLLKALSRRELAVPKHITILYVEQEVTGDETSALQT
                     VLDADVWRKHLLLEQKKINDRISEISDLVRPLETTDPDYKALDEERDDLESNLNDIYD
                     KLTEIESDKAEGRAAAILFGLGFSAEAQQQPTNSFSGGWRMRLSLARALFCKPDLLLL
                     DEPSNMLDVPSITYLSNYLQSYPSTVVVVSHDRAFLNEVATDIIHQHSERLDYYRGSN
                     FDSFYATREERRKNQQREYENQMAYRKHLQTFIDKFRYNAAKSSEAQSRIKKLEKLPI
                     LEPPEEDQTVTFRFPDPDKLSPPVIQLQGVDFGYSPDKLLLKNVDLDVGIDSRIALVG
                     GNGCGKTTLLKILMDQLKPISGLVSRNGRLRIGYFAQHHIDGMDINLSPVEWMAKMSP
                     GKSDEECRRLLGAFGITGTLGLQKIALLSGGQKSRVAFACLGLNTPHILVLDEPSNHL
                     DTAGLDALADALRNFKGGILMVSHDVSTIDRVCNEIWLSESGTVRKFPGSIYDYKKYT
                     LKQSTGAGVIAKQ"
     gene            complement(<1060860..>1063883)
                     /gene="DIS3"
                     /locus_tag="AWJ20_4955"
                     /db_xref="GeneID:30037143"
     mRNA            complement(<1060860..>1063883)
                     /gene="DIS3"
                     /locus_tag="AWJ20_4955"
                     /product="exosome catalytic subunit DIS3"
                     /transcript_id="XM_018882062.1"
                     /db_xref="GeneID:30037143"
     CDS             complement(1060860..1063883)
                     /gene="DIS3"
                     /locus_tag="AWJ20_4955"
                     /inference="similar to AA sequence:KEGG_Orthology:K12585"
                     /note="Exosome core complex catalytic subunit; has both
                     endonuclease and 3'-5' exonuclease activity; involved in
                     3'-5' RNA processing and degradation in both the nucleus
                     and the cytoplasm; role in degradation of tRNAs; has
                     similarity to E. coli RNase R and to human DIS3; mutations
                     in Dis3p corresponding to human mutations implicated in
                     multiple myeloma cause phenotypes suggesting impaired
                     exosome function; protein abundance increases in response
                     to DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0000177 -
                     cytoplasmic exosome (RNase complex) [Evidence IDA] [PMID
                     10465791]; GO_component: GO:0000177 - cytoplasmic exosome
                     (RNase complex) [Evidence IDA] [PMID 19046973];
                     GO_component: GO:0000178 - exosome (RNase complex)
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0000176 - nuclear
                     exosome (RNase complex) [Evidence IDA] [PMID 10465791];
                     GO_component: GO:0000176 - nuclear exosome (RNase complex)
                     [Evidence IDA] [PMID 19046973]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 9562621];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_function: GO:0000175 - 3'-5'-exoribonuclease
                     activity [Evidence IDA,IMP] [PMID 17173052]; GO_function:
                     GO:0000175 - 3'-5'-exoribonuclease activity [Evidence
                     IDA,IMP] [PMID 17643380]; GO_function: GO:0003723 - RNA
                     binding [Evidence IEA,IEA]; GO_function: GO:0004519 -
                     endonuclease activity [Evidence IEA]; GO_function:
                     GO:0004521 - endoribonuclease activity [Evidence IDA,IMP]
                     [PMID 19060886]; GO_function: GO:0004521 -
                     endoribonuclease activity [Evidence IDA] [PMID 19060898];
                     GO_function: GO:0004521 - endoribonuclease activity
                     [Evidence IDA,IMP] [PMID 19129231]; GO_function:
                     GO:0004527 - exonuclease activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0004518 - nuclease activity
                     [Evidence IEA]; GO_function: GO:0000049 - tRNA binding
                     [Evidence IDA,IMP] [PMID 17643380]; GO_process: GO:0000467
                     - exonucleolytic trimming to generate mature 3'-end of
                     5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID 10508172];
                     GO_process: GO:0000467 - exonucleolytic trimming to
                     generate mature 3'-end of 5.8S rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 9390555]; GO_process: GO:0043628 - ncRNA 3'-end
                     processing [Evidence IMP] [PMID 11352936]; GO_process:
                     GO:0070651 - nonfunctional rRNA decay [Evidence IMP] [PMID
                     19481524]; GO_process: GO:0071028 - nuclear mRNA
                     surveillance [Evidence IMP] [PMID 11030620]; GO_process:
                     GO:0071039 - nuclear polyadenylation-dependent CUT
                     catabolic process [Evidence IMP] [PMID 15935759];
                     GO_process: GO:0071042 - nuclear polyadenylation-dependent
                     mRNA catabolic process [Evidence IC] [PMID 10465791];
                     GO_process: GO:0071035 - nuclear polyadenylation-dependent
                     rRNA catabolic process [Evidence IMP] [PMID 16431988];
                     GO_process: GO:0071035 - nuclear polyadenylation-dependent
                     rRNA catabolic process [Evidence IMP] [PMID 18940861];
                     GO_process: GO:0071038 - nuclear polyadenylation-dependent
                     tRNA catabolic process [Evidence IGI] [PMID 15145828];
                     GO_process: GO:0071038 - nuclear polyadenylation-dependent
                     tRNA catabolic process [Evidence IDA] [PMID 15828860];
                     GO_process: GO:0071038 - nuclear polyadenylation-dependent
                     tRNA catabolic process [Evidence IDA] [PMID 15935758];
                     GO_process: GO:0071038 - nuclear polyadenylation-dependent
                     tRNA catabolic process [Evidence IDA,IMP] [PMID 17643380];
                     GO_process: GO:0070478 - nuclear-transcribed mRNA
                     catabolic process, 3'-5' exonucleolytic nonsense-mediated
                     decay [Evidence IC] [PMID 10465791]; GO_process:
                     GO:0070481 - nuclear-transcribed mRNA catabolic process,
                     non-stop decay [Evidence IC] [PMID 10465791]; GO_process:
                     GO:0071051 - polyadenylation-dependent snoRNA 3'-end
                     processing [Evidence IC] [PMID 10465791]; GO_process:
                     GO:0016075 - rRNA catabolic process [Evidence IMP] [PMID
                     10508172]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]"
                     /codon_start=1
                     /product="exosome catalytic subunit DIS3"
                     /protein_id="XP_018736478.1"
                     /db_xref="GeneID:30037143"
                     /translation="MAVATKRQSSSGRGSIAHKVFVRSSKAGNASKIVREQYLRSDIP
                     CSSEACSVCIPPQNADGTFRPPVLAKIPNSNKQRGPHYVVVDTNIALKAIDLLEHKSI
                     FYDVIIPQIVLEEVRNRSLPVYNRLRNLTKASDDEKRFYVFHNEFHQDTHVTRNKNES
                     INDRNDRAIRQTSKWYQDHLKKTVDTRQNISSMDVDGDSSSSSAKMVVVPQIVLISDD
                     RDNRTKAEAEGITALSLRSYLKEFPNGDDLLDLAPSDDWTATSSGLAAIYPSFYPMSR
                     LLGGIKNGTLHQGILSISQFNFLEGSVRTQAYPKPILVLGRENLNRGFNGDVVVVELL
                     PKSQWKIPSSSIIEEEELGKTEGADNESETIETDEERKALAEEALKAQHQQGESAASK
                     VQPTARIVGIIKRNWRFYVGHVSAQSAAGVSSSDNSQKSIFVVPLDKCIPRIRIKTRK
                     LGELVNKRIVVSIDDWPIHSRHPEGHFIRSLGEIESKEAETEALLLEHDVEYRPFPKS
                     VLNCLPPEGHDWKVPENIESTTDEQLKKRRDLRHLLVCSIDPPNCQDIDDALHAHVLP
                     NGNYEVGVHIADVTHFVKPNTPLDDEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPY
                     VDRFSFSVLWEMTPQGEIVNTEFTKSIIRSREAFEYGQAQARIDDESQNDDLTKGMRI
                     LLDLSKKLKKGRMDAGALNLSSPEVKVNTESETSDPGNVEIKKLLDTNSLVEEFMLLA
                     NISVAKKIYESYPQTAMLRRHGAPPATNFEILNDQLRIKKGMSIDLESSKTLADSLDK
                     CVDPEEPFFNNLVRIMATRCMLAAEYFPSGEYGYPEFRHYGLASEIYTHFTSPIRRYA
                     DVVAHRQLAGAIDYESLHPSHRDRNKMESICRNINKRHRNAQFAGRASIEYYVGQVLK
                     ADESEQEGFIIKVFSNGINILVPKFGVESLIHLEDLGDPETASYDEDTYTLHLQSKDD
                     KKPIALSIFDKVKVYVRSVKDETSGKRKVHMSLRS"
     gene            <1064005..>1065479
                     /gene="SKI8"
                     /locus_tag="AWJ20_4956"
                     /db_xref="GeneID:30037144"
     mRNA            join(<1064005..1064046,1064506..1064511,1064592..>1065479)
                     /gene="SKI8"
                     /locus_tag="AWJ20_4956"
                     /product="SKI complex subunit WD repeat protein SKI8"
                     /transcript_id="XM_018882063.1"
                     /db_xref="GeneID:30037144"
     CDS             join(1064005..1064046,1064506..1064511,1064592..1065479)
                     /gene="SKI8"
                     /locus_tag="AWJ20_4956"
                     /inference="similar to AA sequence:KEGG_Orthology:K12601"
                     /note="Ski complex component and WD-repeat protein;
                     mediates 3'-5' RNA degradation by the cytoplasmic exosome;
                     also required for meiotic double-strand break
                     recombination; null mutants have superkiller phenotype;
                     GO_component: GO:0055087 - Ski complex [Evidence IDA]
                     [PMID 10744028]; GO_component: GO:0055087 - Ski complex
                     [Evidence IDA,IPI] [PMID 18042677]; GO_component:
                     GO:0005694 - chromosome [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0000228 - nuclear chromosome [Evidence IDA] [PMID
                     14992724]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0051607 - defense response
                     to virus [Evidence IEA]; GO_process: GO:0007126 - meiotic
                     nuclear division [Evidence IEA]; GO_process: GO:0070478 -
                     nuclear-transcribed mRNA catabolic process, 3'-5'
                     exonucleolytic nonsense-mediated decay [Evidence IGI,IMP]
                     [PMID 12881429]; GO_process: GO:0034427 -
                     nuclear-transcribed mRNA catabolic process,
                     exonucleolytic, 3'-5' [Evidence IMP] [PMID 94827