GenomeNet

Database: RefSeq
Entry: NC_031674
LinkDB: NC_031674
Original site: NC_031674 
LOCUS       NC_031674            4956242 bp    DNA     linear   CON 25-OCT-2016
DEFINITION  Sugiyamaella lignohabitans strain CBS 10342 chromosome B, complete
            sequence.
ACCESSION   NC_031674
VERSION     NC_031674.1
DBLINK      BioProject: PRJNA342695
            BioSample: SAMN04417247
            Assembly: GCF_001640025.1
KEYWORDS    RefSeq.
SOURCE      Sugiyamaella lignohabitans
  ORGANISM  Sugiyamaella lignohabitans
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Trichomonascaceae;
            Sugiyamaella.
REFERENCE   1  (bases 1 to 4956242)
  AUTHORS   Bellasio,M., Peymann,A., Valli,M., Sipitzky,M., Graf,A., Sauer,M.,
            Marx,H. and Mattanovich,D.
  TITLE     Complete genome sequence and transcriptome regulation of the
            pentose utilising yeast Sugiyamaella lignohabitans
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4956242)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4956242)
  AUTHORS   Peymann,A. and Graf,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2016) Department of Biotechnology, University of
            Natural Resources and Life Sciences, Muthgasse 18, Vienna, Vienna
            1190, Austria
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP014503.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4956242
                     /organism="Sugiyamaella lignohabitans"
                     /mol_type="genomic DNA"
                     /strain="CBS 10342"
                     /type_material="culture from holotype of Sugiyamaella
                     lignohabitans"
                     /db_xref="taxon:796027"
                     /chromosome="B"
     gene            <2139..>2819
                     /gene="SDO1"
                     /locus_tag="AWJ20_1962"
                     /db_xref="GeneID:30033821"
     mRNA            <2139..>2819
                     /gene="SDO1"
                     /locus_tag="AWJ20_1962"
                     /product="guanine nucleotide exchange factor SDO1"
                     /transcript_id="XM_018878881.1"
                     /db_xref="GeneID:30033821"
     CDS             2139..2819
                     /gene="SDO1"
                     /locus_tag="AWJ20_1962"
                     /inference="similar to AA sequence:KEGG_Orthology:K14574"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor SDO1"
                     /protein_id="XP_018736851.1"
                     /db_xref="GeneID:30033821"
                     /translation="MLTSGSSSHNSHSNIDREKDLDEVLQIPQVFVHVSKGQVANNED
                     LKAAFGTTDQNVIIQEILKKGELQVGGKEREALSNQMHAEIIQLIAAKCVNPGTKRPY
                     PTSIIDKALSESNFNMVPNKSAKIQALDAIKLLMQSNIIPIVRARMKVLIRVDSSKDA
                     KKFSDKVKALTAEIDDEDWSGKWELTAFIDPGNFRILDELIQKETKGRGSVEVLDTAV
                     VKEGDQDL"
     gene            complement(<2859..>3389)
                     /locus_tag="AWJ20_1963"
                     /db_xref="GeneID:30033822"
     mRNA            complement(<2859..>3389)
                     /locus_tag="AWJ20_1963"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878882.1"
                     /db_xref="GeneID:30033822"
     CDS             complement(2859..3389)
                     /locus_tag="AWJ20_1963"
                     /inference="similar to AA sequence:KEGG_Orthology:K11877"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736852.1"
                     /db_xref="GeneID:30033822"
                     /translation="MKFDDLQDLAGTLHNMSESNDKIEFPAASKTKSIELQDGHIIDV
                     VTVGFEDKISVMVNYDGRIGKIYYVPLLASSTSHLANYENRDDDGNPENDLLPLSHLT
                     PMPLVGGSSDHDVQGRLYASMIASIVSRQSPDENRTVLVGLGTSIGPRPDEEITIEHR
                     KQLLEIVKLVQECRVW"
     gene            complement(<4700..>5089)
                     /locus_tag="AWJ20_1964"
                     /db_xref="GeneID:30033823"
     mRNA            complement(<4700..>5089)
                     /locus_tag="AWJ20_1964"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878883.1"
                     /db_xref="GeneID:30033823"
     CDS             complement(4700..5089)
                     /locus_tag="AWJ20_1964"
                     /inference="similar to AA sequence:KEGG_Orthology:K08968"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736853.1"
                     /db_xref="GeneID:30033823"
                     /translation="MYKSLESSPLSKVNWAGFYVVDPKDSSQLILGPFHGQVACQIIK
                     IGKGVCGTAASSRETQLVKDVEKFPGHIACDGDTKSEIVVPIVDKSSGKVFGVIDIDC
                     QELEGFDEEDQKYLEILAEKLIKYCKW"
     gene            complement(<5690..>9004)
                     /gene="MSS4"
                     /locus_tag="AWJ20_1965"
                     /db_xref="GeneID:30033824"
     mRNA            complement(<5690..>9004)
                     /gene="MSS4"
                     /locus_tag="AWJ20_1965"
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /transcript_id="XM_018878884.1"
                     /db_xref="GeneID:30033824"
     CDS             complement(5690..9004)
                     /gene="MSS4"
                     /locus_tag="AWJ20_1965"
                     /inference="similar to AA sequence:KEGG_Orthology:K00889"
                     /note="Phosphatidylinositol-4-phosphate 5-kinase; involved
                     in actin cytoskeleton organization and cell morphogenesis;
                     multicopy suppressor of stt4 mutation; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 9624177];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IEA]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624177]; GO_function: GO:0016308 -
                     1-phosphatidylinositol-4-phosphate 5-kinase activity
                     [Evidence IDA] [PMID 9624178]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0016301 -
                     kinase activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016307
                     - phosphatidylinositol phosphate kinase activity [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0031321 - ascospore-type
                     prospore assembly [Evidence IGI] [PMID 19502581];
                     GO_process: GO:0046488 - phosphatidylinositol metabolic
                     process [Evidence IEA]; GO_process: GO:0046854 -
                     phosphatidylinositol phosphorylation [Evidence IDA] [PMID
                     9624177]; GO_process: GO:0046854 - phosphatidylinositol
                     phosphorylation [Evidence IDA] [PMID 9624178]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="1-phosphatidylinositol-4-phosphate 5-kinase"
                     /protein_id="XP_018736854.1"
                     /db_xref="GeneID:30033824"
                     /translation="MLAASSPSVTQLQLPFSYQRHSNEAFESEKSRQHSSGTSTSTDT
                     SGGASVSGSDDEHKLNSKLSIVTNGGTLVADNEHQSSDDIDDAFLSHNSLSARSMSSL
                     ATTVDSRDYEKSISTNIAVHSAPLDGQMTSSASSINGLSTTFLPVGDFHVDGPVNGTD
                     DVSSLDNNTVEIETDGTRGFDNDDASYARGQRFGSDTFYDAPNSNNTSSSLTADSLLT
                     VTDNADHREQPASQPHESSQLASYKGLRVSTKGDLPTLSCAPEVVANELSTVNSEERS
                     VNEKPSENGNSIEHEGSTAHGEFLTAPTMDSAEATSGTTSTTSTSSTPTSISNSSTAT
                     SDSSVTTPVVSATPLPFTPPQPNYHSPKSQSASTFTPTSTSVSKPARNDSSSNSGPNQ
                     SPLTTQASNARTSSTSSVATANVLANSSSTSPVPRQMPTFRGSLPGIESSPQLLDPIP
                     SHVRTSIGSTPPSPNVRTSVGSAFSFDDQRYLSRASTGSHHSIASPTSPVSAQQLASL
                     RSPNPSASSSSSLPSMVRERVSNAGSVAVPNVNSTGAVAMTGSTIATANIAPTTLMGP
                     PQLPTRALSQQIVSTSNQSNNRNSLSSQRSAASSQEVPSIRRLSLYSHRNSFSFSRRR
                     SIAGPPIPSNGQELDRSATVIEIERLREEIIVQRELRRRRREFLEDERVLMGTKVSEG
                     HVNYVTAYNMLTGIRVSVSRCNGKVDRPLNDEDFVAKNKLAFDVSGNELTPSARYDFK
                     FKDYAPWVFRHLRELFKLDPADYLMSLTSKYIVSELGSPGKSGSFFYFSRDYRFIIKT
                     IHHSEHKMLRKILKDYYNHVKNNPNTLISQFYGLHRVKLPFGRKIHFIVMNNLFPPHR
                     DIHRTYDLKGSTQGRRLQPQDSKKAVVYKDLNWIDAGESIMLGPTKKRQFLDQLEIDV
                     ALLKRLNIMDYSLLIGIHDLTKGNTENIRDNTLQVFEPGSATISQTKVNELRKALTTA
                     SPTALAQLDLVLNQYERNDFIFYADSGGFRATNENNEPLNDIYYLGIIDCLTPYTFTK
                     RVETFFKGLSNAHVTISAIPALEYGDRFFKFIKSVVVSKREGQQNVIGEETAPSAIEV
                     HLPVLSEASTEARSVN"
     gene            complement(<11084..>13663)
                     /locus_tag="AWJ20_1966"
                     /db_xref="GeneID:30033825"
     mRNA            complement(<11084..>13663)
                     /locus_tag="AWJ20_1966"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878885.1"
                     /db_xref="GeneID:30033825"
     CDS             complement(11084..13663)
                     /locus_tag="AWJ20_1966"
                     /inference="similar to AA sequence:KEGG_Orthology:K01192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736855.1"
                     /db_xref="GeneID:30033825"
                     /translation="MTSGPVKPTHSTTLANWSYRKAGTEKWTASKHGRPATQIHVDLL
                     DNGEIPDPFLDENEKLVQWVADEEWEYQAEFTVSSEQLESGKKTDFVYEGLDTVATVY
                     LNDKQILHSENMFHIGRVDITKDVKVGTNNVRIFFANALIRSRQLEKIHGKMRLFNGE
                     TSRVQLRKSQYHYGWDWGPLLMTSGPYRPVKIETYNYLVSDVFVNAKVSDDLKEVTVS
                     IEGEIEGSKGEPGYLPLQFKVDIKSPSGEQVVNKTFDISVDKDGVSKNSLKIENPQLW
                     YPANYGEQHLYHITVDVVSGSETIQSIEKDVGFRKVELIQRPLVDQEGTTFFFQVNNI
                     PIYCAGGCWIPAHSFTTCLTNDDYKKWIKLMIDGHQNMVRIWGGGIYEEDIFYQECDR
                     LGIMVWQDFMFACGQYPGYPEFLESVSKEAVDQLKRLRNYCSIVLYAGNNEDYQVAEA
                     YPEIEYDPNDTTSDYLKTNFPARHIYEKMFPELVADYSPAVPYHPGSPWGGKTSSDPT
                     IGDIHQWNVWHGNQEKYQDWYKLGGRFVSEFGMEALPDRKTVDQFVTKEHEKYPQSRT
                     MDLHNKSDGFERRLALYVMENIKVEGMDIDNWIYATQLMQSECLAYAYRCWRRQWKGP
                     GREYCAGALVWQVNDCWPVTSWAIVDFYYRPKLSYYAVKRESSPVWIGMYRNVNYLSE
                     EDKKAAEEVPTFDYFKREHFEDIWGVNNTIHEKKVVLHVEVYEIESGKLVETLPPKPV
                     TLKANQTTEIIQNLPVESKTHHVVYCRLVDADSNKVIARGGDWPQPLKYLSFPDRQVK
                     VKVEDGQVRLSTNKPVKGVEITVKNKDLFLEDNGIDLFPGDDQTVIIRGLLSTDEVTI
                     RHY"
     gene            <15080..>16726
                     /locus_tag="AWJ20_1967"
                     /db_xref="GeneID:30033826"
     mRNA            <15080..>16726
                     /locus_tag="AWJ20_1967"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878886.1"
                     /db_xref="GeneID:30033826"
     CDS             15080..16726
                     /locus_tag="AWJ20_1967"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736856.1"
                     /db_xref="GeneID:30033826"
                     /translation="MSDQRSGNEHERSPLLAYSPNDESAPHPLPRSYTISEGQDENGI
                     LMNSGNHHETVNDYNPSSDSSRRSSSKLNFNDVNFGNNPFKKRHFSYSAGGTSPSRHH
                     SFYSQLQQHGSRISLGDAAALELDVERLENLHERRPFRLIGKSCPLRDWSRYCKTEEQ
                     IRQISRAKAIQEYYSKQNDLIERYKAIDRLLDSGIPQSMLKVYGDDIDLGAPNGTTSK
                     KADDPPSPPGNRQGVPANIDEESNLLGGESREDKSNMVMFAIYVNFVINFVLLVGKVI
                     VVLLTNSLSVVASLVDSILDFLSTFIIWASTRLVDQRDWKTKHLYPVGRSRLEPIGVL
                     VFSILIIVSFLKVGDEAINKLLEGRQGSAVDIGIPSIIIMSLTIVVKVFCYLWCRTID
                     SSAVQALAQDAMTDIVFNTFSMLFPLVGHAYDIWWLDPFGALALSAYIIHSWASTAME
                     HIDNLTGSAASPEDRQVVLYLCMRFSDSIKYITALNAYHAGDRITVEVDIVLDDKYNL
                     RDCHDIAEALQYAIETLPFVERAFVHLDYRRGNFTGHIDR"
     gene            <19208..>20860
                     /gene="NAM8"
                     /locus_tag="AWJ20_1968"
                     /db_xref="GeneID:30033827"
     mRNA            <19208..>20860
                     /gene="NAM8"
                     /locus_tag="AWJ20_1968"
                     /product="Nam8p"
                     /transcript_id="XM_018878887.1"
                     /db_xref="GeneID:30033827"
     CDS             19208..20860
                     /gene="NAM8"
                     /locus_tag="AWJ20_1968"
                     /note="RNA binding protein, component of the U1 snRNP
                     protein; mutants are defective in meiotic recombination
                     and in formation of viable spores, involved in the
                     formation of DSBs through meiosis-specific splicing of
                     REC107 pre-mRNA; Nam8p regulon embraces the meiotic
                     pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the
                     putative RNA binding domains RRM2 and RRM3 are required
                     for Nam8p meiotic function; GO_component: GO:0005685 - U1
                     snRNP [Evidence IDA] [PMID 9630245]; GO_component:
                     GO:0071004 - U2-type prespliceosome [Evidence IDA] [PMID
                     16618970]; GO_component: GO:0000243 - commitment complex
                     [Evidence IPI] [PMID 10072386]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 23222640]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     23222640]; GO_function: GO:0003723 - RNA binding [Evidence
                     IEA]; GO_function: GO:0003723 - RNA binding [Evidence IPI]
                     [PMID 10072385]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IPI] [PMID 10072386]; GO_function: GO:0003729 -
                     mRNA binding [Evidence IDA] [PMID 23222640]; GO_function:
                     GO:0003676 - nucleic acid binding [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0006397 - mRNA processing [Evidence
                     IEA]; GO_process: GO:0006376 - mRNA splice site selection
                     [Evidence IMP] [PMID 10072385]; GO_process: GO:0000398 -
                     mRNA splicing, via spliceosome [Evidence IPI] [PMID
                     10072386]; GO_process: GO:0048026 - positive regulation of
                     mRNA splicing, via spliceosome [Evidence IMP] [PMID
                     10983980]"
                     /codon_start=1
                     /product="Nam8p"
                     /protein_id="XP_018736857.1"
                     /db_xref="GeneID:30033827"
                     /translation="MSFSYDYSEAQAQQQQQQQSQPQAADISVSNSGEPKVEPSSVTT
                     DASAAGTAGSASSATTTGAAGSVGLDANGAGSVVPPGTSTSPALVAGSPPTASSDSKS
                     TLWMGELEPWYDENAIGKIWQNFGENVTVKLIRDKYSGVNAGYCFVDFGTPQAAAKAL
                     SLNGQPIPNSQRVFRLNWASGGGLIDKRDDRGPEFSIFVGDLSPEVTEFNLLQLFQSR
                     YSSCKSAKIMTDPSTNASRGYGFVRFNDETHMQRALAEMQGFFLGNRPIRISTATPKS
                     KPGQNGLVGNSGNGAGPNVGGPGGLYHQMGMGGPPPPAGYYGTPQTLNQFTDPNNTTV
                     FVGGLSGHVTEDELRRYFAGFGDITYVRIPPGKGCGFVQFVQRHSAEAAITQMQGYPI
                     GSSRVRLSWGRSQNAVANAGLNGLPGGPGGNNGPPPGAYRPAPPPPNVYPQLNIPAQP
                     HYGPYGPINPHVQGQVDIHGQQQQQLGGPIPGVAGAAGAAGPVPGVAQVNNGADPLLP
                     LGQDPSEPVPVARLNELYLAARDGRLDRMDADGRGYHGVYAQ"
     gene            <23364..>27506
                     /gene="SWR1"
                     /locus_tag="AWJ20_1969"
                     /db_xref="GeneID:30033828"
     mRNA            <23364..>27506
                     /gene="SWR1"
                     /locus_tag="AWJ20_1969"
                     /product="chromatin-remodeling protein SWR1"
                     /transcript_id="XM_018878888.1"
                     /db_xref="GeneID:30033828"
     CDS             23364..27506
                     /gene="SWR1"
                     /locus_tag="AWJ20_1969"
                     /inference="similar to AA sequence:KEGG_Orthology:K11681"
                     /codon_start=1
                     /product="chromatin-remodeling protein SWR1"
                     /protein_id="XP_018736858.1"
                     /db_xref="GeneID:30033828"
                     /translation="MKKGKTPSKSTPKDSTNASSSRKKSQKDNNDDESQSESSFDSDD
                     DSEVLYNDFGERINIPSYESDFATDDLSSGDEEKIPRLKFKFSVPNQTVTHPSHLSNP
                     KFGGSLEKYLDSFISLDDDITLEERDSFVDDQVEVRNRIERAKKSGLLQRHTHGLATN
                     IEKFADPPSFDISNNHHSHLVSHAIYFARLMTEERKAHISRARRIANIVDLHFKRLSG
                     AEEKERKQFERSMRQLARRTGAEVMKKWKVAEKVVRQRRQQALEEQQRNEGKLQLNQI
                     LKQSAQLLEARTEKMTASVNVDDLSDATDENESAGSLADSDDESDAGGSESSDNDSEV
                     MSSSDDDSEVEDVDDEKLTVEQLKEKYSKLKSVTFNDLENKVDVDIIESEDEDEEETV
                     EIDEKAKSLYEEEQSGDSDESVAMDSEFDSDEDDSDESEEASDEEDEPASLASLFNKP
                     QSNDDKQVEADDEQDEYKEPEIEVDIEANQEDQDSDASDKSIKHSSPDTPTSTPEHEH
                     GEIADGTVTTTSHIPTPFLLRGKLREYQSDGLDWLAGLYNTDTNGILADEMGLGKTIQ
                     TISLISYLACEKHIWGPHLIVVPTSVMLNWEMEFKRFAPGFKVMTYYGNPNQRKEKRK
                     GWNKENTWHVCITSYQLVLQDRNVFKRKKWHYMILDEAHNIKNFRSQRWQALLNFNSE
                     RRLLLTGTPLQNNLMELWSLLYFLMPSSKGSAMLPDGFANLKDFQEWFARPVDKLVEG
                     GGQDADDETRATVLKLHQILRPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRYLYDD
                     FMSRAQTRETLSSGNFLSIINCLMQLRKVCNHPDLFEVRPIVTSLAIGKSVVSNFEPL
                     DIIVRKRLLRESYEDHVNLLTLNLLPIKNEGSSFVDWQTIQQLQAYTPMVNELNELVT
                     QLKTSPVQPNYVSIEGNTKYQEYRAKQSRCDKLQHSIYLNFFRCSRKPIYGNDLVSAV
                     TLQNHRPRRSGFDWRQSDALSEMKLSYEQRDEQMKEIITRYAFVTPKVVCLNMTRLTL
                     APVVEEMQSPENQLLLSRQQTFHEAQVKLSIAFPDKRLLQYDCGKLQRLSTLMRDLID
                     GGHRALIFTQMTKVLDILEQFLNIHGWRYLRLDGATKVEQRQVLTERFNTDARIPVFI
                     LSTRSGGLGINLTGADTVIFYDSDWNPSMDKQCQDRCHRIGQTRDVHIYRFVSEYTIE
                     SNILRKATQKQILDNVVIQEGDFTTDYFHKMSVKELVGDVAGVDLDHDLAEPPQNSRS
                     LAKALAQAEDADDAVAASVAMREANLDAEDFSERATSTAATPGRSESEQPTGVSEQSV
                     EPPTGASVEPTDGSVEPSVEPDALQSEQEPDLSDSEESDDGIGHIDDYMIKFIEAGYF
                     GD"
     gene            <31192..>33165
                     /gene="PDE2"
                     /locus_tag="AWJ20_1970"
                     /db_xref="GeneID:30033830"
     mRNA            <31192..>33165
                     /gene="PDE2"
                     /locus_tag="AWJ20_1970"
                     /product="3',5'-cyclic-nucleotide phosphodiesterase PDE2"
                     /transcript_id="XM_018878890.1"
                     /db_xref="GeneID:30033830"
     CDS             31192..33165
                     /gene="PDE2"
                     /locus_tag="AWJ20_1970"
                     /inference="similar to AA sequence:KEGG_Orthology:K01120"
                     /note="High-affinity cyclic AMP phosphodiesterase;
                     component of the cAMP-dependent protein kinase signaling
                     system, protects the cell from extracellular cAMP,
                     contains readthrough motif surrounding termination codon;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0004115 -
                     3',5'-cyclic-AMP phosphodiesterase activity [Evidence IDA]
                     [PMID 3025832]; GO_function: GO:0004114 -
                     3',5'-cyclic-nucleotide phosphodiesterase activity
                     [Evidence IEA,IEA]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0008081 - phosphoric diester hydrolase activity
                     [Evidence IEA]; GO_process: GO:0019933 - cAMP-mediated
                     signaling [Evidence IMP] [PMID 8391474]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA,IEA,IEA];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /product="3',5'-cyclic-nucleotide phosphodiesterase PDE2"
                     /protein_id="XP_018736859.1"
                     /db_xref="GeneID:30033830"
                     /translation="MLGPAGKPIEPPSSPTNPLRKFTGKVAQVASQLSQKSMPRLRPS
                     TSTRHLNNSTSTRETTTSGSISTSTYREASSVTNTNRNSKLHNPSMASKTSSPALSVN
                     SFSSTSAPSLVLYWDVRVPKDNQIYDRFSKLLDNDVSRSKYPEVYSNISLLLEQFPQV
                     HVLNTFQSLAQQLFAYRECAFTTLFYVTTSDLVYVNDDQTIKFVSAQYAHIPGAFIVL
                     SDVTSLWASFARLGAMDISWASIESVKATKPAYWASIIGHARQDQFESRTRQLKTMLG
                     LEQEVESVASANLITKFSFSSKHVLDEFSPSLTSLVNEEKQPLIQELIGSWDFYAHDL
                     KYDELLAATYMMIKHALSSPGLEHYCIPDRKLISLLLVVRNCYHATNPYHNFRHAVDV
                     VQATFFFLISIGVFKPVGKAASVEKSTNPLTAVDGLNLLVAALGHDVGHPGVTNAFLV
                     SSNAPLAKIYNDRSVLESYHSAAFNQILKEYWPQMVQDSNARTMITESVLATDMAVHF
                     DYMKKAEEKGKQDSLYDENINENELQKLRLLLGCLILKCADISNVSRKLDISSKWGTL
                     LVAEFGGLNDLEIDLGLKQAPSQSNEPVTAGLRNKLLGEGQIFFIETYALPLFTAVSR
                     MMPELQFATRQIEENVKIWKSRVGDGDYDNDHK"
     gene            complement(<33355..>35247)
                     /gene="VTS1"
                     /locus_tag="AWJ20_1971"
                     /db_xref="GeneID:30033831"
     mRNA            complement(<33355..>35247)
                     /gene="VTS1"
                     /locus_tag="AWJ20_1971"
                     /product="Vts1p"
                     /transcript_id="XM_018878891.1"
                     /db_xref="GeneID:30033831"
     CDS             complement(33355..35247)
                     /gene="VTS1"
                     /locus_tag="AWJ20_1971"
                     /note="Flap-structured DNA-binding and RNA-binding
                     protein; stimulates deadenylation-dependent mRNA
                     degradation mediated by the CCR4-NOT deadenylase complex;
                     member of the Smaug (Smg) family of post-transcriptional
                     regulators which bind RNA through a conserved sterile
                     alpha motif (SAM) domain that interacts with Smg
                     recognition element (SREs) containing transcripts;
                     stimulates Dna2p endonuclease activity; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0000932 - cytoplasmic mRNA processing body [Evidence
                     IDA] [PMID 18469165]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 11445562]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 20007605]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IDA] [PMID 12858164];
                     GO_function: GO:0003723 - RNA binding [Evidence IDA] [PMID
                     16429156]; GO_function: GO:0070336 - flap-structured DNA
                     binding [Evidence IDA] [PMID 20007605]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0000956 - nuclear-transcribed mRNA
                     catabolic process [Evidence IMP] [PMID 12858164];
                     GO_process: GO:0000956 - nuclear-transcribed mRNA
                     catabolic process [Evidence IMP] [PMID 16429156];
                     GO_process: GO:0000289 - nuclear-transcribed mRNA poly(A)
                     tail shortening [Evidence IMP,IPI] [PMID 18469165];
                     GO_process: GO:0032079 - positive regulation of
                     endodeoxyribonuclease activity [Evidence IDA,IPI] [PMID
                     20007605]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Vts1p"
                     /protein_id="XP_018736860.1"
                     /db_xref="GeneID:30033831"
                     /translation="MEDFSYASNPGNNNMSSRIQQPSHRMHQQVNSSSSLPPFDSPLA
                     ARTRPTSEIFLQTPLKQFGTSNGMNTIGPGGVSLGPGSGTNSALANHINPDDQMMDLA
                     AEKWLADLELYQKTLEEMAEVSLDKNFKEELNDIERWFEVLSVGERTAALYALLQQTT
                     PVQIRFFITVLQKIANRDPISAVLSPTNLEREPLQSQLNEAITRQQQGQQSNSSTSPS
                     NKNISVSNGSTSSKGQSQHHLHQPQPHSAGFTQNYPHLHSPIPSGVGTSPFMTPPPKH
                     DLYNNSFLGSFSKPIAPPISPWAAQEINRPKSADAPTGQNSQLHSLIQQQQLQGLQGF
                     RQFGGAGSRLSNLSVTSNSSDTPSVGGGNSNTYKHNKSLSVLDDSLSSYLPDSSTNWS
                     SIVNTPVSHIGTPQSKLNSEIINSTAMKMAALSTVNNRVVLDSDVKKFRRRGSLISNE
                     DQKYIDRELQNLHIQANKHTSTNSPFASTPSPASWTLGISNNTTSTTNNTNNHNIGNG
                     SPMPSNKHNISTSPQDRKSGLSKVSYGHQDSPSRDMTTSPAPLGTPKKDAPVDIELLQ
                     DIGAWLRSLRLHKYTDNLSDLNWKDLVELTDADLEKRGVNALGARRKMLKVFEQVKEA
                     QQVGSI"
     gene            complement(<37188..>37670)
                     /gene="RTT106"
                     /locus_tag="AWJ20_1972"
                     /db_xref="GeneID:30033832"
     mRNA            complement(<37188..>37670)
                     /gene="RTT106"
                     /locus_tag="AWJ20_1972"
                     /product="Rtt106p"
                     /transcript_id="XM_018878892.1"
                     /db_xref="GeneID:30033832"
     CDS             complement(37188..37670)
                     /gene="RTT106"
                     /locus_tag="AWJ20_1972"
                     /note="Histone chaperone; involved in regulation of
                     chromatin structure in both transcribed and silenced
                     chromosomal regions; affects transcriptional elongation;
                     has a role in regulation of Ty1 transposition; interacts
                     physically and functionally with Chromatin Assembly
                     Factor-1 (CAF-1); GO_component: GO:0005694 - chromosome
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0003690 -
                     double-stranded DNA binding [Evidence IDA,IMP] [PMID
                     20007951]; GO_function: GO:0042393 - histone binding
                     [Evidence IDA,IPI] [PMID 16157874]; GO_function:
                     GO:0042393 - histone binding [Evidence IDA] [PMID
                     18662540]; GO_function: GO:0042393 - histone binding
                     [Evidence IDA,IMP] [PMID 20007951]; GO_process: GO:0006335
                     - DNA replication-dependent nucleosome assembly [Evidence
                     IGI] [PMID 18662540]; GO_process: GO:0006336 - DNA
                     replication-independent nucleosome assembly [Evidence IMP]
                     [PMID 18708354]; GO_process: GO:0070869 - heterochromatin
                     assembly involved in chromatin silencing [Evidence
                     IGI,IMP] [PMID 17410207]; GO_process: GO:0070869 -
                     heterochromatin assembly involved in chromatin silencing
                     [Evidence IGI] [PMID 20007951]; GO_process: GO:0000122 -
                     negative regulation of transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 19683497]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006368 - transcription
                     elongation from RNA polymerase II promoter [Evidence
                     IGI,IMP] [PMID 18708354]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0032196 - transposition [Evidence IEA]"
                     /codon_start=1
                     /product="Rtt106p"
                     /protein_id="XP_018736861.1"
                     /db_xref="GeneID:30033832"
                     /translation="MLLFPVDKIAAISYSSITRLTFNLNIKLTEPIEGIQDYEFSMID
                     HNDYDEINDYVVRNSLENQSMSEARRAKQATNKPEFSNELEKVIAEDNGAGDDDEDEE
                     QDEDYESGSDSEEAASESESDDDDQDNDEDDSDEEEEEEEEDDDEGGQESGQEQDDAE
                     "
     gene            complement(<41941..>42411)
                     /gene="GLC7"
                     /locus_tag="AWJ20_1973"
                     /db_xref="GeneID:30033833"
     mRNA            complement(<41941..>42411)
                     /gene="GLC7"
                     /locus_tag="AWJ20_1973"
                     /product="type 1 serine/threonine-protein phosphatase
                     catalytic subunit GLC7"
                     /transcript_id="XM_018878893.1"
                     /db_xref="GeneID:30033833"
     CDS             complement(41941..42411)
                     /gene="GLC7"
                     /locus_tag="AWJ20_1973"
                     /inference="similar to AA sequence:KEGG_Orthology:K06269"
                     /note="Type 1 serine/threonine protein phosphatase
                     catalytic subunit; cleavage and polyadenylation factor
                     (CPF) component; involved in various processes including
                     glycogen metabolism, sporulation, mitosis; accumulates at
                     mating projections by interaction with Afr1p; interacts
                     with many regulatory subunits; involved in regulation of
                     the nucleocytoplasmic shuttling of Hxk2p; import into
                     nucleus is inhibited during spindle assembly checkpoint
                     arrest; GO_component: GO:0005935 - cellular bud neck
                     [Evidence IDA] [PMID 11412094]; GO_component: GO:0000778 -
                     condensed nuclear chromosome kinetochore [Evidence IDA]
                     [PMID 19948764]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005847 - mRNA
                     cleavage and polyadenylation specificity factor complex
                     [Evidence IDA] [PMID 12819204]; GO_component: GO:0001400 -
                     mating projection base [Evidence IDA] [PMID 10747092];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     11412094]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 23418575]; GO_component: GO:0000164 - protein
                     phosphatase type 1 complex [Evidence IDA] [PMID 8289829];
                     GO_component: GO:0005816 - spindle pole body [Evidence
                     IDA] [PMID 10747092]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0004721
                     - phosphoprotein phosphatase activity [Evidence IEA,IEA];
                     GO_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IDA] [PMID 1660885];
                     GO_process: GO:0000077 - DNA damage checkpoint [Evidence
                     IMP] [PMID 19884341]; GO_process: GO:0000076 - DNA
                     replication checkpoint [Evidence IGI,IMP] [PMID 19884341];
                     GO_process: GO:0030437 - ascospore formation [Evidence
                     IMP] [PMID 9584086]; GO_process: GO:0005975 - carbohydrate
                     metabolic process [Evidence IEA]; GO_process: GO:0007114 -
                     cell budding [Evidence IMP] [PMID 10639337]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0006873 - cellular ion homeostasis [Evidence IMP] [PMID
                     11973298]; GO_process: GO:0007059 - chromosome segregation
                     [Evidence IMP] [PMID 10072383]; GO_process: GO:0070940 -
                     dephosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 24413056]; GO_process: GO:0005977 -
                     glycogen metabolic process [Evidence IEA]; GO_process:
                     GO:0005977 - glycogen metabolic process [Evidence IMP]
                     [PMID 1660885]; GO_process: GO:0016576 - histone
                     dephosphorylation [Evidence IMP] [PMID 10975519];
                     GO_process: GO:0016576 - histone dephosphorylation
                     [Evidence IDA,IMP] [PMID 19884341]; GO_process: GO:0006397
                     - mRNA processing [Evidence IEA]; GO_process: GO:0007126 -
                     meiotic nuclear division [Evidence IPI] [PMID 8754819];
                     GO_process: GO:0007067 - mitotic nuclear division
                     [Evidence IEA]; GO_process: GO:0007094 - mitotic spindle
                     assembly checkpoint [Evidence IMP] [PMID 10072380];
                     GO_process: GO:0035307 - positive regulation of protein
                     dephosphorylation [Evidence IMP] [PMID 23418575];
                     GO_process: GO:0006470 - protein dephosphorylation
                     [Evidence IDA] [PMID 1660885]; GO_process: GO:0034501 -
                     protein localization to kinetochore [Evidence IMP] [PMID
                     19948764]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IMP] [PMID 12837249]; GO_process: GO:0006109 -
                     regulation of carbohydrate metabolic process [Evidence
                     IGI,IPI] [PMID 12167649]; GO_process: GO:0051726 -
                     regulation of cell cycle [Evidence IMP] [PMID 10072380];
                     GO_process: GO:0051726 - regulation of cell cycle
                     [Evidence IMP] [PMID 7891699]; GO_process: GO:0051726 -
                     regulation of cell cycle [Evidence IMP] [PMID 8164671];
                     GO_process: GO:0051726 - regulation of cell cycle
                     [Evidence IMP] [PMID 9584086]; GO_process: GO:0000903 -
                     regulation of cell shape during vegetative growth phase
                     [Evidence IGI] [PMID 12477789]; GO_process: GO:0007346 -
                     regulation of mitotic cell cycle [Evidence IMP] [PMID
                     23418575]; GO_process: GO:0031297 - replication fork
                     processing [Evidence IMP] [PMID 19884341]; GO_process:
                     GO:0009408 - response to heat [Evidence IMP,IPI] [PMID
                     10207049]; GO_process: GO:0030847 - termination of RNA
                     polymerase II transcription, exosome-dependent [Evidence
                     IPI] [PMID 12819204]; GO_process: GO:0030846 - termination
                     of RNA polymerase II transcription, poly(A)-coupled
                     [Evidence IPI] [PMID 12819204]; GO_process: GO:0061587 -
                     transfer RNA gene-mediated silencing [Evidence IMP] [PMID
                     23707796]"
                     /codon_start=1
                     /product="type 1 serine/threonine-protein phosphatase
                     catalytic subunit GLC7"
                     /protein_id="XP_018736862.1"
                     /db_xref="GeneID:30033833"
                     /translation="MHGGLSPDLNSMEQIRRVMRPTDIPDIGLLCDLLWSDPDKDITG
                     WSENDRGVSFTFGPDVVSRFLSKHDMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYC
                     GEFDNAGAMMGVDESLLCSFQILKPAEKKKKYGYTSVGTSRPVTPPRKQKRPTK"
     gene            complement(<44647..>45621)
                     /gene="GLC7"
                     /locus_tag="AWJ20_1974"
                     /db_xref="GeneID:30033834"
     mRNA            complement(<44647..>45621)
                     /gene="GLC7"
                     /locus_tag="AWJ20_1974"
                     /product="type 1 serine/threonine-protein phosphatase
                     catalytic subunit GLC7"
                     /transcript_id="XM_018878894.1"
                     /db_xref="GeneID:30033834"
     CDS             complement(44647..45621)
                     /gene="GLC7"
                     /locus_tag="AWJ20_1974"
                     /inference="similar to AA sequence:KEGG_Orthology:K06269"
                     /note="Type 1 serine/threonine protein phosphatase
                     catalytic subunit; cleavage and polyadenylation factor
                     (CPF) component; involved in various processes including
                     glycogen metabolism, sporulation, mitosis; accumulates at
                     mating projections by interaction with Afr1p; interacts
                     with many regulatory subunits; involved in regulation of
                     the nucleocytoplasmic shuttling of Hxk2p; import into
                     nucleus is inhibited during spindle assembly checkpoint
                     arrest; GO_component: GO:0005935 - cellular bud neck
                     [Evidence IDA] [PMID 11412094]; GO_component: GO:0000778 -
                     condensed nuclear chromosome kinetochore [Evidence IDA]
                     [PMID 19948764]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005847 - mRNA
                     cleavage and polyadenylation specificity factor complex
                     [Evidence IDA] [PMID 12819204]; GO_component: GO:0001400 -
                     mating projection base [Evidence IDA] [PMID 10747092];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     11412094]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 23418575]; GO_component: GO:0000164 - protein
                     phosphatase type 1 complex [Evidence IDA] [PMID 8289829];
                     GO_component: GO:0005816 - spindle pole body [Evidence
                     IDA] [PMID 10747092]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0004721
                     - phosphoprotein phosphatase activity [Evidence IEA,IEA];
                     GO_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IDA] [PMID 1660885];
                     GO_process: GO:0000077 - DNA damage checkpoint [Evidence
                     IMP] [PMID 19884341]; GO_process: GO:0000076 - DNA
                     replication checkpoint [Evidence IGI,IMP] [PMID 19884341];
                     GO_process: GO:0030437 - ascospore formation [Evidence
                     IMP] [PMID 9584086]; GO_process: GO:0005975 - carbohydrate
                     metabolic process [Evidence IEA]; GO_process: GO:0007114 -
                     cell budding [Evidence IMP] [PMID 10639337]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0006873 - cellular ion homeostasis [Evidence IMP] [PMID
                     11973298]; GO_process: GO:0007059 - chromosome segregation
                     [Evidence IMP] [PMID 10072383]; GO_process: GO:0070940 -
                     dephosphorylation of RNA polymerase II C-terminal domain
                     [Evidence IDA] [PMID 24413056]; GO_process: GO:0005977 -
                     glycogen metabolic process [Evidence IEA]; GO_process:
                     GO:0005977 - glycogen metabolic process [Evidence IMP]
                     [PMID 1660885]; GO_process: GO:0016576 - histone
                     dephosphorylation [Evidence IMP] [PMID 10975519];
                     GO_process: GO:0016576 - histone dephosphorylation
                     [Evidence IDA,IMP] [PMID 19884341]; GO_process: GO:0006397
                     - mRNA processing [Evidence IEA]; GO_process: GO:0007126 -
                     meiotic nuclear division [Evidence IPI] [PMID 8754819];
                     GO_process: GO:0007067 - mitotic nuclear division
                     [Evidence IEA]; GO_process: GO:0007094 - mitotic spindle
                     assembly checkpoint [Evidence IMP] [PMID 10072380];
                     GO_process: GO:0035307 - positive regulation of protein
                     dephosphorylation [Evidence IMP] [PMID 23418575];
                     GO_process: GO:0006470 - protein dephosphorylation
                     [Evidence IDA] [PMID 1660885]; GO_process: GO:0034501 -
                     protein localization to kinetochore [Evidence IMP] [PMID
                     19948764]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IMP] [PMID 12837249]; GO_process: GO:0006109 -
                     regulation of carbohydrate metabolic process [Evidence
                     IGI,IPI] [PMID 12167649]; GO_process: GO:0051726 -
                     regulation of cell cycle [Evidence IMP] [PMID 10072380];
                     GO_process: GO:0051726 - regulation of cell cycle
                     [Evidence IMP] [PMID 7891699]; GO_process: GO:0051726 -
                     regulation of cell cycle [Evidence IMP] [PMID 8164671];
                     GO_process: GO:0051726 - regulation of cell cycle
                     [Evidence IMP] [PMID 9584086]; GO_process: GO:0000903 -
                     regulation of cell shape during vegetative growth phase
                     [Evidence IGI] [PMID 12477789]; GO_process: GO:0007346 -
                     regulation of mitotic cell cycle [Evidence IMP] [PMID
                     23418575]; GO_process: GO:0031297 - replication fork
                     processing [Evidence IMP] [PMID 19884341]; GO_process:
                     GO:0009408 - response to heat [Evidence IMP,IPI] [PMID
                     10207049]; GO_process: GO:0030847 - termination of RNA
                     polymerase II transcription, exosome-dependent [Evidence
                     IPI] [PMID 12819204]; GO_process: GO:0030846 - termination
                     of RNA polymerase II transcription, poly(A)-coupled
                     [Evidence IPI] [PMID 12819204]; GO_process: GO:0061587 -
                     transfer RNA gene-mediated silencing [Evidence IMP] [PMID
                     23707796]"
                     /codon_start=1
                     /product="type 1 serine/threonine-protein phosphatase
                     catalytic subunit GLC7"
                     /protein_id="XP_018736863.1"
                     /db_xref="GeneID:30033834"
                     /translation="MVEPIEEFDVDTIIDKLLTVRTSRPGRMVNLLSTEIDYLCKKSR
                     EIFIQQSILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSI
                     ETICLLFAYKIKYPENFFILRGNHEAASTNRIYGFYDECKRRYNIRTWKTFTDVFNCL
                     PVAAVIDEKIFAMHGGLSPDIHSMDQIRRIMRPTDIPDDGLLCDLLWADPDKDVTGWG
                     ENDRGVSYTFGVDVVKKFLEKHDLELICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGE
                     FDNAGAMMSLDENLTCSFQILRPAEKGLSRGKGPFEGRRKKKSRDSDW"
     gene            complement(<46504..>48150)
                     /gene="VHR1"
                     /locus_tag="AWJ20_1975"
                     /db_xref="GeneID:30033835"
     mRNA            complement(<46504..>48150)
                     /gene="VHR1"
                     /locus_tag="AWJ20_1975"
                     /product="Vhr1p"
                     /transcript_id="XM_018878895.1"
                     /db_xref="GeneID:30033835"
     CDS             complement(46504..48150)
                     /gene="VHR1"
                     /locus_tag="AWJ20_1975"
                     /note="Transcriptional activator; required for the vitamin
                     H-responsive element (VHRE) mediated induction of VHT1
                     (Vitamin H transporter) and BIO5 (biotin biosynthesis
                     intermediate transporter) in response to low biotin
                     concentrations; VHR1 has a paralog, VHR2, that arose from
                     the whole genome duplication; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     16533810]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0000977 - RNA polymerase II
                     regulatory region sequence-specific DNA binding [Evidence
                     IDA] [PMID 16533810]; GO_function: GO:0001133 -
                     sequence-specific transcription regulatory region DNA
                     binding RNA polymerase II transcription factor recruiting
                     transcription factor activity [Evidence IDA,IMP] [PMID
                     21278159]; GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 16533810]; GO_process: GO:0061420 - regulation
                     of transcription from RNA polymerase II promoter in
                     response to biotin starvation [Evidence IMP] [PMID
                     16533810]; GO_process: GO:0061420 - regulation of
                     transcription from RNA polymerase II promoter in response
                     to biotin starvation [Evidence IMP] [PMID 21278159];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Vhr1p"
                     /protein_id="XP_018736864.1"
                     /db_xref="GeneID:30033835"
                     /translation="MNTPDSHQKVEHSLKEPDGNASDNDHMVQLGVGITQAIRSRLNF
                     TDDYKWKRFSARRLELIDELELSSRKASEQDEKISLVANRLREEYGFPETTLNDFHRL
                     VRAGIQSVRRNRKRSYLKGTTGPSNPTGNTSSTASGTITPNTSTPTSGHSPILSSDHI
                     HMPQTKQSYTKLTAELASSNSIQDKRVGLQFENISPDRFKFSNQADSDDESSILPLKR
                     PRAVRPSPQNNDRISITSLISPSPPVPTHPLTSDQTVLPPVSSLSLASPGPREDLFIL
                     ALERLQQFTIKLSSHMPVNSNTEFLGQSVMSTAAAYAVERRLPNHESSETVRSYVLSF
                     TVTSAIVRALGLHSFSLLKITLASCCREYGFDTIIHSLSSFYYEMFNIDPTFDLTKES
                     SYDKMASILATVTSSRAIPTPVLPVNTGLLSAPGSTITSLTSLSGTAYKSQAPVVRPV
                     TLRFGNQKLEFTYSPARVSSPPTVSEVLDNGRNAFSINKEQPLQIENRNRPGKILLTD
                     ADVADTFTEARVDIELRVVQRDRPLASSAAADRPKFQELL"
     gene            <49106..>50077
                     /gene="ENV9"
                     /locus_tag="AWJ20_1976"
                     /db_xref="GeneID:30033836"
     mRNA            <49106..>50077
                     /gene="ENV9"
                     /locus_tag="AWJ20_1976"
                     /product="Env9p"
                     /transcript_id="XM_018878896.1"
                     /db_xref="GeneID:30033836"
     CDS             49106..50077
                     /gene="ENV9"
                     /locus_tag="AWJ20_1976"
                     /note="Protein proposed to be involved in vacuolar
                     functions; mutant shows defect in CPY processing and
                     defects in vacuolar morphology; has similarity to
                     oxidoreductases, found in lipid particles; required for
                     replication of Brome mosaic virus in S. cerevisiae, a
                     model system for studying replication of positive-strand
                     RNA viruses in their natural hosts; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0005811 - lipid particle [Evidence
                     IEA,IEA]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence ISS] [PMID
                     8972580]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0006624 - vacuolar protein processing [Evidence IMP]
                     [PMID 21912603]; GO_process: GO:0007033 - vacuole
                     organization [Evidence IMP] [PMID 21912603]"
                     /codon_start=1
                     /product="Env9p"
                     /protein_id="XP_018736865.1"
                     /db_xref="GeneID:30033836"
                     /translation="MTFNHETTSEQIAEAFGSQIKGKVVLVTGATWGGIGADNARVIA
                     ASGAKLVIITGRSQAKLDETIENIQKQTPNAIVRGLILDLSSFKSVRKAAEEVNAYAE
                     DIDVLINNAGVMACPYSKTEDGFEMQFGTNHLGHFLFTNLILKKLLATPHPRVVNVSS
                     LGHGLAPIIFGDIGFSDGAKYDKNHAYGQSKTANILFTRELHRRYNKEHGLVAFSIHP
                     GAILDTNLARHMDINNDYANIEVPKDYWGTGDFAQNMSTLKMKNVSQGGATTLAAAFN
                     PEIASQSGAYLDDCEIHEEHCRNHAKQSNDAFKLWTVSEELVGQKFD"
     gene            <51489..>53402
                     /gene="DSF2"
                     /locus_tag="AWJ20_1977"
                     /db_xref="GeneID:30033837"
     mRNA            <51489..>53402
                     /gene="DSF2"
                     /locus_tag="AWJ20_1977"
                     /product="Dsf2p"
                     /transcript_id="XM_018878897.1"
                     /db_xref="GeneID:30033837"
     CDS             51489..53402
                     /gene="DSF2"
                     /locus_tag="AWJ20_1977"
                     /note="Deletion suppressor of mpt5 mutation; relocalizes
                     from bud neck to cytoplasm upon DNA replication stress;
                     GO_component: GO:0005934 - cellular bud tip [Evidence IDA]
                     [PMID 22842922]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Dsf2p"
                     /protein_id="XP_018736866.1"
                     /db_xref="GeneID:30033837"
                     /translation="MSLQDQQISGNTFTPNLSPLDLLEQQSRQLAHDLHSSKPTDRHK
                     RNSADTIKGVSEPNNPAPERGHVVNRSIDTHSSRLSQNGDTMTEQVPDQVSQQQSPSR
                     VRHKHMASDTSTISTASSYQPNSHSQYATPDSIASNNIKSYNAPLRPIQNFNQDTNQE
                     WTPRSRASMSSLSSFGGGGGILDSFRLSALPSFDRQSVIDTEPSSDNLSDISRAGSLQ
                     TIRSVSGNVRTSFDPRMHIRTVDSGRDANPKNDIEDSESTSPDFGKTHAETNGEASSE
                     RPQLVSNKTFSHNIPSRPVILSAKSYHQSASTSMSPDSTVSTPPSSKSRPVSDASSYY
                     SSTSRFSQSSIKAPAALFQQFSHPTTTNVAHKSRPTGYFFPEPTSRPAVGKHQPQPAK
                     AGNGGLLIPPSIRKSPPPIQTRKTSNDSTNSRNLIPQSLLEKPFADMTVEDHVTIGIA
                     YHESGDLREASYHWQHAAFKGDHTAMLLYGLSLRHGWGMRQNPTEAVQWLRKAMESTI
                     AEGMFKDGDFHKSNVSKEGSEDSGKVKKAHIGLALYELGMSYLHSWGIEKDETMALKS
                     FELAGQFGDADALCEAAALYMHNGPKGRKKDLMKAAKLYRKAGELGANMVGQSWVYKD
                     KYMEDSKKDKKKK"
     gene            complement(<53723..>53989)
                     /gene="MZM1"
                     /locus_tag="AWJ20_1978"
                     /db_xref="GeneID:30033838"
     mRNA            complement(<53723..>53989)
                     /gene="MZM1"
                     /locus_tag="AWJ20_1978"
                     /product="Mzm1p"
                     /transcript_id="XM_018878898.1"
                     /db_xref="GeneID:30033838"
     CDS             complement(53723..53989)
                     /gene="MZM1"
                     /locus_tag="AWJ20_1978"
                     /inference="similar to AA sequence:KEGG_Orthology:K18170"
                     /note="Protein required for assembly of the cytochrome
                     bc(1) complex; acts as a chaperone for Rip1p and
                     facilitates its insertion into the complex at a late stage
                     of assembly; localized to the mitochondrial matrix; null
                     mutant exhibits a respiratory growth defect and reduced
                     mitochondrial zinc levels, which is characteristic of
                     mutations affecting bc(1) complex assembly; member of the
                     LYR protein family; human LYRM7 is a functional ortholog;
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IDA] [PMID 20404342]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 17054397]; GO_function:
                     GO:0044183 - protein binding involved in protein folding
                     [Evidence IMP,IPI] [PMID 22927643]; GO_process: GO:0034551
                     - mitochondrial respiratory chain complex III assembly
                     [Evidence IMP] [PMID 21807901]"
                     /codon_start=1
                     /product="Mzm1p"
                     /protein_id="XP_018736867.1"
                     /db_xref="GeneID:30033838"
                     /translation="MSTTNRTAALSAYRYVLRATRVAFNSDPVALNGSRSQIRAGFKA
                     DRNVTDEAEIKEKIQYIKDIGLILRTNVVQAQKKSEDDNNFGEF"
     gene            <54568..>56172
                     /locus_tag="AWJ20_1979"
                     /db_xref="GeneID:30033839"
     mRNA            <54568..>56172
                     /locus_tag="AWJ20_1979"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878899.1"
                     /db_xref="GeneID:30033839"
     CDS             54568..56172
                     /locus_tag="AWJ20_1979"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736868.1"
                     /db_xref="GeneID:30033839"
                     /translation="MPPRRKRGAATKEVTNGDSSPRTTRASAAKKAKETTTDSKPKRS
                     SSPQNSELASTVEPKVKSKGKNTKQPVVEPSEEEDEAISHTPNQEEPEENKENENVGI
                     KSKLKKVQSPPRNGLLTSALGISLENTPVTRSNKRQHDGEDTDDSPSIVSRSKKHKNS
                     ILSNGEANTSLSTLSQPPKKAVKKPWRTGTATAANSAETASKEGGPTGTIDEDTSSKS
                     KPNTTEKPLLKDKSSNPHIISKVTNGISATTVKSSTVTKTDKVALSNPRLISNSSVTG
                     LISPSKPAHPGNLASSISSHGRLSPTKSHPRVAVGLSPSKHGASDSTLSSALTSFTVN
                     AASELAVKFEKLRDLRETKAEELLNEFKLAAEARFQASDELIRELRLHEEKNQHSQDQ
                     ELVDANIALQNLQQNVANLNSDLEAANEEISLLKAKLEAKENQQSQNMSNLALGICSD
                     LSGLVILKVLNEEDEYTYECVQSGRNGVFRYNLSVAKSDSKEESHDITFTPLLTEKDE
                     HLTSLLPDYFTEPLSFTREAVSILWC"
     gene            complement(<57205..>59694)
                     /gene="MEF2"
                     /locus_tag="AWJ20_1980"
                     /db_xref="GeneID:30033841"
     mRNA            complement(<57205..>59694)
                     /gene="MEF2"
                     /locus_tag="AWJ20_1980"
                     /product="Mef2p"
                     /transcript_id="XM_018878901.1"
                     /db_xref="GeneID:30033841"
     CDS             complement(57205..59694)
                     /gene="MEF2"
                     /locus_tag="AWJ20_1980"
                     /inference="similar to AA sequence:KEGG_Orthology:K02355"
                     /note="Mitochondrial elongation factor involved in
                     translational elongation; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0005525 - GTP binding
                     [Evidence IEA,IEA]; GO_function: GO:0003924 - GTPase
                     activity [Evidence IEA]; GO_function: GO:0003924 - GTPase
                     activity [Evidence ISS] [PMID 19716793]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0006184 - GTP catabolic process [Evidence
                     IEA]; GO_process: GO:0000002 - mitochondrial genome
                     maintenance [Evidence IMP] [PMID 21414316]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence ISS]
                     [PMID 19716793]; GO_process: GO:0051881 - regulation of
                     mitochondrial membrane potential [Evidence IMP] [PMID
                     21414316]; GO_process: GO:0032790 - ribosome disassembly
                     [Evidence ISS] [PMID 19716793]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="Mef2p"
                     /protein_id="XP_018736869.1"
                     /db_xref="GeneID:30033841"
                     /translation="MGVGVRLNCFSILPKFVLAKSSIYKYATAVPHGTRFYSVSRPCF
                     SESSAVRNIGIIAHIDAGKTTTTERMLYYSGLTSHIGDVDQGDTVTDYLQAERERGIT
                     ITSAAVTLDWSGHKINLIDTPGHADFTFEVIRSIRVLDGAVTVLDGVAGVEAQTEKVW
                     RQASDRGIPKIVFINKMDRPGAGFGRTVREVVAKLNTRVGITNFPYFGQMDAGHEGRF
                     QGVVDVVDKRLILWDEGSDGKSVKVSELEDGSELSQECERIRTSLIETLCECEGNDDL
                     VEEVLEISDYMAVPPSSIRKALRNSTLREDISPVLCGASFRNIGVQPLMEAVVNYLPS
                     PEERKAPDAISKVPVSKGKHAAQSIKSENVTLNVNDPKLTCALAFKVVNDPIRGILVY
                     VRVYSGTLQTGSVILNTTNGKKERVSKLLQMQADMPLDISKIEKGNIGVIVGSKEIRT
                     GDTLVAHGLKKDGITTLLKRDLGLHLHPIDVPPPVFFASITPKSISDTRNMEEALDIL
                     LREDPSLRLSYDDDSGQTLLSGMGELHLEIARDRLINDLKAKVKIGPIMISYKESIQA
                     SSKIIEKSYSEGGNEDMSVKVGLMVEPVYEDIELGDLAEKIDPHDNHYVIFPSYTNHP
                     HLSQEEIYEAIKIGIIPALATGGKLARLPLHSISVKITNLEIPEDCTSTASISSAVRL
                     ASQEALRGFIKSDYVIMEPKMDVRVVVNEEDIGNVVNDISSTRRGHVISLNEDDAENS
                     SDQTSISNHFKELAASVYVPPDYTMYMSKHGDRATSQQSLIKAKIPLRKMVGYLTSLR
                     SMTQGRATFLMSFDKYEIAPPDAIDEIVDSL"
     gene            <60189..>61094
                     /locus_tag="AWJ20_1981"
                     /db_xref="GeneID:30033842"
     mRNA            <60189..>61094
                     /locus_tag="AWJ20_1981"
                     /product="pre-mRNA splicing factor SLU7"
                     /transcript_id="XM_018878902.1"
                     /db_xref="GeneID:30033842"
     CDS             60189..61094
                     /locus_tag="AWJ20_1981"
                     /inference="similar to AA sequence:KEGG_Orthology:K12819"
                     /codon_start=1
                     /product="pre-mRNA splicing factor SLU7"
                     /protein_id="XP_018736870.1"
                     /db_xref="GeneID:30033842"
                     /translation="MERPRKIGAKFSGKDIVADDVLQDITTTWDSKRDRWNGYDAHEY
                     KKVVERFEEKERQKKADGELEDDDDDELKKTQDGQLGEKVRSLRERGDKAAYLEDLSE
                     DAVEFNPKTRTMRTEGGTINDNGQFERKLSDSALEYENLRQKAEGLSEQGMAIHMEAS
                     PTEAVLKLKQLQQEKESQKHKLKQELLEKYGGAEHLAPRPKEVEIVPLEASTVTKSGE
                     DKPGLKPSSIKSRYPEDIYPGNHSSVWGSYWINGKWGFACCHSLVKHSYCLGEKGIEI
                     NDSKEEVPQVSTEHPNKRSYDEVSQ"
     gene            <63464..>65449
                     /locus_tag="AWJ20_1982"
                     /db_xref="GeneID:30033843"
     mRNA            <63464..>65449
                     /locus_tag="AWJ20_1982"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878903.1"
                     /db_xref="GeneID:30033843"
     CDS             63464..65449
                     /locus_tag="AWJ20_1982"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736871.1"
                     /db_xref="GeneID:30033843"
                     /translation="MAPFWKKLNSPQSFANHDFTSNFLELALLYDVLRNAKFTTVRKR
                     MELPHDSLCKYDSDMVSAVTQSSIFLVHSDNVMEVKVALLKELMLVSSDHGTHNSLAG
                     SASTSANTTELDTTEVVYLDTPKLEYAQTGKEPAQIRKVNDSSSVLCSPTGGLRHFAS
                     SNLTPEELDLILNEKAAEIDFNQLDGARKLAIGWVQRKQAKPLSKVTYSRNRFSYVND
                     DDAASVIGVNVNNSTETNIWATMDSNIKLEKTTKTELSSAKTFPHSILEIRWKGTSKP
                     QWLSDIEKSHLVYPMREGFSLYAYSVVSFYSDQLQSVPSWLEIIEDNVEIRKVPSVAP
                     VRRSMNSSANLAGANRTDKSVSISTPSILLNDSNAQIHDYDSAKEQEGLSRKSSMTVV
                     EDRENRPQMLSRVSSFYNPASRQRHKLQSQPSESKLAVRYWNEFDDPEDGEDLGVFVI
                     NDEDPSGSYQDKLFSEANIDALVRISDKFLQSIGWFTSKITGSRDGYEALREGNYRRG
                     SSSESDPDEEDEEEDDFDEEASVGRYSPRIKPRTSSDDSDDFAYRSFGDRNNSVAAQR
                     RNSVLTFLYSMCLSLAAFIIMTLFSVTLLQDISEISLGTYVFMISGFIFALAISMLGL
                     SLYLLCEAPPWWQQTIVFSSFFSIVCFGVGGIAWILT"
     gene            complement(<65534..>66802)
                     /gene="ARP6"
                     /locus_tag="AWJ20_1983"
                     /db_xref="GeneID:30033844"
     mRNA            complement(<65534..>66802)
                     /gene="ARP6"
                     /locus_tag="AWJ20_1983"
                     /product="Arp6p"
                     /transcript_id="XM_018878904.1"
                     /db_xref="GeneID:30033844"
     CDS             complement(65534..66802)
                     /gene="ARP6"
                     /locus_tag="AWJ20_1983"
                     /inference="similar to AA sequence:KEGG_Orthology:K11662"
                     /note="Actin-related protein that binds nucleosomes; a
                     component of the SWR1 complex, which exchanges histone
                     variant H2AZ (Htz1p) for chromatin-bound histone H2A;
                     GO_component: GO:0000812 - Swr1 complex [Evidence IDA]
                     [PMID 14645854]; GO_component: GO:0000812 - Swr1 complex
                     [Evidence IDA] [PMID 14690608]; GO_component: GO:0000812 -
                     Swr1 complex [Evidence IDA] [PMID 16299513]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11011149];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0031491 - nucleosome binding [Evidence
                     IMP] [PMID 16299513]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IEA]; GO_process: GO:0006338 -
                     chromatin remodeling [Evidence IDA] [PMID 14645854];
                     GO_process: GO:0006338 - chromatin remodeling [Evidence
                     IGI,IMP] [PMID 14690608]; GO_process: GO:0043486 - histone
                     exchange [Evidence IMP] [PMID 16299513]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Arp6p"
                     /protein_id="XP_018736872.1"
                     /db_xref="GeneID:30033844"
                     /translation="MSVLVIDNGAYELKIGYATDDKNPAHFRVSNSITRSKDRRTYVG
                     NEIENCRDYAGLTYRRPHERGQLVNWETQKAIWDNQFYGKTSKLVGMNGGKPVDPSET
                     SLILTEMPYSLPALSSNMDQIVFEEYGFDSYYRCTPGSLVPWNDIRELYNDTSSRSSP
                     VSECALVIDSGFSSTHVLPVVLGEVYWPAAKRINIGGKHLTNYLKETVSFRYYNMMEE
                     TFLMNVIKERVCFVSLKYQLDLEEAHINKRKSLLRIDYALPDYRTSKLGHIVKGATSS
                     NDSNQVLTLTNERFTIPEALFRPSDLNLDQAGIPETAINCVKLMPEEIQSMLLSNVVL
                     VGGNAVLPGYKERIREELQSFSPQGVNLRVGMPVDPISYAWQGGCRLGSQKDMLSKAY
                     VTKADYMEHGVNLCLSRFGIKKMDNSIAMD"
     gene            <67251..>68048
                     /locus_tag="AWJ20_1984"
                     /db_xref="GeneID:30033845"
     mRNA            <67251..>68048
                     /locus_tag="AWJ20_1984"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878905.1"
                     /db_xref="GeneID:30033845"
     CDS             67251..68048
                     /locus_tag="AWJ20_1984"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736873.1"
                     /db_xref="GeneID:30033845"
                     /translation="MPRTRSLGQAGTAVPRRPTRVVEDDSDEDDSNPGMYSKLSTDTM
                     VPLVSSTPMRPGAVQVAHLEPVSRLSTIEDVDSSKENEFSPTDALGKMPPVTPARKQN
                     RVSFAPIPSGKPTNGSAPPTLAPSHQALARLGNAGHPLTELDLNNRLPPPPQTPLAYP
                     ATPSEDLDSTIEAVRKVSLDSTSPTFRSPSKIANYLEQSSETPHQRLTIHKLVLTNFK
                     SYAGRQEIGPFHSVSTMKKSTNHSCTNFTTVFFCSSGPQRIGKIQRY"
     gene            <68086..>71694
                     /gene="SMC4"
                     /locus_tag="AWJ20_1985"
                     /db_xref="GeneID:30033846"
     mRNA            <68086..>71694
                     /gene="SMC4"
                     /locus_tag="AWJ20_1985"
                     /product="condensin subunit SMC4"
                     /transcript_id="XM_018878906.1"
                     /db_xref="GeneID:30033846"
     CDS             68086..71694
                     /gene="SMC4"
                     /locus_tag="AWJ20_1985"
                     /inference="similar to AA sequence:KEGG_Orthology:K06675"
                     /note="Subunit of the condensin complex; condensin
                     reorganizes chromosomes during both mitosis and meiosis;
                     forms a subcomplex with Smc2p that has ATP-hydrolyzing and
                     DNA-binding activity, but other condensin subunits are
                     required for chromatin binding; required for tRNA gene
                     clustering at the nucleolus; potential Cdc28p substrate;
                     GO_component: GO:0005694 - chromosome [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0000799 - nuclear
                     condensin complex [Evidence IDA] [PMID 10811823];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22842922]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0016887 - ATPase activity
                     [Evidence IDA] [PMID 12719426]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IDA] [PMID 11864994];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_process: GO:0006310 - DNA recombination [Evidence
                     IEA]; GO_process: GO:0006281 - DNA repair [Evidence IEA];
                     GO_process: GO:0006268 - DNA unwinding involved in DNA
                     replication [Evidence IMP] [PMID 24062159]; GO_process:
                     GO:0007049 - cell cycle [Evidence IEA]; GO_process:
                     GO:0051301 - cell division [Evidence IEA]; GO_process:
                     GO:0030261 - chromosome condensation [Evidence IEA];
                     GO_process: GO:0051276 - chromosome organization [Evidence
                     IEA]; GO_process: GO:0010032 - meiotic chromosome
                     condensation [Evidence IC] [PMID 10811823]; GO_process:
                     GO:0051307 - meiotic chromosome separation [Evidence IC]
                     [PMID 10811823]; GO_process: GO:0007076 - mitotic
                     chromosome condensation [Evidence IMP] [PMID 10811823];
                     GO_process: GO:0007067 - mitotic nuclear division
                     [Evidence IEA]; GO_process: GO:0000070 - mitotic sister
                     chromatid segregation [Evidence IMP] [PMID 10811823];
                     GO_process: GO:0070550 - rDNA condensation [Evidence IMP]
                     [PMID 10811823]; GO_process: GO:0007130 - synaptonemal
                     complex assembly [Evidence IC] [PMID 10811823];
                     GO_process: GO:0070058 - tRNA gene clustering [Evidence
                     IMP] [PMID 18708579]"
                     /codon_start=1
                     /product="condensin subunit SMC4"
                     /protein_id="XP_018736874.1"
                     /db_xref="GeneID:30033846"
                     /translation="MRHSKVSALIHNSAAYPNLNSCSVEVHFQDVVDSANGSSTVVPG
                     TELVITRKSFRNNSSKYMINDKESNFTEVTTLLRERGIDLDHKRFLILQGEVESIAQM
                     KPKADNDNDDGLLEYLEDIIGTSQYKKAIEESLAEVEVLNEDCVQKQDRLKIVETELN
                     SLEDQKNDIVTYLELENELAFKQSALWQLQAYLCQKRVELSKSIVEEQHAKLKAELDR
                     TTVNSEEIEVLKKDHAQKLKELDLIKKTLSEKSKLLSKHEIEKVKVEERKKHLDSKRK
                     KLEKSIEAATHSKVETETWLSNYQEESSQLSDQLKGLQKSLENENCQLEAIQDELKDK
                     TAEFTDQIETIQKKLEPWREKTRSKESEIAVANSELELLKERESQGEKSLNESKENIT
                     ITMKEGRAKEREMEKLKKELEHVTSQISMGVKECDQASIKLAKMKQQLVNGRQRVDAA
                     KEALSSTTSQNKVLTGLTRLNDSGRIQGFRGRLGALGTIDAKYDVAISTACPSLDNMV
                     VDTVAAGEQCVDYLRKQNLGRAKFILLEKLPKRDLSPIQTPENVPRLFDLIVPSAPEY
                     APAFYSVLFDTLVAKDADQARRIAYGKKRWRVVTLDGVIVEASGAMSGGGEISRGKMA
                     AGLTEGALSEGQVQELERVQDEHEKKYKIAENTVLTMQTTLKELQERKPEIELEISKV
                     ELDITALTARLNEAKKQSAELAKSLEANRPDPSTLKRSEEHVAKLEAELKQLRSHSEG
                     LEQDVADLQEKIMDAGGVRLRVQKSKVDGIKEQIELVNTRLANGLKENAKANNDFKKH
                     SKTIDNCEAEISASTQELEEANKELSEKQLIIQQFEQLVSQLSDQLEEKQEILDELKS
                     ELDAKQKDIDSLRSREIEIKNTIDQHEKTIKDESNSLRSWISQLQKLQLHDLSEIKAV
                     RVKKEKPLKKSLPRQDVEEGEEAEGNEEDEDVNEDEDVANKSILNKTELFEYSADELE
                     AMNKAELKREIESLQTKGQNAKVDMQILKDYKRRVEEHDARRLALNESVTARDTVKKM
                     CDDLRNRRLEEFMTGFNSISGKLKEMYQMITMGGNAELELVDSLDPFSEGILFSVMPP
                     KKSWRNISNLSGGEKTLSSLALVFALHHYKPTPLYVMDEIDAALDFRNVSIVATYIKE
                     RTKHGQFIVISLRNNMFELAKQLVGIYKVNNMTKSIALQNNDYIHGQDSSNTTILP"
     gene            complement(<71831..>72745)
                     /gene="COQ5"
                     /locus_tag="AWJ20_1986"
                     /db_xref="GeneID:30033847"
     mRNA            complement(<71831..>72745)
                     /gene="COQ5"
                     /locus_tag="AWJ20_1986"
                     /product="2-hexaprenyl-6-methoxy-1,4-benzoquinone
                     methyltransferase"
                     /transcript_id="XM_018878907.1"
                     /db_xref="GeneID:30033847"
     CDS             complement(71831..72745)
                     /gene="COQ5"
                     /locus_tag="AWJ20_1986"
                     /inference="similar to AA sequence:KEGG_Orthology:K06127"
                     /note="2-hexaprenyl-6-methoxy-1,4-benzoquinone
                     methyltransferase; involved in ubiquinone (Coenzyme Q)
                     biosynthesis; localizes to the matrix face of the
                     mitochondrial inner membrane in a large complex with other
                     ubiquinone biosynthetic enzymes; GO_component: GO:0005759
                     - mitochondrial matrix [Evidence IDA] [PMID 9083048];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0043334 - 2-hexaprenyl-6-methoxy-1,4-benzoquinone
                     methyltransferase activity [Evidence IMP,ISS] [PMID
                     9083049]; GO_function: GO:0008168 - methyltransferase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0009060 - aerobic respiration [Evidence IMP] [PMID
                     9083049]; GO_process: GO:0032259 - methylation [Evidence
                     IEA]; GO_process: GO:0006744 - ubiquinone biosynthetic
                     process [Evidence IEA,IEA]; GO_process: GO:0006744 -
                     ubiquinone biosynthetic process [Evidence IMP] [PMID
                     9083048]"
                     /codon_start=1
                     /product="2-hexaprenyl-6-methoxy-1,4-benzoquinone
                     methyltransferase"
                     /protein_id="XP_018736875.1"
                     /db_xref="GeneID:30033847"
                     /translation="MIVKRALARAQKQSNSLRFLNCCNTAITGEPLGFVRRPYSTEGS
                     KTTHFGFKTVPEDEKEHLVKHVFSNVASSYDYMNDAMSLGIHRLWKDHFVSKLDPGRR
                     AGGSPLSFLDVAGGSGDIAFRILDHAAKIHGDHESVMNVVDINPEMLAEGEKRSKETP
                     YGNTSRINFKVQNAEFLDAIPDNSQDIYTVSFGIRNFTNIPAALATAHRVLKPGGVFA
                     CLEFSKVDNSILDTLYQQYSFNIIPLLGQVLVGDRDSYQYLVESIQRFPSQEQFAGMI
                     QDAGFTLAGSGYENLSFGIAAIHTGVKL"
     gene            <73476..>73982
                     /locus_tag="AWJ20_1987"
                     /db_xref="GeneID:30033848"
     mRNA            <73476..>73982
                     /locus_tag="AWJ20_1987"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878908.1"
                     /db_xref="GeneID:30033848"
     CDS             73476..73982
                     /locus_tag="AWJ20_1987"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736876.1"
                     /db_xref="GeneID:30033848"
                     /translation="MLRHYNHLLRAVKVAPSVQVRYTQPLLFGGIAGKLSPWNSTCRG
                     FSSTNSRSMIPVAPIPFDDPLGGDEEDPKKKKDSKKETGRGYDIFMKCLETAGIMVAS
                     LSMLGLAGLIYHRTYKERALTKMSNAFTEGNPAFELSMHQNGEDDRNDWLVPASTYSY
                     NMIQLTAS"
     gene            <74203..>75435
                     /locus_tag="AWJ20_1988"
                     /db_xref="GeneID:30033849"
     mRNA            <74203..>75435
                     /locus_tag="AWJ20_1988"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878909.1"
                     /db_xref="GeneID:30033849"
     CDS             74203..75435
                     /locus_tag="AWJ20_1988"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736877.1"
                     /db_xref="GeneID:30033849"
                     /translation="MKKTNSLYCTLLDAHADPEIFRIRLGKALNFQFHEDYLGSLFSI
                     RGPRDTTAILDIERAFNTLETVAVKHVAKHKRPLILIINNAHMIRDDLEGQNLVELLQ
                     QKAESLSGAGLVTIVFNSDDYWLYERLKKLGTRLEVLTINDFSRKESIQALRRARMKF
                     YGQKISDEDANKVYNLIGGRPQHLAAVASKDDPINACHKLIDKEKTWFLNQCALLGES
                     MDDDVMESGKFSTSAMYLMKELVRLDRERLSKMTPEELATSNHEIPRIPLWRARQIMT
                     RPDYIQHYDNLNIFTLDSLSRVKADSVVMMQAFHEIASLPGFEELLEETADRVSAIES
                     LGRTRELVAKDLVLDGQYKISHSRNETMIKLEMPEEAENDDDERYKLDRREGFWYKGR
                     ADKFKKRQEQKENEKGKI"
     gene            complement(<75545..>77095)
                     /locus_tag="AWJ20_1989"
                     /db_xref="GeneID:30033850"
     mRNA            complement(<75545..>77095)
                     /locus_tag="AWJ20_1989"
                     /product="DNA replication protein Dre4"
                     /transcript_id="XM_018878910.1"
                     /db_xref="GeneID:30033850"
     CDS             complement(75545..77095)
                     /locus_tag="AWJ20_1989"
                     /codon_start=1
                     /product="DNA replication protein Dre4"
                     /protein_id="XP_018736878.1"
                     /db_xref="GeneID:30033850"
                     /translation="MSVSKDDTLPTGWTRHLAPSGHFYYYHAESKRSTYERPKSDSQV
                     IASVKNNNSSESTSRIPTGPRTENQNHERTEKPKQSNQKRKRKKDLRSIDPPQVKVAV
                     KDCDPWLIVILKSGRWFVYNPQTNKSFWDVPEDVLRKIEEMDRDDLILLVARARGLTL
                     STDSAAPKFEEQGRLEAGTEEGNANSAPDNTVIEDVSDDEGVESDRENDDDNIDLNDE
                     NSLEEMSNDDDGLGTGFELDWDNIEDDLKNDDSTGNADLTNQERLSIFYSLLEDFSIN
                     PFGVWEVELNKVLDDDRYDILESNSARSDAFDKWAALKIREQKLQHEELSTKTQDSTE
                     DIIKKMVEDSPVGRFLSLVRRKYKEKYFYVDFKRKYRNEALFDIPELTDKDKEKIYRE
                     YASYKKKPQNDQITLVKEFLSSKIKHSSDLSKLTDTLFNDVRFYIVPDDQISKLVDET
                     LLKLQTQKTSSSDRSIQDRQNKILAEKAKQQRQLSYERRKLEEEVEKLDEAKYSLKRN
                     LSTVLGGK"
     gene            <77713..>78273
                     /gene="PRE9"
                     /locus_tag="AWJ20_1990"
                     /db_xref="GeneID:30033852"
     mRNA            <77713..>78273
                     /gene="PRE9"
                     /locus_tag="AWJ20_1990"
                     /product="proteasome core particle subunit alpha 3"
                     /transcript_id="XM_018878912.1"
                     /db_xref="GeneID:30033852"
     CDS             77713..78273
                     /gene="PRE9"
                     /locus_tag="AWJ20_1990"
                     /inference="similar to AA sequence:KEGG_Orthology:K02728"
                     /note="Alpha 3 subunit of the 20S proteasome; the only
                     nonessential 20S subunit; may be replaced by the alpha 4
                     subunit (Pre6p) under stress conditions to create a more
                     active proteasomal isoform; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0042175 -
                     nuclear outer membrane-endoplasmic reticulum membrane
                     network [Evidence IC] [PMID 9087403]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IC] [PMID 9087403];
                     GO_component: GO:0000502 - proteasome complex [Evidence
                     IEA]; GO_component: GO:0005839 - proteasome core complex
                     [Evidence IEA]; GO_component: GO:0019773 - proteasome core
                     complex, alpha-subunit complex [Evidence IEA];
                     GO_component: GO:0019773 - proteasome core complex,
                     alpha-subunit complex [Evidence IDA] [PMID 9087403];
                     GO_component: GO:0034515 - proteasome storage granule
                     [Evidence IDA] [PMID 18504300]; GO_function: GO:0004175 -
                     endopeptidase activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_function: GO:0008233 - peptidase activity
                     [Evidence IEA]; GO_function: GO:0004298 - threonine-type
                     endopeptidase activity [Evidence IEA,IEA]; GO_process:
                     GO:0010499 - proteasomal ubiquitin-independent protein
                     catabolic process [Evidence IDA] [PMID 19162040];
                     GO_process: GO:0080129 - proteasome core complex assembly
                     [Evidence IMP] [PMID 14739934]; GO_process: GO:0043161 -
                     proteasome-mediated ubiquitin-dependent protein catabolic
                     process [Evidence IDA] [PMID 11545745]; GO_process:
                     GO:0043161 - proteasome-mediated ubiquitin-dependent
                     protein catabolic process [Evidence IDA] [PMID 19029916];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA];
                     GO_process: GO:0051603 - proteolysis involved in cellular
                     protein catabolic process [Evidence IEA]; GO_process:
                     GO:0006511 - ubiquitin-dependent protein catabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome core particle subunit alpha 3"
                     /protein_id="XP_018736879.1"
                     /db_xref="GeneID:30033852"
                     /translation="MYILDDHIVCAVAGIDSDASILVNRARVFAQSYLKTYSEEIPCE
                     ILVKRLCDIKQGYTQYGGLRPFGVSFVFAGYDDLHGFQLYTSNPSGNYSGWKATSVGA
                     NGASAQTLLKQEYKEDFSLDQACELAMKVLSKTMDSATLTSEKLEFSTVGKDSASGKV
                     YQKIWKPADIDALLKATGLGKAEEDD"
     gene            complement(<78447..>79427)
                     /locus_tag="AWJ20_1991"
                     /db_xref="GeneID:30033853"
     mRNA            complement(<78447..>79427)
                     /locus_tag="AWJ20_1991"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878913.1"
                     /db_xref="GeneID:30033853"
     CDS             complement(78447..79427)
                     /locus_tag="AWJ20_1991"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736880.1"
                     /db_xref="GeneID:30033853"
                     /translation="MNLKGSENIQIKGTRAISREVMPKMSPFDATSEADSGRKGLRNS
                     SSPQLPDELWVAVFEFLDIPDLYNCSKVDHRFRRLAQDPQLHHRRLTQTAKWLERAYP
                     LRPSCKDLYDRNILLSRVQLAPSPCQKHILASTRLARIFVKDSLRRGLSRRPTRKELI
                     DRGVMKHGGSIFADKIGSLERQRVVDIIRGFFSDSQRPSLEAAIRRGVVSPPDQENKP
                     VRVLTRIFSYCFRESSESPRSSHATRMLIDPPTRANVHRMTEWFEELARNERSSFRFG
                     TQPSQTSSSFGPYAFSTVATTLSSPSPVHQISGISYDGVSAIRQRFLAIS"
     gene            complement(<80095..>87144)
                     /gene="TAO3"
                     /locus_tag="AWJ20_1992"
                     /db_xref="GeneID:30033854"
     mRNA            complement(<80095..>87144)
                     /gene="TAO3"
                     /locus_tag="AWJ20_1992"
                     /product="Tao3p"
                     /transcript_id="XM_018878914.1"
                     /db_xref="GeneID:30033854"
     CDS             complement(80095..87144)
                     /gene="TAO3"
                     /locus_tag="AWJ20_1992"
                     /note="Component of the RAM signaling network; is involved
                     in regulation of Ace2p activity and cellular
                     morphogenesis, interacts with protein kinase Cbk1p and
                     also with Kic1p; GO_component: GO:0005933 - cellular bud
                     [Evidence IDA] [PMID 12972564]; GO_component: GO:0000131 -
                     incipient cellular bud site [Evidence IDA] [PMID
                     11854408]; GO_component: GO:0043332 - mating projection
                     tip [Evidence IDA] [PMID 12972564]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0007118 -
                     budding cell apical bud growth [Evidence IGI,IMP] [PMID
                     12972564]; GO_process: GO:0007114 - cell budding [Evidence
                     IGI,IMP] [PMID 11854408]; GO_process: GO:0000902 - cell
                     morphogenesis [Evidence IGI,IMP] [PMID 11854408]"
                     /codon_start=1
                     /product="Tao3p"
                     /protein_id="XP_018736881.1"
                     /db_xref="GeneID:30033854"
                     /translation="MFWRKSKSEAAATAAQSATNHSSSKNNSTGNLAELKEAALRMER
                     KSLISIYILCRVLMEVVKQSPPDVLGDDLSEKLEEIVFKQLRTGDPRTLSMSVIRREN
                     WNLFAELLGEMSNSRFLSVGDRFIAELEKVPSVISKEQEPHILLLINGMKYLKLKIYP
                     MDALEESAEFIESLGKFFSRSNSTPVKIAYSEALSQILLPLAGVATAELNHPMWVKPV
                     ETIFAKAMEMIAKPKYWAVAFQLATVILSVAPQELFARHWLTLFESHASKIKDKANRA
                     VIYIGVSRLLWVFVFRWSETLNSTTKKLDIVSKVLFNPGNKKLWTSWESGITTAACVY
                     LIRIGSHGYLQYVLDNILLQMVHSGSVDTLTLESIIPERATVGVRSFMYILSDHETTG
                     TSASRPPFPDDVVLQSVMSNKDRSEPKHIPLPTGSLLQFYEKCCKCIVKLAVLCDTQF
                     GAHITSVDDRPIQLKPMSVSFHFGNNDSYAQHQRLAYLELFSAVIDFIPWCHFPDTQT
                     LTRTTEILCRNVVHSNPKVAQASISALKCLVETRDTRAIVNIYTKLMFSFDEKIFTSY
                     DCPPSSASEFEKILQVYVSLLEIWIANIRVLTKRDANQSETSGSLSVSQPSDDDSSRR
                     SDDMILNNWWSAVEEIEGNGLFFLCSQDRAIRLLAVKIIRLTTEFDEAIRDHGQHMTK
                     SHSRTPSKSTLTPPCRVIQLMETVDLTELFEASKPNIELSMPERSRLAKLHGKKKETL
                     VALAESDYGVDTALWLKAFPTFIKKCFENYPIPIAICRNIVCVRLVRMYDVVVEFSRS
                     EAVAGTANYAFILKHPMRTHPEVVVEQWRTYLIVACSTLTLTDEQKLHIPDSRYQHGR
                     KKSAQKITIHHQRITSVRSVFRMVIPLLGVDHPVIRDAIITGIGCINVNIYKALIECL
                     QPAIETWAEESQRLNQSQSNQSNVSSKQTVGIRKDSSAAISLAYRQERVITEIVHLLY
                     ITSHYLELPSVAEDEWIISEFVGFLNTLRNFLSLPRVQVDYNFQKLRRYFCGLLENVF
                     LGVSRNTERSNPISFESRMRYFTLIEDWCTVGQHWNVAREREAKMKRAALSTVKDSRE
                     HNIILASMELEKKKSDIAILSVLAALCAGPLMQPLDAAGRRKSNVSFNISGLLKWIGT
                     MFESPNDEMHSLGKRALKNLLIHNPDHPIIFEETVANGYRIHSEPKASKSYFVALAEI
                     LLEIPDYPCEVRQALALGLFKTGDEDDEVRSLAVDLLKATEIRFYGTSCLQEYRVNIT
                     NSTPVVYKRAMFNLSSRFAKDHPQETYLVFSELTKFFHVVNDISRRDILAVLLPWIQA
                     VELQVEVNDMPTPSTAMVMNNLFEITVTFSNRIQNEVEALWVALGNGKYPNNVNAIMN
                     FVLHHSLERRDPVFVEYSRKILAYLAAPPAGTTLIDALMKYLQPKAMIPQHLEPYDLS
                     IAERMYPYVATISAVLPVGNKETTFSHGQLALILLVDLIVSPLESVKANLPLILHVSL
                     VLFDHYLPIINDRSRELLVHVVNEFAGSQAGAQEFCELIRVSNSKFNWSYDNLNSDKN
                     GARTPKMMVQMIKDILGIFGTQIPDLRENWSRVALMWATTCPVRHIACRSFQVFRCLL
                     FTLDQNMLADMLARLSNTISDSTTDIQGFAMQILMTLNAVTAELASEDLINYPQLFWA
                     TVACLGTVHEQEFIEVLSILEKFISKIDLDSAETVACLIATFPPKWEAKFRGLQHAVI
                     PGLRSSLAWEQSLRILDRLNQLQDSEIIAGPDRLALAISINLPRYLHALEIGETTPEI
                     EASSDRLRQMCDERGLGALSRILVSFGKGRFRSKQDFLNQTIQALQNNFFPSCEGSVL
                     IFLLGILSNKIKWVKTETMDILKKILPMVDLQKEEFAGVGADIISPLLRLLQTDYAEQ
                     ALGVLDETISISASNMDKHVLRMSLGNRTIRKEYEKTATMFGIPDESGWAIPMPAVTA
                     NITRNNVHAVFYTCNTTPSTEQIPVSAEEFQFHKEEYGFMGGPLDRTDSVSVAEDVEG
                     GSLSHMWTALDNLDSFFTRDMKKSRQQRPNHEHNISVTDTDMSTDNNLDPVESVPQLY
                     DKKVSLILNRSLARTPSTTSFKTSLADSFGNSPTTPTADARFGSSTNVSVIGNSGGPP
                     TPRKREIVDFGRHTRSSSLSSGSVLSSPDIDDQNMSPQDLESTGDEFKLHNGGSTVSF
                     TKYVTSPNSGSSKKLSGVVPRLARTKSSSSSNPSSPVQRVQSPIMRDQAEMPSAPQEN
                     SFRLESFLRGANIRKVKKKASKLDKVKEKDIRDDNAKEEQRQEEEPRSKSKSRNGRSS
                     VMTFGTKLSNSPASMSASSSVSSLTRHKDNQTGQSSYQFPPPR"
     gene            complement(<90163..>91146)
                     /gene="NOP1"
                     /locus_tag="AWJ20_1993"
                     /db_xref="GeneID:30033855"
     mRNA            complement(<90163..>91146)
                     /gene="NOP1"
                     /locus_tag="AWJ20_1993"
                     /product="rRNA methyltransferase NOP1"
                     /transcript_id="XM_018878915.1"
                     /db_xref="GeneID:30033855"
     CDS             complement(90163..91146)
                     /gene="NOP1"
                     /locus_tag="AWJ20_1993"
                     /inference="similar to AA sequence:KEGG_Orthology:K14563"
                     /note="Histone glutamine methyltransferase, modifies H2A
                     at Q105 in nucleolus; component of the small subunit
                     processome complex, which is required for processing of
                     pre-18S rRNA; ortholog of mammalian fibrillarin;
                     GO_component: GO:0030686 - 90S preribosome [Evidence IDA]
                     [PMID 12150911]; GO_component: GO:0031428 - box C/D snoRNP
                     complex [Evidence IDA] [PMID 11081632]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 11932453];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     2686980]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0005840 - ribosome
                     [Evidence IDA] [PMID 16702403]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 12068309];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA,IEA];
                     GO_function: GO:1990259 - histone-glutamine
                     methyltransferase activity [Evidence IMP] [PMID 24352239];
                     GO_function: GO:0008168 - methyltransferase activity
                     [Evidence IEA,IEA]; GO_function: GO:0008649 - rRNA
                     methyltransferase activity [Evidence IDA,IMP] [PMID
                     12215523]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0000494 - box C/D snoRNA
                     3'-end processing [Evidence IMP] [PMID 10733567];
                     GO_process: GO:0000494 - box C/D snoRNA 3'-end processing
                     [Evidence IMP] [PMID 15167896]; GO_process: GO:1990258 -
                     histone glutamine methylation [Evidence IDA,IMP] [PMID
                     24352239]; GO_process: GO:0032259 - methylation [Evidence
                     IEA]; GO_process: GO:0031167 - rRNA methylation [Evidence
                     IDA,IMP] [PMID 12215523]; GO_process: GO:0031167 - rRNA
                     methylation [Evidence IMP] [PMID 8431947]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA,IEA];
                     GO_process: GO:0006364 - rRNA processing [Evidence IMP]
                     [PMID 1825809]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA]; GO_process: GO:0043144 - snoRNA
                     processing [Evidence IMP] [PMID 1825809]; GO_process:
                     GO:0008033 - tRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="rRNA methyltransferase NOP1"
                     /protein_id="XP_018736882.1"
                     /db_xref="GeneID:30033855"
                     /translation="MAFTPGGRGGSRGGGRGGFGGGRGGFGGGRGGAPGGGRGGFGGG
                     RGGARGGAAGGRGGRGGARGGRGGPRGGRGGARGGRGGAAGGAKVVIEPHKHAGVFIA
                     RGKEDLLVTKNLTPGESVYGEKRVSIDVPGQGEDAVATKVEYRVWNPFRSKLAAGILG
                     GLDELFVGPGKKVLYLGAASGTSVSHVADVVGPEGVVYAVEFSHRSGRDLISMAKKRP
                     NVIPIIEDARHPQKYRMLVGMVDVVFADVAQPDQARIIALNSHLFLKDQGGVVISIKA
                     NCIDSTVEAETVFAREVQKLREERVKPLEQLTLEPYERDHCIVVGRYVRSS"
     gene            <92150..>92707
                     /gene="RPL17A"
                     /locus_tag="AWJ20_1994"
                     /db_xref="GeneID:30033856"
     mRNA            <92150..>92707
                     /gene="RPL17A"
                     /locus_tag="AWJ20_1994"
                     /product="ribosomal 60S subunit protein L17A"
                     /transcript_id="XM_018878916.1"
                     /db_xref="GeneID:30033856"
     CDS             92150..92707
                     /gene="RPL17A"
                     /locus_tag="AWJ20_1994"
                     /inference="similar to AA sequence:KEGG_Orthology:K02880"
                     /note="Ribosomal 60S subunit protein L17A; copurifies with
                     the Dam1 complex (aka DASH complex); homologous to
                     mammalian ribosomal protein L17 and bacterial L22; RPL17A
                     has a paralog, RPL17B, that arose from the whole genome
                     duplication; protein abundance increases in response to
                     DNA replication stress; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0022625 - cytosolic large ribosomal subunit [Evidence
                     IDA] [PMID 18782943]; GO_component: GO:0005622 -
                     intracellular [Evidence IEA]; GO_component: GO:0015934 -
                     large ribosomal subunit [Evidence IEA]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA,IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA]; GO_function: GO:0003735 -
                     structural constituent of ribosome [Evidence IDA] [PMID
                     18782943]; GO_process: GO:0002181 - cytoplasmic
                     translation [Evidence IDA] [PMID 18782943]; GO_process:
                     GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L17A"
                     /protein_id="XP_018736883.1"
                     /db_xref="GeneID:30033856"
                     /translation="MTRYSTTPVNPAKSASSRGSYLRVSYKNTYETAQAVNGWPLTKA
                     LTYLEQVSEKKRAIPFRKHAGSIGRASQGKEFGVTKARWPVKSVKFVSDLLKNAQANA
                     DAKGLDTEKLVIKHIQVNQAPKQRRRTYRAHGRINPYQSSPCHIEIILTEADEEIAKA
                     PETSVVRLNSRQRGAKASQKRITAA"
     gene            complement(<93098..>95224)
                     /gene="COY1"
                     /locus_tag="AWJ20_1995"
                     /db_xref="GeneID:30033857"
     mRNA            complement(<93098..>95224)
                     /gene="COY1"
                     /locus_tag="AWJ20_1995"
                     /product="Coy1p"
                     /transcript_id="XM_018878917.1"
                     /db_xref="GeneID:30033857"
     CDS             complement(93098..95224)
                     /gene="COY1"
                     /locus_tag="AWJ20_1995"
                     /inference="similar to AA sequence:KEGG_Orthology:K09313"
                     /note="Golgi membrane protein with similarity to mammalian
                     CASP; genetic interactions with GOS1 (encoding a Golgi
                     snare protein) suggest a role in Golgi function;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IGI]
                     [PMID 12429822]; GO_component: GO:0030173 - integral
                     component of Golgi membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0048193 - Golgi vesicle transport
                     [Evidence IGI] [PMID 12429822]; GO_process: GO:0006891 -
                     intra-Golgi vesicle-mediated transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Coy1p"
                     /protein_id="XP_018736884.1"
                     /db_xref="GeneID:30033857"
                     /translation="MSSANNSPKIPEDDVNANSTAPTSTGGPSAPEGQSTTTTTSKEA
                     LNPFEQAIKVWSDIDLSSLQKSLDDEGDQILVNQTTSVKGRKELASRTKSFRKLSDEE
                     KLVEIKSLLKLYQTEIDNLTNRGKFAETSFMNVYKLLAEAPDPRPLLEASVDSVISAS
                     EVNRLMTENARLNDLVSRHADYDSVKAKLLKVEQSSIETARAKVNAKEAEMNALFDEK
                     ERNWKLREEELQRQIEDLSANKDVAEARLSAHNSSIDPSEGAKSRLLELELVAGDLER
                     ANRKVAQVEKRNLELRTELEGLKSETKANEEKAVLESKISDLEGENAIVLAKIQSLDS
                     KLATQTAASQQKIEVLERDVSRKSEEITTLKNRLHKQQDYEEIKRELDVLKSIEFDVG
                     EDDGERSARSISTQNENAQETKLEKMLLTRNKKLTSDLTNLRVTNHELNEANQAANRQ
                     ISSLTSELEEARNLNNKLEEDLLTLKNSGTSPAMSTVSGWNNSSWGGKNSVNGRVSPT
                     SSIIGGRDGRDLRGGPTPTTSSSDSSILPIITQQRDRFRQRNAELESELRKNWALISS
                     LQKEVETVKKDNVELYERTRYASSYKAQSKRGGSSAEDRYRSVYEEGLTPFQQFRGRE
                     TERALSKMGPLERIVYSFFRGVLSNRLSRNFFFLYCLGLHLLVMVILMYGATSSPVLE
                     VPSTVPGTGAEESLVSEAAVQLAEHP"
     gene            <96127..>97461
                     /gene="FUN26"
                     /locus_tag="AWJ20_1996"
                     /db_xref="GeneID:30033858"
     mRNA            <96127..>97461
                     /gene="FUN26"
                     /locus_tag="AWJ20_1996"
                     /product="nucleoside transmembrane transporter FUN26"
                     /transcript_id="XM_018878918.1"
                     /db_xref="GeneID:30033858"
     CDS             96127..97461
                     /gene="FUN26"
                     /locus_tag="AWJ20_1996"
                     /inference="similar to AA sequence:KEGG_Orthology:K15014"
                     /codon_start=1
                     /product="nucleoside transmembrane transporter FUN26"
                     /protein_id="XP_018736885.1"
                     /db_xref="GeneID:30033858"
                     /translation="MPEDNEDNEAVYLLNEEGDVPPNLIGTNSPPSISNLDYVAYATI
                     GASYLWPWNCLLSATPYFQGRFEGYKFLQANFSSFVMSITTVTGTLFTILLADRQKNA
                     DYSWRVRVGELTIASVFLLLAFSCALSIPAVPYFLFILLCVFSSSIGTGLTQNGSYAI
                     GNTLTSSHTQAITVGQAVSGVLPPIISMLSAIGSGASKEHSNDVNESLDVRESGSSST
                     NSSVGSALYFLAATAVCTAAIICFRQSEKYRKSNASGFSFSNENPAPEPLSATKKQHI
                     PLSTLFSKLFVPASTVFITFAITLIYPVFAGTVKSSNGIPTQFFIPAVYLFWNSGDLL
                     GRVLCGRPQFVVKDRRALTGYAVARLLFVPAFFLTNINGDGIIQSDVYYLLLQFAFGV
                     TNGQLVTSALMESPSFVNENEKEAAGGFMTMSLSIGLAVGSLLSFVLVWILG"
     gene            complement(<97544..>97846)
                     /locus_tag="AWJ20_1997"
                     /db_xref="GeneID:30033859"
     mRNA            complement(<97544..>97846)
                     /locus_tag="AWJ20_1997"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878919.1"
                     /db_xref="GeneID:30033859"
     CDS             complement(97544..97846)
                     /locus_tag="AWJ20_1997"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736886.1"
                     /db_xref="GeneID:30033859"
                     /translation="MLTTKLQSLWLLRQVIQGEGHSYELQGGKFILRLANIFLQGSYK
                     GLLVQVEYNSSGSEDTSGQIQKINEFLAQYGLKFVGNKLAKDEIGTAWQYVDALSR"
     gene            <98510..>99682
                     /gene="RPD3"
                     /locus_tag="AWJ20_1998"
                     /db_xref="GeneID:30033860"
     mRNA            <98510..>99682
                     /gene="RPD3"
                     /locus_tag="AWJ20_1998"
                     /product="histone deacetylase RPD3"
                     /transcript_id="XM_018878920.1"
                     /db_xref="GeneID:30033860"
     CDS             98510..99682
                     /gene="RPD3"
                     /locus_tag="AWJ20_1998"
                     /inference="similar to AA sequence:KEGG_Orthology:K11405"
                     /codon_start=1
                     /product="histone deacetylase RPD3"
                     /protein_id="XP_018736887.1"
                     /db_xref="GeneID:30033860"
                     /translation="MPVAYAYSEELIEYADKLPSNKGRASRVNALIESFGLMDKFDGI
                     IRVKPCTQADLEKYHDKNFIKFLLTGDDGLDAESETEGEESDESYEGKDEPVSKEALY
                     GLHYDCPPFDGLEKYVKLVAGATLQCADYLVSLLDTDIAQNTSKVAINWTGGRHHAKR
                     AACSGFCYVNDINLGIQRLRTKFDKVLYVDLDLHHGDGVETAFAYSDKVKSVSVHRYE
                     RGFFPGTGGMNTTSRSVVNIPTKYGLSDKSFIQIFDTIIVAEKEDFQPDAVVVTTGCD
                     GLARDELREWNLSFSSFEYIIDQIVNSWKLPTLLLGGGGYHTLDTARCLAICTAAALN
                     VPDRKQWVEIPMHDYFNEYVKDNYSLRVESHVRHNTPDENSEEYLKKLADYFEHRR"
     gene            <100425..>101837
                     /gene="BFR1"
                     /locus_tag="AWJ20_1999"
                     /db_xref="GeneID:30033861"
     mRNA            <100425..>101837
                     /gene="BFR1"
                     /locus_tag="AWJ20_1999"
                     /product="Bfr1p"
                     /transcript_id="XM_018878921.1"
                     /db_xref="GeneID:30033861"
     CDS             100425..101837
                     /gene="BFR1"
                     /locus_tag="AWJ20_1999"
                     /note="Component of mRNP complexes associated with
                     polyribosomes; implicated in secretion and nuclear
                     segregation; multicopy suppressor of BFA (Brefeldin A)
                     sensitivity; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 23222640]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 23222640];
                     GO_component: GO:0042175 - nuclear outer
                     membrane-endoplasmic reticulum membrane network [Evidence
                     IDA] [PMID 11410665]; GO_component: GO:0005844 - polysome
                     [Evidence IDA] [PMID 11410665]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IDA] [PMID 11410665];
                     GO_function: GO:0003723 - RNA binding [Evidence IDA] [PMID
                     11410665]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA] [PMID 23222640]; GO_process: GO:0016071 -
                     mRNA metabolic process [Evidence IPI] [PMID 11410665];
                     GO_process: GO:0007126 - meiotic nuclear division
                     [Evidence IMP] [PMID 8913743]; GO_process: GO:0007088 -
                     regulation of mitosis [Evidence IMP] [PMID 8913743]"
                     /codon_start=1
                     /product="Bfr1p"
                     /protein_id="XP_018736888.1"
                     /db_xref="GeneID:30033861"
                     /translation="MSKSNSPTPAPAAGAGKRVTRPNKEAFNAKLAELEAEFKTAEKN
                     LEIARNDVKKALGTSTPQTEEREKLSNELNEIAAKQRQFKTSNASIKKEIDIIDENIK
                     RSIKDLKALKDKNSYKSVDEVNAKIKSLERDIESGKLRLVEEKRYIADISNLKKIKNS
                     FGQLDQLQASIDAERAKLAKVRGTLDTTSQNALSDRYNEVKKQLDAIRDGQQKAYKEK
                     NTLFEKRDAANKVRDAARSNISKLKDEYYGQLRAYTAQAEADRIARAEKEEAEKKAFA
                     AEKKKAELREKLEAASEPAFANQIDIAENLLVHFDPEYKRADSNDISLKSTGPVKTAS
                     GRTIDVPHGAELKKSDEELFAGLGGKKNKKKSSSDSKLRLNVGIIDDFATLNIPIPVS
                     KDDVEGTIAKLKEKIQYYKENQDRVTAERIERAKAEIAKLELADKEDEEKKEEEEEKA
                     EEAPAATEKAEPEASVEASA"
     gene            complement(<101977..>103020)
                     /gene="FEN2"
                     /locus_tag="AWJ20_2000"
                     /db_xref="GeneID:30033865"
     mRNA            complement(<101977..>103020)
                     /gene="FEN2"
                     /locus_tag="AWJ20_2000"
                     /product="Fen2p"
                     /transcript_id="XM_018878925.1"
                     /db_xref="GeneID:30033865"
     CDS             complement(101977..103020)
                     /gene="FEN2"
                     /locus_tag="AWJ20_2000"
                     /inference="similar to AA sequence:KEGG_Orthology:K03448"
                     /note="Plasma membrane H+-pantothenate symporter; confers
                     sensitivity to the antifungal agent fenpropimorph;
                     relocalizes from vacuole to cytoplasm upon DNA replication
                     stress; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IEA,IEA];
                     GO_component: GO:0005886 - plasma membrane [Evidence
                     IGI,ISS] [PMID 10373490]; GO_function: GO:0015233 -
                     pantothenate transmembrane transporter activity [Evidence
                     IGI,IMP] [PMID 10373490]; GO_process: GO:0006897 -
                     endocytosis [Evidence IMP] [PMID 15020461]; GO_process:
                     GO:0015887 - pantothenate transmembrane transport
                     [Evidence IGI,IMP] [PMID 10373490]; GO_process: GO:0055085
                     - transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Fen2p"
                     /protein_id="XP_018736889.1"
                     /db_xref="GeneID:30033865"
                     /translation="MLGSWYKKNELGKRAAIFVSVGDIGSMAGGWIQAGLFARLDGHG
                     LPAWRLIFIVVFAMTIPFVFLGLIAIPDLPRHENAWFLSDEEKKLAIDRLQRHVPTET
                     MSLRVVWRAVKSWQFWLMPFIFFLYGVSVQMLGNNVMPLWMKSRGYTVVQMNNYPTVI
                     FAFAIVGTLGYSFLSDRLGSRWQASVAIGFTFTLCCPILLSNNVPDGAKFFAFFFLGT
                     CLAPQALWFTWCADVTSHDLYLRSITTGWMNAIDEAFIAWWPIVFYPVTDAPTFRTGY
                     IASLVLGTLIVPTVGAIVYLDRRDQRLHYDADSDDEQTPIEGVGHNSSQRSILANDAS
                     KLQSNYNSIEVTI"
     gene            <104711..>107242
                     /locus_tag="AWJ20_2001"
                     /db_xref="GeneID:30033866"
     mRNA            <104711..>107242
                     /locus_tag="AWJ20_2001"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878926.1"
                     /db_xref="GeneID:30033866"
     CDS             104711..107242
                     /locus_tag="AWJ20_2001"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736890.1"
                     /db_xref="GeneID:30033866"
                     /translation="MGQQVTGANDLGLNIAVESHGRFIAVSDSNKRVRIMAFGLSDDN
                     SLASIIDSRQDIQSRHTISIGGGVVLNMAFLTTGSTAYNTSTSMSPKIAPVASQGDPR
                     TTGGDDVYLVLLYAVSRKLKLNMYKVPYGQREFSYIHDIGLCGTFTLSLDFKEEIPMY
                     MVPVSMNESSAIVLVTKRQLLLVTFLDIMSGHRILTSALLPDYPLAVHQSPYNKDRSV
                     FYLTTKDSHLYRVKVSEMRGFELLSFKHWPGRDLGSSFVLQPYDDEGPTSDINSDRLL
                     ITFGGDLCCGGSMVFNSVGMIYDDGEQADIEEEGDVDIYDNWAPISDFKPINIQSTSR
                     GDSLELFACTGLHHQGAITQFRHGIRASVFLQGPSMTEAPQLYSMQSHDGLESYLIVS
                     LPWKTTLYLVEQSTIDEQNGQEAYFPQLSEVPNNCGIDYKNETKAISFLPETKFVIQV
                     TSSQILLTDLMGSSKRFDVTRASCAAIFKSMVAVAFYDEDALSNKVVIYSINSVNYED
                     GDNWIERKSVVLMSHPVSFVKFTERKDNGINLFIGSYEPRIDVYHIDNDCDARLVLEI
                     KNIFTDEEEVPNDLHLQDRMLDRFIIGLRNGSYINCVLEDMTMRLESKKKLANLPIQF
                     VNIDHKPGPNVFVLSNGRLSCFDKKNFLEAPQKVVVDIDKVADIRSACQFYYNMEDGK
                     HQFVAVIMNNRLTILALDLFATVIPKQVHLGASPRRMLYLEHIGALAVVVSPSSTSKT
                     SLLRFVDPKRMVEIDFRLYDATSPSSKTCFQANEVIYSLNEWSLKIDGNTYKFLLLGS
                     GIKGLPEGKFRILRLSRTTEGIKATIQHSWITAGHVYSVSQFEAL"
     gene            <109047..>112073
                     /gene="PET309"
                     /locus_tag="AWJ20_2002"
                     /db_xref="GeneID:30033867"
     mRNA            <109047..>112073
                     /gene="PET309"
                     /locus_tag="AWJ20_2002"
                     /product="Pet309p"
                     /transcript_id="XM_018878927.1"
                     /db_xref="GeneID:30033867"
     CDS             109047..112073
                     /gene="PET309"
                     /locus_tag="AWJ20_2002"
                     /note="Specific translational activator for the COX1 mRNA;
                     also influences stability of intron-containing COX1
                     primary transcripts; localizes to the mitochondrial inner
                     membrane; contains seven pentatricopeptide repeats (PPRs);
                     GO_component: GO:0031314 - extrinsic component of
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     18039654]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IDA] [PMID
                     9692914]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     9692914]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0045182 -
                     translation regulator activity [Evidence IGI] [PMID
                     7664742]; GO_process: GO:0016070 - RNA metabolic process
                     [Evidence IMP] [PMID 7664742]; GO_process: GO:0009060 -
                     aerobic respiration [Evidence IMP] [PMID 7664742];
                     GO_process: GO:0097034 - mitochondrial respiratory chain
                     complex IV biogenesis [Evidence IMP] [PMID 7664742];
                     GO_process: GO:0070134 - positive regulation of
                     mitochondrial translational initiation [Evidence IMP]
                     [PMID 18039654]; GO_process: GO:0070134 - positive
                     regulation of mitochondrial translational initiation
                     [Evidence IMP] [PMID 7664742]"
                     /codon_start=1
                     /product="Pet309p"
                     /protein_id="XP_018736891.1"
                     /db_xref="GeneID:30033867"
                     /translation="MSWSGILRSSSSNTLRRSEALYWSLQSYSQAYFSGSWNRYLLAA
                     SIVWENGLFGATTKDTRKRLNKTRVGKTHLEKFWHQKRKLSSWSPSCASAVNITSSRS
                     PEFAGSASIGQISKGPEMGAVPRDLINALNPKNLSDLELIESWRKEITSTDRRRQMQA
                     LAKKQELYSHFLSSLQRTPNEDLLEQLLALVHCVPHPHSSVDYNFRIYLLRISGELDM
                     ISCCLEEASNQLSKDEFLAVLRAVVDDFISSHTPIPPSFLNIFASTILKYDGTLELLS
                     RRYHEERSILKSIIRHLSTASPTLTSILDDFLRNSPHFGSMLVTTCIDILGQPEDVKP
                     QLVEQLWNRKLELDLASPLDLHRVMTAFYHNCQYEQVLHLYDSYPSLHMHWQFDIVLL
                     TLAKLRNWDRLQTVFESLFRHDDLPDINHYGIVIQALSQLGKVDIVDTLFSSLLAKSI
                     NPSIEILHGLMYSRLALGEVHGVEYFFNQITILGLRPNPRSYNILLRSYRDSHEIQKA
                     LNLIGQMAELNIPITRYAVTTLISTCTERRDTETGEALFDWALSYGIKPDIIMFNSLI
                     ACYMESNCLTKAEKIYEMMKEGSHCRPTVDTLTSMLTGYSRMATKIPNSQQKVLKLEE
                     DMKKYSISPDDRWLSSLMHYNLSIKNFKQVEAIFVDLTKKYRVDTTPYHYSIMMEAYI
                     IQRKLKEAEELYNTMKQQNVIPTFNTQEKYLRLKISDPAAKVRQEAAGYLQDFLQATD
                     IIDLESKQLPRNVIPFSMVKRVSREFMKSGNYESALEFMKPYNEEGYDPKEQFKVSAF
                     MLELYGHAGYWSLIEKTWESFLEQVRRAYVPVKVSDGAEPRYEKRLPTRYRGTFWQAV
                     NSKLNQLQNFGQYSKMLDLISWAEKEGLGVTSKNMNTLVKGLLFDDKFLVKAFEVSEE
                     CLAPTTVAKLQAKGSGHTHPLYGLKYKDYNLSMSTFKALVRKFDRLITITAYEGKCSR
                     LKAFILVNEKYPKLMKLFSWREKSRTKRRPRLAAST"
     gene            complement(<112221..>112631)
                     /gene="SPC3"
                     /locus_tag="AWJ20_2003"
                     /db_xref="GeneID:30033868"
     mRNA            complement(<112221..>112631)
                     /gene="SPC3"
                     /locus_tag="AWJ20_2003"
                     /product="Spc3p"
                     /transcript_id="XM_018878928.1"
                     /db_xref="GeneID:30033868"
     CDS             complement(112221..112631)
                     /gene="SPC3"
                     /locus_tag="AWJ20_2003"
                     /inference="similar to AA sequence:KEGG_Orthology:K12948"
                     /note="Subunit of signal peptidase complex; complex
                     catalyzes cleavage of N-terminal signal sequences of
                     proteins targeted to the secretory pathway; homologous to
                     mammalian SPC22/23; other members of the complex are
                     Spc1p, Spc2p, and Sec11p; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA,IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005787 - signal
                     peptidase complex [Evidence IEA]; GO_component: GO:0005787
                     - signal peptidase complex [Evidence IDA] [PMID 1846444];
                     GO_component: GO:0005787 - signal peptidase complex
                     [Evidence IDA] [PMID 8910564]; GO_function: GO:0008233 -
                     peptidase activity [Evidence IEA]; GO_function: GO:0008233
                     - peptidase activity [Evidence IMP] [PMID 9148930];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IMP] [PMID 9148931]; GO_process: GO:0045047 - protein
                     targeting to ER [Evidence IMP] [PMID 9148931]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA]; GO_process:
                     GO:0006465 - signal peptide processing [Evidence IEA];
                     GO_process: GO:0006465 - signal peptide processing
                     [Evidence IMP] [PMID 9148930]; GO_process: GO:0006465 -
                     signal peptide processing [Evidence IDA,IMP] [PMID
                     9148931]"
                     /codon_start=1
                     /product="Spc3p"
                     /protein_id="XP_018736892.1"
                     /db_xref="GeneID:30033868"
                     /translation="MSRKVAARFGRRGGSVDGKAKDNYRIKFDLSTDLSPLFNWNTKQ
                     VFVYLTAEYDGKREDINNRVTFWDSIIKSKEDAVLDLKNVRGSYSVYDVGSSLENKNA
                     TIRLEWNVQPHVGFLIFGETVATEDGSFIFPALT"
     gene            <115250..>116755
                     /gene="UGA2"
                     /locus_tag="AWJ20_2004"
                     /db_xref="GeneID:30033869"
     mRNA            <115250..>116755
                     /gene="UGA2"
                     /locus_tag="AWJ20_2004"
                     /product="succinate-semialdehyde dehydrogenase
                     (NAD(P)(+))"
                     /transcript_id="XM_018878929.1"
                     /db_xref="GeneID:30033869"
     CDS             115250..116755
                     /gene="UGA2"
                     /locus_tag="AWJ20_2004"
                     /inference="similar to AA sequence:KEGG_Orthology:K00135"
                     /note="Succinate semialdehyde dehydrogenase; involved in
                     the utilization of gamma-aminobutyrate (GABA) as a
                     nitrogen source; part of the 4-aminobutyrate and glutamate
                     degradation pathways; localized to the cytoplasm;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016620 -
                     oxidoreductase activity, acting on the aldehyde or oxo
                     group of donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_function: GO:0009013 - succinate-semialdehyde
                     dehydrogenase [NAD(P)+] activity [Evidence IEA,IEA];
                     GO_function: GO:0009013 - succinate-semialdehyde
                     dehydrogenase [NAD(P)+] activity [Evidence IMP,ISS] [PMID
                     11031268]; GO_function: GO:0009013 -
                     succinate-semialdehyde dehydrogenase [NAD(P)+] activity
                     [Evidence IMP] [PMID 3888627]; GO_process: GO:0034599 -
                     cellular response to oxidative stress [Evidence IMP] [PMID
                     11031268]; GO_process: GO:0009450 - gamma-aminobutyric
                     acid catabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0009450 - gamma-aminobutyric acid catabolic process
                     [Evidence IEP,IMP,ISS] [PMID 11031268]; GO_process:
                     GO:0009450 - gamma-aminobutyric acid catabolic process
                     [Evidence IMP] [PMID 3888627]; GO_process: GO:0006540 -
                     glutamate decarboxylation to succinate [Evidence
                     IGI,IMP,ISS] [PMID 11031268]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="succinate-semialdehyde dehydrogenase
                     (NAD(P)(+))"
                     /protein_id="XP_018736893.1"
                     /db_xref="GeneID:30033869"
                     /translation="MLRSRIFTRAMSSTGKPVLKNPKLLRDKSYVDGQWISASSGKTF
                     KVFDPATCQEIGSVPEHTAADYAKAIEHAKKAFASFSKTSNRERSNLLRKWASLLTEN
                     SEDLAKILTWENGKPLPEAKGEIASCVANFEWFSEEAPRIYGDTIPSQNPNTRIHTIK
                     QPVGVCGIITPWNFPASMISRKVGAAVATGCTTVIKPAAETPYSALALAYLAEEAGIP
                     KGVVNVLTTNEHVQDVGREICENPLVSKVTFTGSTNVGRILMKQAASTLKKVSFELGG
                     NAPFIVFEDADIDAAVDGAIASKFRGSGQTCICANRFYVHEKIYDEFAKKLAAKVSGF
                     KVGNGLEEGTTQGPLINEKAVQKVDRHVQDALGKHAHALVGGKPATELGENFYSPTVL
                     VDVDASMAVTQEETFGPLAALSKFSTDEEVIKLANNVEVGLAAYIYTNNNSRVHRVSE
                     GLQVGMVGVNTGLITESALPFGGVKESGFGREGSKYGLDDYLVIKSVVNAI"
     gene            complement(<115696..>116136)
                     /locus_tag="AWJ20_2005"
                     /db_xref="GeneID:30033870"
     mRNA            complement(<115696..>116136)
                     /locus_tag="AWJ20_2005"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878930.1"
                     /db_xref="GeneID:30033870"
     CDS             complement(115696..116136)
                     /locus_tag="AWJ20_2005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736894.1"
                     /db_xref="GeneID:30033870"
                     /translation="MAPSTAASMSASSNTMKGALPPNSKETFLRVDAACFMRILPTLV
                     EPVKVTLLTNGFSQISLPTSWTCSLVVNTLTTPLGIPASSARYANANAEYGVSAAGLM
                     TVVQPVATAAPTFLEIIEAGKFQGVMIPQTPTGCLIVWIRVLGF"
     gene            complement(<116820..>118130)
                     /locus_tag="AWJ20_2006"
                     /db_xref="GeneID:30033871"
     mRNA            complement(<116820..>118130)
                     /locus_tag="AWJ20_2006"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878931.1"
                     /db_xref="GeneID:30033871"
     CDS             complement(116820..118130)
                     /locus_tag="AWJ20_2006"
                     /inference="similar to AA sequence:KEGG_Orthology:K11979"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736895.1"
                     /db_xref="GeneID:30033871"
                     /translation="MPYDPNHCTHHDAPMRQQLFACLTCRAKDKQDNGICYSCSIQCH
                     SNHELVELFARRGFSCDCGTTRMASFGACNLRKNFDGLDTPEETNKYNHNFSGRFCSC
                     DQVYDPSSEQGIMFQCLLGDACDEEWFHEECILGVDRLGTVETEANPESTSVKDDAID
                     DTALKSHYPQGVNMYDLLEPAESSVVKAPEEIKEEQEKSEQNQDGNLAVNNEEDDEDE
                     EGDEDDEDDTLDGLPRQEDIGAFICWKCVEKNPILLKWGKSWPEVAHEPVVHGIFKTI
                     EERELSIKSLKPEPSNRDVEKNEFDKRALDDGVSSIQPLKKIKSDEQKQEVSLFLKPG
                     FHDHVKASSDPDIKAFAEKFPFLLEEESVYEPPQDDDANSSLLDAGTRALNSIPRDQA
                     INGMQAYSMIRERLSLFLRPFAEQGKVVTEHDVTNFFEEVRNEK"
     gene            <118446..>119633
                     /gene="RAD57"
                     /locus_tag="AWJ20_2007"
                     /db_xref="GeneID:30033872"
     mRNA            <118446..>119633
                     /gene="RAD57"
                     /locus_tag="AWJ20_2007"
                     /product="putative DNA-dependent ATPase RAD57"
                     /transcript_id="XM_018878932.1"
                     /db_xref="GeneID:30033872"
     CDS             118446..119633
                     /gene="RAD57"
                     /locus_tag="AWJ20_2007"
                     /inference="similar to AA sequence:KEGG_Orthology:K10958"
                     /codon_start=1
                     /product="putative DNA-dependent ATPase RAD57"
                     /protein_id="XP_018736896.1"
                     /db_xref="GeneID:30033872"
                     /translation="MDLYESYPSCSLLKNTNFDSLLSAFEEFEITTADLVVNDPKVIA
                     QRCGRSQVELLRFLNIFYKEALNGLEFINIGELQDGKLDKNTACLSGTSSSPLQESCI
                     STRMLTTGDSKFDSELRGGIPAGYITEVSGESGSGKSNFLTQLCVTVQLPKALGGLEK
                     SALYICTESGFETRRLIDMIEYIKQTHSLNESQISSDNVHCINCRDQEHLEQVLKYQL
                     PVAIERFNVGILLIDSIAAHLRAEFDLQHVQQRNNKLILLSRHLRKLASLNELAVVIA
                     NQVSDRFIRNLPAHSEPDALFLDHQIRWFSGWEEPNIVVPPSSSFHSSQQSTPATTER
                     PRTPSLGLAWSNCIDQRIVLKRALLPDGSSHRTFNIVFSPFSPQSCTPFKIMKGGVYS
                     IDT"
     gene            <119897..>122404
                     /gene="MCM2"
                     /locus_tag="AWJ20_2008"
                     /db_xref="GeneID:30033873"
     mRNA            <119897..>122404
                     /gene="MCM2"
                     /locus_tag="AWJ20_2008"
                     /product="MCM DNA helicase complex subunit MCM2"
                     /transcript_id="XM_018878933.1"
                     /db_xref="GeneID:30033873"
     CDS             119897..122404
                     /gene="MCM2"
                     /locus_tag="AWJ20_2008"
                     /inference="similar to AA sequence:KEGG_Orthology:K02540"
                     /note="Protein involved in DNA replication; component of
                     the Mcm2-7 hexameric helicase complex that binds chromatin
                     as a part of the pre-replicative complex; relative
                     distribution to the nucleus increases upon DNA replication
                     stress; GO_component: GO:0031261 - DNA replication
                     preinitiation complex [Evidence IDA] [PMID 9554851];
                     GO_component: GO:0042555 - MCM complex [Evidence IEA];
                     GO_component: GO:0042555 - MCM complex [Evidence IDA]
                     [PMID 12480933]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 10704410]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 22842922]; GO_component:
                     GO:0005656 - nuclear pre-replicative complex [Evidence
                     IDA] [PMID 16824194]; GO_component: GO:0005656 - nuclear
                     pre-replicative complex [Evidence IDA] [PMID 9335335];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     10704410]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0031298 -
                     replication fork protection complex [Evidence IDA] [PMID
                     16531994]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA,IEA]; GO_function: GO:0003678 - DNA helicase activity
                     [Evidence IEA]; GO_function: GO:0003678 - DNA helicase
                     activity [Evidence IDA] [PMID 18657510]; GO_function:
                     GO:0003688 - DNA replication origin binding [Evidence IDA]
                     [PMID 11756674]; GO_function: GO:0003688 - DNA replication
                     origin binding [Evidence IDA] [PMID 16824194];
                     GO_function: GO:0003682 - chromatin binding [Evidence IDA]
                     [PMID 10783164]; GO_function: GO:0004386 - helicase
                     activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0003697 - single-stranded DNA binding
                     [Evidence IMP] [PMID 17895243]; GO_function: GO:0017116 -
                     single-stranded DNA-dependent ATP-dependent DNA helicase
                     activity [Evidence IDA] [PMID 18657510]; GO_process:
                     GO:0032508 - DNA duplex unwinding [Evidence IEA];
                     GO_process: GO:0006260 - DNA replication [Evidence
                     IEA,IEA]; GO_process: GO:0006270 - DNA replication
                     initiation [Evidence IEA]; GO_process: GO:0006271 - DNA
                     strand elongation involved in DNA replication [Evidence
                     IMP] [PMID 10834843]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0006974 - cellular response
                     to DNA damage stimulus [Evidence IMP] [PMID 22564307];
                     GO_process: GO:0000727 - double-strand break repair via
                     break-induced replication [Evidence IMP] [PMID 20516198];
                     GO_process: GO:1902450 - negative regulation of
                     ATP-dependent DNA helicase activity [Evidence IDA] [PMID
                     13679365]; GO_process: GO:0033260 - nuclear cell cycle DNA
                     replication [Evidence IMP] [PMID 10834843]; GO_process:
                     GO:0006267 - pre-replicative complex assembly involved in
                     nuclear cell cycle DNA replication [Evidence IDA] [PMID
                     16824194]; GO_process: GO:0006267 - pre-replicative
                     complex assembly involved in nuclear cell cycle DNA
                     replication [Evidence IPI] [PMID 9335335]"
                     /codon_start=1
                     /product="MCM DNA helicase complex subunit MCM2"
                     /protein_id="XP_018736897.1"
                     /db_xref="GeneID:30033873"
                     /translation="MSGSRKRDRRNSEDFRGEPPSSPNLPMANLASSPPAFEDEDELI
                     QEDVIDDLDELAEEEAGEDLFGDNMERDYMESRQNDQYDLGDQNIDDNEYDDLDISAR
                     RQVDAQLNRRDRQIRNQRGLPDAFLDDGDGYDDLVPPTTRRRRNQYDEDLAMDNSDDD
                     DPMNEILSLESLGDVKAESIAEWVSQPSVHRSVAREFKNFLLEYTDENGRSVYGNRIR
                     TLGEVNSESLEIVYTHLVESKATLAYFLAVAPTEILKIFDVVAMEAIELHYPEYSRIH
                     AEVHVRISGLPTTFTLRDLRENHLNSLVRVTGVVTRRTGVFPQLKYVKFNCPKCGMIL
                     GPYFQDSNTEVTISFCHSCQSRGPFILNSEKTVYRNYQKITLQESPGTVPAGRLPRHR
                     EVILLWDLIDVAKPGEEVDITGIYKNSYDGGLNAKNGFPVFATVIEANLVQRREAGKT
                     GDFTLTEEEEREIRTLAKSKDIINTIIRSIAPSIYGHKDIKTALACSLFGGVAKRQEK
                     HTVRGDINVLLLGDPGTAKSQLLKYVEKTAHRAVFATGQGASAVGLTASVRKDPITRE
                     WTLEGGALVLADKGTCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCAV
                     IAAANPNGGRYNSTIPFAANVDLTEPILSRFDVLCVVRDTVDPEVDEMLAKFVVTSHT
                     KNHPLDPGEGNSGLQQEDEDDDMGEEEEEDLLASLQPNAGATISQELLRKYIHYARTK
                     FQPRLSQQYEGKIGSIYSEIRQYSRNTGSFPITVRHLESIIRLSESFAKMRLSENVSE
                     GDVNRAISVTIDSFVGAQKSSLRRSLRRSLMKYTYNN"
     gene            complement(<122694..>123470)
                     /gene="MAF1"
                     /locus_tag="AWJ20_2009"
                     /db_xref="GeneID:30033874"
     mRNA            complement(<122694..>123470)
                     /gene="MAF1"
                     /locus_tag="AWJ20_2009"
                     /product="RNA polymerase III-inhibiting protein MAF1"
                     /transcript_id="XM_018878934.1"
                     /db_xref="GeneID:30033874"
     CDS             complement(122694..123470)
                     /gene="MAF1"
                     /locus_tag="AWJ20_2009"
                     /codon_start=1
                     /product="RNA polymerase III-inhibiting protein MAF1"
                     /protein_id="XP_018736898.1"
                     /db_xref="GeneID:30033874"
                     /translation="MSPPTLQVFSPPSSYYPTSNVHEHVFDPNSKENVLSRSRRNSRA
                     NSGYAGSLGTHTSNYNSGGNGTLTVSNIIQNSTAGSLSSSPFGPLDQAASRKTFAYLI
                     SVLNASDPDRDFSSLQPEDFKREPSSTSVVNTFNNILFGQGLPVPPRLWETLDKNIDL
                     KESSIYSHTPPEAFLADEPGTMWSMMWFFFNKRRKRVAYIHLKAVRHYQSPLLTAVDS
                     RRRRKDEIKDEYDEDKDEYDLTYSSDSQMYDEVVGDLELE"
     gene            complement(<124618..>125844)
                     /gene="PPH3"
                     /locus_tag="AWJ20_2010"
                     /db_xref="GeneID:30033876"
     mRNA            complement(<124618..>125844)
                     /gene="PPH3"
                     /locus_tag="AWJ20_2010"
                     /product="phosphoprotein phosphatase PP4 catalytic subunit
                     PPH3"
                     /transcript_id="XM_018878936.1"
                     /db_xref="GeneID:30033876"
     CDS             complement(124618..125844)
                     /gene="PPH3"
                     /locus_tag="AWJ20_2010"
                     /note="Catalytic subunit of protein phosphatase PP4
                     complex; active complex is composed of Pph3p and Psy2p,
                     with Psy4p apparently providing additional substrate
                     specificity in some cases; regulates recovery from the DNA
                     damage checkpoint and also the gene conversion- and
                     single-strand annealing-mediated pathways of meiotic
                     double-strand break repair; involved in activation of
                     Gln3p to alleviate nitrogen catabolite repression; Pph3p
                     and Psy2p localize to foci on meiotic chromosomes;
                     GO_component: GO:0000794 - condensed nuclear chromosome
                     [Evidence IDA] [PMID 20951350]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0030289 - protein phosphatase 4 complex
                     [Evidence IDA,IMP] [PMID 16299494]; GO_component:
                     GO:0030289 - protein phosphatase 4 complex [Evidence IDA]
                     [PMID 17517611]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA,IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0004721
                     - phosphoprotein phosphatase activity [Evidence IEA,IEA];
                     GO_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IDA,IMP] [PMID 16299494];
                     GO_function: GO:0004722 - protein serine/threonine
                     phosphatase activity [Evidence IDA] [PMID 7941742];
                     GO_process: GO:0000724 - double-strand break repair via
                     homologous recombination [Evidence IGI] [PMID 21135129];
                     GO_process: GO:2000002 - negative regulation of DNA damage
                     checkpoint [Evidence IMP] [PMID 16299494]; GO_process:
                     GO:2000002 - negative regulation of DNA damage checkpoint
                     [Evidence IMP] [PMID 17517611]; GO_process: GO:1902660 -
                     negative regulation of glucose mediated signaling pathway
                     [Evidence IMP] [PMID 24277933]; GO_process: GO:0051173 -
                     positive regulation of nitrogen compound metabolic process
                     [Evidence IMP] [PMID 10940301]; GO_process: GO:0006470 -
                     protein dephosphorylation [Evidence IDA,IMP] [PMID
                     16299494]; GO_process: GO:0006470 - protein
                     dephosphorylation [Evidence IDA] [PMID 7941742];
                     GO_process: GO:0072462 - signal transduction involved in
                     meiotic recombination checkpoint [Evidence IMP] [PMID
                     20951350]"
                     /codon_start=1
                     /product="phosphoprotein phosphatase PP4 catalytic subunit
                     PPH3"
                     /protein_id="XP_018736899.1"
                     /db_xref="GeneID:30033876"
                     /translation="MSLVDETIELLKSCSHVPESVVKQLCYKAQELLIEEGNVQLVHT
                     PVTICGDIHGQFHDLLTLFSIGGECPTTSYLFLGDFVDRGFYSLESFLLLLCLKVRYP
                     DSITLIRGNHESRQITSAYGFYDECLRKYGSASVWRLCCNVFDYLSLSALVGGPGGVF
                     CVHGGLSPAIQNLNEIRHIDRKQEVPHDGPMCDLLWSDPDDSLDMTNENKDDIYDNEL
                     NENGNGHDADEEDAGTNTNYRVNHAGSGNGTGSSGESSEGMRSDSNSNDEDIYSPVSS
                     PDIGLNGLYDLSKSGGNRSTLQSMAASWGVSPRGAGYLFGSLPVHQFNHINNTSLIAR
                     AHQLVLEGYKEMFDNQLVTVWSAPNYCYRCGNVAAILNIDDNYERRYSIFHAQEADQG
                     TGQVVPTKRPVAEYFL"
     gene            <129665..>132304
                     /gene="RSN1"
                     /locus_tag="AWJ20_2011"
                     /db_xref="GeneID:30033877"
     mRNA            <129665..>132304
                     /gene="RSN1"
                     /locus_tag="AWJ20_2011"
                     /product="Rsn1p"
                     /transcript_id="XM_018878937.1"
                     /db_xref="GeneID:30033877"
     CDS             129665..132304
                     /gene="RSN1"
                     /locus_tag="AWJ20_2011"
                     /note="Membrane hypothetical protein; overexpression
                     suppresses NaCl sensitivity of sro7 mutant cells by
                     restoring sodium pump (Ena1p) localization to the plasma
                     membrane; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 19001347]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA,IEA];
                     GO_component: GO:0016020 - membrane [Evidence IDA] [PMID
                     17005914]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006893 - Golgi to plasma
                     membrane transport [Evidence IGI] [PMID 17005914]"
                     /codon_start=1
                     /product="Rsn1p"
                     /protein_id="XP_018736900.1"
                     /db_xref="GeneID:30033877"
                     /translation="MGGSSSSSTSSGSTIGTTAVFNIAVFVIFVTAFLILRPRHKNVY
                     QPRVIAKTVPDSSRPRPLATGNFVWFRDLLSRPDSEILRDAGLDGYFFLRYLRLIFFI
                     CLVGIILVYPVLLAVNATGGGTPQGVSNSGFDILSFVNVRNKNRYFAHVFIGYLFFGF
                     ILFSLYRELQYYVAVRQSVLTSPAYSNLVSSRTILLTTLPDEYMNSSKLANLFEGVKF
                     VFINKNAKDLAKKVKQRGKLAGNIESAEVSLLKKAVSNRLKSEKKGASPIEGEDIDVY
                     VPQKKRPTRRLKPIIGKKVDTIDHDSQELQEVNTEIEQLQSKYTSLPSLNSAFITFHT
                     QEQAELGYQSLAHQQALHMAPRYIGITPDDVIWSNLRLKWWERLIKELGTTAIICALI
                     IFWSIPVAFVGALSNIKALEKKLPWLDFLNNLPKPLMGLVTGLLPTILLAVLMMLLPI
                     FIRLMGKLAGNPSKSRVEYYTQNAYFGFQVVQVFLVTTIASGASAVVVQIIEDPSSAM
                     SLLATNLPKASNFYIAYFMLQGFTACGSMLLQIVSLILFYVLGFILDGTPRKKWNRNN
                     VIGSLGWGTVFPVYTNLAVITITYSIISPLLLAFSGITFGLIYLAYLHNLMFVKSPSD
                     GRGIYYARAILQTFTGLYIAEVCLLGLFLLAKSWGPLVLQAIFLGFTVFVNLSLKSAF
                     SPLLFQLPRSLLRAEARDDNRKYSRSSAGSVIPSPDTSFEKNHNDAHPSSYPLTNEPS
                     NAPIVNQSQVEAGRTKYGPIPSGGTIARFFKPHLYLTPEVLNQELLNAPVFHEPQAPL
                     SDEEESVAYNHPAANAPNPVVWIPRDPWGLSAAQVQSLRERDVNVSDDGTWFDIDETK
                     KKSKFGFTSSISEVPIWTQPPNY"
     gene            <132768..>133616
                     /gene="IPP1"
                     /locus_tag="AWJ20_2012"
                     /db_xref="GeneID:30033878"
     mRNA            <132768..>133616
                     /gene="IPP1"
                     /locus_tag="AWJ20_2012"
                     /product="inorganic diphosphatase IPP1"
                     /transcript_id="XM_018878938.1"
                     /db_xref="GeneID:30033878"
     CDS             132768..133616
                     /gene="IPP1"
                     /locus_tag="AWJ20_2012"
                     /inference="similar to AA sequence:KEGG_Orthology:K01507"
                     /note="Cytoplasmic inorganic pyrophosphatase (PPase);
                     homodimer that catalyzes the rapid exchange of oxygens
                     from Pi with water, highly expressed and essential for
                     viability, active-site residues show identity to those
                     from E. coli PPase; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0004427 - inorganic diphosphatase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004427 -
                     inorganic diphosphatase activity [Evidence IDA] [PMID
                     8224193]; GO_function: GO:0000287 - magnesium ion binding
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_process: GO:0006796 -
                     phosphate-containing compound metabolic process [Evidence
                     IEA]; GO_process: GO:0006796 - phosphate-containing
                     compound metabolic process [Evidence IC] [PMID 8224193]"
                     /codon_start=1
                     /product="inorganic diphosphatase IPP1"
                     /protein_id="XP_018736901.1"
                     /db_xref="GeneID:30033878"
                     /translation="MSTSPYGIRKIGAQNTLEHKVYIEKDGKPISAFHDVPLYANAEK
                     TILNMIVEVPRWTNAKMEISKELPLNPIVQDTKKGKLRFVRNCFPHKGYIHNYGAFPQ
                     TWEDPNFTHPETKAVGDNDPLDVCEIGEAVGYTGQIKQVKVLGVMALLDEGETDWKII
                     AIDVKDPHASKVNDIEDVEKNFPGLLRATNEWFRIYKIPDGKPENQFAFSGECKNKKY
                     AEDVIRECAEAWEKLVAGKVDPKGIELSTAESEAASAVATGENLPPAPIDASIDKWFF
                     IAGASV"
     gene            complement(<134501..>136195)
                     /gene="TRP1"
                     /locus_tag="AWJ20_2013"
                     /db_xref="GeneID:30033879"
     mRNA            complement(<134501..>136195)
                     /gene="TRP1"
                     /locus_tag="AWJ20_2013"
                     /product="phosphoribosylanthranilate isomerase TRP1"
                     /transcript_id="XM_018878939.1"
                     /db_xref="GeneID:30033879"
     CDS             complement(134501..136195)
                     /gene="TRP1"
                     /locus_tag="AWJ20_2013"
                     /inference="similar to AA sequence:KEGG_Orthology:K01817"
                     /note="Phosphoribosylanthranilate isomerase; catalyzes the
                     third step in tryptophan biosynthesis; in 2004, the
                     sequence of TRP1 from strain S228C was updated by changing
                     the previously annotated internal STOP (TAA) to serine
                     (TCA); GO_component: GO:0005737 - cytoplasm [Evidence IDA]
                     [PMID 14562095]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016853 -
                     isomerase activity [Evidence IEA]; GO_function: GO:0004640
                     - phosphoribosylanthranilate isomerase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004640 -
                     phosphoribosylanthranilate isomerase activity [Evidence
                     IDA] [PMID 3286643]; GO_function: GO:0004640 -
                     phosphoribosylanthranilate isomerase activity [Evidence
                     IMP] [PMID 348687]; GO_process: GO:0009073 - aromatic
                     amino acid family biosynthetic process [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]; GO_process: GO:0000162 -
                     tryptophan biosynthetic process [Evidence IEA,IEA];
                     GO_process: GO:0000162 - tryptophan biosynthetic process
                     [Evidence IMP] [PMID 10790693]; GO_process: GO:0000162 -
                     tryptophan biosynthetic process [Evidence IDA] [PMID
                     3286643]; GO_process: GO:0000162 - tryptophan biosynthetic
                     process [Evidence IMP] [PMID 348687]; GO_process:
                     GO:0006568 - tryptophan metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="phosphoribosylanthranilate isomerase TRP1"
                     /protein_id="XP_018736902.1"
                     /db_xref="GeneID:30033879"
                     /translation="MADIAIFNDKARCPVDEQRRIFSQSRNCTPSSPFIVGHLNHSHT
                     EPDDFIQFSQIGASVLVNCSGITLHNLAARNAINRLAVRPLLLWASESDKTQEYIVGE
                     EVEAAVTGSDGILYHSSDLFRNDNPETIDFAVSKFQQCKAQALSSIVTIENHNHLTAF
                     LSLPIKPTAVFTFDDKELAASVSSALQGSVAHVHLQTITDQNPYNPSNNNFSAIFIED
                     VQNIPKMDAHLVQVPTHSSSKSAKSTISTSITPSSSDNSPLVKVCGIKTVEAAIKALE
                     SGADMIGMILVPGRSRTVDFQDAKKISDAVHNYGRAPAILPSPSPVSQTSQPSRRLSV
                     ISSTTSLFQKATHLSNKDTSSLPNSLNSSSSTSISQHPGSPISRRGSTQTLLPPWPSL
                     TNIPSGASVFEVNSRIVRAKTKRRPAIVGVFQNQPLETILSLQHELDLDYVQLHGDEP
                     LEWCRIIPVPVIKRFTPNTDGFANSSLVGYHYISLLDGEIGGEGKLVDWSSAKSQVAL
                     GARFILAGGLNESNVASALQTEGVFGVDVSGGVETAGTKDLNKIERFVKTAKAVNL"
     gene            <137434..>138573
                     /gene="SUA5"
                     /locus_tag="AWJ20_2014"
                     /db_xref="GeneID:30033880"
     mRNA            <137434..>138573
                     /gene="SUA5"
                     /locus_tag="AWJ20_2014"
                     /product="Sua5p"
                     /transcript_id="XM_018878940.1"
                     /db_xref="GeneID:30033880"
     CDS             137434..138573
                     /gene="SUA5"
                     /locus_tag="AWJ20_2014"
                     /inference="similar to AA sequence:KEGG_Orthology:K07566"
                     /note="Protein involved in threonylcarbamoyl adenosine
                     biosynthesis; Sua5p and Qri7p are necessary and sufficient
                     for RNA t6A modification in vitro; null mutant lacks
                     N6-threonylcarbamoyl adenosine (t6A) modification in the
                     anticodon loop of ANN-decoding tRNA; member of conserved
                     YrdC/Sua5 family; binds single-stranded telomeric DNA and
                     null mutant has abnormal telomere length; GO_component:
                     GO:0005694 - chromosome [Evidence IEA]; GO_component:
                     GO:0000781 - chromosome, telomeric region [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA]; GO_function: GO:0003677 - DNA binding
                     [Evidence IEA]; GO_function: GO:0003725 - double-stranded
                     RNA binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016779
                     - nucleotidyltransferase activity [Evidence IEA];
                     GO_function: GO:0043047 - single-stranded telomeric DNA
                     binding [Evidence IDA] [PMID 19369944]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0006417 - regulation of translation
                     [Evidence IEA]; GO_process: GO:0006450 - regulation of
                     translational fidelity [Evidence IMP] [PMID 19884342];
                     GO_process: GO:0008033 - tRNA processing [Evidence IEA];
                     GO_process: GO:0000723 - telomere maintenance [Evidence
                     IMP] [PMID 19369944]; GO_process: GO:0070526 -
                     threonylcarbamoyladenosine biosynthetic process [Evidence
                     IDA] [PMID 23620299]; GO_process: GO:0070525 -
                     threonylcarbamoyladenosine metabolic process [Evidence
                     IMP] [PMID 19287007]; GO_process: GO:0070525 -
                     threonylcarbamoyladenosine metabolic process [Evidence
                     IMP] [PMID 21183954]"
                     /codon_start=1
                     /product="Sua5p"
                     /protein_id="XP_018736903.1"
                     /db_xref="GeneID:30033880"
                     /translation="MYTKVLPVDPESIRFDPDDINKPPSIASPSSTLDNLNEAVKILQ
                     TSHDPVAFPTETVYGLGASALDTESARAIYTAKNRPADNPLIIHVSSIEQLERRLLPA
                     GERVPEIYRGLINKFWPGPLTIILPVPDPTAISPVCTHGQSTFAVRLPANPVARALIS
                     LSDLPLAAPSANASTKPSPTQAQHVFTDLKGKIPLILDGGSSDIGVESTVVDGLSNPP
                     MLLRPGGVSIEQIREFGGPSWQNVVVGRATAKSDEVVRTPGMKYKHYSPRAPLTLFIG
                     CTEQQLIDYVIRSNPSSVGLLTTRHFNQKELAKTLRQLPGHITVHDKSLGQSGADISR
                     NLFASFREMDAKGVDLILVEGIDEQNEGLAIMNRARKAASTVISA"
     gene            complement(<138695..>141475)
                     /gene="PMR1"
                     /locus_tag="AWJ20_2015"
                     /db_xref="GeneID:30033881"
     mRNA            complement(<138695..>141475)
                     /gene="PMR1"
                     /locus_tag="AWJ20_2015"
                     /product="Ca(2+)/Mn(2+)-transporting P-type ATPase PMR1"
                     /transcript_id="XM_018878941.1"
                     /db_xref="GeneID:30033881"
     CDS             complement(138695..141475)
                     /gene="PMR1"
                     /locus_tag="AWJ20_2015"
                     /inference="similar to AA sequence:KEGG_Orthology:K01537"
                     /note="High affinity Ca2+/Mn2+ P-type ATPase; required for
                     Ca2+ and Mn2+ transport into Golgi; involved in Ca2+
                     dependent protein sorting and processing; D53A mutant
                     (Mn2+ transporting) is rapamycin sensitive, Q783A mutant
                     (Ca2+ transporting) is rapamycin resistant; Mn2+ transport
                     into Golgi lumen appears to be required for rapamycin
                     sensitivity; mutations in human homolog ATP2C1 cause
                     acantholytic skin condition Hailey-Hailey disease;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IDA]
                     [PMID 24124599]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IDA] [PMID 9092527]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0005509 - calcium
                     ion binding [Evidence IDA] [PMID 10545175]; GO_function:
                     GO:0005388 - calcium-transporting ATPase activity
                     [Evidence IEA,IEA]; GO_function: GO:0005388 -
                     calcium-transporting ATPase activity [Evidence IDA,IMP]
                     [PMID 10545175]; GO_function: GO:0005388 -
                     calcium-transporting ATPase activity [Evidence IMP] [PMID
                     1379856]; GO_function: GO:0019829 - cation-transporting
                     ATPase activity [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0015410
                     - manganese-transporting ATPase activity [Evidence IDA]
                     [PMID 10801856]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_process:
                     GO:0070588 - calcium ion transmembrane transport [Evidence
                     IEA,IEA]; GO_process: GO:0006816 - calcium ion transport
                     [Evidence IEA,IEA]; GO_process: GO:0006816 - calcium ion
                     transport [Evidence IDA,IMP] [PMID 10545175]; GO_process:
                     GO:0006812 - cation transport [Evidence IEA]; GO_process:
                     GO:0006874 - cellular calcium ion homeostasis [Evidence
                     IGI] [PMID 23569283]; GO_process: GO:0006887 - exocytosis
                     [Evidence IGI] [PMID 1379856]; GO_process: GO:0006811 -
                     ion transport [Evidence IEA]; GO_process: GO:0006828 -
                     manganese ion transport [Evidence IDA] [PMID 10801856];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ca(2+)/Mn(2+)-transporting P-type ATPase PMR1"
                     /protein_id="XP_018736904.1"
                     /db_xref="GeneID:30033881"
                     /translation="MSEKSSNGRVETGPTPIANGQLPAATYCSLSSEETAARLHTSLT
                     VGLESSQDVNYRKSVHGPNELTGQEQDSLGIRFLQQFYENPLILLLIGSAAISFIMGN
                     IDDAVSITVAIFIVVTVGFVQEYRSEQSLEALNKLVPPSCHLTRGNHSSTVLASNLVP
                     GDLVHFSVGDRIPADVRITEAAGLSIDESNLTGEPHPVHKDIQEVKTESPLGTIPVSD
                     RTCIAFMGTLVCAGNGSGIVVGTGHNTEFGSVFEMMAEIDKPKTPLQISMDKLGKELS
                     LMSFGVIGMICLIGVIQGRSWLDMFQIGVSLAVAAIPEGLPIIVTVTLALGVLRMAEE
                     KAIMRRLPSVETLGSVNVICSDKTGTLTKNRMTVTKLWTVGMGSTSKSWLTIDSHSTV
                     NELTHHVTDNPALPVMLQVGNFCNNTRTSEETGKHIGNPTDVALIDVLDKFGLEDARN
                     TRTRVSETPFSSSRKWMAVSAHSGDATNSTVYVKGAVERILPLCKKYVDAKGKPNGTI
                     DEKSSKAINDVATTMALEGVRILAFAYSLKPSQDTENLQDLVFAGLIGMYDPPRPGVN
                     NSINRLMQGSVKVIMITGDSEATASTIAKQIGMPLNGERSVMTGETLERLSTKELAEA
                     ISYVTVFARTSPENKLNIVRALQARGDVVAMTGDGVNDAPALKLADIGISMGESGTDV
                     AKEAADMVLVDDDFNTILNAIKEGKAIFSNIQNFLAFQLSTSVAALTLVVLSTLFKLP
                     NPLNAMQILWINILMDGPPAQSLGVEPVDPVVMTKPPRSRNDHVLTRSLVQRVFQSGL
                     LIVFGTLFVYVREMSDNVVTARDTTMSFTCFVFFDMFNALSCRSTTKSVLEIGLFSNK
                     MFNFAVGFSLLGQMAVIYVPFFQAIFQTEALYLSDLILLIALSSSVLIVDEIRKHYVR
                     KNEWMSRYSNAV"
     gene            <140253..>140750
                     /locus_tag="AWJ20_2016"
                     /db_xref="GeneID:30033882"
     mRNA            <140253..>140750
                     /locus_tag="AWJ20_2016"
                     /product="unintegrated signal peptide"
                     /transcript_id="XM_018878942.1"
                     /db_xref="GeneID:30033882"
     CDS             140253..140750
                     /locus_tag="AWJ20_2016"
                     /codon_start=1
                     /product="unintegrated signal peptide"
                     /protein_id="XP_018736905.1"
                     /db_xref="GeneID:30033882"
                     /translation="MTGSAGLSVTWCVSSLTVLWESIVSHDFDVEPMPTVHSLVTVMR
                     FLVKVPVLSLQITLTDPRVSTLGRRRIIAFSSAIRSTPSANVTVTIIGNPSGIAATAN
                     DTPIWNMSNHERPWITPIKQIIPMTPKLIKESSLPSLSMEICNGVLGLSISAIISNTL
                     PNSVL"
     gene            complement(<142679..>145846)
                     /gene="MET10"
                     /locus_tag="AWJ20_2017"
                     /db_xref="GeneID:30033883"
     mRNA            complement(<142679..>145846)
                     /gene="MET10"
                     /locus_tag="AWJ20_2017"
                     /product="sulfite reductase subunit alpha"
                     /transcript_id="XM_018878943.1"
                     /db_xref="GeneID:30033883"
     CDS             complement(142679..145846)
                     /gene="MET10"
                     /locus_tag="AWJ20_2017"
                     /inference="similar to AA sequence:KEGG_Orthology:K00380"
                     /note="Subunit alpha of assimilatory sulfite reductase;
                     complex converts sulfite into sulfide; GO_component:
                     GO:0009337 - sulfite reductase complex (NADPH) [Evidence
                     IDA] [PMID 6751400]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016903 - oxidoreductase activity, acting on the
                     aldehyde or oxo group of donors [Evidence IEA];
                     GO_function: GO:0004783 - sulfite reductase (NADPH)
                     activity [Evidence IEA]; GO_function: GO:0004783 - sulfite
                     reductase (NADPH) activity [Evidence IDA] [PMID 6751400];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0019344 - cysteine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0070814 - hydrogen sulfide biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0009086 - methionine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]; GO_process: GO:0000103 - sulfate assimilation
                     [Evidence IMP] [PMID 19236486]; GO_process: GO:0000103 -
                     sulfate assimilation [Evidence IMP] [PMID 7928966]"
                     /codon_start=1
                     /product="sulfite reductase subunit alpha"
                     /protein_id="XP_018736906.1"
                     /db_xref="GeneID:30033883"
                     /translation="MSPSIDEKSDRVTNGQAKISGPFPISGDIMTLEGSFYASAQLLI
                     QQIAYSLSESIFSYSPEDFDLDSAVSEWSKFGQKSAKGITPQLHKLESRIGAASVLLG
                     YLYNRGGINSEVQTVLASSATLEYMKPVLAQFALEEDYKTPLVFQIAAVDYATETGKL
                     VTDYLPAAHISRDLGLGLISSLSVNDAQHIALLATALSRVLPTIHVYEGVRGVRETSR
                     TNNVLDAVDVSNKYDAIKASEGSLSSKILSTFENLNASLGTSYRPFEYSGDANAETVI
                     VSFGSVEGVIASQVVQALPNVGAVNVRLYSPFLDQEFLRLLPSSTKKIIVLGQVENQG
                     QVDDSRVHSGLYSDVATSVLMKYGFNGSAPTVADAKYSRETVWTPTEVFELLNSSPSD
                     LISESTKQFTFWDVDTSKSATAAATLAHTLSLDPTVAVNYFSAHDNETLGGVVESSIR
                     VSHQPLEAPYPVQKADVVFVNDVKILNEYNVLENARNGATLLISSKHAAEEVEKVLNN
                     AAKKSIAEKKVRLSTVDYEAIGENPETLGRTQTMVQQIAFWKTAYPQLTLNEITTKIV
                     TANGVDTELVAATVASLIEKVAEIGLSSASVPEEWAKVDQTVELSSSFVYPTSFTANK
                     LAGTIEQELNVVPESLTWVDAAKKVTFKEAYGVQSELRPDLSVKNFVSKVQVNERVTP
                     ADYDRHIFHLELDITGTGLTYAIGEALGVHAPNSTEQVNEFIEWYGLDPHEIVSIPAR
                     EDGDVYEEAKTTYHVLKDNLDIFGKPPKKFYESLATYATNPKEKSHLEKLASAEGAAE
                     LKKRAEEDFDTYADILHEFSSAHPTIAQLVEIVAPLKRREYSIASSQKVHPNAVHLLI
                     VVVDWVDSRGRKRFGQCSKFLSGLSAGDEVVVSVKPSVMKLPHDTKAPIIMSGLGTGL
                     APFKAFLEEKAWQKAQGYEIGDIYLFLGSRHQRQEYLYGELFEAYKNAGILTYIGAAF
                     SRDQPQKIYIQDRIKQAKEKLIDAFVTKGGSFYLCGPTWPVPDISGALADIVATEAAT
                     RGETIDAAREIENLKEQERYILEVY"
     gene            <148020..>150236
                     /gene="VID28"
                     /locus_tag="AWJ20_2018"
                     /db_xref="GeneID:30033884"
     mRNA            <148020..>150236
                     /gene="VID28"
                     /locus_tag="AWJ20_2018"
                     /product="glucose-induced degradation complex subunit
                     VID28"
                     /transcript_id="XM_018878944.1"
                     /db_xref="GeneID:30033884"
     CDS             148020..150236
                     /gene="VID28"
                     /locus_tag="AWJ20_2018"
                     /note="GID Complex subunit, serves as adaptor for
                     regulatory subunit Vid24p; protein involved in
                     proteasome-dependent catabolite degradation of
                     fructose-1,6-bisphosphatase (FBPase); localized to the
                     nucleus and the cytoplasm; GO_component: GO:0034657 - GID
                     complex [Evidence IDA] [PMID 16872538]; GO_component:
                     GO:0034657 - GID complex [Evidence IDA] [PMID 18508925];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0030437 -
                     ascospore formation [Evidence IMP] [PMID 12586695];
                     GO_process: GO:0045721 - negative regulation of
                     gluconeogenesis [Evidence IMP] [PMID 12686616];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 12586695]; GO_process: GO:0043161 -
                     proteasome-mediated ubiquitin-dependent protein catabolic
                     process [Evidence IMP] [PMID 12686616]; GO_process:
                     GO:0043161 - proteasome-mediated ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 15358789];
                     GO_process: GO:0007039 - vacuolar protein catabolic
                     process [Evidence IMP] [PMID 15358789]"
                     /codon_start=1
                     /product="glucose-induced degradation complex subunit
                     VID28"
                     /protein_id="XP_018736907.1"
                     /db_xref="GeneID:30033884"
                     /translation="MIPTNSIRDQLRATDESTQLTGLKRLKNTIIGHTDQKELLCTDD
                     VINPLLSLLANGPLSVSLQASIVLGSFAHGSESTVQKLLRYPVIQTVITTINSVVCPD
                     VGTNEVLSPSPELISSCLRILVTILQAQPAVGVIAQYPEIIDILTILLSGDDCPSDIV
                     LQTCKLIPLLSPRKTASLTRLPSLAPYLLKRISNHMAQGGHRTQLVSRNSPLEAALSA
                     VSQILTEKQARSVLELTASNVISINSKAPAFSESSNDFLLGLVHLTRADDIGIRLTAV
                     ELLSKLQNYASSPVQRDIIARNLLPTLVPMFDLLGTDPRVSLTLSYICRDNEKHASLA
                     VEIGLVKKIITVLKAKDIASWKDREIIENNLYALAGIGIHRDSLRMEIVEAGALTYIT
                     NIISLKPAAESSSADISSIRKVKISACHVLRALSRSVALIRTSLASTDIVDGIVDLYT
                     ESEPSPELNDGIMSDESSFEVIEREQQREDQLEVRTAVMAAICNLILEFSPVQKTIFE
                     KGALDLIIDGAHSDYASLRLNSIWALKHAIFEANRDTKSMALSKLEPSYLLRLCNDSI
                     IEIQEQSLDFIRNFLCRNYQGVDYIFESIGKETLFELIEDKIDLHEQFPQVLTPAIYI
                     LVHIAAGTDEHRDIVAEQESVLSKLIPLMTHPLADVRTAIVWLIINLTWLEEPDNSPR
                     REVCKIRAERLARLGFKDMLDKLSQDPTLDVRERTKTALYQFDELFGRGSSNYVVS"
     gene            complement(<150344..>153412)
                     /locus_tag="AWJ20_2019"
                     /db_xref="GeneID:30033885"
     mRNA            complement(<150344..>153412)
                     /locus_tag="AWJ20_2019"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878945.1"
                     /db_xref="GeneID:30033885"
     CDS             complement(150344..153412)
                     /locus_tag="AWJ20_2019"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736908.1"
                     /db_xref="GeneID:30033885"
                     /translation="MITLSNKFYREHDGSTAKNTKTPITTSLTIDQVLENESEVKLGG
                     KVKTKLHLFRLARLVKQIPTSPPSFTTHSRCAPASASTSNGSSVITSPQPDRVSNADN
                     ISSQTNHPPPSSLDDIQIPAVPCAPSTGINIYRSAPSPLPIFRSLKAGRNKEDRPTSS
                     DTKYYQQPNSYPGKFNRQQSDHTVQRSIDSVTCAKTAKHCSTKEELDVLGCSSHNRIG
                     ADDCIICTCTLVTSRSCGTTNPDHNVSRLDTQSNIVNNNKNTTFNSNNNSVNRNSDKD
                     KQQNPKTLLEFTERKSADTFPSSHPTLYNFPIKPTVDTSKVHGSPNSSVAVGNPIQTM
                     TSVGKGGFLLSSGPLKRGSRKGSGLGSGSGSTTKTASSTGFQVPTSSSNDVGSIGTGS
                     SGTTLPPSSPPQPSSPNAGSRPESKSLQRSKDTARMAALLMNLRYADETSNISDYGTT
                     LPTDTRVTGSPLTSNGKLMASSLAPSNSHVPKGAPLPLLDTSFGSSHMSHPGSSSPIS
                     NANLDSVTGSNHPPSPTVISSTTRARAIRAKARLELQYEMISEYQTGRRRNVMHFPEE
                     PDENKHDVESSDHVKTSENDNNVPSLGDRVKEKYTYNPLQVIRNRVAKKEQGNGYLHY
                     IVNNTAWNFYWHVDVSELVSDYAWRIRYGGNMRDREGKLLYPDRYKPDIRQDQDNDTS
                     GANTSGTGVSDPNNLSTSASKGEELIQRIKSKLSSRPPSGINSNENSDSSWSRSDISD
                     LEDNRANHRRENRQSTSSSRRNSESPTRKVPFESVNNKGRYSTSASQRKLSISNVPLA
                     VDETAADDSLLLEPTKNFAEADQSALTAKRVTPTSVSSTSLPSEQQQDKLAYYANELR
                     YLDMVYELSYLQISRKPYWYVENLNQDTAESMSTEMMALTKQFEGELIPKERQYLANT
                     EQEMRKLQFDLTQDYGSRLDSVLLDSDRILNEVNTSLSLEIRKVGMRLDKLEANAPTL
                     QWMWKLAYMLLEWLLVAFMWLAWGVVVGMRQLRRLVALVYGIVKWLLWCS"
     gene            <154317..>154637
                     /gene="TRS20"
                     /locus_tag="AWJ20_2020"
                     /db_xref="GeneID:30033887"
     mRNA            <154317..>154637
                     /gene="TRS20"
                     /locus_tag="AWJ20_2020"
                     /product="Trs20p"
                     /transcript_id="XM_018878947.1"
                     /db_xref="GeneID:30033887"
     CDS             154317..154637
                     /gene="TRS20"
                     /locus_tag="AWJ20_2020"
                     /note="Core component of transport protein particle
                     (TRAPP) complexes I-III; TRAPP complexes are related
                     multimeric guanine nucleotide-exchange factors for the
                     GTPase Ypt1p, regulating ER-Golgi traffic (TRAPPI),
                     intra-Golgi traffic (TRAPPII), endosome-Golgi traffic
                     (TRAPPII and III) and autophagy (TRAPPIII); mutation of
                     conserved residues leads to defects in endocytic recycling
                     and a block in sporulation/meiosis; mutations in the human
                     homolog cause the spondyloepiphyseal dysplasia;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence
                     IEA,IEA]; GO_component: GO:1990070 - TRAPPI protein
                     complex [Evidence IDA] [PMID 11239471]; GO_component:
                     GO:1990071 - TRAPPII protein complex [Evidence IDA] [PMID
                     11239471]; GO_component: GO:1990072 - TRAPPIII protein
                     complex [Evidence IDA] [PMID 20375281]; GO_component:
                     GO:0005783 - endoplasmic reticulum [Evidence IEA,IEA];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0000407 - pre-autophagosomal structure
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006888 -
                     ER to Golgi vesicle-mediated transport [Evidence IEA];
                     GO_process: GO:0006888 - ER to Golgi vesicle-mediated
                     transport [Evidence IMP] [PMID 11239471]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IGI] [PMID 9564032]; GO_process: GO:0006914 -
                     autophagy [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA,IEA]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="Trs20p"
                     /protein_id="XP_018736909.1"
                     /db_xref="GeneID:30033887"
                     /translation="MASYYLAIIGTKDCPIYELEFGSYRQSGDGISKFPPEIKELSPF
                     ILHSSLDIVEDVQWTTNSLYLKSVDNFYSYMVSAFVTPGSKYTISGANLGVGPKFRLE
                     EPAD"
     gene            complement(<155042..>156616)
                     /locus_tag="AWJ20_2021"
                     /db_xref="GeneID:30033888"
     mRNA            complement(<155042..>156616)
                     /locus_tag="AWJ20_2021"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878948.1"
                     /db_xref="GeneID:30033888"
     CDS             complement(155042..156616)
                     /locus_tag="AWJ20_2021"
                     /inference="similar to AA sequence:KEGG_Orthology:K11560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736910.1"
                     /db_xref="GeneID:30033888"
                     /translation="MARPRKSDAGPNGSDVSGQPVPHTTSSNVEVTNPPKKKRGRPRK
                     SVSREEDDGFVFKRLDSESSLNSSTAKPVSSSKKVTTLKETVHLALEQAKSQSISSSR
                     SEPEKAKKIASKSSSSQKHSAHSSKENEKQKKRSQREHDHAHSKDSDKRQKLSKMRPR
                     DTTSGSAIATPPPSIPSSDNHDSQPGSYDDSIAGRTSTTQVLLHDQETPVIRRNQKLR
                     NQTTTGKRRSSLSNRGKRLSNIGNGYLADPHSDVDARDFSKHLDENLSDVQRLKQVLL
                     WCLKRNLEVHGEDLKRKRDQSTKSTSEELTALTIARQIFEEEVVKNLVDGKISIDWHS
                     RPENAGQANVKRIPNSLNVTAQNNLTAFQKRLEELEREKEELERNLQSVGKSRLSKER
                     LDNLIDDNILNTLDDQTRRLFLEYKSSSTPVLEPSIQLRSFRENLPNVEVGVTQLRDG
                     VHKIESITKAASIFIDKTMKKLSEAAAITYANNNSTQLVLTIPEANSDADRSESSLRT
                     PVSPHDILRAISRLES"
     gene            <158301..>159746
                     /locus_tag="AWJ20_2022"
                     /db_xref="GeneID:30033889"
     mRNA            <158301..>159746
                     /locus_tag="AWJ20_2022"
                     /product="Mitochondrial distribution and morphology
                     protein 34"
                     /transcript_id="XM_018878949.1"
                     /db_xref="GeneID:30033889"
     CDS             158301..159746
                     /locus_tag="AWJ20_2022"
                     /inference="similar to AA sequence:KEGG_Orthology:K17775"
                     /codon_start=1
                     /product="Mitochondrial distribution and morphology
                     protein 34"
                     /protein_id="XP_018736911.1"
                     /db_xref="GeneID:30033889"
                     /translation="MSFKFNWSFFNKDSLLDQTSEVFKVAMNKGIKPDIIIGDMAVDK
                     FELGTVPPSLEILEIGDLAEDKFRGIFKLEYAGDASLSIKTQVQANPLALLNAQSCRL
                     RGAFPKIVGAACPLELPLSIFISEFKLSAIVIIVFSMARGLTLVFQNDPLESVKVSST
                     FDSLPGIAEFLQQEVEARLRESLRDDIPEVLHKLSQEKLVSSNRSEGMKELMTHLQHT
                     PHSHRYSNAFAFTNDSSPIPDLFHGSDETVNGLHDLDASHSTLSIRADSMIPDCVTRS
                     TLASFEEDLKAKAAMEEDAQRLKYQARHKGSRRYSSTSSSTSLSELGAMSPIMDAYPR
                     LYRDVRPKKRVIKLSKTNSTISEPSTISPSTQLESPNITASTSTHCTPASPQSPPSRS
                     TPEMSPLHSNKGSPRERGRPKRRELSFASIRSPSPIDLDFRAVLEKQKQKENLSFTLN
                     GASEKTLSKWAINNQHQIFAPPKYEELREDL"
     gene            complement(<162624..>165347)
                     /gene="SSM4"
                     /locus_tag="AWJ20_2023"
                     /db_xref="GeneID:30033890"
     mRNA            complement(<162624..>165347)
                     /gene="SSM4"
                     /locus_tag="AWJ20_2023"
                     /product="E3 ubiquitin-protein ligase SSM4"
                     /transcript_id="XM_018878950.1"
                     /db_xref="GeneID:30033890"
     CDS             complement(162624..165347)
                     /gene="SSM4"
                     /locus_tag="AWJ20_2023"
                     /inference="similar to AA sequence:KEGG_Orthology:K10661"
                     /note="Ubiquitin-protein ligase involved in ER-associated
                     protein degradation; located in the ER/nuclear envelope;
                     ssm4 mutation suppresses mRNA instability caused by an
                     rna14 mutation; GO_component: GO:0000837 - Doa10p
                     ubiquitin ligase complex [Evidence IDA] [PMID 16873066];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0030176 -
                     integral component of endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 11641273]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005635 -
                     nuclear envelope [Evidence IDA] [PMID 11641273];
                     GO_component: GO:0005637 - nuclear inner membrane
                     [Evidence IEA]; GO_component: GO:0005637 - nuclear inner
                     membrane [Evidence IDA] [PMID 17051211]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_function:
                     GO:0016874 - ligase activity [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004842 - ubiquitin-protein transferase
                     activity [Evidence IDA] [PMID 11641273]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0030433 - ER-associated ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 11641273];
                     GO_process: GO:0030433 - ER-associated ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 15252059];
                     GO_process: GO:0016567 - protein ubiquitination [Evidence
                     IEA]"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase SSM4"
                     /protein_id="XP_018736912.1"
                     /db_xref="GeneID:30033890"
                     /translation="MIVREWILLNDAFVRDLQMAGNAPVGNIANAIHNNNAQMVPQLR
                     IPNPRIEAVRAVDENPLDIELDRLRADFGAFDAPQAERANGENVALEGRDQNVENANA
                     IANDNANGRDGRIHRPQDFALPVNVREDDFFFGGVDDEPEDLGEVGEVEGIRDIIGLK
                     GPIVNAFATCAAATVLSAIALACLYLLPYATGRLVVILLGESVSPILKFYKQTLESQV
                     TWVNNIFFVFASFIDTRILASNPDFSLVKFHEAVKDLTFNLINGIPSSVNSSIMIRAS
                     ITSRLLLTFLGYSISGTFLAAFISNSNLTASRTGRDMLRVLKEMGAICKVITVIGIEL
                     VLFPIFCGLLLDFSLLPLFETASIADQVNFAVKYPVISTILHWALGTCYMFIFAMFVS
                     LCRKIMRPGVLYFVRDPNDPNFHPIKDVLDRGLMSQLAKIGLSALIYGALIVLCLGGV
                     IYTLRYLNVEFLPVSFVSTTREHIVIMIPFCAAYFLTLPIFIRTVRNLSVMRKIWAYA
                     FESSCSYLRLSSFILNKPVPQEQGTVHYGSIAAWFMSSKPDYSRPVTIDDIAKNGKWD
                     GAYFVKDGGFVRAPDTDSISSKKKLNLFIPVTKDDVRLDGVEEGSESNELEKYSVVYR
                     PPHFRIRIALLLCCIWGYGALVVMSMILIPIYTGHVMSQFLLHPIFKDMCDVFQFILG
                     SIPLFILFYTADNWDRVKEKFLNEYNQLRQSPLASSEAASGIVHLFKLLFSILVCLVV
                     PTAIGGILDLYISSPLYHVLSSEIVYSKSMLTKFISGVLSILLAKNVVMQHAPNSSLA
                     RSFRALSENGWIGYQNPMAATKLLLPLMSILGLAAICPPFLCWALLKIWYHDVSPETQ
                     ARMYVFCYPVLVVWIALDLAIYSVRTAIKLWVTKARDDIYLVSRQLENLEH"
     gene            complement(<165903..>166142)
                     /gene="SSM4"
                     /locus_tag="AWJ20_2024"
                     /db_xref="GeneID:30033891"
     mRNA            complement(<165903..>166142)
                     /gene="SSM4"
                     /locus_tag="AWJ20_2024"
                     /product="E3 ubiquitin-protein ligase SSM4"
                     /transcript_id="XM_018878951.1"
                     /db_xref="GeneID:30033891"
     CDS             complement(165903..166142)
                     /gene="SSM4"
                     /locus_tag="AWJ20_2024"
                     /inference="similar to AA sequence:KEGG_Orthology:K10661"
                     /note="Ubiquitin-protein ligase involved in ER-associated
                     protein degradation; located in the ER/nuclear envelope;
                     ssm4 mutation suppresses mRNA instability caused by an
                     rna14 mutation; GO_component: GO:0000837 - Doa10p
                     ubiquitin ligase complex [Evidence IDA] [PMID 16873066];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0030176 -
                     integral component of endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 11641273]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005635 -
                     nuclear envelope [Evidence IDA] [PMID 11641273];
                     GO_component: GO:0005637 - nuclear inner membrane
                     [Evidence IEA]; GO_component: GO:0005637 - nuclear inner
                     membrane [Evidence IDA] [PMID 17051211]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA]; GO_function:
                     GO:0016874 - ligase activity [Evidence IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004842 - ubiquitin-protein transferase
                     activity [Evidence IDA] [PMID 11641273]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0030433 - ER-associated ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 11641273];
                     GO_process: GO:0030433 - ER-associated ubiquitin-dependent
                     protein catabolic process [Evidence IMP] [PMID 15252059];
                     GO_process: GO:0016567 - protein ubiquitination [Evidence
                     IEA]"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase SSM4"
                     /protein_id="XP_018736913.1"
                     /db_xref="GeneID:30033891"
                     /translation="MDLTSPTKDQESPGYSDHGEPSSDTNSQSSLPQSSSINEHVEPP
                     DDDTCRICRGEASEEEPLYHPCKCSGSIKYVHQDW"
     gene            <167427..>169031
                     /gene="TRM2"
                     /locus_tag="AWJ20_2025"
                     /db_xref="GeneID:30033892"
     mRNA            <167427..>169031
                     /gene="TRM2"
                     /locus_tag="AWJ20_2025"
                     /product="Trm2p"
                     /transcript_id="XM_018878952.1"
                     /db_xref="GeneID:30033892"
     CDS             167427..169031
                     /gene="TRM2"
                     /locus_tag="AWJ20_2025"
                     /inference="similar to AA sequence:KEGG_Orthology:K15331"
                     /note="tRNA methyltransferase; 5-methylates the uridine
                     residue at position 54 of tRNAs and may also have a role
                     in tRNA stabilization or maturation; endo-exonuclease with
                     a role in DNA repair; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0008173
                     - RNA methyltransferase activity [Evidence IEA];
                     GO_function: GO:0030697 - S-adenosylmethionine-dependent
                     tRNA (m5U54) methyltransferase activity [Evidence
                     IEA,IEA]; GO_function: GO:0051908 - double-stranded DNA
                     5'-3' exodeoxyribonuclease activity [Evidence IDA] [PMID
                     17205207]; GO_function: GO:0008168 - methyltransferase
                     activity [Evidence IEA]; GO_function: GO:0000014 -
                     single-stranded DNA endodeoxyribonuclease activity
                     [Evidence IDA] [PMID 17205207]; GO_function: GO:0030696 -
                     tRNA (m5U54) methyltransferase activity [Evidence IDA,IMP]
                     [PMID 10864043]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0006281 - DNA
                     repair [Evidence IGI,IMP] [PMID 17205207]; GO_process:
                     GO:0001510 - RNA methylation [Evidence IEA]; GO_process:
                     GO:0006396 - RNA processing [Evidence IEA]; GO_process:
                     GO:0006302 - double-strand break repair [Evidence IGI,IMP]
                     [PMID 17534700]; GO_process: GO:0032259 - methylation
                     [Evidence IEA]; GO_process: GO:0006400 - tRNA modification
                     [Evidence IDA] [PMID 10864043]; GO_process: GO:0008033 -
                     tRNA processing [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Trm2p"
                     /protein_id="XP_018736914.1"
                     /db_xref="GeneID:30033892"
                     /translation="MTDTGLIQANSKVTAEPVVNNDKIHPRSPSLDPTPLKKQKRVKT
                     KRYREPPVDPISAEGVLINDIRALLKSQGISEDEITNDMKAFFSRDKSVPYPDYQVVE
                     LKISALSSVGNGIGIWESPDPEAPSSIRKRVVVVPYALVGETVKTKIYRTNKYYYESE
                     LNEVVDKSPLRDDALVRCKYFTTCSGCQYQMLPYDEQLKIKREVIVNAYAHYAPLLTS
                     DDVPSILDTVGSPEQYNYRTKLTPHFDVPRKGRLERIPPIGFGVKGRKEVLDIEECVI
                     GTPVINKGMVEQRKVVHENFASYKRGATILLRENIKEIEDSPSTVVCTTDSKEIVTEY
                     VGDFKFKYPAGSFFQNNNSILPSVTSYVRDNIVLPSSGKPPKYLVDTYCGSGLFGITC
                     STAVEQLIGVEISKDSVEYAQKNAELNNLKNASFIVGEAEKIFDKVSDAPLETSIIID
                     PPRKGCDKQFLDQLLEFRPAKVVYVSCNVHSQARDIEYLLKSEVARDRSSNSGNKYII
                     DSIRGFDFFPQTHHVESVAVLSLKNN"
     gene            complement(<175785..>177227)
                     /locus_tag="AWJ20_2027"
                     /db_xref="GeneID:30033893"
     mRNA            complement(<175785..>177227)
                     /locus_tag="AWJ20_2027"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878953.1"
                     /db_xref="GeneID:30033893"
     CDS             complement(175785..177227)
                     /locus_tag="AWJ20_2027"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736915.1"
                     /db_xref="GeneID:30033893"
                     /translation="MFLKYDPDTDLLKLDLEQIPVFLHIRLAQLVLESLNCFIVVARY
                     GSEELKSQMYQLDPNLVLEWRTNFAEILELRKAVQVYEEKSNAFGLSRVLWNKQSDLT
                     PRSVDVDTVNFFDVPSQYPSIPSINASLDRADRSHKGDIVEKIVDGTLFGTLREARDD
                     ELPIEMVAQLSFAPIIRTQWKLANKLVMRIFKGEQDIVDHARLIEQTYFLANGELAIR
                     LEERIFGTTTQGGLALDAQHFGMEISGSWQPTSLEINSCLSGVLEDVIRKLPGVCNEV
                     RQAGFINFGFSEKNRQQSNLFATSVLKLTYRVPKPLSLIFNSKAIYYLDKIFQRLIMG
                     LRLTHWLKMKRHGVYCVQNQQLRNFISCSLSSINLAIRNIWEALINKLVVMNVEEETS
                     LEQVISEVTTALDRIFTNMISGPEEELLFSIYSVVFEPTTDDDKLRKLIVQLISQLQK
                     QTIQANTDALIFTRIFTDQLQFSGFYERND"
     gene            complement(<178693..>178766)
                     /locus_tag="AWJ20_2028"
                     /db_xref="GeneID:30033894"
     tRNA            complement(<178693..>178766)
                     /locus_tag="AWJ20_2028"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:30033894"
     gene            complement(<178914..>179924)
                     /locus_tag="AWJ20_2029"
                     /db_xref="GeneID:30033895"
     mRNA            complement(<178914..>179924)
                     /locus_tag="AWJ20_2029"
                     /product="Bifunctional purine biosynthesis protein purH"
                     /transcript_id="XM_018878954.1"
                     /db_xref="GeneID:30033895"
     CDS             complement(178914..179924)
                     /locus_tag="AWJ20_2029"
                     /codon_start=1
                     /product="Bifunctional purine biosynthesis protein purH"
                     /protein_id="XP_018736916.1"
                     /db_xref="GeneID:30033895"
                     /translation="MPKPIRLTASKSSRINKPSVGKKPALPLMPSDIAFLKDFDEKKS
                     LRQARSKAQQEKLQDDGPAELEWQLQVSTIPDIVKSMRIVLDRMWAPIPEKGLGREGR
                     GDVYHFRKSIPPLVRTTHLYAIYPDNSTYVDREIRTACEDGTVRRLVVNLVEGSDLLI
                     ESTHYYAILDEQVRKYEESLSKSEDEGSKVVTSAIVKALKIFKKLLIKNPTAISLSLS
                     ELEDVDLAKLRNNLLSLGFLTLQSGQMDSFVISVPNIGSYLRLVASSRKWIIRNLDKM
                     SWKELLESTLQERWESNKTYWYDFKGCLLEWVLYDCFGGGWCEPFKTPVGRGWKLTGK
                     KG"
     gene            <180932..>183247
                     /locus_tag="AWJ20_2030"
                     /db_xref="GeneID:30033897"
     mRNA            <180932..>183247
                     /locus_tag="AWJ20_2030"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878956.1"
                     /db_xref="GeneID:30033897"
     CDS             180932..183247
                     /locus_tag="AWJ20_2030"
                     /inference="similar to AA sequence:KEGG_Orthology:K01127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736917.1"
                     /db_xref="GeneID:30033897"
                     /translation="MEDWIHEFEKADKQDKGQVNIGPRSIDSVVRNLKMNAFQRVLNA
                     FKYKERGRVHNSGAKDESDNELALKAFIFGILTHQVADISWHSLGIQQGLLRMLANRE
                     FNGDVAEAHSVLDTGGDMIYVRRMLQSGLNLDWIQGEWKYPTADILEIISRAGYSVTS
                     SQLDYCMFRGKAALGAELQLAVSAFAPYAQRSPLLFEHIDDYFLGGVTEMSTATRHCS
                     YSLAEWFANQTTPADPWSVCEVYEGMKGKSYRNSNFLYENETLPTEDYTTQSTPYLDI
                     PLAQSISSDTKLEISAHQNIFGDSDSKVLAELATVISTGVPNGAFGTSLTIGKFLNDE
                     LCLAISAPYESVTFGFGRTAKEVPKGSVYVVELSQLVVSNNNIAVKTPAKMITLEMPE
                     EGPPYQFNERFGAKMTKITLAGFDVLIVSRPGTSRLSFFLENRNIFNIHWGSASVKYG
                     SFGDKLAGESLVVGDVDGDGIDDLVVGSPYSDISGRPQAGEVHVINGLSLQSIFSVAV
                     ESRSRVPLEFDIKDVAEIVLHLPSLTSSPGYSLFGSKVAVVSRGSTNYLLIGAEGVGK
                     VFAFDSKKDFKYVFVLSSNVNTGANFGGKLLVGNNDGWIAVGSTTEDVHSDRTGRVKC
                     SQCGAIYLFRIKEIGVIEDLSLYNSTDELTAYEQGYLGFKTRKGMESGSFSRFGHEGT
                     IIDKYLYTSSPFGQNERGQVWRLDLSKHGKGNFELLIEESPWPYSNGFGTSLAGIQQN
                     GETFLASGMPYYGTNERGWLQGAVALYHLKD"
     gene            <186176..>188560
                     /gene="SUL1"
                     /locus_tag="AWJ20_2031"
                     /db_xref="GeneID:30033898"
     mRNA            <186176..>188560
                     /gene="SUL1"
                     /locus_tag="AWJ20_2031"
                     /product="Sul1p"
                     /transcript_id="XM_018878957.1"
                     /db_xref="GeneID:30033898"
     CDS             186176..188560
                     /gene="SUL1"
                     /locus_tag="AWJ20_2031"
                     /inference="similar to AA sequence:KEGG_Orthology:K14708"
                     /note="High affinity sulfate permease of the SulP anion
                     transporter family; sulfate uptake is mediated by specific
                     sulfate transporters Sul1p and Sul2p, which control the
                     concentration of endogenous activated sulfate
                     intermediates; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IMP,ISS] [PMID 7616962]; GO_function:
                     GO:0008271 - secondary active sulfate transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015116 - sulfate transmembrane transporter activity
                     [Evidence IEA]; GO_function: GO:0015116 - sulfate
                     transmembrane transporter activity [Evidence IGI,IMP]
                     [PMID 7616962]; GO_process: GO:1902358 - sulfate
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0008272 - sulfate transport [Evidence IEA]; GO_process:
                     GO:0008272 - sulfate transport [Evidence IGI,IMP] [PMID
                     7616962]; GO_process: GO:0055085 - transmembrane transport
                     [Evidence IEA]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IMP] [PMID 7616962]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Sul1p"
                     /protein_id="XP_018736918.1"
                     /db_xref="GeneID:30033898"
                     /translation="MSTGSDHLFSSSGNGANDEAEPSYISIPQYDEPPVSIKDFGREV
                     FADTPKKIKEYLLSLFPIIRWIYRYNFVWLYGDLIAGITVGAVLVPQSMSYAKIATLP
                     PQIGLYSSFVGVMIYCFFATSKDVSIGPVAVMSLQTSKAIAHVIHKHPEYANDPTYIA
                     LGLSLLCGAIALGIGLLRLGFILEYIPMPAVLGFMTGSAFTIAAGQVPGLMGISKLFN
                     TRDATHLVVIHTLQNLKHSNLDAAFGLVSLFILYFSRWLFAFLGKRYPKYERVFFFGS
                     VLRNAFVIIFSTLISWGICHHHKNPKKFPISVLGTVPRGLQNVGYHTIDQNLASALAP
                     ELPISTVILLMEHIAIAKSFGRVNDYRINPNQELIAIGTTNMIGTFFNAYPATGSFSR
                     SALKSKCGVRTPLAGIFTGIVVIVAIYGLTGTFYWISNASLSAVIIHAVTDLMAPWYV
                     TWKFWKSSPVETIVFLGAVFLSVFVSLESGIYFSFAACLVFLLLRISFPTGQFLGRVE
                     VVEYLNPNYSEANGAIEETSRIDNDPEDKKKYEVVRQTSSSGSANPKPTTVKKYTWVP
                     LNHHNINKDVLIQPPPPGVFVFRPGESFTFPNAARQLEILVQEVRKQTRKGGVQQHQL
                     TLGERPWNDHGPRHKVYDEGFVDERPLLRAVVFDFSASPHIDLNGVQALADIRQELNK
                     YANREVEYHFVGILSVWSRRALMAHSFGGDNSETRPERHYVEISLRQAAGVDGSATEA
                     VEEESKKKNKYRDEEERDTVSQLSNDGSYIPIIATNTPFFHLEIPNLEFPESRE"
     gene            complement(<188760..>189698)
                     /gene="YJU2"
                     /locus_tag="AWJ20_2032"
                     /db_xref="GeneID:30033899"
     mRNA            complement(<188760..>189698)
                     /gene="YJU2"
                     /locus_tag="AWJ20_2032"
                     /product="Yju2p"
                     /transcript_id="XM_018878958.1"
                     /db_xref="GeneID:30033899"
     CDS             complement(188760..189698)
                     /gene="YJU2"
                     /locus_tag="AWJ20_2032"
                     /note="Essential protein required for pre-mRNA splicing;
                     associates transiently with the spliceosomal NTC
                     ('nineteen complex') and acts after Prp2p to promote the
                     first catalytic reaction of splicing; GO_component:
                     GO:0071006 - U2-type catalytic step 1 spliceosome
                     [Evidence IDA] [PMID 17515604]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0000384 - first spliceosomal transesterification
                     activity [Evidence IDA] [PMID 17515604]; GO_process:
                     GO:0000349 - generation of catalytic spliceosome for first
                     transesterification step [Evidence IDA] [PMID 17515604]"
                     /codon_start=1
                     /product="Yju2p"
                     /protein_id="XP_018736919.1"
                     /db_xref="GeneID:30033899"
                     /translation="MGDRKTVNKYYPPDFDPSKITKKRKSIKESAAASLQTVRLMAPF
                     SMRCTTCGEFIYRGKKFNAKKQPTGESYLGIKIIRFYIRCPRCAGEIRFKTDPKIGDY
                     VTEQGAERNREPWREKAEEEEDLEQRLDRLEREEIEQQEREQLRKQYGIAGAVTAKKD
                     QNNPDADIMAELESKVLDSKREMEIQDELDAIRTRNARIEMAASGGGLLERAQEVVQS
                     AVVGKKKLEEEEDEEAARKAFKRTSDGVIIRQARPPDDTGPSATSTSNVSSTVPIKPT
                     VPNASLFNPTSVLKKPVKGGKKLNALGVVVKKKSLV"
     gene            <190962..>193301
                     /gene="TRK2"
                     /locus_tag="AWJ20_2033"
                     /db_xref="GeneID:30033900"
     mRNA            <190962..>193301
                     /gene="TRK2"
                     /locus_tag="AWJ20_2033"
                     /product="Trk2p"
                     /transcript_id="XM_018878959.1"
                     /db_xref="GeneID:30033900"
     CDS             190962..193301
                     /gene="TRK2"
                     /locus_tag="AWJ20_2033"
                     /note="Component of the Trk1p-Trk2p potassium transport
                     system; contributes to K(+) supply and maintenance of
                     plasma-membrane potential; TRK2 has a paralog, TRK1, that
                     arose from the whole genome duplication; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005886 - plasma membrane [Evidence TAS] [PMID
                     2072919]; GO_function: GO:0008324 - cation transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015079 - potassium ion transmembrane transporter
                     activity [Evidence IEA]; GO_function: GO:0015079 -
                     potassium ion transmembrane transporter activity [Evidence
                     IDA,ISS] [PMID 2072919]; GO_process: GO:0006812 - cation
                     transport [Evidence IEA]; GO_process: GO:0030007 -
                     cellular potassium ion homeostasis [Evidence IDA] [PMID
                     2072919]; GO_process: GO:0006811 - ion transport [Evidence
                     IEA]; GO_process: GO:0071805 - potassium ion transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006813 -
                     potassium ion transport [Evidence IEA]; GO_process:
                     GO:0042391 - regulation of membrane potential [Evidence
                     IMP] [PMID 21424545]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Trk2p"
                     /protein_id="XP_018736920.1"
                     /db_xref="GeneID:30033900"
                     /translation="MTFLCSIILYPGGNIRYIDALFIGAAGCTQAGLNTVQLNELYTY
                     QQIFLMIFPFLTTPIFIHSSVVFLRLHWFEKHFKDVKINSKIQSKLRRTATMARAESR
                     DHEIGLEPLKWNGEYSKRDSNPPVPTSNNTEEVSGLHVPPASDIRFGDLPQPRRQKSI
                     APQDMYKSINMMQRNRRLSNDLNDGPALVIKSPRVMDEENELKEKMRLAATVTGQNVD
                     SSPSSSGNASTEHESVDLGERIRPSISYAVSPERSNYDIDGIKLDRRSRTLSTSNVPN
                     ENQRSQHERTGSKASVTRGTRRFSRSRTLDRIFNRTLSNDGPTTKVMSTNYLSWQPTV
                     GRNSAFVDLTEEQKEELGGVEYRSLKLLAKVLVAYYMGFYLFGLVTFWPYASLRNLLK
                     DHFTSEGFTSTLWAWFTSVSAFSDTGFTLTPESMAFFQREAYIPLLSAFLIVIGNTGF
                     PVLLRFIIWIAFKFTPRFGRAHESLGFLLDHPRRCFTLLFPSSATWWLLAVLVILNSV
                     DLVLFLVLDLTSKAITEIPVGYRIVCGLFQAIATRTAGFTIVSMSDVHPAVRVSYVIM
                     MYISVLPIAISVRRTNVYEEQSLGVYYPENDGEDPEAKHHSYVGAHLKKQLYFDLWFI
                     CLGLFIICIAEGAKLDNNEFQIFDVLFEIVSAYGTVGLSMGAANTNLALSGAFNVIGK
                     LVIIALMIRGRHRGLPYALDRAIILQGDKIQRTDSIQETRTRNKRLMSMSIPINDDVG
                     LTTARSNDTGYMRERPGLRTETSTLDRFPSQAVSDGEDD"
     gene            <194218..>195855
                     /gene="TPO1"
                     /locus_tag="AWJ20_2034"
                     /db_xref="GeneID:30033901"
     mRNA            <194218..>195855
                     /gene="TPO1"
                     /locus_tag="AWJ20_2034"
                     /product="Tpo1p"
                     /transcript_id="XM_018878960.1"
                     /db_xref="GeneID:30033901"
     CDS             194218..195855
                     /gene="TPO1"
                     /locus_tag="AWJ20_2034"
                     /note="Polyamine transporter of the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; recognizes spermine, putrescine, and
                     spermidine; catalyzes uptake of polyamines at alkaline pH
                     and excretion at acidic pH; during oxidative stress
                     exports spermine, spermidine from the cell, which controls
                     timing of expression of stress-responsive genes;
                     phosphorylation enhances activity and sorting to the
                     plasma membrane; GO_component: GO:0033101 - cellular bud
                     membrane [Evidence IDA] [PMID 13679573]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IMP]
                     [PMID 11171066]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IDA] [PMID 12562762]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA,IMP] [PMID
                     15637075]; GO_function: GO:0015297 - antiporter activity
                     [Evidence IEA]; GO_function: GO:0015606 - spermidine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11171066]; GO_function: GO:0015606 - spermidine
                     transmembrane transporter activity [Evidence IDA,IMP]
                     [PMID 15637075]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11171066]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IDA,IMP]
                     [PMID 15637075]; GO_function: GO:0000297 - spermine
                     transmembrane transporter activity [Evidence IMP] [PMID
                     9920864]; GO_process: GO:1902047 - polyamine transmembrane
                     transport [Evidence IMP] [PMID 24136413]; GO_process:
                     GO:0015847 - putrescine transport [Evidence IMP] [PMID
                     9920864]; GO_process: GO:0015848 - spermidine transport
                     [Evidence IMP] [PMID 11171066]; GO_process: GO:0015848 -
                     spermidine transport [Evidence IDA,IMP] [PMID 15637075];
                     GO_process: GO:0015848 - spermidine transport [Evidence
                     IMP] [PMID 9920864]; GO_process: GO:0000296 - spermine
                     transport [Evidence IMP] [PMID 11171066]; GO_process:
                     GO:0000296 - spermine transport [Evidence IDA,IMP] [PMID
                     15637075]; GO_process: GO:0000296 - spermine transport
                     [Evidence IMP] [PMID 9920864]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tpo1p"
                     /protein_id="XP_018736921.1"
                     /db_xref="GeneID:30033901"
                     /translation="MSSGNSADASGIGDSSPNQSSRNSEEFPLDVEKVISVNGGFKKN
                     GEEQDPSPGPSHKQENADTDSNENTDLLDPRQYDENIFLVTFSKGDKENPQNWSLRKK
                     SLHTAFYGLTTFAAQFNSAVMSPTVPHLMDSFGISREVAILGTSLYVLGIAFGPSVFA
                     PYSEMNGRKMGVMLPFFISLIFTAGTASSDNISAILCTRFFAGFFAGAPVVSSGGVLA
                     DIWDPAIRGVALIFYAVFVTAGVTFGSILSSVVTSGSDTDWRWSCWLIVIIGGVILFF
                     DVILLSETYAPVILAKRASNLRINTHQWAYHAKHDEWKLDLKEFLTLHLLRPFAMFAT
                     PIVFCIAMFASFVFGVLYLVITSVPITFQITKGWEGTVATLPMVALFLGLITGSGLNV
                     WSGLRYAKLVRANNNKPLPEQRFPVMMMFGWLMPAGTFIFAWTLRPEIHWIVPMIGIY
                     LLGTGFIVIFQGCLNYLVDTFTRFAASAIAANTFVRSIFGGIFPLFGDTMFINLGVNW
                     GGSLVGFIALALTPIPYIFYLYGEKLRSRNPYSKLVS"
     gene            <197062..>199857
                     /gene="PBS2"
                     /locus_tag="AWJ20_2035"
                     /db_xref="GeneID:30033902"
     mRNA            <197062..>199857
                     /gene="PBS2"
                     /locus_tag="AWJ20_2035"
                     /product="mitogen-activated protein kinase kinase PBS2"
                     /transcript_id="XM_018878961.1"
                     /db_xref="GeneID:30033902"
     CDS             197062..199857
                     /gene="PBS2"
                     /locus_tag="AWJ20_2035"
                     /inference="similar to AA sequence:KEGG_Orthology:K11227"
                     /codon_start=1
                     /product="mitogen-activated protein kinase kinase PBS2"
                     /protein_id="XP_018736922.1"
                     /db_xref="GeneID:30033902"
                     /translation="MSVYHGTSNNDYLAVDRRESSSSSPMPPTPRPSISDQGCGSSVN
                     NDEGLTVSSNAGSSSVPLPLPSPGIVFSKQEDFEEYQTDSRQAQAYHNGVSANVALPR
                     TSSQAKPRQSQASANSLSRHTYNETYSSSMNSLNSFTSSTSNHLPPRVSSYNNSSTNI
                     SGLTRSTSSSAGSSSSSTPKPMLNSRSTSTGARFQRVNRQASHGNTISPDETIAEALS
                     AKLKSNLALSTSPSASPPPVSVASSPSLSTLSPSSANGTNSPALGSTPPTQWAASAIM
                     NGGIASVSPDVHARILTFQQSRQSRSNSGSNAALNFIPGSVPLLPNDGAPAGSPSSPN
                     LVGLTGGNMCTPQAIKDNLSRSSSSSSSSSYSNYSRTISSYSSPIVSPHPEDKGSEKL
                     PPARQLAQPLQLSQKTSNLQIKIPSTIEDSDGTDSGDDHGTANPTIESAATIVPSADS
                     SLNTPQSATQTGKPFSGALFINSVSQGTKIPTQRPSLSERRGLKLSDMSQPPPIPKLK
                     SHPLLPSTGTGRSTSLLDRRMQASAPAGLFPKWSGKLNMDPSSERATPNISGGEGDQA
                     NGADSGSGPGAQAPVVLRPPGVGGFNRQNSLFSNYKKYVDVKSGSLNFAGKASLHSKG
                     VDFSSGSSFRISIDEFEPMGELGRGNYGTVTKVLHKPTKVIMAMKEIRLELDETKFRQ
                     ILMELEILHKCDSPYIVDFYGAFFVEGAVYMCMEYMDGGSLNNIYQGGVEDRYLAIIT
                     DSVVRGLKKLKDEHNIIHRDVKPTNILVSTSGKVKLCDFGVSGNLVASIARTNVGCQS
                     YMAPERIRSKNPNEAITYTVESDIWSLGLSLIEIARGEYPYPADTHNSIYSQLMAILD
                     GEPPCLPDDKYSPEARAFVAQCLNKTARLRPSYAELLKHPWLVNIEQELAHSPTLEVE
                     FGAFVKRSVERNNHREN"
     gene            <200119..>201759
                     /gene="ANR2"
                     /locus_tag="AWJ20_2036"
                     /db_xref="GeneID:30033903"
     mRNA            <200119..>201759
                     /gene="ANR2"
                     /locus_tag="AWJ20_2036"
                     /product="Anr2p"
                     /transcript_id="XM_018878962.1"
                     /db_xref="GeneID:30033903"
     CDS             200119..201759
                     /gene="ANR2"
                     /locus_tag="AWJ20_2036"
                     /note="hypothetical protein; may have a role in lipid
                     metabolism, based on localization to lipid droplets;
                     predicted to be palmitoylated; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0005811 - lipid particle [Evidence
                     IDA] [PMID 24868093]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Anr2p"
                     /protein_id="XP_018736923.1"
                     /db_xref="GeneID:30033903"
                     /translation="MSGHPRKKLAIGAFLIKFDMRTGNSLIWSKSQPGIEIDWEGVEF
                     MAMPSGLHSRQSDVIRFVLSNPLERVTRTGSTRDRLLGDEAFGYLKNNIEGIAVFNQN
                     FHRGDATTTRINVRSTIQMYSLGVLCTKSDSEISSKCWGFVDILTELLTTFMNLNQDN
                     HQVHETLDFRPFESLLQYDDNGELQTLSLSPPRLSAKPLNLAPHHPILSTTELLVTYG
                     PLIFEIWKAALLRDKILLMDKSNSISVDDMCKFVYIISVFGTVPNDVFDLIPRNKQHS
                     LSTATNPIYNVNVSDITSLSHLKHFIATTTDEILLEKEYLYNMTVVKTGDRAIAATTS
                     TTDFYGNLNTMPISAGFHDKRRFQILISGLGIETPHHTSGQSILAHVCSNISSLFSLT
                     SLYGLLWWATAGEQANSDTDRYLEGLPLLTQTQVESSSHVAGQRASSYATESPYFNAI
                     SELSPPQPSATMEPWQISVIGYFQAKTRRIFETVASIVESQDQDQSETSLQTVISIEP
                     PDLMDMGLDPISLRDHEFVVKFISLWWGRPARVNHVCC"
     gene            complement(<201957..>204599)
                     /gene="LHS1"
                     /locus_tag="AWJ20_2037"
                     /db_xref="GeneID:30033904"
     mRNA            complement(<201957..>204599)
                     /gene="LHS1"
                     /locus_tag="AWJ20_2037"
                     /product="Hsp70 family chaperone LHS1"
                     /transcript_id="XM_018878963.1"
                     /db_xref="GeneID:30033904"
     CDS             complement(201957..204599)
                     /gene="LHS1"
                     /locus_tag="AWJ20_2037"
                     /inference="similar to AA sequence:KEGG_Orthology:K09486"
                     /note="Molecular chaperone of the endoplasmic reticulum
                     lumen; involved in polypeptide translocation and folding;
                     nucleotide exchange factor for the ER lumenal Hsp70
                     chaperone Kar2p; regulated by the unfolded protein
                     response pathway; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005788 -
                     endoplasmic reticulum lumen [Evidence IEA]; GO_component:
                     GO:0005788 - endoplasmic reticulum lumen [Evidence IDA]
                     [PMID 8654361]; GO_component: GO:0005788 - endoplasmic
                     reticulum lumen [Evidence IDA] [PMID 8887673];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IDA,IMP]
                     [PMID 19759005]; GO_function: GO:0016887 - ATPase activity
                     [Evidence IEA]; GO_function: GO:0000774 -
                     adenyl-nucleotide exchange factor activity [Evidence IDA]
                     [PMID 14704430]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0051082
                     - unfolded protein binding [Evidence IMP,IPI] [PMID
                     10409721]; GO_function: GO:0051082 - unfolded protein
                     binding [Evidence IGI,IMP] [PMID 8654361]; GO_function:
                     GO:0051082 - unfolded protein binding [Evidence IGI,IMP]
                     [PMID 8887673]; GO_process: GO:0006200 - ATP catabolic
                     process [Evidence IEA]; GO_process: GO:0008152 - metabolic
                     process [Evidence IEA]; GO_process: GO:0031204 -
                     posttranslational protein targeting to membrane,
                     translocation [Evidence IMP] [PMID 8654361]; GO_process:
                     GO:0031204 - posttranslational protein targeting to
                     membrane, translocation [Evidence IMP] [PMID 8887673];
                     GO_process: GO:0006986 - response to unfolded protein
                     [Evidence IGI,IMP] [PMID 8654361]; GO_process: GO:0006986
                     - response to unfolded protein [Evidence IGI,IMP] [PMID
                     8887673]"
                     /codon_start=1
                     /product="Hsp70 family chaperone LHS1"
                     /protein_id="XP_018736924.1"
                     /db_xref="GeneID:30033904"
                     /translation="MHIKLFKSTFLGFLFILFTSLQLIQCAVLGIDFGQEYTKGSLVA
                     PGAPFEVIMTSDSKRKDLSGITFKKAPGSGSGTFERIYGNSAAAVIQRFPATSPFYLK
                     PLLGQSLDSPAAKWYSEQFPAVKLVPSNNNRSTIAIQIFDDIYSVEEIVAMSFSEIKG
                     RASKVLTQALSGSSGYLKDTALSVPPYYSIQQRKALQDAVEIADLRLISLVNDGAAVA
                     ANFAASRQFENDKKEHHIIYDIGAGSTTATLVEIYQADLVPEGSPFPRSHTVIDVIGV
                     GYDTELGGHVLTQSVRNILIDKFLEANPKVKRNDLLNDHRALARFWREAERVKFVLSA
                     NSETQSSIESAYNDISLKTHVSRVEFEDANRHLFDKVPAPILDALNNPLNNSTEAFDF
                     SKVSSIILTGGSTRIPIVQQELLSLINARDPTEQVTLAKNVNADEAAVLGTALRGVGI
                     SKIFRSKDMAVIDRAIWDYSAEIDGEVATIFPRGTPLDSKFVLPFDSSKDDFKLVLYE
                     NGKEFVRHNINGVQSAIKRLLNDPHRECISNVSVEAEFHLSNSRIVELLGTYAKCESI
                     EKVVSTESSQQSSTSDSADVESSSETDNASSGTTSSATTASVSPTAKPPKVVKKSVSM
                     TNSFDGPRPMGSASKQSALSRLRALDRLDADRLSREEARNTFESRLYRVRELLESEES
                     AQQKLAEFGEWFDYDSEKASIKVLQEKLAELNALADSYNKETTVQQIELPKETGSVVE
                     PTMAGPEIILEPPVVQEQQPFENEKLADVYQGIKEVAEMLDQLGIDIPNREAVAQILG
                     GSTVPDSTSNLKGIAELLRSKLQAANLDGSEPADSGDVESRLNDLRHMIKKAADIIKT
                     ESSATPSVSISTSPSPKNPQHDDL"
     gene            <206591..>213319
                     /gene="URA2"
                     /locus_tag="AWJ20_2038"
                     /db_xref="GeneID:30033905"
     mRNA            <206591..>213319
                     /gene="URA2"
                     /locus_tag="AWJ20_2038"
                     /product="bifunctional carbamoylphosphate
                     synthetase/aspartate transcarbamylase"
                     /transcript_id="XM_018878964.1"
                     /db_xref="GeneID:30033905"
     CDS             206591..213319
                     /gene="URA2"
                     /locus_tag="AWJ20_2038"
                     /inference="similar to AA sequence:KEGG_Orthology:K11541"
                     /note="Bifunctional carbamoylphosphate
                     synthetase/aspartate transcarbamylase; catalyzes the first
                     two enzymatic steps in the de novo biosynthesis of
                     pyrimidines; both activities are subject to feedback
                     inhibition by UTP; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11015727]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IDA] [PMID
                     11921093]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0016597 - amino acid binding [Evidence IEA];
                     GO_function: GO:0004070 - aspartate carbamoyltransferase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004070 -
                     aspartate carbamoyltransferase activity [Evidence IDA]
                     [PMID 10446140]; GO_function: GO:0004070 - aspartate
                     carbamoyltransferase activity [Evidence IMP] [PMID
                     4550660]; GO_function: GO:0004088 - carbamoyl-phosphate
                     synthase (glutamine-hydrolyzing) activity [Evidence IEA];
                     GO_function: GO:0004088 - carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing) activity [Evidence IDA] [PMID
                     5776390]; GO_function: GO:0016743 - carboxyl- or
                     carbamoyltransferase activity [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA,IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0044205 - 'de
                     novo' UMP biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006207 - 'de novo' pyrimidine nucleobase biosynthetic
                     process [Evidence IEA]; GO_process: GO:0006207 - 'de novo'
                     pyrimidine nucleobase biosynthetic process [Evidence IDA]
                     [PMID 181668]; GO_process: GO:0006207 - 'de novo'
                     pyrimidine nucleobase biosynthetic process [Evidence IMP]
                     [PMID 4550660]; GO_process: GO:0070409 - carbamoyl
                     phosphate biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006520 - cellular amino acid metabolic process
                     [Evidence IEA]; GO_process: GO:0006543 - glutamine
                     catabolic process [Evidence IEA]; GO_process: GO:0006541 -
                     glutamine metabolic process [Evidence IDA] [PMID 5651325];
                     GO_process: GO:0008152 - metabolic process [Evidence
                     IEA,IEA]; GO_process: GO:0045984 - negative regulation of
                     pyrimidine nucleobase metabolic process [Evidence IDA]
                     [PMID 5651325]; GO_process: GO:0006807 - nitrogen compound
                     metabolic process [Evidence IEA]; GO_process: GO:0006221 -
                     pyrimidine nucleotide biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="bifunctional carbamoylphosphate
                     synthetase/aspartate transcarbamylase"
                     /protein_id="XP_018736925.1"
                     /db_xref="GeneID:30033905"
                     /translation="MSSDKIEELPVVSATPSLPIFPPLHNTDKLVTLELKNGISVQGY
                     SFGADKSVAGELVFQTGMVGYPESITDPSYEGQILVITFPLVGNYGVPSRDEMDELVP
                     QLPRYFESNRIHVAGLVVASYTEEYSHFLAKSSLGTWLKEEGIPAIYGVDTRGLTKLI
                     RTQGSTLSRIRLQKEKVNPALSWDENFEEVEYDDPNVKNLVARVSIKEPVLYKPASSV
                     TPVVDSTGKTLRILAIDVGMKYNQVRCFVNRGVELKVVPWDYDFVGAGEQYDGLFVSN
                     GPGDPATLTSVVKRLETVVEQAKTPIFGICLGHQLLASASGASTLKLKFGNRGHNIPA
                     TNLISGRCYITSQNHGYAVDVNTLKEGWKELFVNANDGSNEGIYHTSKPIFSVQFHPE
                     STPGPRDTEFLFDVFINTVLKHKNAGGKPIGPVEFPGGTIEENRAKHPRVHAKKVLVL
                     GSGGLSIGQAGEFDYSGSQAIKALKQEGIYTILINPNIATIQTSKGLADKVYFLPVNA
                     DFVRKVIKYENPDAIYVTFGGQTALNVGIQLKDEFESLGVKVLGTPIDTIITTEDREL
                     FARSMEEIGEKCAKSATASTTAEALEVVKEIKFPVIVRAAYALGGLGSGFAENEEQLV
                     ALCQKAFAASPQILIERSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIV
                     VAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSS
                     ALASKATGYPLAFIAAKLGLNIPLNEIKNSVTKVTCACFEPSLDYVVVKIPRWDLKKF
                     TRVSKELSSSMKSVGEVMSIGRTFEEAIQKAIRSTDYQNLGFNATEALMSIDIDDELQ
                     TPSDQRLFAIANAFDSGYTVDKVWSLTKIDKWFLHKLENLIKFAKMMEQFQSKTIPST
                     TMRQAKQLGFEDRQIAKFVSSNELSIRRLRVEAGITPFVKQIDTVAAEFPAFTNYLYL
                     TYNADSHDIDFNDNGVMVLGSGVYRIGSSVEFDWCAVRAVRTLREQGTKTIMVNYNPE
                     TVSTDYDEADRLYFEVINLERVLDIYQLEQSAGVVISMGGQTSNNIALTLHRENVKIL
                     GTSPDMIDSAENRYKFSRMLDKIGVDQPAWKELTSIEEAEAFADKVSYPVLVRPSYVL
                     SGAAMNTVYSRDDLESYLKQAVEVSRDYPVVITKYIENAKEIEMDAVAKDGKLVMHVV
                     SEHVENAGVHSGDATLIVPPQDLSAETVKRIVEATAKIGQALNVSGPYNIQFIAKDNE
                     IKVIECNVRASRSFPFVSKVLGVDLIEMATKVIAGVPIQPYPLQQLPEDYVAIKVPQF
                     SFSRLSGADPVLGVEMASTGEVACFGRNKYEAYLKSLIATGIKPPKKNILLSIGSFKE
                     KTELLPSVKKLHELGYKLFATAGTADFIQEHGIPVQYLEVLNEGEDEKSEFSLTQHLA
                     NNLIDMYINLPSSNRFRRPASYMSKGYRTRRMAVDYAIPLVTNVKCAKLLVEALALNI
                     PLEVSSIDSQSSHRLLSLPGLINIATFVPSLLSAGGSPDFEKVSEASLKAGFTITRIL
                     PTGVDGSITDALSLLTAQENTRGKSAVDFNLSIAATGDNASQLVKASPNVGSLVIPFN
                     YFNNNLDKVATVSEHFNVWPTSKPIVTDASSTDLASILLLASLHNRPVHVTNVLKKAD
                     LALISMAKEKGLKVTCDVSIHALFLSQVEFPGCSHLPTKEDQEGLWEGLESIDIFAVG
                     VLPSQLAKSLGLTVEAGVGIADALPLLLTAVRENKLTVEDIVLRLSTNPKKIFDLHDQ
                     SGTTVEVDLDRQTTVSSFYSKPLYGTVERVTYNDKTVVLEGKIVVSDFHLGKDVSGHS
                     NAAQVVPASPLVKGGAVFASPRPASPTGVSGFNAQARKMSFNAVSVVAPGGRADLDSA
                     LVLEDDDKSKGPTLKLVTEPQLPSALRNVIRKNNPFLRRHVTSVLDFSRSDLHSLFSL
                     AQELRLAVERVGAVDLLRGRVLATLFYEPSTRTSTSFDAAMQRLGGKVISITTSTSSV
                     QKGETLQDTVRTLASYTDAIVLRHPSEESVAIASKYSPVPIINGGNGSKEHPTQAFLD
                     LFTIREELGTVNGLTVTFMGDLKYGRTVHSLCSLLKHYQVRVQIVCPKDLALPAHVYD
                     ELAKAGKITVVSENLTDEILENTDVLYCTRVQKERFPSLDEYEKFKNLYVVDNKVLRK
                     AKKHMCVMHPLPRVNEISEEVDFDHRAAYFRQMRHGLFVRMALLAMVIGVDF"
     gene            <214221..>215399
                     /locus_tag="AWJ20_2039"
                     /db_xref="GeneID:30033906"
     mRNA            <214221..>215399
                     /locus_tag="AWJ20_2039"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878965.1"
                     /db_xref="GeneID:30033906"
     CDS             214221..215399
                     /locus_tag="AWJ20_2039"
                     /inference="similar to AA sequence:KEGG_Orthology:K12837"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736926.1"
                     /db_xref="GeneID:30033906"
                     /translation="MAKASGLFPTSSDIRKLNERRDGGDNDKGSMAEPASLMLPPPPP
                     TILTAGSNEYNVSPQGSRLAKLVILSGYDAEAQSIEMLTKLFITLLLSITDSGATADS
                     VKDCFYANGSDKTKLVIELAKPELATIAVAFDGVALDESEPDTTKFSITRPEGYIIPL
                     SSDNIEGAKDDKKTKFDVEGPFKGSMSNIPTFIGEEQILELLKAFGQVRFCKILTDVA
                     GNSKGVAFFEYEDTSILDIACQGLNNMALGDNQLIVRKACVGLEQSQPVMSLDTLLKL
                     CQDNDRKNEHPPTSVMQLWNAISPEELADDEAREEISAQIEQECSKFGPVESVNIPKE
                     NSASSTMLSSSIGGRIYVKFSSSSACKEAVKHLGGRKFTDRTIISGFYHEDAYKLGIL
                     "
     gene            <218687..>221182
                     /gene="SEC27"
                     /locus_tag="AWJ20_2040"
                     /db_xref="GeneID:30033908"
     mRNA            <218687..>221182
                     /gene="SEC27"
                     /locus_tag="AWJ20_2040"
                     /product="Sec27p"
                     /transcript_id="XM_018878967.1"
                     /db_xref="GeneID:30033908"
     CDS             218687..221182
                     /gene="SEC27"
                     /locus_tag="AWJ20_2040"
                     /inference="similar to AA sequence:KEGG_Orthology:K17302"
                     /note="Essential beta'-coat protein of the COPI coatomer;
                     involved in ER-to-Golgi and Golgi-to-ER transport;
                     contains WD40 domains that mediate cargo selective
                     interactions; 45% sequence identity to mammalian
                     beta'-COP; GO_component: GO:0030126 - COPI vesicle coat
                     [Evidence IGI,ISS] [PMID 7929113]; GO_component:
                     GO:0030663 - COPI-coated vesicle membrane [Evidence IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0031410 - cytoplasmic vesicle [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0030117 - membrane coat [Evidence IEA];
                     GO_function: GO:0005198 - structural molecule activity
                     [Evidence IEA]; GO_function: GO:0043130 - ubiquitin
                     binding [Evidence IDA] [PMID 21070969]; GO_process:
                     GO:0006888 - ER to Golgi vesicle-mediated transport
                     [Evidence IMP] [PMID 7929113]; GO_process: GO:0006886 -
                     intracellular protein transport [Evidence IEA];
                     GO_process: GO:0032511 - late endosome to vacuole
                     transport via multivesicular body sorting pathway
                     [Evidence IMP,IPI] [PMID 17101773]; GO_process: GO:0015031
                     - protein transport [Evidence IEA]; GO_process: GO:0006890
                     - retrograde vesicle-mediated transport, Golgi to ER
                     [Evidence IMP] [PMID 8001155]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0016192 -
                     vesicle-mediated transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Sec27p"
                     /protein_id="XP_018736927.1"
                     /db_xref="GeneID:30033908"
                     /translation="MNYETQVVVKTIDVSHLPVRAGRFVARKNWIVLGSDDYMVRVFN
                     YNTGEKVTQFEAHPDYIRVLVVHPTQPFVLTAGDDMTIKLWNWDQGWRNTQTFEGHSH
                     YVMYLAFNPKDPNTFASACLDKTVKIWSLGSSTPNFTLEAHETKGANFVEYYPQSDKP
                     YLITTSDDRTIRVWDYQTKSCVATMADHMNNVSFAVFHPELPVIISGSEDSTIKIWNA
                     NTYKLEQTLNYGLERAWCAACKKGSNLMALGFDAGSVVLQLGKEEPAISMDPNGRLIW
                     SKHSEVFSSVVKGGDDVNDGDFLPIAQKDLGNVEVYPTQLNHSPNGRFVAVTGDGEYI
                     IYTALAWRNKSFGSGLDFAWAQDSNEYAVRESTSSIRLFKNFKERPIGHLNIGYSATQ
                     IYGGTLLGINGGEFVAFYDWESGLLVRRIDVEASQVVWSDSGELVAIITDDSFYILRF
                     SRDAFQLAVQNNSVSEDDGVEESFEVAYDISDSVRTGKWVGDCFIYTTFSNRLNYLVG
                     GEVYTISHFDKQMYLLGYIPRDNAIYLADKDVNVTAYKLSLAVVEYQTVVLRGDMDYA
                     AEILEKVPDNEKTKVARFLEAQGYPELALEVSRDSDHRFDLAVSLDKLDIAEEIASSV
                     DDEHKWKSLGDKSLLSWNVILAEKSFKAAHDFESLLLIYTSTGNKPGAAELAEEAVKA
                     GKYNLAFNAYWYVGDTDACIKLLNDTGRSSEAALFALTYGGDVDGSVKKWKDGLVKSG
                     RSKIAQSISEPSQDKELFPANVGQKVTTLPSIGGDLIDVDDIATPEPEPQSAEEAELI
                     EVEAEAEPESDPTAEDKAEETEDADAEVEKDSL"
     gene            <221497..>222978
                     /locus_tag="AWJ20_2041"
                     /db_xref="GeneID:30033909"
     mRNA            <221497..>222978
                     /locus_tag="AWJ20_2041"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878968.1"
                     /db_xref="GeneID:30033909"
     CDS             221497..222978
                     /locus_tag="AWJ20_2041"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736928.1"
                     /db_xref="GeneID:30033909"
                     /translation="MSIVKIQNGLFRKLGEGSKRTLIFKSPLSLDIKSTDRWAITGPR
                     KTELLEILASKHIPDPPLSRTYPFLANQNAWPSQVTQLIEFSNADVKAPHISARYESL
                     REELDETLNESLLAATHSKDQAKVDHVLEKFSLKGIENRWIVGLSNGQSRRARLAKAL
                     LRDPKFLLVDEPFVGLDPFSRKQASDILSKLSPEPHVVVGLRYQDEFPSWITHVAITD
                     RTGNGISHQGPIKDLAPYLDEMRRDHIVQVVKAKDLAVKAAEKSKLAASNNPEVIKLD
                     SVSVSYKGEPIFSNLTWKVKKGEKWHLRGDNGTGKSTLLSLLTGDHPQSWNPKISLFG
                     EPRGTGKQSYFSINEKFGHVSPEIHALFPMNLTVKEAISTGFVVGYYIPLKKLSQEQE
                     DRIDELLSLFEHISKDEVLRDLSVSNQKIVMFLRGLAKRPDILILDEAFSAMAEESID
                     KCKQYIDLEYDGTLIVVGHIEDEVPLCHKYIRLTAAEPEFGEL"
     gene            complement(<223075..>223743)
                     /locus_tag="AWJ20_2042"
                     /db_xref="GeneID:30033910"
     mRNA            complement(<223075..>223743)
                     /locus_tag="AWJ20_2042"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878969.1"
                     /db_xref="GeneID:30033910"
     CDS             complement(223075..223743)
                     /locus_tag="AWJ20_2042"
                     /inference="similar to AA sequence:KEGG_Orthology:K07734"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736929.1"
                     /db_xref="GeneID:30033910"
                     /translation="MYIPKYNVEPSEELQIQLIREFPLGTIITSSADGIIANHLPFLV
                     DKTSDGLVLRAHFARVNHQRDDFRSGKELLVVFKGLDGYETPNWYVDTKPTTGKVVPT
                     WDFSAVHVYGVPTVIEDPAWIYKQFTDLSNMNEREQSEPWTVDQAPESYVNLLQKAIW
                     GLEIKVTRVESKWKVGQKLSDKDNRGVIEGFKTQGEKGAALSEVVEKAKIRHDERRKN
                     GLQT"
     gene            complement(<225405..>226148)
                     /locus_tag="AWJ20_2043"
                     /db_xref="GeneID:30033911"
     mRNA            complement(<225405..>226148)
                     /locus_tag="AWJ20_2043"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878970.1"
                     /db_xref="GeneID:30033911"
     CDS             complement(225405..226148)
                     /locus_tag="AWJ20_2043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736930.1"
                     /db_xref="GeneID:30033911"
                     /translation="MRFSYATSALLAVAATSVNAALVTQYVQVTVDVYEQAHVFVNGN
                     GDPVSTSYELVSSEESAPTQVPSSHQHSDAQPVQIQLTTSTAAASSSPAPPPPAPTTS
                     SSTTTPPPPPPPTTTSSPPPPPPAPSSSSASSDSSDSSSSSGSGEFSGQGTFYSPGMG
                     SCGIESSDSDFIAALNAPQMGSPANPNANPNCGKKAIVYSGGKSVTVTIVDKCPSCAY
                     GSLDLSPAAFNELADPSAGRIDISWSWAS"
     gene            complement(<227499..>229136)
                     /gene="HNM1"
                     /locus_tag="AWJ20_2044"
                     /db_xref="GeneID:30033912"
     mRNA            complement(<227499..>229136)
                     /gene="HNM1"
                     /locus_tag="AWJ20_2044"
                     /product="Hnm1p"
                     /transcript_id="XM_018878971.1"
                     /db_xref="GeneID:30033912"
     CDS             complement(227499..229136)
                     /gene="HNM1"
                     /locus_tag="AWJ20_2044"
                     /note="Plasma membrane transporter for choline,
                     ethanolamine, and carnitine; involved in the uptake of
                     nitrogen mustard and the uptake of glycine betaine during
                     hypersaline stress; co-regulated with phospholipid
                     biosynthetic genes and negatively regulated by choline and
                     myo-inositol; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA,IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence ISS] [PMID 2203793]; GO_function:
                     GO:1901235 - (R)-carnitine transmembrane transporter
                     activity [Evidence IMP] [PMID 23755272]; GO_function:
                     GO:0015171 - amino acid transmembrane transporter activity
                     [Evidence IEA]; GO_function: GO:0015220 - choline
                     transmembrane transporter activity [Evidence IMP] [PMID
                     2203793]; GO_function: GO:0015220 - choline transmembrane
                     transporter activity [Evidence IGI] [PMID 3514579];
                     GO_function: GO:0034228 - ethanolamine transmembrane
                     transporter activity [Evidence IGI] [PMID 3514579];
                     GO_process: GO:1900749 - (R)-carnitine transport [Evidence
                     IMP] [PMID 23755272]; GO_process: GO:0003333 - amino acid
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006865 - amino acid transport [Evidence IEA,IEA];
                     GO_process: GO:0015871 - choline transport [Evidence IMP]
                     [PMID 2203793]; GO_process: GO:0015871 - choline transport
                     [Evidence IGI] [PMID 3514579]; GO_process: GO:0034229 -
                     ethanolamine transport [Evidence IGI] [PMID 3514579];
                     GO_process: GO:0031460 - glycine betaine transport
                     [Evidence IMP] [PMID 16487344]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Hnm1p"
                     /protein_id="XP_018736931.1"
                     /db_xref="GeneID:30033912"
                     /translation="MVEEEKKRLSVESLRSGQQQKLDAFDLADMGHAQELPRQFSMWS
                     MLALAFSVLGTWATFAQDLMSGLQNGGSIAILWGLALVTICNICVAVSLGELCSSMPT
                     ALGQAYWIHRLWNTPAGRFSSYICAWINTFGWWTLTASQIAFMTNFILGIKVMFDNDW
                     AGASEGWVQFLVYVGITVVFTLTNVLACRKDNFLAWFNNVVGIQFTMLFVIFSLAMLI
                     AVGVHHDKHFQTAGFVFGKWLNETGWPDGVVWFTGLLQAAYGLTAFDSVIHMVEEIPS
                     PRVNAPRVIYLAVIMGAITGGIFMVVCLFCIQDLDSILNSPTGLPFMQLLTDTVGVQG
                     GAALLSIFVFNGLGQGVSVATTASRLTWGFARDGGLPFSQYFAHVDTYWHVPARSLWA
                     QGVIIAVVGVLYLFASTVLEAILSVSTIALTISYGMPIAALVLVGRDKLTPGPFHLGR
                     YGMFCNIVSIIYCCVTTVFFFFPGGPDPAPADMNYAIAVFGVMMVIALAFWFIKGRRT
                     YLLTDEALIEMLRARELENSANDATVVVVDGQAPEKN"
     gene            <230964..>231419
                     /locus_tag="AWJ20_2045"
                     /db_xref="GeneID:30033913"
     mRNA            <230964..>231419
                     /locus_tag="AWJ20_2045"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878972.1"
                     /db_xref="GeneID:30033913"
     CDS             230964..231419
                     /locus_tag="AWJ20_2045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736932.1"
                     /db_xref="GeneID:30033913"
                     /translation="MPPKTSAAELTIRLKHKKQTVLLILAGGVTVNGLKKTLAKALNE
                     TRGSDQGVDEVDDAPIPKPSFETASDVEEDTDKQPGAEEITAKIIDANDLRVGIPVDK
                     SDFSKGFTDITDAKGNIEANGIVEGSILAFCTKDGDFEIEVPYDDNLDE"
     gene            <234659..>235537
                     /gene="RTR1"
                     /locus_tag="AWJ20_2046"
                     /db_xref="GeneID:30033914"
     mRNA            <234659..>235537
                     /gene="RTR1"
                     /locus_tag="AWJ20_2046"
                     /product="Rtr1p"
                     /transcript_id="XM_018878973.1"
                     /db_xref="GeneID:30033914"
     CDS             234659..235537
                     /gene="RTR1"
                     /locus_tag="AWJ20_2046"
                     /note="CTD phosphatase; dephosphorylates S5-P in the
                     C-terminal domain of Rpo21p; has a cysteine-rich motif
                     required for function and conserved in eukaryotes;
                     shuttles between the nucleus and cytoplasm; RTR1 has a
                     paralog, RTR2, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 18408053]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 18408053];
                     GO_function: GO:0008420 - CTD phosphatase activity
                     [Evidence IDA] [PMID 19394294]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0046872
                     - metal ion binding [Evidence IEA]; GO_function:
                     GO:0004721 - phosphoprotein phosphatase activity [Evidence
                     IEA,IEA]; GO_process: GO:0070940 - dephosphorylation of
                     RNA polymerase II C-terminal domain [Evidence IDA,IMP]
                     [PMID 19394294]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IGI,IMP,IPI] [PMID 18408053]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Rtr1p"
                     /protein_id="XP_018736933.1"
                     /db_xref="GeneID:30033914"
                     /translation="MSDTIFSMDTGDSTAHPKFATQQDAVINGVTHNVSANNSPSQSL
                     IEMCRIIAKYSKPGFLSAGEASQILLSIVELMSDGVESDALKFSSRFLTGSDYEDIVV
                     ERNILHRCGYPICDKDPKGIHKAHQINYRTPKMILPSTYLSKYCTKEHYQASTFFASQ
                     LSDASLFSRKDVTLLPYGASTEYELQIALMEEVQVLSQSQNRSMQDIIQELKSLSLSK
                     QQSQIDTLPSTQPRRYSSANPADPHLVDLSDQIKAFKIVERDPSIPTLDAGDEPIEEA
                     IASGVEGYNSRFGRSV"
     gene            <236924..>238288
                     /gene="HXT13"
                     /locus_tag="AWJ20_2047"
                     /db_xref="GeneID:30033915"
     mRNA            <236924..>238288
                     /gene="HXT13"
                     /locus_tag="AWJ20_2047"
                     /product="hexose transporter HXT13"
                     /transcript_id="XM_018878974.1"
                     /db_xref="GeneID:30033915"
     CDS             236924..238288
                     /gene="HXT13"
                     /locus_tag="AWJ20_2047"
                     /inference="similar to AA sequence:KEGG_Orthology:K08139"
                     /codon_start=1
                     /product="hexose transporter HXT13"
                     /protein_id="XP_018736934.1"
                     /db_xref="GeneID:30033915"
                     /translation="MVDEKIQVENVEHVVYDSPEKEIVEFRGSDALLEAAQKDPPKIF
                     SKRMLQLYIICLIPFLCSTMNGYDGSLLSSLLLLKPFNDTFGATTVGIKAGLISAMYQ
                     IGGVATIPFLGPVNDTFGRRFGMFFGCLIVVIGTVVQATSKNINQLMGGRFVLGFGVS
                     FATAAAPIYAIEISHPSYRAAITGSYNTLYCWGSILATVVLFCTQNIPNNRAWIIPTY
                     VQMVCPGLVVIFSMFLPESPRWLYCNGKQEKAKEILTYYHGEGNPENAFITLQIREFE
                     EQLELDGTDKRWWDYRALFRDRASIYRLCCNLVYSCFGQLSNGGISYFVGAFYHSAGI
                     TSNRTIFSYNLGTGFLSFILALIGAQVIQQIGRRKVILGSLVGMTLFWALVTICVARF
                     DASGEKTTAWAQAGIAFYILFGVVYGKLRCCLFRQVYILTKTQPSRLLLCKHFILMKS
                     FHTK"
     gene            <242372..>244669
                     /gene="SIP5"
                     /locus_tag="AWJ20_2048"
                     /db_xref="GeneID:30033916"
     mRNA            join(<242372..242725,242918..>244669)
                     /gene="SIP5"
                     /locus_tag="AWJ20_2048"
                     /product="Sip5p"
                     /transcript_id="XM_018878975.1"
                     /db_xref="GeneID:30033916"
     CDS             join(242372..242725,242918..244669)
                     /gene="SIP5"
                     /locus_tag="AWJ20_2048"
                     /note="hypothetical protein; interacts with both the
                     Reg1p/Glc7p phosphatase and the Snf1p kinase; forms
                     cytoplasmic foci upon DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IPI] [PMID
                     10628972]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 22842922]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0042149 -
                     cellular response to glucose starvation [Evidence IMP,IPI]
                     [PMID 10628972]"
                     /codon_start=1
                     /product="Sip5p"
                     /protein_id="XP_018736935.1"
                     /db_xref="GeneID:30033916"
                     /translation="MGNVPTKDVSATGSGSNSRSRSASTATAESSTTTASSSRRTRLS
                     STSSRSTVRDETSGFGTSVTGLSRKSGKKKEKSSASDAPLVSDVSEMVDGGYLVPQGV
                     YSGPQDFKAKVVRNLIIERRLAPFYKGIEDYDDTWTDRQLLAAVRNLPIPPATDPVVS
                     PTTSSDQAEPVEEPDRKKKEKEADTPVDPATETDESAEQGYESENALKWVSSSLPNAV
                     GGSFLQARNSDDGGSSGRLAGFESNPSIRSSSSRSSDPDDGILSPPSNGKQKQPMTPP
                     LAASAEEDETIPFPSSPASSSSGAMRIIEFKTETMHIEDTATGTNSISTNASARITSG
                     GGISIETRPREGSAKLGPPILLPRNRANTTSRYGPGPTSSSMKPAPPPMEVILYRGAI
                     ECPICFLNYPKYLNTTRCCTQPICSECFVQIKRPDPHPPYHENNGSGPSTAPATDNPE
                     EALVSEPACCPFCQMPEFGVVYIPSPHRSGIPASSLTSSLRAHLSSSLSGVFSSHHHT
                     PVSSSAASIVSMSTSNSATGTPRRRGSLPPNAPEVVTTDHVRPDWAMKLSRARHQLAR
                     KSAAANALHASAFLFEGNEGAASSSSSHSRRHDKKKKSSSRLRGLSSPSSPASILGSS
                     SSGSGSSRRHTTSSPSSGTSFPVPSRTRIRDLEDMMIVEAIRRSLTDERSGSPSGESP
                     KAPASQSSQEVKKDEITTQ"
     gene            <250855..>252030
                     /gene="HAC1"
                     /locus_tag="AWJ20_2049"
                     /db_xref="GeneID:30033917"
     mRNA            <250855..>252030
                     /gene="HAC1"
                     /locus_tag="AWJ20_2049"
                     /product="transcription factor HAC1"
                     /transcript_id="XM_018878976.1"
                     /db_xref="GeneID:30033917"
     CDS             250855..252030
                     /gene="HAC1"
                     /locus_tag="AWJ20_2049"
                     /codon_start=1
                     /product="transcription factor HAC1"
                     /protein_id="XP_018736936.1"
                     /db_xref="GeneID:30033917"
                     /translation="MVVVKSEPKDLYLFSDESLQYGDDTLIDDKDALNDDEDNMNETD
                     ELQDQDCSLSDRQMSEEHDLDDSDMVTTESIDAATGLTITTTVGSGANKRKEVMTLPL
                     PPGSLPPRKRAKTKDEKEQRRIERIMRNRQAAHASREKKRKHVEELEKKCVVLTSENE
                     QLQQNMRQMKESQVQMLEQHYLLMAKVQQLQNVLKTAKTTGDLSVLDSADFTVSLPSM
                     PTATLLSQGSSDMVSPVSTSTTTTGTSTPGTSVDDSSERDKLHTKASRSSSPLSSSSS
                     SSTMLLSSTVKEEECTSPEALLLSNVITTAPSLSNSPLQSDNLDFDDSSNESTISTPP
                     SHNTYIKQELFEDDKDSYNFENSNQAHHPAAVMCDQQRLRLTKFSPLSESLPQSITV"
     gene            <254820..>256241
                     /locus_tag="AWJ20_2050"
                     /db_xref="GeneID:30033919"
     mRNA            <254820..>256241
                     /locus_tag="AWJ20_2050"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878978.1"
                     /db_xref="GeneID:30033919"
     CDS             254820..256241
                     /locus_tag="AWJ20_2050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736937.1"
                     /db_xref="GeneID:30033919"
                     /translation="MRAAVNLHINITDDMRGGVGGGGGGMPGYAMTRTPSNSSVNSTS
                     SNPPPLTPINQTIGTPTINRQFMFHRLNSVSSIATSEDDSDVNARLDNPLDSFLDWPS
                     QDDDLLMNIYQAYIDNPTTAPFAGKIPPSGVVHQVAKTTLHEAKKKSRPFLHSMLAVR
                     KRLLLLCERNSAPTQIYTRASSTSSLSSNSSFNFSNAPAITPGTIPPNRFFRQLSFGS
                     NGSPESPVMTPLANRIKRPCTGFANGTSPGEAHAITTNDGVSLSAFMLGHPDDYDEEM
                     AFADESPLGTSLLPPPPTFRIPEYENSNNNNSNNNAGPQSPIDIQPSPFDRKTRQGST
                     SSRGSPKLGSQSQNVPPQQPNAYSSQTQQNIANWLLNTPNHHGQATTSGLGMPLTPAP
                     SPLNIKNAHRASVGTSAQANPDDFDFGLDSPFKEMTVTPTRPHQQSPGSQPSTPVEDP
                     YPNYTAQRKRESLRMKRGMKAPI"
     gene            <256745..>257827
                     /gene="GLE2"
                     /locus_tag="AWJ20_2051"
                     /db_xref="GeneID:30033920"
     mRNA            <256745..>257827
                     /gene="GLE2"
                     /locus_tag="AWJ20_2051"
                     /product="RNA export factor GLE2"
                     /transcript_id="XM_018878979.1"
                     /db_xref="GeneID:30033920"
     CDS             256745..257827
                     /gene="GLE2"
                     /locus_tag="AWJ20_2051"
                     /inference="similar to AA sequence:KEGG_Orthology:K14298"
                     /note="RNA export factor associated with the nuclear pore
                     complex (NPC); associates with NUP116p; required for
                     polyadenylated RNA export but not for protein import;
                     homologous to S. pombe Rae1p and human RAE1; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 15210706];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031965 -
                     nuclear membrane [Evidence IEA]; GO_component: GO:0005643
                     - nuclear pore [Evidence IEA,IEA]; GO_component:
                     GO:0005643 - nuclear pore [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0005643 - nuclear pore [Evidence IDA]
                     [PMID 8970155]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0051028 -
                     mRNA transport [Evidence IEA]; GO_process: GO:0031081 -
                     nuclear pore distribution [Evidence IMP] [PMID 9725905];
                     GO_process: GO:0016973 - poly(A)+ mRNA export from nucleus
                     [Evidence IMP] [PMID 8970155]; GO_process: GO:0000973 -
                     posttranscriptional tethering of RNA polymerase II gene
                     DNA at nuclear periphery [Evidence IMP] [PMID 20932479];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:2000728 - regulation of mRNA export from
                     nucleus in response to heat stress [Evidence IMP] [PMID
                     15210706]; GO_process: GO:0000972 -
                     transcription-dependent tethering of RNA polymerase II
                     gene DNA at nuclear periphery [Evidence IMP] [PMID
                     20098417]; GO_process: GO:0000972 -
                     transcription-dependent tethering of RNA polymerase II
                     gene DNA at nuclear periphery [Evidence IMP] [PMID
                     20932479]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="RNA export factor GLE2"
                     /protein_id="XP_018736938.1"
                     /db_xref="GeneID:30033920"
                     /translation="MSGLFASRSVGTTSNGPAPSSELMLQNDRTLANPPEDSISDMSF
                     SSQADYLAVASWDKKVRIYEVSPQGDSQGRAMYEHQAPVLTAQWFQDGSKVVSGGCDN
                     AVRAHDLQSSQTIQIGQHDAPVSSVRAVDVGSGSPVVASASWDKTLRYWDLRQQQAIS
                     TIQLPERAYSMDSQGKLLVVGTAERHICVIDLSNPGQIFKNTQSPLKWQTRVVACYPS
                     GNGYAVTSIEGRCAIQYVDDAEQAKLGFSFKCHRDQATPPRNDNLIYSVNGVSFHPVY
                     GTFCTAGSDGTVHFWDKDSRSRLKFSRPVGGTISSTAFNRNGTLFAYAVSYDWSKGYQ
                     FNTPNYPNMVKIHPTNDSETKQRPKK"
     gene            complement(<258533..>258823)
                     /gene="IGO2"
                     /locus_tag="AWJ20_2052"
                     /db_xref="GeneID:30033921"
     mRNA            complement(<258533..>258823)
                     /gene="IGO2"
                     /locus_tag="AWJ20_2052"
                     /product="Igo2p"
                     /transcript_id="XM_018878980.1"
                     /db_xref="GeneID:30033921"
     CDS             complement(258533..258823)
                     /gene="IGO2"
                     /locus_tag="AWJ20_2052"
                     /note="Protein required for initiation of G0 program;
                     prevents degradation of nutrient-regulated mRNAs via the
                     5'-3' mRNA decay pathway; phosphorylated by Rim15p; GFP
                     protein localizes to the cytoplasm and nucleus; IGO2 has a
                     paralog, IGO1, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0019208 - phosphatase regulator activity [Evidence IMP]
                     [PMID 23861665]; GO_process: GO:0048255 - mRNA
                     stabilization [Evidence IGI] [PMID 20471941]"
                     /codon_start=1
                     /product="Igo2p"
                     /protein_id="XP_018736939.1"
                     /db_xref="GeneID:30033921"
                     /translation="MYGRLPSRAELLNRKLKDRKFFDSGDYALKQAGKDTTQVVGSEH
                     PVPEIIPHHTSPPQSRHASFSYGSATAAHDPSLMAAHELDLKLKGIHRSSIA"
     gene            complement(<264441..>264833)
                     /gene="MRPS16"
                     /locus_tag="AWJ20_2053"
                     /db_xref="GeneID:30033922"
     mRNA            complement(<264441..>264833)
                     /gene="MRPS16"
                     /locus_tag="AWJ20_2053"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_018878981.1"
                     /db_xref="GeneID:30033922"
     CDS             complement(264441..264833)
                     /gene="MRPS16"
                     /locus_tag="AWJ20_2053"
                     /inference="similar to AA sequence:KEGG_Orthology:K02959"
                     /note="Mitochondrial ribosomal protein of the small
                     subunit; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_component: GO:0005763 - mitochondrial
                     small ribosomal subunit [Evidence IPI] [PMID 12392552];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IPI] [PMID 12392552]; GO_process:
                     GO:0032543 - mitochondrial translation [Evidence IC] [PMID
                     12392552]; GO_process: GO:0006412 - translation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_018736940.1"
                     /db_xref="GeneID:30033922"
                     /translation="MKGSVRIRLARFGRKHAPVYNIVVAKAKSGRDKLPVEVIGTYNP
                     IATPLTPEQKERGEKPVKDIKIDFHRSKYWIGVGAQPTEVVARLFRKAGVLPPQWPGP
                     NSGPVVPKKNEIQGVKAITEPLPEPPVR"
     gene            complement(<265090..>265161)
                     /locus_tag="AWJ20_2054"
                     /db_xref="GeneID:30033923"
     tRNA            complement(<265090..>265161)
                     /locus_tag="AWJ20_2054"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:30033923"
     gene            <266084..>268516
                     /gene="DNM1"
                     /locus_tag="AWJ20_2055"
                     /db_xref="GeneID:30033924"
     mRNA            <266084..>268516
                     /gene="DNM1"
                     /locus_tag="AWJ20_2055"
                     /product="dynamin-related GTPase DNM1"
                     /transcript_id="XM_018878982.1"
                     /db_xref="GeneID:30033924"
     CDS             266084..268516
                     /gene="DNM1"
                     /locus_tag="AWJ20_2055"
                     /inference="similar to AA sequence:KEGG_Orthology:K17065"
                     /note="Dynamin-related GTPase involved in mitochondrial
                     organization; required for mitochondrial fission and
                     morphology; assembles on the cytoplasmic face of
                     mitochondrial tubules at sites at which division will
                     occur; also participates in endocytosis and regulating
                     peroxisome abundance; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005741 - mitochondrial
                     outer membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005741 - mitochondrial outer membrane [Evidence IDA]
                     [PMID 11038182]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005777 -
                     peroxisome [Evidence IDA] [PMID 16968746]; GO_function:
                     GO:0005525 - GTP binding [Evidence IEA,IEA]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IEA]; GO_function:
                     GO:0003924 - GTPase activity [Evidence IDA] [PMID
                     16186251]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0042802 - identical
                     protein binding [Evidence IDA] [PMID 16186251];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0042803 - protein homodimerization
                     activity [Evidence IDA] [PMID 16186251]; GO_process:
                     GO:0006184 - GTP catabolic process [Evidence IEA];
                     GO_process: GO:0001300 - chronological cell aging
                     [Evidence IMP] [PMID 18298044]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0000266 -
                     mitochondrial fission [Evidence IGI,IMP] [PMID 10559943];
                     GO_process: GO:0000001 - mitochondrion inheritance
                     [Evidence IGI] [PMID 17336903]; GO_process: GO:0051646 -
                     mitochondrion localization [Evidence IGI] [PMID 23341591];
                     GO_process: GO:0007005 - mitochondrion organization
                     [Evidence IMP] [PMID 9786946]; GO_process: GO:0016559 -
                     peroxisome fission [Evidence IGI] [PMID 18445678];
                     GO_process: GO:0007031 - peroxisome organization [Evidence
                     IGI,IMP] [PMID 16968746]; GO_process: GO:0051260 - protein
                     homooligomerization [Evidence IDA] [PMID 16186251]"
                     /codon_start=1
                     /product="dynamin-related GTPase DNM1"
                     /protein_id="XP_018736941.1"
                     /db_xref="GeneID:30033924"
                     /translation="MAALEDLIPVVNKLQDLVFNTIGSDTLDLPQVVVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLILQLVNIPSSAPPTWTQNDNTGYGTNNVNNGSTSS
                     NSTTSNSLSSSPASTHGAIAGGGPNPNATFVREAEWGEFLHIPGRRFYDFSDIRREIE
                     SETARIAGNNKGINRLPINLKIFSPHVLNLTLVDLPGLTKIPIGDQPTDIERQTRGLI
                     SEYIAKPNSIILAVSPANVDLVNSESLKLARQVDPQGKRTIGVLTKLDLMDQGTNALD
                     ILSGHVYPLKLGFIGVVNRSQQDIQEGKSLDESLTAEKNFFATHPVYRNIAHKCGTAY
                     LAKSLNQTLMAHIRDRLPDIKARLNTLMGQTEQELASYGVDSSYSKENRGPLILQLMT
                     RFASSFIASIEGTSSEISTKELCGGARIYYIYNEVFGQSLTNIDPVGTLSHSDVRTAI
                     RNSTGPRPSLFVPELAFDLLVKPQIKLLEGPSQRCVELVYEELMKICHNCGSTELSRY
                     PKLQAKLIEVISDLLRERLGPTSAYVSSLIDIQRAYINTNHPNFVGAAAAMASVLEEK
                     QAKEKKVKELEKAAHEKKLLGDLAFNGSAATDGSDTPVSGQEPPADHILQNGSADQTK
                     KKHRPSSSSNPITNNVPATHEATPNGHKDSFLNYFFGKDGAEQSSVGGHSALSARSKD
                     SPFIQSPAASDPSSARFDLRDIESSLDNPLEHFSEREQLECELITRLIISYFDIVRES
                     IQDQVPKAVMHLLVNFSKESAQNRLVSELYKESLFDDLLYEDETLAQEREKCQNMLKT
                     YKEAARVIGEVV"
     gene            complement(<268605..>269843)
                     /gene="AIM17"
                     /locus_tag="AWJ20_2056"
                     /db_xref="GeneID:30033925"
     mRNA            complement(<268605..>269843)
                     /gene="AIM17"
                     /locus_tag="AWJ20_2056"
                     /product="Aim17p"
                     /transcript_id="XM_018878983.1"
                     /db_xref="GeneID:30033925"
     CDS             complement(268605..269843)
                     /gene="AIM17"
                     /locus_tag="AWJ20_2056"
                     /note="hypothetical protein; the authentic, non-tagged
                     protein is detected in highly purified mitochondria in
                     high-throughput studies; null mutant displays reduced
                     frequency of mitochondrial genome loss; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0051213 - dioxygenase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Aim17p"
                     /protein_id="XP_018736942.1"
                     /db_xref="GeneID:30033925"
                     /translation="MIRGSRLLLRRQLARKYHVESFDKSGISLGGFRTAEPVKFRNLF
                     LRDACASTESVDVSTKQKTFSTAQLGDSIYAKNVTVNPSTQSLDVEWADGHKSSYSQD
                     FLETYSNTVSRRRYRHLDLHDTNIWNSGTSKFTYDDAYSTSYKAYLESPNDLVKSLQR
                     DGIAFITDIPPGEKFNSSKITVEHIAEQIGPIKNTFYGPSWNVISQSMAKNVAYTAVY
                     LPLHMDLLYFESPPGVQLLHVIENNTIGGESIFADSFAAALHILETDPDAYSALTEVP
                     ISYHYVNDNQHYYFARPLIVEDVNSSVDEKTGRRAISHINYSPPFQGPIDAIATTHDV
                     ADNVVTNFYRGLRLFEEYIENPSNQIEVKMAENTCVLFMNRRTLHGRQQFQPGSGNRW
                     FKGTYLDIDSFQSKLRTSKS"
     gene            complement(<271524..>272657)
                     /gene="RTT109"
                     /locus_tag="AWJ20_2057"
                     /db_xref="GeneID:30033926"
     mRNA            complement(<271524..>272657)
                     /gene="RTT109"
                     /locus_tag="AWJ20_2057"
                     /product="H3 histone acetyltransferase RTT109"
                     /transcript_id="XM_018878984.1"
                     /db_xref="GeneID:30033926"
     CDS             complement(271524..272657)
                     /gene="RTT109"
                     /locus_tag="AWJ20_2057"
                     /inference="similar to AA sequence:KEGG_Orthology:K11309"
                     /codon_start=1
                     /product="H3 histone acetyltransferase RTT109"
                     /protein_id="XP_018736943.1"
                     /db_xref="GeneID:30033926"
                     /translation="MSIETRFESELREFLPKFKEPFGLVHIRTNPRKCRRLVYLPKKQ
                     SRSVPLDASSTHFFVLSYKNIDFFALEIIIYESPNSMTLFVSKADTNGHYYELEAGAS
                     LSVLDITTGLLRGLLHHYIKPSKLLRICLFAKSEGQYLFPLSSENPNKHVLPDGELVK
                     WWLKVLNKLSGEFEQISRATLQIPGSDKSAIEAFFPKVTGNGGLPWTVGDIFRDESDL
                     KRKRQRGAVYYIPRFPDDPKGRFLDYLVLEKRAQTTSLDQFILELQSRQEFRLGSVVG
                     IIGVEGFIKENSDAYNLAVSSPHSVSYKEFVQLKDVLMNLSFATREFAESASEEFSDR
                     VPEFAKLKIFGAKEAKIKDKKTATTSAPVNVLGGMLIRKKPKK"
     gene            complement(<273377..>273655)
                     /gene="PRE3"
                     /locus_tag="AWJ20_2058"
                     /db_xref="GeneID:30033927"
     mRNA            complement(<273377..>273655)
                     /gene="PRE3"
                     /locus_tag="AWJ20_2058"
                     /product="proteasome core particle subunit beta 1"
                     /transcript_id="XM_018878985.1"
                     /db_xref="GeneID:30033927"
     CDS             complement(273377..273655)
                     /gene="PRE3"
                     /locus_tag="AWJ20_2058"
                     /inference="similar to AA sequence:KEGG_Orthology:K02738"
                     /note="Beta 1 subunit of the 20S proteasome; responsible
                     for cleavage after acidic residues in peptides;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005789 - endoplasmic reticulum membrane
                     [Evidence IC] [PMID 9087403]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IC] [PMID 9087403]; GO_component:
                     GO:0000502 - proteasome complex [Evidence IEA];
                     GO_component: GO:0005839 - proteasome core complex
                     [Evidence IEA]; GO_component: GO:0019774 - proteasome core
                     complex, beta-subunit complex [Evidence IDA] [PMID
                     9087403]; GO_component: GO:0034515 - proteasome storage
                     granule [Evidence IDA] [PMID 18504300]; GO_function:
                     GO:0004175 - endopeptidase activity [Evidence IEA];
                     GO_function: GO:0004175 - endopeptidase activity [Evidence
                     IMP] [PMID 9207060]; GO_function: GO:0004175 -
                     endopeptidase activity [Evidence IMP] [PMID 9312134];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0008233 - peptidase activity
                     [Evidence IEA]; GO_function: GO:0004298 - threonine-type
                     endopeptidase activity [Evidence IEA,IEA]; GO_process:
                     GO:0010499 - proteasomal ubiquitin-independent protein
                     catabolic process [Evidence IDA] [PMID 19162040];
                     GO_process: GO:0043161 - proteasome-mediated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 11545745]; GO_process: GO:0043161 -
                     proteasome-mediated ubiquitin-dependent protein catabolic
                     process [Evidence IDA] [PMID 19029916]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA]; GO_process:
                     GO:0051603 - proteolysis involved in cellular protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="proteasome core particle subunit beta 1"
                     /protein_id="XP_018736944.1"
                     /db_xref="GeneID:30033927"
                     /translation="MAVKFKDGIILGADSRTTTGAFIANRVTDKLTQVHDKVWCCRSG
                     SAADTQAVADIVHYHLQAYAAENNEPPSAKVAASIFRVLCYNNKDNLR"
     gene            <274720..>276381
                     /gene="moe1"
                     /locus_tag="AWJ20_2059"
                     /db_xref="GeneID:30033928"
     mRNA            <274720..>276381
                     /gene="moe1"
                     /locus_tag="AWJ20_2059"
                     /product="translation initiation factor eIF3d Moe1"
                     /transcript_id="XM_018878986.1"
                     /db_xref="GeneID:30033928"
     CDS             274720..276381
                     /gene="moe1"
                     /locus_tag="AWJ20_2059"
                     /inference="similar to AA sequence:KEGG_Orthology:K03251"
                     /codon_start=1
                     /product="translation initiation factor eIF3d Moe1"
                     /protein_id="XP_018736945.1"
                     /db_xref="GeneID:30033928"
                     /translation="MSAPRLPKLASTSEPWGPPSEVPTSLRFNNVPYAPYSKGDKLGK
                     AADWAFDAGKDGKDQKRQQYGRGFRDPYHAYGSNFTSFFTNEEDEGITSFSVVDSAAK
                     AAPKNAGGRGGSQHTILKSRRGGAGAAGGRGGSFQSQRGHHQGQGRGGQGGGRGQGFK
                     RPGWRDYDKPQKVRDASVNITEGWSLIQSIGFNEFQKLSFDVRQGESIDSYGSVHYYN
                     NKTLDKPSVNAKLEPLDRIVYNISTSDDPVIQELSAKDAGTVFATDSIISLLMCVTKT
                     VNPWDIIITKKNGKVYLDKREGGPLDLVSVDENAADAPADATDSKDTLNNATALAYEA
                     TYINQNFNANAVIESSETYDFGKPNPFYSEEDQKQSEPLLAHGYDYKKFNLANNVEEE
                     PINLVIRTEIDAAQKNLNGSVSLVTVKALNEYGGSTGALEWKNRFVNARGAIVAAEMK
                     NNLCKISRWTVQSILAGANLMKIGFVSRVNPKDNTQHTIIGVIGQEPAQLSNQINLNL
                     NNGWGIVKSVVNICSELDEGKYVLLRDPNNPAVKLYKVPSNAFEE"
     gene            complement(<276531..>279335)
                     /locus_tag="AWJ20_2060"
                     /db_xref="GeneID:30033930"
     mRNA            complement(<276531..>279335)
                     /locus_tag="AWJ20_2060"
                     /product="centrin-binding protein Sfi1"
                     /transcript_id="XM_018878988.1"
                     /db_xref="GeneID:30033930"
     CDS             complement(276531..279335)
                     /locus_tag="AWJ20_2060"
                     /codon_start=1
                     /product="centrin-binding protein Sfi1"
                     /protein_id="XP_018736946.1"
                     /db_xref="GeneID:30033930"
                     /translation="MTSSHRANDDGSEIGQDAISTVDGLTYYDPGHLTSDEDPESFSN
                     SVLRAAARRLSNVNTSAGDEEDQESEEDFDDGDVLQQMKSPIQANRDHQPILPAPPIP
                     HDAIRKTKLTSSDVQLLRLVTEAADRRIRSNRSNSPIKDNGDSSLNEADFAELFQTYK
                     VFTARNKITPENNPSYYHCLNVIVHLCSYPQETWRERLEQLLTDFSSAVTRRLRYQDL
                     EQRLKKFQLYYQSRVLGLWYSRYVEQSMYDQNLQTVAAIRYRQTLKRDAFKVWKYNFE
                     VEQWSLSSAELRYEKSLLRKSLAKLYNKSSSIEGDRNIAKMFILGKFLSKWSKSYHYN
                     KQIGKSASLRYMSGLKRRIFYDWTFKFDEEMAEARANETIAIKCFNSWKNKTARFIQI
                     GLKTEEQADARLAERAIRQWSNLLADRSNDYSLATSVYKKNLAGTVLAVWKKRTQLSL
                     AAYPLLEKNWQSKASVVFGNWHLRTLQSLEAKRFRDFMLCHRILRSWRLQAGAVLIIK
                     GIDVNIVKQRFHCWLLLERLELVLRYRNNSIKLKVLKHWFIRSRRSFRHNWALHKEAV
                     SYDCARTQIKALFSWQRRLKSHRQDEQNAQGIYKQRKQKEYFSKYLAALFEYSQNYHL
                     ACKTYERSVVTRTLLEWRDEAYRRKFKRLAATYREQKRKFNHQRLKVVFVFWRSRYAE
                     VVNDQQLALSMITQRDLLVKKSTFHGWASKIDHFESELDRAIYTYNANLLSLAIEKWR
                     QKNTKIQQDNDMAGLRDMNQQWSLLGKVLRGWSYKVSERKRDYSLADDIYSKRQRSKF
                     GRIWKLWHAKYSEQTLMRQFGQTNIGFTELEENKSPTARFKNPTQNIPHTIARIPQGA
                     SGSPDTRHFLTSITKPSTLFNTSLLETPTRARASGINVPLTAVEQWRKMKSSSKLRNK
                     LSDSNESNEPNDPEMNLTDN"
     gene            <280181..>281587
                     /gene="OST1"
                     /locus_tag="AWJ20_2061"
                     /db_xref="GeneID:30033931"
     mRNA            <280181..>281587
                     /gene="OST1"
                     /locus_tag="AWJ20_2061"
                     /product="Ost1p"
                     /transcript_id="XM_018878989.1"
                     /db_xref="GeneID:30033931"
     CDS             280181..281587
                     /gene="OST1"
                     /locus_tag="AWJ20_2061"
                     /inference="similar to AA sequence:KEGG_Orthology:K12666"
                     /note="Alpha subunit of the oligosaccharyltransferase
                     complex of the ER lumen; complex catalyzes
                     asparagine-linked glycosylation of newly synthesized
                     proteins; GO_component: GO:0005783 - endoplasmic reticulum
                     [Evidence IEA,IEA]; GO_component: GO:0005789 - endoplasmic
                     reticulum membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA,IEA]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0008250 - oligosaccharyltransferase
                     complex [Evidence IPI] [PMID 10358084]; GO_component:
                     GO:0008250 - oligosaccharyltransferase complex [Evidence
                     IPI] [PMID 16297388]; GO_component: GO:0008250 -
                     oligosaccharyltransferase complex [Evidence IPI] [PMID
                     9405463]; GO_function: GO:0004579 -
                     dolichyl-diphosphooligosaccharide-protein glycotransferase
                     activity [Evidence IEA]; GO_function: GO:0004579 -
                     dolichyl-diphosphooligosaccharide-protein glycotransferase
                     activity [Evidence IDA] [PMID 9015380]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]; GO_process:
                     GO:0006487 - protein N-linked glycosylation [Evidence IDA]
                     [PMID 9015380]; GO_process: GO:0018279 - protein N-linked
                     glycosylation via asparagine [Evidence IPI] [PMID
                     9988747]; GO_process: GO:0006486 - protein glycosylation
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Ost1p"
                     /protein_id="XP_018736947.1"
                     /db_xref="GeneID:30033931"
                     /translation="MRLVNLLQVSVALFSVASAESIIPKTFENVQLTQSIDLTGSYLK
                     RSLDITARNIADEPQQVYIVAVDSKAFPNLSILEGQDKSTGRSVLARRIEDAHDDGVE
                     YYQLSLREPVQPGEELNLLVAEAYSGLLSPLPEVGGQDDEQYLVYSGSKYALSPYDTL
                     VSSLKIKIYGTYAEELTIGDDEPEQATVEGSGHILSFGEYKELAPLSSKPFKLRYSNP
                     RPLVRADKLERDIWVSHWGASVSIEETYWLTNIGTRLKDSFSRLDYNKGQSQYNLNVA
                     SIRQLRFPLGPNARDAYYTDLVGNVSTSHFRSNGQESILEIAPRYPVFGGWHYNFTVG
                     WSHDLSDFVKDVGNENYLLKIPIIQGPQDISYGEVDVRVILPEGASDIQVVSLFGAST
                     DISNTYSFLDTKGRPTVEFKYNNLIDGHRSGEFFVQYTYTTGDSLRKPLAIALTFASF
                     FTLFLVFDKIDVSIFRKK"
     gene            complement(<281858..>283507)
                     /locus_tag="AWJ20_2062"
                     /db_xref="GeneID:30033932"
     mRNA            complement(<281858..>283507)
                     /locus_tag="AWJ20_2062"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878990.1"
                     /db_xref="GeneID:30033932"
     CDS             complement(281858..283507)
                     /locus_tag="AWJ20_2062"
                     /inference="similar to AA sequence:KEGG_Orthology:K02605"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736948.1"
                     /db_xref="GeneID:30033932"
                     /translation="MVSISSKECPNLKTALKLIVARLTESQSAQGGSAAEDNVADEEK
                     DEDLEGEDVPMGANDIRYDRRLRYDLDILAQWCNKQVRSEAVTSLDQLRIVISIQDAD
                     SFQVSILTGLIEMMQSYITTIPLKLMLNVATSLEVFQEKLPRKCIRLLRGKAFQAQMA
                     EGIMKILRETLFKYDESTLLLSPDLFNSLVHRQKQSLESVDTFISSLKYIFMAHYYSN
                     PFSVLTTGNEHVNGFITSQHLRALRMLPSFKTFVERKLEQGSYSEAAKLLEDDDYLKS
                     LISISIEEFREYARNVLSSIEIIIQLEQSLGYEESCEFRNTMDLYPAALSGELINLPK
                     GRRGTTFIDSLISKVRKLDDESEMPFIVDQLETICHDDKSGVAWDIYSRFQEKCHSAL
                     DASQPLNMANIFADTLETHFKFALVSYKEMFLYEVLLSDLFTLQENVFLPTYRGALEL
                     GLSNPKHYWGDVTESTAQAPHISVLYQLYRESSVFINIFDYYSVFKGLIHRPDNLADD
                     EWDRKSLAWFLQGIAELKFIGIIRDSKRKFECVEKIAWKDL"
     gene            complement(<285387..>285484)
                     /locus_tag="AWJ20_2063"
                     /db_xref="GeneID:30033933"
     tRNA            complement(<285387..>285484)
                     /locus_tag="AWJ20_2063"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:30033933"
     gene            complement(<285954..>286562)
                     /gene="FRE2"
                     /locus_tag="AWJ20_2064"
                     /db_xref="GeneID:30033934"
     mRNA            complement(<285954..>286562)
                     /gene="FRE2"
                     /locus_tag="AWJ20_2064"
                     /product="Fre2p"
                     /transcript_id="XM_018878991.1"
                     /db_xref="GeneID:30033934"
     CDS             complement(285954..286562)
                     /gene="FRE2"
                     /locus_tag="AWJ20_2064"
                     /note="Ferric reductase and cupric reductase; reduces
                     siderophore-bound iron and oxidized copper prior to uptake
                     by transporters; expression induced by low iron levels but
                     not by low copper levels; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 8164662];
                     GO_function: GO:0052851 - ferric-chelate reductase (NADPH)
                     activity [Evidence IEA]; GO_function: GO:0000293 -
                     ferric-chelate reductase activity [Evidence IDA] [PMID
                     8164662]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_process: GO:0015677 -
                     copper ion import [Evidence IDA] [PMID 9153234];
                     GO_process: GO:0006825 - copper ion transport [Evidence
                     IEA]; GO_process: GO:0006811 - ion transport [Evidence
                     IEA]; GO_process: GO:0055072 - iron ion homeostasis
                     [Evidence IEA]; GO_process: GO:0006826 - iron ion
                     transport [Evidence IDA] [PMID 8164662]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Fre2p"
                     /protein_id="XP_018736949.1"
                     /db_xref="GeneID:30033934"
                     /translation="MSILSEQENRTKTMPVMVEGFYKSFRQFSNYDNVMLVAGGTGIT
                     TAFSQVTSLLFQDRSRTIKLIWAVRSPAPLNWFSKEILYLRSWPKSIELQIYISQALF
                     ENDCGAKPCSPLDIEAGVQGVVGSQALDYGCGSNYQLAFITGGRPELQKEIANFIKHA
                     SGSIAICSCGPPTFIDRARYTFVHNMYKSDYHIDYFEEPYSC"
     gene            complement(<288477..>289481)
                     /locus_tag="AWJ20_2065"
                     /db_xref="GeneID:30033935"
     mRNA            complement(<288477..>289481)
                     /locus_tag="AWJ20_2065"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878992.1"
                     /db_xref="GeneID:30033935"
     CDS             complement(288477..289481)
                     /locus_tag="AWJ20_2065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736950.1"
                     /db_xref="GeneID:30033935"
                     /translation="MSSHVQQSIPPGLLSLLVTKYEEKSKKHAIQNLYRLQVESYKND
                     SGKYECPICQKSYVHFKHLRRHNRQHTGYRPHVCHICRDTFCRSDILKRHYERCFSKF
                     IATGKLSAKSRVPKVSKEYVQSANSPPLTDTPLPDQHLSTTDPVTLPGNMMGGTDTNS
                     KLNYTPTFYPAHPSPPSLDYIQSRDEFRQVVPRQPIYSSDNISIMPIDSPEYISSPGP
                     PNCPGAGPLIKQEELTPPAFESYSARDSCTSLVSPVSLDETVNSLPITGIVDDTPPTE
                     NEYFPRFVSNIRKPGQFYCEDTYGYRPDQTTIIANGPRIISVSSASNDIVLRWLEPDW
                     "
     gene            <292168..>293631
                     /locus_tag="AWJ20_2066"
                     /db_xref="GeneID:30033936"
     mRNA            <292168..>293631
                     /locus_tag="AWJ20_2066"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878993.1"
                     /db_xref="GeneID:30033936"
     CDS             292168..293631
                     /locus_tag="AWJ20_2066"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736951.1"
                     /db_xref="GeneID:30033936"
                     /translation="MAKNRKKNWQQEYGHEAGRLTRSKSQALKKILDTPGDRNNDDEF
                     PVLKRLSLYASSIKGDGNCLFRSFSDQYYGDNGDRHQEVRAEVVNYMKEHSDYFALFL
                     EGSGSGNESWPAYIKRMAKDGVYGDNLEIVAFARRYGVNVMIYQNDFMYVVSCQEDDK
                     EKNGVVRDIHIAYHTWEHYSSVRNLAGPHSGLPEVQPSLVEGGGAIEPSSGTSDDVPK
                     WMMDAIKRSIPYPPTEQMENLIVKLFRKYNNSHDFGRIVEEIIMMDNGDGEVNFDTDV
                     EVVDSLSDIDKPTTTSMIDQDKVTNDSSAKSIQKDQDTSVQVANSPETSMGVDEINSS
                     MSNSPEDSSSRSSSTSNTSSTTVASSVDDEGDESKGEAKLSNINGKRNSSLLSNELTE
                     ESESDRTHEISVIPRSRAKKDAVTNSAPRVKRLTAREKKERQKKEAAERKRASKISSV
                     SDRSRSTTAGLSDTSSSTTTATPSTTPSTPGIRTMYI"
     gene            complement(<294890..>295204)
                     /gene="TRX1"
                     /locus_tag="AWJ20_2067"
                     /db_xref="GeneID:30033937"
     mRNA            complement(<294890..>295204)
                     /gene="TRX1"
                     /locus_tag="AWJ20_2067"
                     /product="thioredoxin TRX1"
                     /transcript_id="XM_018878994.1"
                     /db_xref="GeneID:30033937"
     CDS             complement(294890..295204)
                     /gene="TRX1"
                     /locus_tag="AWJ20_2067"
                     /inference="similar to AA sequence:KEGG_Orthology:K03671"
                     /note="Cytoplasmic thioredoxin isoenzyme; part of
                     thioredoxin system which protects cells against oxidative
                     and reductive stress; forms LMA1 complex with Pbi2p; acts
                     as a cofactor for Tsa1p; required for ER-Golgi transport
                     and vacuole inheritance; with Trx2p, facilitates
                     mitochondrial import of small Tims Tim9p, Tim10p, Tim13p
                     by maintaining them in reduced form; abundance increases
                     iunder DNA replication stress; TRX1 has a paralog, TRX2,
                     that arose from the whole genome duplication;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     8603912]; GO_component: GO:0000324 - fungal-type vacuole
                     [Evidence IPI] [PMID 9657146]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IEA];
                     GO_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IDA] [PMID 22984289]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0015036 - disulfide oxidoreductase activity [Evidence
                     IDA] [PMID 19362171]; GO_function: GO:0015036 - disulfide
                     oxidoreductase activity [Evidence ISS] [PMID 1988444];
                     GO_function: GO:0015035 - protein disulfide oxidoreductase
                     activity [Evidence IEA]; GO_process: GO:0006888 - ER to
                     Golgi vesicle-mediated transport [Evidence IDA] [PMID
                     9813082]; GO_process: GO:0045454 - cell redox homeostasis
                     [Evidence IEA]; GO_process: GO:0045454 - cell redox
                     homeostasis [Evidence TAS] [PMID 11169096]; GO_process:
                     GO:0034599 - cellular response to oxidative stress
                     [Evidence ISS] [PMID 1988444]; GO_process: GO:0009263 -
                     deoxyribonucleotide biosynthetic process [Evidence IEA];
                     GO_process: GO:0006662 - glycerol ether metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0080058 - protein deglutathionylation [Evidence
                     IDA,IGI] [PMID 20074363]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0006890 -
                     retrograde vesicle-mediated transport, Golgi to ER
                     [Evidence IDA] [PMID 9813082]; GO_process: GO:0042144 -
                     vacuole fusion, non-autophagic [Evidence IDA] [PMID
                     9657146]; GO_process: GO:0000011 - vacuole inheritance
                     [Evidence IMP] [PMID 8603912]; GO_process: GO:0000011 -
                     vacuole inheritance [Evidence IMP] [PMID 9015301]"
                     /codon_start=1
                     /product="thioredoxin TRX1"
                     /protein_id="XP_018736952.1"
                     /db_xref="GeneID:30033937"
                     /translation="MTVNPITSLSQFQEEIKFSGLTVIDFYATWCGPCKMISPVLDRI
                     SDATPSAHFFKVDVDAVPDVASENEISAMPTLLFFKNGVKVESVVGANIAKINAVVKD
                     LA"
     gene            <294927..>295127
                     /locus_tag="AWJ20_2068"
                     /db_xref="GeneID:30033938"
     mRNA            <294927..>295127
                     /locus_tag="AWJ20_2068"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878995.1"
                     /db_xref="GeneID:30033938"
     CDS             294927..295127
                     /locus_tag="AWJ20_2068"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736953.1"
                     /db_xref="GeneID:30033938"
                     /translation="MLAPTTDSTLTPFLKNNKVGMAEISFSEATSGTASTSTLKKWAE
                     GVASEILSRTGEIILQGPHQVA"
     gene            <296328..>296669
                     /locus_tag="AWJ20_2069"
                     /db_xref="GeneID:30033939"
     mRNA            <296328..>296669
                     /locus_tag="AWJ20_2069"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878996.1"
                     /db_xref="GeneID:30033939"
     CDS             296328..296669
                     /locus_tag="AWJ20_2069"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736954.1"
                     /db_xref="GeneID:30033939"
                     /translation="MGVESLTICSANLDKNVTKEHIYSLFLPFGPIVDVVPVTDPKHG
                     FRGSADIEFETEEDAAAAIDNMEGAQVFGKTLHVRLSRKDLSEGAPRVDMNKALWAQD
                     HEQDQPSTEPE"
     gene            complement(<301055..>302038)
                     /locus_tag="AWJ20_2070"
                     /db_xref="GeneID:30033941"
     mRNA            complement(<301055..>302038)
                     /locus_tag="AWJ20_2070"
                     /product="hypothetical protein"
                     /transcript_id="XM_018878998.1"
                     /db_xref="GeneID:30033941"
     CDS             complement(301055..302038)
                     /locus_tag="AWJ20_2070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736955.1"
                     /db_xref="GeneID:30033941"
                     /translation="MASGAKYRPQRWRREARGLEDSFSKLNIEGESHAEADAKARARR
                     ERFSQPAKKEEYGLISRGEDNRLRVDSKARRTYFYQTQLRALKIIAASTSQRQYIEDV
                     LKIVDHEVSDSYQAVDTNGRHQSSDTDSEDSVLMSLRKLREALLPIEPDKFTKQVFLF
                     SVRMAVLAGKYQAFIPSVLYILDVIHPVVPLSFDEFRQVALLHVYHTAHFSNDVGTAY
                     KTLYHYLPDDKRAWTVLQALASNNFVSWVQQKRTEPDLWLRLSLDQNHATMAKNAIPT
                     ISKSYMKLHESSIERLLGLDWNTLTSNPNIGCVWPKDSTGTATIRQRKTQS"
     gene            <303610..>305703
                     /gene="TRP5"
                     /locus_tag="AWJ20_2071"
                     /db_xref="GeneID:30033942"
     mRNA            <303610..>305703
                     /gene="TRP5"
                     /locus_tag="AWJ20_2071"
                     /product="tryptophan synthase TRP5"
                     /transcript_id="XM_018878999.1"
                     /db_xref="GeneID:30033942"
     CDS             303610..305703
                     /gene="TRP5"
                     /locus_tag="AWJ20_2071"
                     /inference="similar to AA sequence:KEGG_Orthology:K01694"
                     /note="Tryptophan synthase; catalyzes the last step of
                     tryptophan biosynthesis; regulated by the general control
                     system of amino acid biosynthesis; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016829 - lyase
                     activity [Evidence IEA]; GO_function: GO:0004834 -
                     tryptophan synthase activity [Evidence IEA,IEA];
                     GO_function: GO:0004834 - tryptophan synthase activity
                     [Evidence IDA] [PMID 391563]; GO_function: GO:0004834 -
                     tryptophan synthase activity [Evidence ISO] [PMID
                     6276387]; GO_function: GO:0004834 - tryptophan synthase
                     activity [Evidence IDA] [PMID 6342605]; GO_process:
                     GO:0009073 - aromatic amino acid family biosynthetic
                     process [Evidence IEA]; GO_process: GO:0008652 - cellular
                     amino acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0000162 - tryptophan biosynthetic process
                     [Evidence IEA,IEA,IEA]; GO_process: GO:0000162 -
                     tryptophan biosynthetic process [Evidence IMP] [PMID
                     10790693]; GO_process: GO:0006568 - tryptophan metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="tryptophan synthase TRP5"
                     /protein_id="XP_018736956.1"
                     /db_xref="GeneID:30033942"
                     /translation="MSANLNATFAKCKKEGRNAMLTFLTAGFPSVAETVPLLKSLQDG
                     GADIIELGVPFSDPIADGPTIQKANQIALENGVSVHVCLELVRQARAAGVNIPIILMG
                     YYNPILQYGENKFVEDAKKAGVDGFLLVDLPPEEASRFRKISSNSGLSYIPLIAPSTT
                     NERLAQLSEIADSFLYVVSRMGTTGVAGGLDSNVSTLLKRVRQFTGEKPLAVGFGIST
                     RENYLTVSPVADGIVIGSYLISLIDNTPKEERLETVKKYINGIVGGREVVVDPRPESP
                     STTPVLSEDEEEQKKQFYALVDRFGDYGGQYVPEVLHQCLSELEKGFNEAIHDEKFWE
                     ELRSYYPYMGRPSNLYFADRLSEKVGGAKIWLKREDLNHTGSHKINNALAQVLIARRL
                     GKTQVIAETGAGQHGVATATVAAKFGLKCKVFMGAEDCRRQALNVFRMKLLGAEVVPV
                     HAGTKTLRDACSEALRTWVTTIGDTHYVLGSATGPHPFPTMVRTFQSVIGQETKEQFA
                     KYNDGKLPDVVVACVGGGSNCSGMFAPFIEDKSVKLVGVEAGGEGLQTDKHSATLSAG
                     KSGVLHGAKTYVLQNADGQVQDTHSISAGLDYPGVGPELASWKDSGRVKFIAATDLEA
                     LQGFRILSETEGIIPAMESSHAIHGAVELAKTMSPDEHVVICLSGRGDKDVQNIADLL
                     PTYGPKLGWDVRFEN"
     gene            <305901..>308699
                     /locus_tag="AWJ20_2072"
                     /db_xref="GeneID:30033943"
     mRNA            <305901..>308699
                     /locus_tag="AWJ20_2072"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879000.1"
                     /db_xref="GeneID:30033943"
     CDS             305901..308699
                     /locus_tag="AWJ20_2072"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736957.1"
                     /db_xref="GeneID:30033943"
                     /translation="MWPSWRSQGPKLGYGHDGFGIYVPHLVPETPWLFARRHDLGYKF
                     QSTGILKTYDASQDYRVINKKVDMDIIDDVKRRGQRLGELNPLQGDYIPNDLLTSYNS
                     ESYGFLHRTKHDPLKGSCIAIGSIRETVSSEGADSKTESDLQESAEEYSDEEESDFNS
                     RQAIAYVNGKDQYQVKFGFIDKASSEFSSANGSSYYANMPDINVATSFNVNSPVMQVE
                     FAEPEPEISPYMLVRSKNGTKILSVTSENDKIAVYDLLDIPFQSKQAYNFETLSRPVE
                     HCHSTFNPWNYANVATINSQGVWSLWDLSSEQSLVSLSSPTTMSAFNRHSQTSSPWNK
                     IIWGADSSSLYSINRKYLQLFDIRSDSATSSKGDTVLECTDRETHFRDMARSKINDNQ
                     FFVLDSKSVKWMDMRNPGSVLLSWDHFLDLEDTTIKLTVNGIKDNVHVVGVYSQIHQA
                     NFLYQFVESEGLPSSADDPILIVSPPDELAQSLELIPFTAEGNDGDIEMINLVRLPVD
                     GALQGEILTSDPDYQSENHTNNIDNGINSDIVNSANGVVKANKNTEYIESISVETDDV
                     RYKFDYILPDLVPVSKLDFRAVYEFLFENLSQIPEETSKDEDIENFARHLGETINSMF
                     IAKQSTSKSTGMNEDPDIRKRRTLTLLELSEIGTPLLRLYNNLEDLSALIHQLTDHYK
                     DTKISVKELRRDMNTLFGGEFVNNIQNNYDYLLSIWTNSLNTQTLGPERVAELTAQRK
                     KLALYIIIRLTLTSVGVYVEGESKPILQDTHLLKPLSKYTQVRNPHDFNLTANTELLL
                     DEWELGTNVDDYKWYRLGDTPMEDDTSSSVPDRYQQIMSQLSQHSQRMISPQPVRVRS
                     SRAKTTASSQPVGSNPFSSPIQSTTRLATSSRSSSQRVAPLQSSQSNMQRMAQSQPIQ
                     GESSQRRLKRKKRNEGFG"
     gene            <309160..>311664
                     /gene="CWH41"
                     /locus_tag="AWJ20_2073"
                     /db_xref="GeneID:30033944"
     mRNA            <309160..>311664
                     /gene="CWH41"
                     /locus_tag="AWJ20_2073"
                     /product="Cwh41p"
                     /transcript_id="XM_018879001.1"
                     /db_xref="GeneID:30033944"
     CDS             309160..311664
                     /gene="CWH41"
                     /locus_tag="AWJ20_2073"
                     /inference="similar to AA sequence:KEGG_Orthology:K01228"
                     /note="Processing alpha glucosidase I; ER type II integral
                     membrane N-glycoprotein involved in assembly of cell wall
                     beta 1,6 glucan and asparagine-linked protein
                     glycosylation; also involved in ER protein quality control
                     and sensing of ER stress; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IDA] [PMID 8576053]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]; GO_function: GO:0016787 - hydrolase activity
                     [Evidence IEA]; GO_function: GO:0016798 - hydrolase
                     activity, acting on glycosyl bonds [Evidence IEA];
                     GO_function: GO:0004573 - mannosyl-oligosaccharide
                     glucosidase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004573 - mannosyl-oligosaccharide glucosidase activity
                     [Evidence IDA] [PMID 14680956]; GO_function: GO:0004573 -
                     mannosyl-oligosaccharide glucosidase activity [Evidence
                     IMP,ISS] [PMID 9430631]; GO_process: GO:0009272 -
                     fungal-type cell wall biogenesis [Evidence IMP] [PMID
                     9430631]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0009311 - oligosaccharide
                     metabolic process [Evidence IEA]; GO_process: GO:0006487 -
                     protein N-linked glycosylation [Evidence IMP] [PMID
                     9363442]"
                     /codon_start=1
                     /product="Cwh41p"
                     /protein_id="XP_018736958.1"
                     /db_xref="GeneID:30033944"
                     /translation="MNCQSRRRPSPYNWSQFNHKLKMVHWPHFLSLANLIALSWLCVV
                     FVSSSPQSVLKSAPLINEYARQSNSSLLWGPYRSNLYFGIRPRIPKSLLSGLMWYNAD
                     SYDGLKNLRHTCEQGDAMAGYGWQQYDPRSGGHQVINDLDNFVNISTDFVKTEVGSWA
                     VRVKGVPQNEQRRTTVIFYSGLEGHGKLDLESQLTPEGIEGPVELVGSSPELGDFSIE
                     VTTGPSTNRHPKTSHVVDKVRPSQNSHYASLMMPDDNVWLAKEVFQTFIEDNVSQFSA
                     LFDEADMIPPWSVFTLQNRDDLKGNVHMIQRTYQGSFEFDILYNPIEISESSKISSRK
                     LGDLLELSLSEFDTKFKRAFQFQPPFDSSLKHELFAKEMFSNLVGGIGYFYGTSIVDR
                     SLSDLDDDEGDWEVEAAALASGVGKEEGPFELFTAVPSRPFFPRGFYWDEGFHLIPVL
                     DYDADLTLEVLKSWFSLVDGDGWIAREQILGPEARSKVPTEFRTQYPHYANPPTLMLL
                     FSNIAKRAHEWSQSEHGTNFDGSLVLGNAHIEYPELLFSYAEKIYPELQSHYEWFRRT
                     QKGEIRQWDREAFSSKEGYRWRGRTPNHCLTSGLDDYPRAAMPHPGELHVDLLSWIGM
                     MTRSIKEIARVLGKDDDVEMYSEIEEAIVKNLYDLHWDHKEQMYCDSTIDDYEESVHV
                     CHRGYVSLFPFMLQLIPEDSTEQLLAAINDIKDPGGLWSPYGIRSLSKSDEFFGTKEN
                     YWRGPIWINMNYMILESLRYYGTSETSSAEVKSLSSEIYKELRVNIVNNVFNRWEETG
                     FAWEQYDSNTGKAQGVKHFLGWTSLVIKIMAMPEEL"
     gene            complement(<311800..>312810)
                     /gene="RTC2"
                     /locus_tag="AWJ20_2074"
                     /db_xref="GeneID:30033945"
     mRNA            complement(<311800..>312810)
                     /gene="RTC2"
                     /locus_tag="AWJ20_2074"
                     /product="Rtc2p"
                     /transcript_id="XM_018879002.1"
                     /db_xref="GeneID:30033945"
     CDS             complement(311800..312810)
                     /gene="RTC2"
                     /locus_tag="AWJ20_2074"
                     /note="Putative vacuolar membrane transporter for cationic
                     amino acids; likely contributes to amino acid homeostasis
                     by exporting cationic amino acids from the vacuole;
                     positive regulation by Lys14p suggests that lysine may be
                     the primary substrate; member of the PQ-loop family, with
                     seven transmembrane domains; similar to mammalian PQLC2
                     vacuolar transporter; RTC2 has a paralog, YPQ1, that arose
                     from the whole genome duplication; GO_component:
                     GO:0071627 - integral component of fungal-type vacuolar
                     membrane [Evidence IDA] [PMID 23169667]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0031966 - mitochondrial membrane [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005774 - vacuolar
                     membrane [Evidence IEA]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA]; GO_function: GO:0015326 - cationic
                     amino acid transmembrane transporter activity [Evidence
                     IMP,ISA] [PMID 23169667]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA]; GO_process: GO:0034488 -
                     basic amino acid transmembrane export from vacuole
                     [Evidence IMP,ISA] [PMID 23169667]; GO_process: GO:0006810
                     - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Rtc2p"
                     /protein_id="XP_018736959.1"
                     /db_xref="GeneID:30033945"
                     /translation="MLENIDPPSHLRVVLSGMAGSSSLACWIVLLLPQLIEQWRLKSA
                     DGISIGFLIIWLLGDVTNLAGSLWANLRPEVILLAVWYCIADSLIMVSYFYYKRLARL
                     RQARKAHKHKQHRPSSGDDHEEDPTAPLLDRRNSANRKRPSTSAINEDDEVNTNGPSH
                     HEHHEHRHHHHHNQTRRDSLTSIVLETSSSSGIFSKVVLPVLFVIASGILGYLVSGNQ
                     SDNTGEISDEPLALGPQILGYTSAVLYLSARIPQIIQNHQRRSTHGLSLVFFVFSVLG
                     NATYAAGILLYRTDIQWVTLYFPWLLGSLGTILEDCVIFLQFYMYDSEHKDEDSESAV
                     HD"
     gene            <314581..>315369
                     /gene="RPL8B"
                     /locus_tag="AWJ20_2075"
                     /db_xref="GeneID:30033946"
     mRNA            <314581..>315369
                     /gene="RPL8B"
                     /locus_tag="AWJ20_2075"
                     /product="ribosomal 60S subunit protein L8B"
                     /transcript_id="XM_018879003.1"
                     /db_xref="GeneID:30033946"
     CDS             314581..315369
                     /gene="RPL8B"
                     /locus_tag="AWJ20_2075"
                     /inference="similar to AA sequence:KEGG_Orthology:K02936"
                     /note="Ribosomal 60S subunit protein L8B; required for
                     processing of 27SA3 pre-rRNA to 27SB pre-rRNA during
                     assembly of large ribosomal subunit; depletion leads to a
                     turnover of pre-rRNA; L8 binds to Domain I of 25S and 5.8
                     S rRNAs; mutation results in decreased amounts of free 60S
                     subunits; homologous to mammalian ribosomal protein L7A,
                     no bacterial homolog; RPL8B has a paralog, RPL8A, that
                     arose from the whole genome duplication; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0022625 - cytosolic large ribosomal subunit [Evidence
                     IDA] [PMID 11983894]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA,IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IC] [PMID 11983894]; GO_process:
                     GO:0002181 - cytoplasmic translation [Evidence IC] [PMID
                     11983894]; GO_process: GO:0000470 - maturation of LSU-rRNA
                     [Evidence IMP] [PMID 22893726]; GO_process: GO:0042254 -
                     ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L8B"
                     /protein_id="XP_018736960.1"
                     /db_xref="GeneID:30033946"
                     /translation="MTQPAKGKKPAPAPFSTKTASTKAAKNPLIEKRPRNFGIGQDIQ
                     PKRNLSRFVKWPEYVRLQRQKKILNLRLKVPPAIAQFQNTLDKNTAAQAFKIFNKYRP
                     ETAAEKKERLTKEAAAIAEGKKKEDVSEKPYVVKYGLNHVVSLIENKKPQLVLIANDV
                     DPIELVVFLPALCRKMGVPYAIIKGKARLGTLVHKKTAAVVALTEVKSDDKAALSTLL
                     STIEANYSSKYEELRRKWGGGIMGAKAQAKIEKRRKILEAAVKV"
     gene            <315607..>317217
                     /locus_tag="AWJ20_2076"
                     /db_xref="GeneID:30033947"
     mRNA            <315607..>317217
                     /locus_tag="AWJ20_2076"
                     /product="putative membrane protein"
                     /transcript_id="XM_018879004.1"
                     /db_xref="GeneID:30033947"
     CDS             315607..317217
                     /locus_tag="AWJ20_2076"
                     /note="similar to Pantoea sp. aB, conserved hypothetical
                     protein (NCBI: ZP_07377486.1)"
                     /codon_start=1
                     /product="putative membrane protein"
                     /protein_id="XP_018736961.1"
                     /db_xref="GeneID:30033947"
                     /translation="MSSSLVPDRTPGSMSQYSKINLVSYLLLCLFVISFLVFLNSTQP
                     FVLTDILGDDVNIGDKVGSLAFADEIVSIVLCPLWGSLSDKVGTRPVSVIGLLILSTS
                     LFFYTTGNSVYPDLLLLRMFFAVGTSACVSMIPAILAELSASYEESKFDGYRQVEDMN
                     WGDDVSNDEENDALEAIEERNAYFDDPTVVSRDTPFFEQSEASPKSYRNAKLAGLVGV
                     VTGIGAVLSVSLFLPLPTWLDRNSGGENDAKIALRNSYYIVSAIAFFVSILLFLGLHK
                     DRSKSFRLWLNGGSVSIFDEAALDTMPDSLPYFQTIKMGFLAAKDRQVALSYVGGLVA
                     RSATVALTLFVPLAVNFYFYEQGICKVGDPHDALPDVKKGCHEAYVLAAILTGIANTV
                     SLVFAPIWGLLGDYIGQHGSLMVSALVGFTGCIGFAFVEKPNSPVSFVMACFLGAGQI
                     GAIVLSMSMCTNSRRQYNGSISGVYSLSGGLGILLITKVGGYISDIWKGAPFVILAGF
                     YFLLCIAIIWALPKGESKGFSRLFSPPR"
     gene            <317638..>317724
                     /locus_tag="AWJ20_2077"
                     /db_xref="GeneID:30033948"
     tRNA            <317638..>317724
                     /locus_tag="AWJ20_2077"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:30033948"
     gene            <318406..>319170
                     /gene="RPL2A"
                     /locus_tag="AWJ20_2078"
                     /db_xref="GeneID:30033949"
     mRNA            <318406..>319170
                     /gene="RPL2A"
                     /locus_tag="AWJ20_2078"
                     /product="ribosomal 60S subunit protein L2A"
                     /transcript_id="XM_018879005.1"
                     /db_xref="GeneID:30033949"
     CDS             318406..319170
                     /gene="RPL2A"
                     /locus_tag="AWJ20_2078"
                     /inference="similar to AA sequence:KEGG_Orthology:K02938"
                     /note="Ribosomal 60S subunit protein L2A; homologous to
                     mammalian ribosomal protein L2 and bacterial L2; RPL2A has
                     a paralog, RPL2B, that arose from the whole genome
                     duplication; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0022625 - cytosolic
                     large ribosomal subunit [Evidence IDA] [PMID 18782943];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0030687 - preribosome, large subunit
                     precursor [Evidence IDA] [PMID 23212245]; GO_component:
                     GO:0030529 - ribonucleoprotein complex [Evidence IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA,IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0019843 - rRNA binding [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA]; GO_function: GO:0003735 -
                     structural constituent of ribosome [Evidence IDA] [PMID
                     18782943]; GO_process: GO:0002181 - cytoplasmic
                     translation [Evidence IDA] [PMID 18782943]; GO_process:
                     GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L2A"
                     /protein_id="XP_018736962.1"
                     /db_xref="GeneID:30033949"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRKGAAKLRTLDFAERHGYIRGV
                     VKKILHDPGRGAPLATVAFRDPYKYKVREETFIANEGVYTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTILSNVEEKVGDRGALGRTSGNYVIVIGHNPEEGKTRLKLPSGAKKIVSS
                     QARGVVGVVAGGGRIDKPLLKAGNAFHKFKVKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVAGQKAGLIAARRTGLLRGTQKTKD"
     gene            <319897..>323022
                     /gene="SMC2"
                     /locus_tag="AWJ20_2079"
                     /db_xref="GeneID:30033950"
     mRNA            <319897..>323022
                     /gene="SMC2"
                     /locus_tag="AWJ20_2079"
                     /product="condensin subunit SMC2"
                     /transcript_id="XM_018879006.1"
                     /db_xref="GeneID:30033950"
     CDS             319897..323022
                     /gene="SMC2"
                     /locus_tag="AWJ20_2079"
                     /inference="similar to AA sequence:KEGG_Orthology:K06674"
                     /note="Subunit of the condensin complex; condensin
                     reorganizes chromosomes during both mitosis and meiosis;
                     essential SMC chromosomal ATPase family member that forms
                     a subcomplex with Smc2p that has ATP-hydrolyzing and
                     DNA-binding activity, but other condensin subunits are
                     required for chromatin binding; required for clustering of
                     tRNA genes at the nucleolus; GO_component: GO:0005694 -
                     chromosome [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0000796 - condensin complex [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0000799 -
                     nuclear condensin complex [Evidence IDA] [PMID 10811823];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0003680 - AT DNA binding [Evidence IDA]
                     [PMID 9727028]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IDA] [PMID 9727028]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IDA] [PMID 12719426];
                     GO_function: GO:0000217 - DNA secondary structure binding
                     [Evidence IDA] [PMID 9727028]; GO_function: GO:0003682 -
                     chromatin binding [Evidence IDA] [PMID 16055730];
                     GO_function: GO:0003690 - double-stranded DNA binding
                     [Evidence IDA] [PMID 9727028]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006310
                     - DNA recombination [Evidence IEA]; GO_process: GO:0006281
                     - DNA repair [Evidence IEA]; GO_process: GO:0007049 - cell
                     cycle [Evidence IEA]; GO_process: GO:0051301 - cell
                     division [Evidence IEA]; GO_process: GO:0030261 -
                     chromosome condensation [Evidence IEA]; GO_process:
                     GO:0051276 - chromosome organization [Evidence IEA];
                     GO_process: GO:0010032 - meiotic chromosome condensation
                     [Evidence IC] [PMID 10811823]; GO_process: GO:0051307 -
                     meiotic chromosome separation [Evidence IC] [PMID
                     10811823]; GO_process: GO:0007076 - mitotic chromosome
                     condensation [Evidence IEA]; GO_process: GO:0007076 -
                     mitotic chromosome condensation [Evidence IMP] [PMID
                     10811823]; GO_process: GO:0007067 - mitotic nuclear
                     division [Evidence IEA]; GO_process: GO:0000070 - mitotic
                     sister chromatid segregation [Evidence IMP] [PMID
                     10811823]; GO_process: GO:0070550 - rDNA condensation
                     [Evidence IMP] [PMID 10811823]; GO_process: GO:0007130 -
                     synaptonemal complex assembly [Evidence IC] [PMID
                     10811823]; GO_process: GO:0070058 - tRNA gene clustering
                     [Evidence IMP] [PMID 18708579]"
                     /codon_start=1
                     /product="condensin subunit SMC2"
                     /protein_id="XP_018736963.1"
                     /db_xref="GeneID:30033950"
                     /translation="MKVEEIIIDGFKSYATRTVISGWDASFNCITGLNGSGKSNILDA
                     ICFVLGITTMTTVRAQNLQDLIYKRGQAGVTRASVTILFDNSDKSNSPLGFEDQAQFS
                     VTRQIVLGGTSKFLINGHRAQQQSVQQLFQSVQLNINNPNFLIMQGQITKVLNMKPAE
                     ILALIEEAAGTRMFEDRREKAIKTMTKKEKKVEEILNLLHDEIEPKLENLRNEKRTFI
                     EYQQTLSSLERIEKMVVAHDYLKGSEKLLAHSQALEERKELLGNISASVDKLNSEIQN
                     LEEELKRLRKTKEDQISKGGKFQALEKQYKGACQEVARIRTLLELKDSTLKEENEKRD
                     ELKSTLAEHESRLKKQSSQYSTIEKEYETVKAKHVRDNEEISRNEELLQSLQTGVSSK
                     AGQETGYASQLQEVRTIVNNAKTTAAQAKVKQEHVEKLIKEDSAKVTKAQKQNQEMLN
                     TLAGAEEYYNSLKSKLSQAGWDPETIKTLKTKEYELGEQIRSLDDEIESMRRKTSNID
                     FHYSKPSPTFRASSVRGLVAQLFSLDKSKYPQATAIEVCAGGRLFNVVVDNDVTAAQL
                     LQNGKLKRRVTIIPLNKISSSRLSEERLSNAKKLAPGKVDLALNIVGYEADVFAAMEY
                     VFGSTLICKDTATAQLVTFDPKVRAKSVTLDGDIYDPMGTLSGGSKSNSSGLLISLQQ
                     YNELSRLLKEKNEDLANVKEEIARENKLMAQFKDIKKELDLKEHEITLYKQQLESSPS
                     ALVLAKHEERVKELEELSLQISDANKQFEEGGIELSRIEKDMNEFKQNKGSKLGQLKA
                     KVEKLRASYTQSEQVVKQKLEVFQTAQVEIEQLTDDVSTMKEQLEDKTNSIQDLAASI
                     ESINAQLKRAAQTESTYLQQLEAEKSALTGMDDELNTMEEIRDKKRKLVTEQGLESQK
                     LRHEIENLSKEHESLQHAISGLDQKYEWIQDQKQHFGKIGTPYDFSHANVDQSRKQLR
                     QLQERINGMKKTVNSKVMNMIESVEKKEESLKSMIQTIEKDKKKIEDTIVSLDNYKRE
                     ALIKTWEKVSV"
     gene            complement(<323724..>324818)
                     /gene="QCR6"
                     /locus_tag="AWJ20_2080"
                     /db_xref="GeneID:30033952"
     mRNA            complement(join(<323724..324203,324747..>324818))
                     /gene="QCR6"
                     /locus_tag="AWJ20_2080"
                     /product="ubiquinol--cytochrome-c reductase subunit 6"
                     /transcript_id="XM_018879008.1"
                     /db_xref="GeneID:30033952"
     CDS             complement(join(323724..324203,324747..324818))
                     /gene="QCR6"
                     /locus_tag="AWJ20_2080"
                     /inference="similar to AA sequence:KEGG_Orthology:K00416"
                     /note="Subunit 6 of the ubiquinol cytochrome-c reductase
                     complex; the complex, also known as the cytochrome bc(1)
                     complex or Complex III, is a component of the
                     mitochondrial inner membrane electron transport chain;
                     highly acidic protein; required for maturation of
                     cytochrome c1; may be loosely associated with the complex
                     since it is easily released into the intermembrane space;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005758 - mitochondrial intermembrane
                     space [Evidence IDA] [PMID 22984289]; GO_component:
                     GO:0005750 - mitochondrial respiratory chain complex III
                     [Evidence IDA] [PMID 10873857]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0070469 -
                     respiratory chain [Evidence IEA]; GO_function: GO:0008121
                     - ubiquinol-cytochrome-c reductase activity [Evidence
                     IEA]; GO_function: GO:0008121 - ubiquinol-cytochrome-c
                     reductase activity [Evidence IMP] [PMID 8288589];
                     GO_process: GO:0009060 - aerobic respiration [Evidence
                     IMP] [PMID 8288589]; GO_process: GO:1902600 - hydrogen ion
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006122 - mitochondrial electron transport, ubiquinol
                     to cytochrome c [Evidence IEA]; GO_process: GO:0006122 -
                     mitochondrial electron transport, ubiquinol to cytochrome
                     c [Evidence IMP] [PMID 8288589]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]"
                     /codon_start=1
                     /product="ubiquinol--cytochrome-c reductase subunit 6"
                     /protein_id="XP_018736964.1"
                     /db_xref="GeneID:30033952"
                     /translation="MSGITSFWSDLVESIMPTVAYAEEAPKQDAPLDHDSEEVESESK
                     SETETVAKNTGKESSEEETTEESSEESTEESTEESTEESTEEGSEEESEDGEEDDEEE
                     EEEEEEDEPEDILPELREKAAEGPCHSFKHHFEECIERVTAEQQEEGYAEKEYKEDCV
                     EEFFHLSHCIDEQVAPVLFTKLK"
     gene            complement(<326465..>327412)
                     /locus_tag="AWJ20_2081"
                     /db_xref="GeneID:30033953"
     mRNA            complement(<326465..>327412)
                     /locus_tag="AWJ20_2081"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879009.1"
                     /db_xref="GeneID:30033953"
     CDS             complement(326465..327412)
                     /locus_tag="AWJ20_2081"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736965.1"
                     /db_xref="GeneID:30033953"
                     /translation="MSADTETPVEKVEEPTSTPSTTTPANDEPTPSSNGEAAVEYDTK
                     RVYIGNLPFRSTHKDLRDLFEDFHISSLNIPKSKVTHSSGRVFFKKLGYAFAEFPTEE
                     DAKKAVESVNEKVLNDRQLNVRFARVLDRKARKEKSAAAAAAAASTAETNGNDQSSTT
                     TTSSKEGGTSKAAPKKPAPRRRRPTGPDSTDTVFLGNLPVDTTVEELEEFFKPLSPVE
                     VKLAIKKPRKAKRKDAVITLPGRTLGFVKLADEATQKKAIDEYNGKTFKDVELQVKVA
                     TQLVEEEAEEEGAADVSSADATDADATSEAASAPVSAEN"
     gene            <331036..>332076
                     /locus_tag="AWJ20_2082"
                     /db_xref="GeneID:30033954"
     mRNA            <331036..>332076
                     /locus_tag="AWJ20_2082"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879010.1"
                     /db_xref="GeneID:30033954"
     CDS             331036..332076
                     /locus_tag="AWJ20_2082"
                     /inference="similar to AA sequence:KEGG_Orthology:K14684"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736966.1"
                     /db_xref="GeneID:30033954"
                     /translation="MATVKEVGKSATSPSSLASSSSSPPSSLADNPSVIALRNYLALP
                     IVSSFVAGGVAGAVSRTVVSPLERMKIIFQVQGPGSQSYQGVGPTLAKMWREEGWRGF
                     MRGNGINCVRIVPYSAVQFSSYTIYKNFLLSRTPSSKRVDLDTLERLGAGALAGITSV
                     VATYPLDIVRTRLSIQTASLKPLKVSGSQVHAQKPLGMWSVMSDMYKTEGGFRALYRG
                     LIPTTMGVAPYVGLNFAVYESMREYVTPKGEKNPSALGKLFAGAVSGAVAQTITYPFD
                     VLRRRFQVVSMGAGQLGFQYTSVWDAISSIVKQEGIRGIYKGLSANLLKVAPSMASSW
                     LSYEYTKELLKY"
     gene            complement(<332385..>333455)
                     /locus_tag="AWJ20_2083"
                     /db_xref="GeneID:30033955"
     mRNA            complement(<332385..>333455)
                     /locus_tag="AWJ20_2083"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879011.1"
                     /db_xref="GeneID:30033955"
     CDS             complement(332385..333455)
                     /locus_tag="AWJ20_2083"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736967.1"
                     /db_xref="GeneID:30033955"
                     /translation="MSFIGSGSTLGFAALVKCAALNFPANRGVATSVPVAAFGLSAFF
                     LSGVASIISPGDTYGLLCILSFLPMFLFIITLPFIKVLPLEYVSANVRTSSEKGSLCI
                     NLPVISEKEHSEPSSSPRRLYSGSHALTDSPIDIYGTRLLRTKTFWLHFFLLGTLAGV
                     GQMYIYSCGYCVRALIEDPESNAHALQKLQSVQVGTISLTSFSGRIMSGFLSDYIHNK
                     HHLPRTLILIASASIMLVAQASAFSVTSASSLWIPSAATGLAYGICYGSYPTIVSDTF
                     GMRYFSQNWGFLALSPVPTSYILNMMFGALYDVNSTVDEAGHRVCALGKDCYSRSFII
                     TSGAITTALLVLVPYVMTRKRR"
     gene            <334892..>336025
                     /gene="FMT1"
                     /locus_tag="AWJ20_2084"
                     /db_xref="GeneID:30033956"
     mRNA            <334892..>336025
                     /gene="FMT1"
                     /locus_tag="AWJ20_2084"
                     /product="Fmt1p"
                     /transcript_id="XM_018879012.1"
                     /db_xref="GeneID:30033956"
     CDS             334892..336025
                     /gene="FMT1"
                     /locus_tag="AWJ20_2084"
                     /inference="similar to AA sequence:KEGG_Orthology:K00604"
                     /note="Methionyl-tRNA formyltransferase; catalyzes the
                     formylation of initiator Met-tRNA in mitochondria;
                     potential Cdc28p substrate; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 5277072]; GO_function: GO:0016742 -
                     hydroxymethyl-, formyl- and related transferase activity
                     [Evidence IEA]; GO_function: GO:0004479 - methionyl-tRNA
                     formyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0004479 - methionyl-tRNA formyltransferase
                     activity [Evidence IMP] [PMID 10781559]; GO_function:
                     GO:0004479 - methionyl-tRNA formyltransferase activity
                     [Evidence IDA] [PMID 12549912]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0009058 - biosynthetic process [Evidence IEA];
                     GO_process: GO:0071951 - conversion of methionyl-tRNA to
                     N-formyl-methionyl-tRNA [Evidence IEA]; GO_process:
                     GO:0071951 - conversion of methionyl-tRNA to
                     N-formyl-methionyl-tRNA [Evidence IMP] [PMID 10781559];
                     GO_process: GO:0071951 - conversion of methionyl-tRNA to
                     N-formyl-methionyl-tRNA [Evidence IDA] [PMID 12549912];
                     GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0006413 - translational initiation
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Fmt1p"
                     /protein_id="XP_018736968.1"
                     /db_xref="GeneID:30033956"
                     /translation="MLAKRPILGSLWNPCGQKHRLLYIARSYSIAKSPLRIALFGTDN
                     FTVHSLKALHRYQLANPHVIESLHVITRTPKPSGRGLKVVKEAPSAVYAFEQDIPVLR
                     AETDSDIVALADHGYNLAIAVSYGKLIPAQFLSQLTYGGINVHPSLLPDLSGAAPLHR
                     ALLRGYDTTGVTVQTLHPTKFDRGKILLHSPEVHIAKNETLQSLESKLGELGSECLVT
                     VVDEYRFADPDLNVPTATKYSPSYAPKIQPKEKNINFTKHSLSQILLKHRILGKLAVF
                     QPTADGVKRIILDNIIDASSLADVVTNEKARLDSLQIGEYDFFKHSDGNSKKAQTVCI
                     IRVQDGFISPFLLVFQGYSPQTAAQFQKSLRKRAVTSKQLQVS"
     gene            complement(<336117..>338450)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2085"
                     /db_xref="GeneID:30033957"
     mRNA            complement(<336117..>338450)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2085"
                     /product="membrane morphogenesis protein VPS13"
                     /transcript_id="XM_018879013.1"
                     /db_xref="GeneID:30033957"
     CDS             complement(336117..338450)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2085"
                     /inference="similar to AA sequence:KEGG_Orthology:K19525"
                     /codon_start=1
                     /product="membrane morphogenesis protein VPS13"
                     /protein_id="XP_018736969.1"
                     /db_xref="GeneID:30033957"
                     /translation="MLPNRKAQWSAPFNITNTGRTYVKVFVHGKGTVLLKIDVLLENS
                     TLFLYFDEAGNNWPYSIRNFSKFEFLFYQANPYVDDQGVEQHPHPPFNPIRYKLPPKS
                     LMSYAWDFPAAPFKELVILCNGKERRVQLTEIGNLRPMKLPRTERSEGGIIELHVVAD
                     GPLQSLVLSDYDASSSIYKIKSQSQASSVSQQASSSQVDLFSVDDSVDNDSVLTVTVQ
                     LEGVGVSLINRRHVELCYMTTRGFEFKYKSSELYETFSMKVKWIQIDNQLYGGHYDVI
                     LFPSVLPKSTREMENHPTFSAMVTRVKDDSHGVLYIKYASVLLQQMTLEMDEDFLFSL
                     LDFARDPNTPWTGSEKDILCDESSHIPEPEKESSGEEIYIEVLHIHPAQMDLSFVRTE
                     RINVEDRSSSPTALNYFVNILTMAIGNINDAPVKLNALLMENVRTQMPVLIQSVESHY
                     SQGFLYQVHKILGSADFIGNPVGLFNNISSGFVDMFYEPYNGFMLNDRLDEFGIGLAK
                     GGFSFMKKSIFGISDSVYKVTGSISKGLSVATLDREFQSRRRINMARNRPRHALYGLT
                     QGATSFFDSVTSGVSGLALAPMEGAAKEGASGFFKGLGKGIVGLPTKTAIGFFDLASN
                     LSEGVRNTTTVFDGETITRIRPARFIAQDGIVRPYSQREAVGQQWLKSANSGRYFKDE
                     YLAHINMTQNAAVVIVTTTRIITLFTSNLRTDWEVRFDELRSINRKSTGLTLILRPDD
                     ERREFFIPIGDQDSQRFLFKEISTAVKEYNRRLQTIS"
     gene            complement(<339147..>341327)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2086"
                     /db_xref="GeneID:30033958"
     mRNA            complement(<339147..>341327)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2086"
                     /product="membrane morphogenesis protein VPS13"
                     /transcript_id="XM_018879014.1"
                     /db_xref="GeneID:30033958"
     CDS             complement(339147..341327)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2086"
                     /inference="similar to AA sequence:KEGG_Orthology:K19525"
                     /codon_start=1
                     /product="membrane morphogenesis protein VPS13"
                     /protein_id="XP_018736970.1"
                     /db_xref="GeneID:30033958"
                     /translation="MCKVTQYDNRYDILLTIDSPQMILALDYLFALKGFIDFGMSSEG
                     GEDEVSKVEEIEDTEEESEDTSAASNSDSGMSFSYHINVVDFSVILLADPSLENTEAL
                     VFKAEQLVLSQRATTTLAVSKVGMFLCDMSHFEEERLRVLDDFSMTASVDTTGSDATH
                     QLSSVQVSVEPLVLRLSLRDVVLVSNIIQKASALSEGESKITEVEDSDAPTYSRFSKT
                     EKRKIGGNSKRRPSAVATKSSANGHHRRNSSVSKKLALPRVKVVRGEEMTADFEGLRL
                     VVIGAAHELPVLDMSVKPFSISARSWSSDLRVDLATESFVNVFNPSKSAWEPLVETWD
                     IGLNISRSTDVTNTFVNVYSRKPIEVTLTSQTIELLSKSIDFVSANSGNDDLLLRPRD
                     SDAPYCIRNETGYPIEVWSDSDKDTNEPQVKRIEDGQDIPWRFHDWHELRENLSTDLQ
                     KLMLGVSLKDSSYDDIRAVSVTSEGEHLHILHRNSQRTGHRLLCDIKLENYHKKITFR
                     SALNVTNSTHINIHVSTKSDPNQMWTLKPSESRAIPISLVHECNLVVMPDRQLGFDWS
                     NTAIYWKDLLEAPGSLSCETLPGKPHSFFHFHIEADFNKSLPITWGYPYMTVNICAPV
                     EIVNLLPYDFDFEIVSKNTTGKRVGWKNSLRKGETSPVHVVKRSDLLLLKVHPATAGY
                     TESEFAIINVPNHGIYKGKFSREKVMTTHSTDGVQTLNLRIHYL"
     gene            complement(<341788..>348480)
                     /gene="VPS13"
                     /locus_tag="AWJ20_2087"
                     /db_xref="GeneID:30033959"
     mRNA            complement(join(<341788..341800,341872..345791,
                     348364..>348480))
                     /gene="VPS13"
                     /locus_tag="AWJ20_2087"
                     /product="membrane morphogenesis protein VPS13"
                     /transcript_id="XM_018879015.1"
                     /db_xref="GeneID:30033959"
     CDS             complement(join(341788..341800,341872..345791,
                     348364..348480))
                     /gene="VPS13"
                     /locus_tag="AWJ20_2087"
                     /inference="similar to AA sequence:KEGG_Orthology:K19525"
                     /codon_start=1
                     /product="membrane morphogenesis protein VPS13"
                     /protein_id="XP_018736971.1"
                     /db_xref="GeneID:30033959"
                     /translation="MSDGLTAGSEVALPSVLPFEPTDSSLDPLLGSSAALSKLFKLPL
                     NVLEGHLGELVLQIPWSNLKNQPVKVVIQDVFLLAEPRLDEDYDPEEESRREQELKKE
                     RLERLELLEKSTPSQGYSQQDVQKNQSFTESLINKTIENLQITIRNIHIRYEDQTSVP
                     GHPFSLGFTLEELSALSTDDEWNPKFIQSITHVTRKLAKLNSLAIYWNTDSDSIRRTS
                     DDESGEKMLDNFRTMIISKEKAERNQYILKPVSGIGRITLNKFPSDSQPKSKVQLIFD
                     ELGFVFDSDQYRDALWTADLFRLYMNSKEFKRFRPTVSVKEDPKAWFKYAAEAVRSHI
                     HEKNKPWNWDYLTMRLQIRRRYIDLYKLRTKSSPPGTLSNPDEQAEFKQLEFDLSFED
                     IKFYRSLAKAELRKEQAKVKEEKKRTILGGTSQSDSGSAAPAASWTSWIWGGGAKNAN
                     QASNGDDEVTMTEEQRKELYDVIEWDEKAAVEKSVTVPQNQITLEVETALESGSFTIR
                     NDPHGASHDVAAVYFNGFKAQFLQRPTSFLTSISLQEFRVDDKSEGTLFKQIVTVKPL
                     SHEDDHTHHNVDSHDSTPSTESESAVTSGNSGESSEDAFFWLSFEKNPLDESADSSLH
                     VKTKSITIFYNAHFLERVARFFKPPKTHLETIGAIINAAGATVEGIRNQTRIGLEYAL
                     QEHKTANVKLDLQAPLIVIPLDVTSWKSPCVIIDAGHISLLSELAPSELLDEIKKKKS
                     HQYKERDWERLESLMYDKFKLQFHDTQILLGNNVRDTMKQLHQENSENPAHVIDRINM
                     DFLVEISILPEAYSLTKFKVTGHLPLFSASMSDAKYKLMMQIIDKSIPNFNFDDDEDI
                     EDLSDPDPALPPSEIFSRPAAVEHDYGFDSDEDKEPDGETSDAQSVTSTSTADIGSST
                     VASSIQANATSESQNIFVFVFKIDKVELSLHRCIDDSTLEQSPLVDMVMEQFELEYCF
                     RSLEMTADVTLGSLRIEDYIDTKCPSELRQIVSSSNSGDSTSDLFKVKYRRIKLPIIK
                     KTGEEPSDQIVEVSMSTIRFVVEPKTFLTLLDFIITTFTNPEEAEASDSPRIEDVEPA
                     AGQDSPQESVAPAGQGSIDVRVDLRSIILILNDEGLQLGTLKLDSALVSVRLFGETMN
                     IHSRIGGFSLQDDTGETQIPSDSNLNQLISIEGDELADFRYETFDRSRKDLSYNSSIY
                     FRLGSLRVNVIEKPLSRIIGFASRLLQMKGLYDRARQLAMNQANQIESPDKIRFDVII
                     KTPIFFFPTISADSGDKYDSVTANLGEIYLQNKFESVDGVEDVAINNVSAGVRDMKLT
                     SRFYFEESWSQNLEIIDKIDILFDISKAD"
     gene            <347195..>350866
                     /gene="PIM1"
                     /locus_tag="AWJ20_2088"
                     /db_xref="GeneID:30033960"
     mRNA            <347195..>350866
                     /gene="PIM1"
                     /locus_tag="AWJ20_2088"
                     /product="ATP-dependent Lon protease PIM1"
                     /transcript_id="XM_018879016.1"
                     /db_xref="GeneID:30033960"
     CDS             347195..350866
                     /gene="PIM1"
                     /locus_tag="AWJ20_2088"
                     /inference="similar to AA sequence:KEGG_Orthology:K08675"
                     /note="ATP-dependent Lon protease; involved in degradation
                     of misfolded proteins in mitochondria; required for
                     biogenesis and maintenance of mitochondria; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IEA,IEA];
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IMP] [PMID 8146662]; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IMP] [PMID 8276800];
                     GO_component: GO:0042645 - mitochondrial nucleoid
                     [Evidence IBA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA,IEA]; GO_function:
                     GO:0004176 - ATP-dependent peptidase activity [Evidence
                     IEA,IEA]; GO_function: GO:0004176 - ATP-dependent
                     peptidase activity [Evidence IMP] [PMID 8146662];
                     GO_function: GO:0004176 - ATP-dependent peptidase activity
                     [Evidence IMP] [PMID 8276800]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IEA]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0070361
                     - mitochondrial light strand promoter anti-sense binding
                     [Evidence IBA]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_function: GO:0008233 - peptidase activity
                     [Evidence IEA]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IEA]; GO_function:
                     GO:0004252 - serine-type endopeptidase activity [Evidence
                     IEA,IEA]; GO_function: GO:0008236 - serine-type peptidase
                     activity [Evidence IEA]; GO_function: GO:0003697 -
                     single-stranded DNA binding [Evidence IBA]; GO_function:
                     GO:0003727 - single-stranded RNA binding [Evidence IBA];
                     GO_process: GO:0006200 - ATP catabolic process [Evidence
                     IEA,IEA]; GO_process: GO:0034599 - cellular response to
                     oxidative stress [Evidence IBA,IEA]; GO_process:
                     GO:0051131 - chaperone-mediated protein complex assembly
                     [Evidence IEA]; GO_process: GO:0051131 -
                     chaperone-mediated protein complex assembly [Evidence IGI]
                     [PMID 8810243]; GO_process: GO:0006515 - misfolded or
                     incompletely synthesized protein catabolic process
                     [Evidence IEA,IEA]; GO_process: GO:0006515 - misfolded or
                     incompletely synthesized protein catabolic process
                     [Evidence IMP] [PMID 16336126]; GO_process: GO:0006515 -
                     misfolded or incompletely synthesized protein catabolic
                     process [Evidence IGI,IMP] [PMID 7957078]; GO_process:
                     GO:0007005 - mitochondrion organization [Evidence IBA];
                     GO_process: GO:0070407 - oxidation-dependent protein
                     catabolic process [Evidence IBA,IEA]; GO_process:
                     GO:0030163 - protein catabolic process [Evidence IEA];
                     GO_process: GO:0051260 - protein homooligomerization
                     [Evidence IBA]; GO_process: GO:0006508 - proteolysis
                     [Evidence IEA,IEA]; GO_process: GO:0090296 - regulation of
                     mitochondrial DNA replication [Evidence IEA]; GO_process:
                     GO:0001666 - response to hypoxia [Evidence IBA]"
                     /codon_start=1
                     /product="ATP-dependent Lon protease PIM1"
                     /protein_id="XP_018736972.1"
                     /db_xref="GeneID:30033960"
                     /translation="MLSSLKTTGRARRGADRLICQIQNARQCRSYHGLPRINKSIVDT
                     RGVLLSGSHRERDSSRIFATGISQVPRFTTAQFSTSRFVLNNSTGNGDGSNGKNDDLQ
                     KVNNDQINESKEKELEKEKEQENSVESSSSGTGSEDTAASQTSGKKKSTTSETSKRSR
                     RSLSPKVSESESATEAAAPTPLRKAVKPSPSAASILFADSNTANSQGSSDSSSGGNNS
                     NNASENGNAKKQPISPLKQVLPVVLSHRPVFPGLAVHCNSTDETFIAAIDALEKTKSW
                     DRTVVAFLRKPVEDEEPTVKSSSSGTMTGSVGPSASHSTTTQLMTNVEEAYSVGCVCR
                     VETIEVTASDGKLIFNSSLFPLYRVRAGELTEPVKDAPVIRQSAAILDADTGLDVTSF
                     DKAAEEPNNGSSEESVGSNGSTDGSATSEPAVKPSDIVNVHWMKGITAVSDEPYAVDD
                     RAIQELCFKIIDVLYSISNTSYPLKVQVEKFSKLVRRSPGEDFQKPDFLADFCAALCS
                     GDKEIQAILETANIKTRLEASLDLLNRELLSIKMHEKISKAIAEQTAQRQREFILQEQ
                     YKYIKKELGMDDEKGKLAQKFLERADALAMPEEVRKVFDEELAKFRGLESTAGEYSTV
                     KSYLDWLVSLPWGKFSTDKFDLNAAKKLLDDQHFGLKEVKDRILEFIAVAKLSGSVDG
                     KILCFAGPPGVGKTSVARSIAEALNRKFDRFSVGGLYDASEIKGHRRTYVAALPGKII
                     QALKKCETQNPVILIDEIDKVGTSSVHGDPSAALLEVLDPEQNKNFQDIYLDVPVDIS
                     KILFICTANTLDTLPQPLKDRMEIIHIPGYVNSEKVSIAEGYLTPSLRKKSGLENVDI
                     KLSSDALLKLVTSYTRESGVRGLNKILEKIYRKVAYNVVIEKEKDTPPIASASESAAE
                     AAATETASESKDAVADQPKSETVVTADAKEVAPEPIDPELLKDYHLEINVDDLTKYVG
                     APLYNTVRLYEKFPPGVTMGLAYTPLGGVPLFVETVLQQPLDPKSTPKLTRTGHLGEV
                     MNESSSIAYSFSRMYMVKRFLGNRFLDHAVLHTHFPEGAVKKDGPSAGIAMATSLISL
                     ALNKPVNPDVCMTGEITLTGKVLQIGGLREKSAAAKAAGSKIIVFPKDNMAEWEDLPE
                     MIREGLTPMPVSWYDEVFDIAFGQVDQAEIESMWSKELATKDVDNSTLGRNDDAGFTP
                     PPPPPPSNRSPSLRASSPY"
     gene            complement(<350365..>350730)
                     /locus_tag="AWJ20_2089"
                     /db_xref="GeneID:30033961"
     mRNA            complement(<350365..>350730)
                     /locus_tag="AWJ20_2089"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879017.1"
                     /db_xref="GeneID:30033961"
     CDS             complement(350365..350730)
                     /locus_tag="AWJ20_2089"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736973.1"
                     /db_xref="GeneID:30033961"
                     /translation="MDSISAWSTWPKAMSNTSSYHETGMGVSPSRIISGRSSHSAMLS
                     LGKTMILDPAALAAADFSLKPPIWRTLPVRVISPVMQTSGLTGLFKANEIRLVAIAIP
                     ADGPSFLTAPSGKCVWSTA"
     gene            <351424..>352278
                     /gene="YIP5"
                     /locus_tag="AWJ20_2090"
                     /db_xref="GeneID:30033963"
     mRNA            <351424..>352278
                     /gene="YIP5"
                     /locus_tag="AWJ20_2090"
                     /product="Yip5p"
                     /transcript_id="XM_018879018.1"
                     /db_xref="GeneID:30033963"
     CDS             351424..352278
                     /gene="YIP5"
                     /locus_tag="AWJ20_2090"
                     /note="Protein that interacts with Rab GTPases; localized
                     to late Golgi vesicles; computational analysis of
                     large-scale protein-protein interaction data suggests a
                     possible role in vesicle-mediated transport; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IDA] [PMID
                     17178117]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0017137 - Rab GTPase binding
                     [Evidence IPI] [PMID 11943201]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Yip5p"
                     /protein_id="XP_018736974.1"
                     /db_xref="GeneID:30033963"
                     /translation="MGSQAYAPPDFESSGSGAYNVSGSMASAGPGNPLLGSGNKTGSI
                     FSFDFYQWYFNVDTPVVLYRCLLALNPFNNTPFIDSEADLNVGSPAGLIAGGDGNPDL
                     YGPFWLCTTVIFVLFFASTLTGLLFTAWQGGKYDYKFDLLTGAAGLMYGYTFVIPTGL
                     WLIVRYLNISPSTTLLQLISLYGYSNVTWIPVAILSISPLLGTPTLSNVIRWIMIALG
                     FTLSGSFIGKNVYRALIPSQQSDSFVIDRKPALSVLIGVIALHMGLSFAVKILFFGTV
                     TAPPPPTN"
     gene            complement(<352506..>354461)
                     /gene="YVC1"
                     /locus_tag="AWJ20_2091"
                     /db_xref="GeneID:30033964"
     mRNA            complement(<352506..>354461)
                     /gene="YVC1"
                     /locus_tag="AWJ20_2091"
                     /product="Yvc1p"
                     /transcript_id="XM_018879019.1"
                     /db_xref="GeneID:30033964"
     CDS             complement(352506..354461)
                     /gene="YVC1"
                     /locus_tag="AWJ20_2091"
                     /note="Vacuolar cation channel; mediates release of Ca(2+)
                     from the vacuole in response to hyperosmotic shock;
                     GO_component: GO:0000324 - fungal-type vacuole [Evidence
                     IDA] [PMID 11427713]; GO_component: GO:0000324 -
                     fungal-type vacuole [Evidence IDA] [PMID 11781332];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 20035756]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005774 - vacuolar membrane [Evidence
                     IEA]; GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0005227 - calcium activated cation channel
                     activity [Evidence IDA] [PMID 1700419]; GO_function:
                     GO:0005262 - calcium channel activity [Evidence IEA];
                     GO_function: GO:0005262 - calcium channel activity
                     [Evidence IDA] [PMID 11781332]; GO_function: GO:0005216 -
                     ion channel activity [Evidence IEA]; GO_function:
                     GO:0005267 - potassium channel activity [Evidence IDA]
                     [PMID 1700419]; GO_function: GO:0005272 - sodium channel
                     activity [Evidence IDA] [PMID 1700419]; GO_function:
                     GO:0005244 - voltage-gated ion channel activity [Evidence
                     IDA] [PMID 1700419]; GO_process: GO:0070588 - calcium ion
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006816 - calcium ion transport [Evidence IEA];
                     GO_process: GO:0030003 - cellular cation homeostasis
                     [Evidence IDA,IMP] [PMID 11427713]; GO_process: GO:0030003
                     - cellular cation homeostasis [Evidence IDA,IMP] [PMID
                     11781332]; GO_process: GO:0006811 - ion transport
                     [Evidence IEA,IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Yvc1p"
                     /protein_id="XP_018736975.1"
                     /db_xref="GeneID:30033964"
                     /translation="MSTDLASVPAPLVPAQDDLPLVQVSPKQVLKIALRVKKLIDTVV
                     PIQLTEEEVIKPSSIVLTEKIFQLILEAAGGKGDGAPGTSSRRYRATLVFVLLVIKKW
                     NRRAALSLLYDSDLYNTRAFVAECYAKRILDTEQDEYYMFRDMLCQRYSITVHGSDSA
                     PANALELAADLHSTVVIGSSGYQRCMKWLWRGWMVQSDQTPTEYDFYAKVNDPRFWSH
                     FDPDRIKTPKYQNYIQLLVSLIYLAFYSYAVNNANPSASLIASELWLYLFTFGFILDE
                     INKLLNVGYAYIGFWNTFNDTLYILVVVAFGFRCAALTYSKSSDQRLSYDLAAYHILS
                     CAAPLIWGRLLLFLDSVRFFGAMLIVLKELMKESIIFFVLLVVVAGGFLQAFIGLDIA
                     DGTRDVTMLVVQVMTRTVLDGIDFEWMDGFAPPYGEVLYYIFTFLVSTLLLNILVALF
                     NSAYQNIYDNATDEYLASMAQKTLRFIRAPDENVFIPPLNLLELAFLILPFEWWMDAS
                     MYQRINRIFMSIIYSPFLLLIAVDEAKAARRVLYNRSKGVHDDANEEDEEWDLFDGFT
                     IDAHGIHSYGAEAVQMEMAIEAGDPEFKIDEDAFQKKVEKQVPNFDPQRQTGISAAKA
                     EELIAKIDALSALVEKLTLEKGQSSSS"
     gene            <356207..>358228
                     /gene="CIR2"
                     /locus_tag="AWJ20_2092"
                     /db_xref="GeneID:30033965"
     mRNA            <356207..>358228
                     /gene="CIR2"
                     /locus_tag="AWJ20_2092"
                     /product="Cir2p"
                     /transcript_id="XM_018879020.1"
                     /db_xref="GeneID:30033965"
     CDS             356207..358228
                     /gene="CIR2"
                     /locus_tag="AWJ20_2092"
                     /inference="similar to AA sequence:KEGG_Orthology:K00311"
                     /note="Putative ortholog of human ETF-dH; found in a large
                     supramolecular complex with other mitochondrial
                     dehydrogenases; may have a role in oxidative stress
                     response; ETF-dH is also known as electron transfer
                     flavoprotein dehydrogenase; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IDA,IPI] [PMID 11502169]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0051539 - 4 iron, 4
                     sulfur cluster binding [Evidence IEA]; GO_function:
                     GO:0004174 - electron-transferring-flavoprotein
                     dehydrogenase activity [Evidence IEA,IEA]; GO_function:
                     GO:0051536 - iron-sulfur cluster binding [Evidence
                     IEA,IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_function: GO:0016491
                     - oxidoreductase activity [Evidence IEA,IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Cir2p"
                     /protein_id="XP_018736976.1"
                     /db_xref="GeneID:30033965"
                     /translation="MLGYKSTGATLQKSASAGAARVLARNSTKSTTKQFSRCFTALKS
                     NTITGTQTGTIQNTTNGKLKRNLTRSTLINSRLRTSITHNGRRSYSTSPEEGEAAAEE
                     EFPELSEPREADEVDVCIVGGGPAGLAAAIRFKQLDLEKGSGELRVIVLEKASDMGAH
                     TVSGAVLEPRALDELLPEWRDDPSLPESVTPVTSEAMRFLTKSMTIPLPEPPQMKNHG
                     NYIVSLNQMVKWLSEKAEEIGVEVYPGFSVSELVYDEQGRVKGIATNDQGVSRDFKPK
                     ASFQRGMEFHAKITLLAEGCHGSLSKQVIKKYDLRKDSDPQTYGLGIKEVWEVPKEKF
                     NKGFVGHSMGWPLSSDVYGGGFIYHFGDGLVTVGAVIGLDYKNPWISPYQEFQRMKHH
                     PFYANTLKGGKCISYAARALNEGGLQSIPKLSFPGGGLIGCTAGFVNVPKIKGTHTAM
                     KTGMLAAESAFDSISAFNSAIEEGQSESEVTAPSVESYEESFKDSWVYKELHEIRNVR
                     PSFNNPLKMWGGVMYSGLDTLILKGRTPWTFHHKHTDSGATEPASKYNKIEYPKPDGE
                     LSFDILTSVSRTGTNHDEDEPCHLRIPDQDNRKHTEIAYPKYQGIENRFCPAGVYEYI
                     EDASEPLGVRFQINSQNCIHCKTCDIKVPTQDINWTVPEGGDGPKYYMT"
     gene            <360167..>361426
                     /gene="NMA1"
                     /locus_tag="AWJ20_2093"
                     /db_xref="GeneID:30033966"
     mRNA            <360167..>361426
                     /gene="NMA1"
                     /locus_tag="AWJ20_2093"
                     /product="nicotinamide-nucleotide adenylyltransferase
                     NMA1"
                     /transcript_id="XM_018879021.1"
                     /db_xref="GeneID:30033966"
     CDS             360167..361426
                     /gene="NMA1"
                     /locus_tag="AWJ20_2093"
                     /inference="similar to AA sequence:KEGG_Orthology:K06210"
                     /note="Nicotinic acid mononucleotide adenylyltransferase;
                     catalyzes the transfer of the adenylyl moiety of ATP to
                     nicotinamide mononucleotide to form NAD; involved in
                     pathways of NAD biosynthesis, including the de novo,
                     NAD(+) salvage, and nicotinamide riboside salvage
                     pathways; homolog of human NMNAT; NMA1 has a paralog,
                     NMA2, that arose from the whole genome duplication;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0000309
                     - nicotinamide-nucleotide adenylyltransferase activity
                     [Evidence IEA]; GO_function: GO:0000309 -
                     nicotinamide-nucleotide adenylyltransferase activity
                     [Evidence IDA] [PMID 10428462]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_function: GO:0016779
                     - nucleotidyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0009435 - NAD biosynthetic process
                     [Evidence IEA,IEA]; GO_process: GO:0009435 - NAD
                     biosynthetic process [Evidence IDA] [PMID 10428462];
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]; GO_process: GO:0019363 - pyridine nucleotide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="nicotinamide-nucleotide adenylyltransferase
                     NMA1"
                     /protein_id="XP_018736977.1"
                     /db_xref="GeneID:30033966"
                     /translation="MDPSLAPDFIPPSEQRNRVPTTAGNRVPTVSPIQAYELEEAFDS
                     QLDINSSHFGTAFPAARRRSSTIEIDMADISQNIPRISSAMSASPTDSDLESNNGREK
                     FTNTDGGDNASNLKSFDSNQRLASPLAASNYNEPTARQIIQSADLEEVPLGVTRQAKK
                     LVDYQFPVHRLADTMLDDSKVPLVLVACGSFSPITYLHLRMFEMAMDSIREHTRLEVI
                     GGYYSPVSDNYQKPGLAKSHHRVRMCELACERTSSWLMVDAWESLQPTYTRTALVLDH
                     FNEEINVRRQGVGTADGQRKPVKIMLLAGGDLIESMGEPNVWAEDDLHHILGRYGCII
                     VERTGSDVRSFLLSHDIMYEHRRNVLVIKQLIYNDISSTKVRLFLRRGMSVQYLLPNS
                     VIRYILEHGLYINESEPVKQVLSEKGD"
     gene            <367021..>368586
                     /locus_tag="AWJ20_2094"
                     /db_xref="GeneID:30033967"
     mRNA            <367021..>368586
                     /locus_tag="AWJ20_2094"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879022.1"
                     /db_xref="GeneID:30033967"
     CDS             367021..368586
                     /locus_tag="AWJ20_2094"
                     /inference="similar to AA sequence:KEGG_Orthology:K08150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736978.1"
                     /db_xref="GeneID:30033967"
                     /translation="MSSVESTSLLRGEEEDVSGSVPVSAVSSVPEILSDVDKEVDGVN
                     LYMLLCIVCACVGGLMFGYDTGCISQVIELLSDDLGHYLVAWELELITSSTSLFALMG
                     SIFAGISADRYGRKVLIAVSCVVFILAALVMALSMSLAWLVLGRSLVGLAVGVASTIV
                     SVYIAEISPPRYRGRLVALNSVSTTGGQVLAYLSGVAFHKTTNGWRYIVGLSGIPPLL
                     FLLVMTAVPESPRFLFMNGRVDEAKQVLLKLDPRVDVAQVEEMVRQDLSYKDANNGVD
                     DSSLARLFSVPANFRALVVGCGLMAAQQLCCFNGFMYFSVSLFAMAGFDNPFAVSLVV
                     SITNFVFTWGAVKYIDKVGRRAILLRSVWIMVVALIVVAFAFTTIDPSAIKNATNNDS
                     GKPGSDSEPDGMKILTVAATIVFVASYAIGLGNIPWQAIEFLPLDVRSLGSMFITSTN
                     WTFNTLVSASFLHLLKWLTGTGTFLLYAFFTLLAYIGIYLYYPEVAGLPLEKVNDIFK
                     QGWRGLGKRGVVL"
     gene            complement(<368795..>371680)
                     /gene="PAN2"
                     /locus_tag="AWJ20_2095"
                     /db_xref="GeneID:30033968"
     mRNA            complement(<368795..>371680)
                     /gene="PAN2"
                     /locus_tag="AWJ20_2095"
                     /product="Pan2p"
                     /transcript_id="XM_018879023.1"
                     /db_xref="GeneID:30033968"
     CDS             complement(368795..371680)
                     /gene="PAN2"
                     /locus_tag="AWJ20_2095"
                     /inference="similar to AA sequence:KEGG_Orthology:K12571"
                     /note="Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease complex; complex acts to control
                     poly(A) tail length and regulate the stoichiometry and
                     activity of postreplication repair complexes;
                     GO_component: GO:0031251 - PAN complex [Evidence IDA]
                     [PMID 8816488]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0004527 -
                     exonuclease activity [Evidence IEA,IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0004518 - nuclease activity [Evidence
                     IEA]; GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]; GO_function: GO:0004535 - poly(A)-specific
                     ribonuclease activity [Evidence IEA]; GO_function:
                     GO:0004535 - poly(A)-specific ribonuclease activity
                     [Evidence IMP] [PMID 8550599]; GO_process: GO:0090503 -
                     RNA phosphodiester bond hydrolysis, exonucleolytic
                     [Evidence IEA]; GO_process: GO:0031124 - mRNA 3'-end
                     processing [Evidence IMP,IPI] [PMID 8550599]; GO_process:
                     GO:0006397 - mRNA processing [Evidence IEA]; GO_process:
                     GO:0006397 - mRNA processing [Evidence IMP,IPI] [PMID
                     8550599]; GO_process: GO:0090305 - nucleic acid
                     phosphodiester bond hydrolysis [Evidence IEA,IEA];
                     GO_process: GO:0006301 - postreplication repair [Evidence
                     IGI,IPI] [PMID 11953437]"
                     /codon_start=1
                     /product="Pan2p"
                     /protein_id="XP_018736979.1"
                     /db_xref="GeneID:30033968"
                     /translation="MLSNVTKMKRDSQAIALGLASGSVDVVDPNSLQVVKTFNSHSGP
                     ISDLDCRQHIIMTCGTSLRKQGYVPDPLVNCYDLRAMKPLPPIPFPAGAAYIKIHPKM
                     STCCIIASQSGQLQFADSANPTSVFIHQAAITSPLTSLELSPSGDYLSLTDEEGYIHL
                     WSNTVNPSASFSEFSAPLDFPTSQDPPLHFGVDDDVSLATVGMPYYKEELLSSWSNED
                     MVFKLGMPSPKIDRSILAGMKVVDYVGYGSYKKTREPRNMAQKYISLDSNRRSSITVP
                     RFISEKERTGEIDDESAIFDDDVRDDDKRPNGKTNTQAPSSRKITKMYRRLEIKYSKF
                     GVNDFDFDFYNKTQYAGLENQAANTYCNSILQLYRYSKYMYNFALKKLAVATTVERVS
                     LLSELGFVFDMLHLAGGKHCCTANFVNALSSIPEAVALGLVFDDMVPNLDQPGLVLQK
                     FKTFLMEQIVKNEKYQTLSVENQLQNVHSNPAALATLPSEFESSVAGIPVSTSIRCLS
                     CGTDSIKKSTIYELDLQTEYGFRNNSSAGPGPNTANFDSLFFKALNSSLDKTNKVRGW
                     CDVCRKYQQLVTTRSATKLPQVLNVNINIFPEADTSVSRQIWASPHWPPTEFFTDNHS
                     RRLVANHRVGKDKYELLGCVVEISRPGHSDHHLVSVVKIDEAWYLFNDFLVKQIPEKD
                     ALDFSLAWKTPVLLVYQLANEMPKEFDYGSWKQTLDTSILYKDFFTAGNREEVRREYE
                     LLTLEEAPKPGTLVAIDAEFVMLQNEETEIRSDGTKSIVKPRSLSLARVSVVRGEGPK
                     EGVAFIDDYIATTDTIVDYLTEFSGIEPGDLDPALSKRGLVSLHTAYKRLWLLLQLGV
                     TFVGHGLSNDFRTINIQVPANQVIDTLDIYFVRARQRKLSLKFLAWYLLDENVQTGNH
                     DSIEDARTALHLYKKHQQLLRDGTFDATLAKVYSEGHKYNFRPPANS"
     gene            complement(<374204..>374277)
                     /locus_tag="AWJ20_2096"
                     /db_xref="GeneID:30033969"
     tRNA            complement(<374204..>374277)
                     /locus_tag="AWJ20_2096"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:30033969"
     gene            complement(<377609..>379693)
                     /gene="GSH1"
                     /locus_tag="AWJ20_2097"
                     /db_xref="GeneID:30033970"
     mRNA            complement(<377609..>379693)
                     /gene="GSH1"
                     /locus_tag="AWJ20_2097"
                     /product="glutamate--cysteine ligase"
                     /transcript_id="XM_018879024.1"
                     /db_xref="GeneID:30033970"
     CDS             complement(377609..379693)
                     /gene="GSH1"
                     /locus_tag="AWJ20_2097"
                     /inference="similar to AA sequence:KEGG_Orthology:K11204"
                     /note="Gamma glutamylcysteine synthetase; catalyzes the
                     first step in glutathione (GSH) biosynthesis; expression
                     induced by oxidants, cadmium, and mercury; protein
                     abundance increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IBA];
                     GO_component: GO:0005622 - intracellular [Evidence IDA]
                     [PMID 2184310]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA]; GO_function: GO:0004357 -
                     glutamate-cysteine ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004357 - glutamate-cysteine ligase
                     activity [Evidence IDA] [PMID 1687097]; GO_function:
                     GO:0004357 - glutamate-cysteine ligase activity [Evidence
                     IMP] [PMID 2184310]; GO_function: GO:0016874 - ligase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006750
                     - glutathione biosynthetic process [Evidence IEA,IEA,IEA];
                     GO_process: GO:0006750 - glutathione biosynthetic process
                     [Evidence IDA] [PMID 1687097]; GO_process: GO:0006750 -
                     glutathione biosynthetic process [Evidence IMP] [PMID
                     8768524]; GO_process: GO:0046686 - response to cadmium ion
                     [Evidence IDA] [PMID 10921921]; GO_process: GO:0042542 -
                     response to hydrogen peroxide [Evidence IMP] [PMID
                     7615092]"
                     /codon_start=1
                     /product="glutamate--cysteine ligase"
                     /protein_id="XP_018736980.1"
                     /db_xref="GeneID:30033970"
                     /translation="MGLLSLGTPLEWNEVSQYTDHVREHGIEQLIHIHNANKDKKNDS
                     LLWGDEVEYMVVELDPESKEAKLSLRQAQILDDLAQAEKKGDLTAHNVVFHPEYGRYM
                     LEATPAKPFTGDFKDLLLVEANMATRRTIAKEHMNSNEFPLTLTSYPRLGVGQFTSPA
                     AEPNGKASRSFFLPDEIINPHVRFPTLTANIRTRRGSKVAINVPIYKDEKTPSPFVDD
                     SIPWDRDLYPEDANAREGAALPDHIYMDSMGFGMGCSCLQITFQATDIDEGRDLYDQL
                     APLAPILLALTAAAPAYRGYLSDQDARWNVIAGSVDDRTPVERGLVPADDINEESEDS
                     EVAQKAENNENSEKNEKTNGKAQFCSSQSNRTKTTSTTKYPSVKANSDRVIPKSRYDS
                     IDSYISGHLKGSASHFNDTKLVINKKVKKRLTEAGFDEQLSNHFAHLFIRDPIVIFKE
                     LLDIDDTKESDHFENIQSTNWQTMRFKPPPPSEGPNQNVGWRVEFRPMEVQITDFENA
                     AFSVFIVLVTRVILSYKLNFYIPISKVDENMKVAHYRDAVNKNKFWFRTDIESPTSQP
                     DTETEPSPGIYELLSINEIINGKADKSFIGLVPLIRRYLNYINIDLDTLCQLDRYLSL
                     ISRRASGELWTAATWMRHFITSHPKYNKDSKISSDINYDLMQKVYDITQGKGWDDGLT
                     KHFLGGFSSSVP"
     gene            <390180..>391613
                     /gene="CUP9"
                     /locus_tag="AWJ20_2098"
                     /db_xref="GeneID:30033971"
     mRNA            <390180..>391613
                     /gene="CUP9"
                     /locus_tag="AWJ20_2098"
                     /product="Cup9p"
                     /transcript_id="XM_018879025.1"
                     /db_xref="GeneID:30033971"
     CDS             390180..391613
                     /gene="CUP9"
                     /locus_tag="AWJ20_2098"
                     /note="Homeodomain-containing transcriptional repressor;
                     regulates expression of PTR2, which encodes a major
                     peptide transporter; imported peptides activate
                     ubiquitin-dependent proteolysis, resulting in degradation
                     of Cup9p and de-repression of PTR2 transcription; CUP9 has
                     a paralog, TOS8, that arose from the whole genome
                     duplication; protein abundance increases in response to
                     DNA replication stress; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IC] [PMID 9427760]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA,IEA]; GO_function: GO:0000978 -
                     RNA polymerase II core promoter proximal region
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     9427760]; GO_function: GO:0001103 - RNA polymerase II
                     repressing transcription factor binding [Evidence IPI]
                     [PMID 18708352]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IEA]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 19111667]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     19158363]; GO_function: GO:0003700 - sequence-specific DNA
                     binding transcription factor activity [Evidence IEA];
                     GO_function: GO:0001133 - sequence-specific transcription
                     regulatory region DNA binding RNA polymerase II
                     transcription factor recruiting transcription factor
                     activity [Evidence IC] [PMID 18708352]; GO_function:
                     GO:0001133 - sequence-specific transcription regulatory
                     region DNA binding RNA polymerase II transcription factor
                     recruiting transcription factor activity [Evidence IC]
                     [PMID 9427760]; GO_process: GO:0035955 - negative
                     regulation of dipeptide transport by negative regulation
                     of transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 10850718]; GO_process: GO:0035955 - negative
                     regulation of dipeptide transport by negative regulation
                     of transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 17005992]; GO_process: GO:0035955 - negative
                     regulation of dipeptide transport by negative regulation
                     of transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 18708352]; GO_process: GO:0035955 - negative
                     regulation of dipeptide transport by negative regulation
                     of transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 9427760]; GO_process: GO:0035952 - negative
                     regulation of oligopeptide transport by negative
                     regulation of transcription from RNA polymerase II
                     promoter [Evidence IMP] [PMID 17005992]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Cup9p"
                     /protein_id="XP_018736981.1"
                     /db_xref="GeneID:30033971"
                     /translation="MNTSDQTNRSSLPRSSNSDSPLSVSNMSMSIAASSVQPQWQMSA
                     NDTPVLPHERSNIRLPSINELMASFSNEPQQSVPRANSSSYYSPAVNVKPEPHSPPFY
                     TQSSQQQQQHPPAHSHIPLQSHLSQPEPRSEHASLPHPSHPYQPSQQPQQQQPPQLQQ
                     PHPHQQQQHGQQLPHGQQQLQPLQQSHTQYQQGPVSPSLASSSSSNMDSAPAYSTTSS
                     GQPGSDGHSNTSIQMLLDASSSADSSQKKRSHSVSSASSVSSNSNRMPPTSGGAMNNN
                     STPGNTSNGSASSSSPPFSISPPPFSASPYSPPLKRRGNLPRAVTDILRNWLSSHLHY
                     PYPTEQEKIELMKQTGLSLNQVSNWFINARRRRVPAIYKHSGLMNMTERPRRTVSEFN
                     MRHSPQQQPMMNHQRSVSQIHHPQQPPQPQPQQQPPPPPMSQPTPPPPPPSMTNPLQQ
                     QAPTPAAPPPNHMHYSSQPHIPPQWKP"
     gene            complement(<392070..>394457)
                     /gene="CTI6"
                     /locus_tag="AWJ20_2099"
                     /db_xref="GeneID:30033972"
     mRNA            complement(<392070..>394457)
                     /gene="CTI6"
                     /locus_tag="AWJ20_2099"
                     /product="Cti6p"
                     /transcript_id="XM_018879026.1"
                     /db_xref="GeneID:30033972"
     CDS             complement(392070..394457)
                     /gene="CTI6"
                     /locus_tag="AWJ20_2099"
                     /note="Component of the Rpd3L histone deacetylase complex;
                     relieves transcriptional repression by binding to the
                     Cyc8p-Tup1p corepressor and recruiting the SAGA complex to
                     the repressed promoter; contains a PHD finger domain;
                     GO_component: GO:0033698 - Rpd3L complex [Evidence IDA]
                     [PMID 16286007]; GO_component: GO:0033698 - Rpd3L complex
                     [Evidence IDA] [PMID 16286008]; GO_component: GO:0033698 -
                     Rpd3L complex [Evidence IDA] [PMID 16314178];
                     GO_component: GO:0033698 - Rpd3L complex [Evidence IDA]
                     [PMID 19040720]; GO_component: GO:0070210 - Rpd3L-Expanded
                     complex [Evidence IDA] [PMID 19040720]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IC] [PMID 12086626];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0035064 - methylated histone binding
                     [Evidence IDA] [PMID 17142463]; GO_function: GO:0008134 -
                     transcription factor binding [Evidence IDA] [PMID
                     12086626]; GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IEA]; GO_process: GO:0061188 -
                     negative regulation of chromatin silencing at rDNA
                     [Evidence IMP] [PMID 16286008]; GO_process: GO:0061186 -
                     negative regulation of chromatin silencing at silent
                     mating-type cassette [Evidence IMP] [PMID 16286008];
                     GO_process: GO:0031939 - negative regulation of chromatin
                     silencing at telomere [Evidence IMP] [PMID 16286008];
                     GO_process: GO:0045893 - positive regulation of
                     transcription, DNA-templated [Evidence IMP] [PMID
                     12086626]; GO_process: GO:0030174 - regulation of
                     DNA-dependent DNA replication initiation [Evidence IMP]
                     [PMID 19417103]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Cti6p"
                     /protein_id="XP_018736982.1"
                     /db_xref="GeneID:30033972"
                     /translation="MVGKRAGRSRSAQAGEVSDSTSSTPNGDSGNSSRRSRRHASSLL
                     EGDDEMTEENDTSRPHDEDSADNSSSINNNSSSKEKGISSTPTRRRTRKGTEGVADSV
                     LVAEEATLSSTPVKSQVKNEDGDDTIGEDEMKLEYDNDNEKEDEIVHDADVTIEEEGN
                     TTKELMSDEEAEPEADLDPEPEAELKNEPTGKEEQEEEEDDVEEEHIGRRGKREKRER
                     KTKVEPEDDTGAAGDDESHEDTKDSIDPAPRRRGRGRGKRRRKSPNEEDVELDADGDT
                     EMVPAEPELEPDLEDADEAQADGASDDIPEEGEEDAEGEDSSVTRCICGHQELQTHRI
                     SKTKHSSIDSGLFIQCDQCQVWQHGFCVGFSSETEVPDVYYCEWCRPDFHLVVVRPWG
                     KTSSYLPHADPNANAAKEDDGSSVSNGNDDEHSSGSRSSRAQRHRKDLNERDGYFDKK
                     EKDEDTSISSIDKTASNGNVAKSVSSPSTRSRRSAAAQGSPTVIRTAHEEAAHRRKTL
                     NSSRDMSYEETLKRVLEESTYDIQPPNASAANDSDSNTTTTTTSTTRRRRNNNSSQAL
                     LAAEAAERDRDISSEDQSGSMTSSKRRTRDNTMKPPSRKRAAGGAVNGAGSGAAETGE
                     GSRASSPVSESRTTGSTGKSKRQRTKGSRNQASSEGNSAGASGASTPKKSATRPVERS
                     KPRIPPPRSTMSDMRKRVGAILEFIARTQIDHANEQNERHQLLRDRNSLHQQLTGEPP
                     QTDASSTSDQQPDPTSKFAGLFQLHQSNLDQMDQLTRKLLHWEQLFGRYGERSTH"
     gene            complement(<394926..>395036)
                     /locus_tag="AWJ20_2100"
                     /db_xref="GeneID:30033975"
     tRNA            complement(<394926..>395036)
                     /locus_tag="AWJ20_2100"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:30033975"
     gene            complement(<395314..>397683)
                     /gene="TCO89"
                     /locus_tag="AWJ20_2101"
                     /db_xref="GeneID:30033976"
     mRNA            complement(<395314..>397683)
                     /gene="TCO89"
                     /locus_tag="AWJ20_2101"
                     /product="Tco89p"
                     /transcript_id="XM_018879028.1"
                     /db_xref="GeneID:30033976"
     CDS             complement(395314..397683)
                     /gene="TCO89"
                     /locus_tag="AWJ20_2101"
                     /note="Subunit of TORC1 (Tor1p or
                     Tor2p-Kog1p-Lst8p-Tco89p); regulates global H3K56ac; TORC1
                     complex regulates growth in response to nutrient
                     availability; cooperates with Ssd1p in the maintenance of
                     cellular integrity; deletion strains are hypersensitive to
                     rapamycin; GO_component: GO:0031931 - TORC1 complex
                     [Evidence IPI] [PMID 14736892]; GO_component: GO:0031234 -
                     extrinsic component of cytoplasmic side of plasma membrane
                     [Evidence IDA] [PMID 14736892]; GO_component: GO:0000306 -
                     extrinsic component of vacuolar membrane [Evidence IDA]
                     [PMID 14736892]; GO_component: GO:0000329 - fungal-type
                     vacuole membrane [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0000329 - fungal-type vacuole membrane
                     [Evidence IDA] [PMID 17560372]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005886 - plasma
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0031929 -
                     TOR signaling [Evidence IC] [PMID 14736892]; GO_process:
                     GO:0031505 - fungal-type cell wall organization [Evidence
                     IMP] [PMID 14736892]; GO_process: GO:0006071 - glycerol
                     metabolic process [Evidence IGI] [PMID 10931309];
                     GO_process: GO:0001558 - regulation of cell growth
                     [Evidence IPI] [PMID 14736892]; GO_process: GO:0009651 -
                     response to salt stress [Evidence IMP] [PMID 17298473]"
                     /codon_start=1
                     /product="Tco89p"
                     /protein_id="XP_018736983.1"
                     /db_xref="GeneID:30033976"
                     /translation="MPHTTGPNRVLRQTSGNDSGGSDDSSGSSSNTRKPERPHLTSHN
                     SSTGGQKLFVARSGHGHAKHFRSSASATRLNKMTRMAPLHGLNDSSVTGRSPNQTSGV
                     AQGTSGATGAAGAGAGAGSGGGPSSGGSGSRGNAKFLRSKSTDNIYNHNPAEVIHRRN
                     TSQAMLRSSRSQTRIGRHHPHMHALMPTRSRDSSVSVDQTGGSAATGAGSGSGSGGAV
                     KRKSTAGMVRAARPVIQLDHDDSDDENDMEESGDESHDKSDARNLDSASKNANANANQ
                     VPLPVEEQAAQQTRGAVQIQELPPSDSPVSTGSNTNTTNGGADANTNANSNSSRASPL
                     SPAAGSEAVREPLPTADSTVSKGATTPAISAVTSTSSRQSSPRPGASASVTATATAAF
                     QSATGRDMTSNNLQPPSLGGQPKSDEEYEDTDADDDDEPPATSQPKHISPTDSFKPLL
                     HSTNTPTPPQISTETVVAISGSEASTSGSSTTATPYLSRTTSNHLNSDSTGSDPEVVR
                     SRFLDTSYRSGESTPYPVASWVDLQRISSTTNNTSSSSAVVDPVNGKITNGPADSGIA
                     SGSGAGNSTGANRVASETALDNPSLVTTRTQQKLWLQRQSIDHPPTPTSTMSLTSEQR
                     RDFERITKEFINVRRYQSPIAEAVDRIRNRRQPQVSSVALQNRKKRPDTNNSSDPYSN
                     LSQSLPKRVTSLSATTLNESNGFPTDNTNASNTWKSVTTTTAASAANVGSVAYKLTKI
                     WNEGWQDPDEPEPPAPQESPSIHSQAQQVQQQIAAAQRQIRSNAAIKLV"
     gene            <399353..>400633
                     /gene="VPS45"
                     /locus_tag="AWJ20_2102"
                     /db_xref="GeneID:30033977"
     mRNA            <399353..>400633
                     /gene="VPS45"
                     /locus_tag="AWJ20_2102"
                     /product="Vps45p"
                     /transcript_id="XM_018879029.1"
                     /db_xref="GeneID:30033977"
     CDS             399353..400633
                     /gene="VPS45"
                     /locus_tag="AWJ20_2102"
                     /note="Protein of the Sec1p/Munc-18 family; essential for
                     vacuolar protein sorting; required for the function of
                     Pep12p and the early endosome/late Golgi SNARE Tlg2p;
                     essential for fusion of Golgi-derived vesicles with the
                     prevacuolar compartment; GO_component: GO:0000139 - Golgi
                     membrane [Evidence IDA] [PMID 7720726]; GO_component:
                     GO:0031201 - SNARE complex [Evidence IPI] [PMID 10397773];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     9624182]; GO_component: GO:0019898 - extrinsic component
                     of membrane [Evidence IDA] [PMID 7720726]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0005774 - vacuolar membrane [Evidence IEA];
                     GO_component: GO:0005773 - vacuole [Evidence IEA];
                     GO_function: GO:0000149 - SNARE binding [Evidence IPI]
                     [PMID 16769821]; GO_function: GO:0051082 - unfolded
                     protein binding [Evidence IMP,IPI] [PMID 11432826];
                     GO_process: GO:0032258 - CVT pathway [Evidence IMP] [PMID
                     10545112]; GO_process: GO:0006895 - Golgi to endosome
                     transport [Evidence IGI] [PMID 9335586]; GO_process:
                     GO:0006896 - Golgi to vacuole transport [Evidence IMP]
                     [PMID 7720726]; GO_process: GO:0048210 - Golgi vesicle
                     fusion to target membrane [Evidence IMP] [PMID 9650782];
                     GO_process: GO:0035543 - positive regulation of SNARE
                     complex assembly [Evidence IMP] [PMID 11432826];
                     GO_process: GO:0006623 - protein targeting to vacuole
                     [Evidence IMP] [PMID 7628704]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0007035 -
                     vacuolar acidification [Evidence IMP] [PMID 7628704];
                     GO_process: GO:0000011 - vacuole inheritance [Evidence
                     IMP] [PMID 1493335]; GO_process: GO:0007033 - vacuole
                     organization [Evidence IMP] [PMID 9650782]; GO_process:
                     GO:0006904 - vesicle docking involved in exocytosis
                     [Evidence IEA]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Vps45p"
                     /protein_id="XP_018736984.1"
                     /db_xref="GeneID:30033977"
                     /translation="MKQRPLIRFDRNSSMAKKLAHEVSYIVKQERTQLFDFRKPDTAP
                     ILLILDRRNDPITPLLTPWTYQAMVHELVGIQNNRVDLSNVPDISKDLKEIVLSADKD
                     PFFAKTMYLNFGDLGASIKDYVSQYQAKTKSNSVIESIADMKRFVEDYPEFRRLSGNV
                     SKHVTLVSELSRLVSTNGDLLEVSELEQSLACNDSHNSDMKNVQQMLVQSQVSANSKL
                     RLVALYALRYQYHSNNATEALLGLLGTQHPEIASKIHAVRILVNSYAGGKQRQENLFA
                     SSSFFARAQSGFKGLKGVENVYTQHEPLLKTTLTNLIKGKLKKTTHPYYDPGDGSLPS
                     WAVHGMGSGPGSNSDDGEKPQDIIIFMVGGTTYEEARVVAEMNAVARGVRILIGGTTI
                     HNSQSFLNDIEDAGSRWPPPPPATASERLASRVH"
     gene            complement(<401313..>401825)
                     /gene="CBC2"
                     /locus_tag="AWJ20_2103"
                     /db_xref="GeneID:30033978"
     mRNA            complement(<401313..>401825)
                     /gene="CBC2"
                     /locus_tag="AWJ20_2103"
                     /product="Cbc2p"
                     /transcript_id="XM_018879030.1"
                     /db_xref="GeneID:30033978"
     CDS             complement(401313..401825)
                     /gene="CBC2"
                     /locus_tag="AWJ20_2103"
                     /inference="similar to AA sequence:KEGG_Orthology:K12883"
                     /note="Small subunit of the heterodimeric cap binding
                     complex with Sto1p; interacts with Npl3p, possibly to
                     package mRNA for export from the nucleus; may have a role
                     in telomere maintenance; contains an RNA-binding motif;
                     GO_component: GO:0000243 - commitment complex [Evidence
                     IDA] [PMID 8682299]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005846 - nuclear cap
                     binding complex [Evidence IEA]; GO_component: GO:0005846 -
                     nuclear cap binding complex [Evidence IDA] [PMID 8811086];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0048471 - perinuclear region of cytoplasm
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0000339 - RNA cap binding
                     [Evidence IEA]; GO_function: GO:0000339 - RNA cap binding
                     [Evidence IDA,ISS] [PMID 8682299]; GO_function: GO:0003676
                     - nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0008380 - RNA splicing [Evidence IEA];
                     GO_process: GO:0045292 - mRNA cis splicing, via
                     spliceosome [Evidence IEA]; GO_process: GO:0006397 - mRNA
                     processing [Evidence IEA]; GO_process: GO:0000398 - mRNA
                     splicing, via spliceosome [Evidence IMP] [PMID 8682299];
                     GO_process: GO:0051028 - mRNA transport [Evidence IEA];
                     GO_process: GO:0000184 - nuclear-transcribed mRNA
                     catabolic process, nonsense-mediated decay [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Cbc2p"
                     /protein_id="XP_018736985.1"
                     /db_xref="GeneID:30033978"
                     /translation="MSRIDNPDLFTVHSTERTDGPSGYILRQAKRSQKGQDDLKAVET
                     TKTLYVGNLSFYTSEEQIFELFSKAGEITRIIMGLDRFNKTPCGFCFVEYETHKQAVD
                     CVKYINGTKLDDRVVKVDLDPGFVEGRQYGRGSSGGQVRDEFRDDYDPGRGGYGKRWS
                     QAAQADRDAL"
     gene            <404526..>406079
                     /gene="DJP1"
                     /locus_tag="AWJ20_2104"
                     /db_xref="GeneID:30033979"
     mRNA            <404526..>406079
                     /gene="DJP1"
                     /locus_tag="AWJ20_2104"
                     /product="Djp1p"
                     /transcript_id="XM_018879031.1"
                     /db_xref="GeneID:30033979"
     CDS             404526..406079
                     /gene="DJP1"
                     /locus_tag="AWJ20_2104"
                     /note="Cytosolic J-domain-containing protein; required for
                     peroxisomal protein import and involved in peroxisome
                     assembly, homologous to E. coli DnaJ; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005829 - cytosol [Evidence IDA] [PMID 9679141];
                     GO_function: GO:0051087 - chaperone binding [Evidence ISS]
                     [PMID 9679141]; GO_process: GO:0016558 - protein import
                     into peroxisome matrix [Evidence IMP] [PMID 9679141]"
                     /codon_start=1
                     /product="Djp1p"
                     /protein_id="XP_018736986.1"
                     /db_xref="GeneID:30033979"
                     /translation="MVVDTAYYEILEVSTDASELDIKRAYRKMAIRHHPDKNPDDPTA
                     HERFQAIGEAYQVLSDPDLRKRYDQFGKEQAVPDAGFEDPAEFFTTIFGGEAFADLIG
                     EISLIKDLTKTMEIASLDDDEDDLVTGEKKSEVKADAEKTSTPGAGGSGLSPTAAAEA
                     SPLNSASTKTGGHSPSGSATTATSPFPNVQSPQPSYGAAEARPAATSPLPGTKSGKGT
                     PVLAAITAGPDSDAHSTASSSTATEKKKEKKDKKSKNSLSKEQKAELEQYEIERQKAK
                     AERLETLRVKLIDRISVWTETGKDDAVTYAFKEKTRLEAENLKMESFGIELLHAIGHT
                     YYSKGSTLLKSQKFLGISGFFSRVKEKGTLAKDTWNTISSALDAQSSLQEMARAEEKG
                     GDEWTEERRVEMERTLLGKILAAAWNGSRYEIQSVLREVCDQVLYDKSVPMSKRLERA
                     QALVIIGSIFKSTVRTAEEAAEAQMFEELVAEAAASKKKKKDKHQHQTAAEKSADAAS
                     AAASAAASH"
     gene            complement(<406313..>407005)
                     /locus_tag="AWJ20_2105"
                     /db_xref="GeneID:30033980"
     mRNA            complement(<406313..>407005)
                     /locus_tag="AWJ20_2105"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879032.1"
                     /db_xref="GeneID:30033980"
     CDS             complement(406313..407005)
                     /locus_tag="AWJ20_2105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736987.1"
                     /db_xref="GeneID:30033980"
                     /translation="MSRIETAALETYSACDVADALVKNGLADGGFIPHLVQQSPERPP
                     ETAVTGPAYTVLYAPIDDPRPAVASHYIDSAPEGSVVVLATTPDTQLSTAPYTTINNA
                     LYGGLMSTRAKFLGCKGSVVLGKIRDISEHRSLNYPVYSYGLGIAAPNKVAKVVGVNV
                     PLTVPSSDLTIHPGDQIVGDENGVAVIPQRLLQNVIQDIPPRVKADQLAAEDIKSGVP
                     AAEAQKTRRKNL"
     gene            complement(<407804..>409573)
                     /locus_tag="AWJ20_2106"
                     /db_xref="GeneID:30033981"
     mRNA            complement(<407804..>409573)
                     /locus_tag="AWJ20_2106"
                     /product="Uric acid-xanthine permease (UAPA transporter)"
                     /transcript_id="XM_018879033.1"
                     /db_xref="GeneID:30033981"
     CDS             complement(407804..409573)
                     /locus_tag="AWJ20_2106"
                     /codon_start=1
                     /product="Uric acid-xanthine permease (UAPA transporter)"
                     /protein_id="XP_018736988.1"
                     /db_xref="GeneID:30033981"
                     /translation="MTASNNIIDPVVVYADEEELPHPIAQTKTATTIRSTAETIRRKI
                     TTREGILGDFDYAYLFTPRIPFYTSMKERQSSEPTRSSTVFFGLNSSIPLLLGIVLGL
                     QHCLAMLAGIITPPIIISSMANLTTEDSEYLVSASLIACGFLSMVQIIRFRILKTKYY
                     IGTGLLSVVGTSFSTISVVSTAFPQFYKNGFCPSDANGKPLPCPDAYGALLGTCAVCG
                     LIEVLLSFCPPKILQKIFPPLVTGPVVLLIGTSLVQSGFQDWVGGSGCATPGTICPSP
                     GAPHALPWGSAQFIGLGFLAFVCIVLCEKWGSPFMKSCSIVISLIIGCIVAAACGYFD
                     RSTIDAAPVANFMWVKTFRLSVAGNMVLPVLSVYIVCMMETIGDVTATSDVSRQPVEG
                     DLYDSRIQGGVLADGLNSIIAALMTITPMSTFAQNNGVISLTQCANRVAGLWACFFLI
                     IMGIFSKFAGAIVAIPKPVLGGVTTFLFSSVAVSGIKIISSIPFTRRDRFVLTASLMF
                     GFAALLVPNWFSQVFTYQGDNNRLKGLLDAVIIFMETPYSIAGFVGVIVNLVIRQEFD
                     VATSIEDLDGTENVHLPGAETEK"
     gene            <414602..>416371
                     /gene="CLG1"
                     /locus_tag="AWJ20_2107"
                     /db_xref="GeneID:30033982"
     mRNA            <414602..>416371
                     /gene="CLG1"
                     /locus_tag="AWJ20_2107"
                     /product="Clg1p"
                     /transcript_id="XM_018879034.1"
                     /db_xref="GeneID:30033982"
     CDS             414602..416371
                     /gene="CLG1"
                     /locus_tag="AWJ20_2107"
                     /note="Cyclin-like protein that interacts with Pho85p; has
                     sequence similarity to G1 cyclins PCL1 and PCL2;
                     GO_component: GO:0000307 - cyclin-dependent protein kinase
                     holoenzyme complex [Evidence IPI] [PMID 9032248];
                     GO_function: GO:0016538 - cyclin-dependent protein
                     serine/threonine kinase regulator activity [Evidence ISA]
                     [PMID 8212900]; GO_function: GO:0016538 - cyclin-dependent
                     protein serine/threonine kinase regulator activity
                     [Evidence IPI] [PMID 9032248]; GO_function: GO:0019901 -
                     protein kinase binding [Evidence IEA]; GO_process:
                     GO:0016239 - positive regulation of macroautophagy
                     [Evidence IMP] [PMID 20417603]; GO_process: GO:0000079 -
                     regulation of cyclin-dependent protein serine/threonine
                     kinase activity [Evidence IEA]"
                     /codon_start=1
                     /product="Clg1p"
                     /protein_id="XP_018736989.1"
                     /db_xref="GeneID:30033982"
                     /translation="MPGLPYYNDQMVTPPDYLVNHPAYGHNMPATRYASNPAPPQPYS
                     YGMVAPAQAISAPYDYPYKQSIRYQQLQQQARAHAQAQAQAQAQAQAQQHSQDYQDYQ
                     QQRQAQSSSVQAHLPHQLQSQPQLQLQMPQTHVYAHQPQSQPGPHQSHTRHHHATSFS
                     SNGTTFFVPTVPLDQMAPHMAPAGSSNGLRPALGPAIAPVVGQTGVSAPGTGHSVNGT
                     APAGAAAAAQAQAQPPTGGVSATLDYEIDQMSDFLSTMAFGIMVPMASTNQFTWDNPS
                     FTAYKKFVCQVLTATRLPKSTIILALVYLSKKWAISKPTVVECDSSVVYTVLVVALLL
                     ANKFHDDNTFTNKSWNEATGIPVKELTTVEAQWLREIQWSLSLNQNDLKGWQKWNHCW
                     KVYMSSKAAAVAAATVKQMSPYRSEAKEKYSDGLPSPTSPVYYSRDSSPRSNSPRRAT
                     YTIPKWYETANNTPVNAISSGRRSASQQHSSAALAAVTSNTSEPFVSYFQQSFAIPGT
                     SAYDEEKAVDSASYNRRAIPGAYYNYPTHHHHAHHHQYPQSHYMAAYNHLAGCSCSLC
                     VFEPIKQPAIHNGQWFGSSVVAC"
     gene            complement(<416740..>418065)
                     /locus_tag="AWJ20_2108"
                     /db_xref="GeneID:30033983"
     mRNA            complement(<416740..>418065)
                     /locus_tag="AWJ20_2108"
                     /product="2-aminoadipate transaminase"
                     /transcript_id="XM_018879035.1"
                     /db_xref="GeneID:30033983"
     CDS             complement(416740..418065)
                     /locus_tag="AWJ20_2108"
                     /note="Protein with 2-aminoadipate transaminase activity;
                     shares amino acid similarity with the aminotransferases
                     Aro8p and Aro9p; YER152C is not an essential gene;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_function: GO:0047536 -
                     2-aminoadipate transaminase activity [Evidence IDA] [PMID
                     19342587]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0030170 - pyridoxal
                     phosphate binding [Evidence IEA]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0009058 -
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="2-aminoadipate transaminase"
                     /protein_id="XP_018736990.1"
                     /db_xref="GeneID:30033983"
                     /translation="MSVSKVKKVNFFRGHPSNSLLGPSSHYVLKASENVLSPAHRPGD
                     DDDEDRHPLTYGSDPGSLTVRKQIAKWTYPDLSADKEQIYADSINLTNGASFGAGGAL
                     LQCTSAHSGFTKQAFIVSPTYFLINSVFLDAGFADKFSPIEQRADGSIDLVALEKLLV
                     HFDKEPEVSYEDAAKYIQDDSRPRRKLYKYVMYLVPTFSNPRGTVIPLSDRLKLLELA
                     RAHDMLLLCDDVYDWLYYKADSINDLPPRLVTLDRESTTDSSSYGNTISNCTFSKLVG
                     PGLRVGWQETVSPRLAQQLCQGGAVRSGGTPAHLNTMLVGSLLSLGYMESILKDLRSV
                     FGDRSKHMRQDFEKYLPQGTQIEGGEGGYFFWVTLPEEYNGRAIAEQCLKKNVVLAEA
                     HNFQVAHGPTPRVPINDNSFRICFAYHTVEESQQGIQVWGEVCEENKNK"
     gene            complement(<418614..>421067)
                     /gene="KIP3"
                     /locus_tag="AWJ20_2109"
                     /db_xref="GeneID:30033984"
     mRNA            complement(<418614..>421067)
                     /gene="KIP3"
                     /locus_tag="AWJ20_2109"
                     /product="tubulin-dependent ATPase KIP3"
                     /transcript_id="XM_018879036.1"
                     /db_xref="GeneID:30033984"
     CDS             complement(418614..421067)
                     /gene="KIP3"
                     /locus_tag="AWJ20_2109"
                     /inference="similar to AA sequence:KEGG_Orthology:K10401"
                     /note="Kinesin-related antiparallel sliding motor protein
                     involved in mitotic spindle positioning; sliding activity
                     promotes bipolar spindle assembly and maintenance of
                     genome stability; also inhibits spindle elongation and
                     promotes spindle disassembly in late anaphase;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005881 - cytoplasmic microtubule
                     [Evidence IDA] [PMID 9693366]; GO_component: GO:0005856 -
                     cytoskeleton [Evidence IEA,IEA]; GO_component: GO:0005871
                     - kinesin complex [Evidence IEA]; GO_component: GO:0005871
                     - kinesin complex [Evidence TAS] [PMID 9153752];
                     GO_component: GO:0005874 - microtubule [Evidence IEA];
                     GO_component: GO:0005880 - nuclear microtubule [Evidence
                     IDA] [PMID 9693366]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0008017 - microtubule
                     binding [Evidence IEA]; GO_function: GO:0003777 -
                     microtubule motor activity [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_function: GO:0008574 - plus-end-directed microtubule
                     motor activity [Evidence IDA] [PMID 16906145];
                     GO_function: GO:0008574 - plus-end-directed microtubule
                     motor activity [Evidence IDA] [PMID 16906148];
                     GO_function: GO:0070463 - tubulin-dependent ATPase
                     activity [Evidence IDA] [PMID 16906148]; GO_process:
                     GO:0000132 - establishment of mitotic spindle orientation
                     [Evidence IMP] [PMID 16906148]; GO_process: GO:0000132 -
                     establishment of mitotic spindle orientation [Evidence
                     IGI,IMP] [PMID 9281582]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0007018 -
                     microtubule-based movement [Evidence IEA]; GO_process:
                     GO:0051228 - mitotic spindle disassembly [Evidence IMP]
                     [PMID 23851487]; GO_process: GO:0051228 - mitotic spindle
                     disassembly [Evidence IMP] [PMID 9813090]; GO_process:
                     GO:0030472 - mitotic spindle organization in nucleus
                     [Evidence IGI,IMP] [PMID 10525539]; GO_process: GO:0031115
                     - negative regulation of microtubule polymerization
                     [Evidence IMP] [PMID 24616221]; GO_process: GO:0030473 -
                     nuclear migration along microtubule [Evidence IMP] [PMID
                     9693366]; GO_process: GO:0070462 - plus-end specific
                     microtubule depolymerization [Evidence IDA] [PMID
                     16906145]; GO_process: GO:0070462 - plus-end specific
                     microtubule depolymerization [Evidence IDA] [PMID
                     16906148]; GO_process: GO:0032888 - regulation of mitotic
                     spindle elongation [Evidence IMP] [PMID 24616221];
                     GO_process: GO:0090307 - spindle assembly involved in
                     mitosis [Evidence IMP] [PMID 23851487]"
                     /codon_start=1
                     /product="tubulin-dependent ATPase KIP3"
                     /protein_id="XP_018736991.1"
                     /db_xref="GeneID:30033984"
                     /translation="MQQALFNGGGGNSNGSGSSSSNGMRQNRIREHRFVFDRLFDDTA
                     TQNDVYCHTTRPLLDNVLDGYNATVFAYGATGCGKTHTISGNPSQPGIIFLTMKELFE
                     RIDALRDTKTIDLSLSYLEIYNETIRDLLEPAGSGPGPKRILQLRENADKRISVSNLS
                     SHKPENVDQVMDMILQGNQNRTMSPTEANAVSSRSHAVLQINITQKARTAELSEAHTF
                     ATLSIIDLAGSERASATKNRGERLIEGANINKSLLALGNCINALCDPRQRGHVPYRDS
                     KLTRLLKFSLGGNCKTVMIVCVSPSSQHYDETLNTLKYADRAKKIKTKVSRNQHSLDR
                     HVGSYLKMITEQRAEIEELRNREAKVIQEALDKDRMTREKRLKALEEALESLDAAVEK
                     SRSEYSNKSVCISKLRTLSLQISQIDAIAEALVENSKQYQLPGMEVFQSALQMAKNKA
                     TAEQGKIQQYLQSINASQAIDSAATILSRRLQETSGWSKQDSTNFENYLNWKKSSLEN
                     ELLQKSLTGTPSAISLNVVARLLFKCIGRLESLRSQPGEIIAGEVTLLTKELLNDMER
                     SNILTEPTGCESNAFDLSLLNQPQQPLLHTSSVMNNVVHMTASPKRLSSSRRVSILKK
                     KSPRLLRRSSVLMRASSPLKPRKTSKRVRWEDSEDTDSLANDMTESASDMGLSDSSMS
                     VDRSTPTVAPLTDPRVTRLMSPLREVTLDSDINSSIDYSVSHPSGMGKKIGPRSDLTR
                     RSLNKPRPSILGINKHAPGRVEKENSSSPISSLDNQSILLSPSSTPPVPTLSSRSSGT
                     PFHLAATASSSMKQNLRRS"
     gene            <423686..>425777
                     /gene="OXA1"
                     /locus_tag="AWJ20_2110"
                     /db_xref="GeneID:30033986"
     mRNA            join(<423686..423807,424616..>425777)
                     /gene="OXA1"
                     /locus_tag="AWJ20_2110"
                     /product="Oxa1p"
                     /transcript_id="XM_018879038.1"
                     /db_xref="GeneID:30033986"
     CDS             join(423686..423807,424616..425777)
                     /gene="OXA1"
                     /locus_tag="AWJ20_2110"
                     /inference="similar to AA sequence:KEGG_Orthology:K03217"
                     /note="Mitochondrial inner membrane insertase; mediates
                     the insertion of both mitochondrial- and nuclear-encoded
                     proteins from the matrix into the inner membrane; also has
                     a role in insertion of carrier proteins into the inner
                     membrane; acts as a voltage-gated ion channel, activated
                     by substrate peptides; interacts with mitochondrial
                     ribosomes; conserved from bacteria to animals;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA,IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0030061 - mitochondrial crista [Evidence
                     IDA] [PMID 22513091]; GO_component: GO:0097002 -
                     mitochondrial inner boundary membrane [Evidence IDA] [PMID
                     22513091]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005762 -
                     mitochondrial large ribosomal subunit [Evidence IPI] [PMID
                     14657017]; GO_component: GO:0005762 - mitochondrial large
                     ribosomal subunit [Evidence IPI] [PMID 19783770];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0005216 - ion channel
                     activity [Evidence IDA] [PMID 22829595]; GO_function:
                     GO:0032977 - membrane insertase activity [Evidence IMP]
                     [PMID 9285818]; GO_function: GO:0032977 - membrane
                     insertase activity [Evidence IMP] [PMID 9428747];
                     GO_function: GO:0097177 - mitochondrial ribosome binding
                     [Evidence IDA] [PMID 14657018]; GO_process: GO:0000002 -
                     mitochondrial genome maintenance [Evidence IGI,IMP] [PMID
                     18826960]; GO_process: GO:0033615 - mitochondrial
                     proton-transporting ATP synthase complex assembly
                     [Evidence IMP] [PMID 17344477]; GO_process: GO:0045039 -
                     protein import into mitochondrial inner membrane [Evidence
                     IMP] [PMID 22846909]; GO_process: GO:0051205 - protein
                     insertion into membrane [Evidence IEA]; GO_process:
                     GO:0032979 - protein insertion into mitochondrial membrane
                     from inner side [Evidence IMP] [PMID 17452441];
                     GO_process: GO:0032979 - protein insertion into
                     mitochondrial membrane from inner side [Evidence IMP]
                     [PMID 9285818]; GO_process: GO:0032979 - protein insertion
                     into mitochondrial membrane from inner side [Evidence IMP]
                     [PMID 9428747]; GO_process: GO:0032979 - protein insertion
                     into mitochondrial membrane from inner side [Evidence
                     IMP,IPI] [PMID 9482871]"
                     /codon_start=1
                     /product="Oxa1p"
                     /protein_id="XP_018736992.1"
                     /db_xref="GeneID:30033986"
                     /translation="MLLREDTLPDIGLATFETNPEPKSTVASPEPRTGEAEDDEPYGS
                     SVLQQSVFGVRPALRQTKAFPGFAKRFNSSQVASATTSSTNGTTETVSELAASAGSAI
                     QTEIAPIVQSASETIQAVVDTVSPDQIGYFQSVGLAQSWWWPPGMFQHIFEIVHVSTG
                     LPWWATIAMVTVGMRAVMFPMYLKASNATAKMTALKPELNRLMKDYTNSDDPIAAQKT
                     LMERKKLMLAHNVKTSHLLLPMASVPFFIGVFSALNGMSKVPVHGLTSEGALWFTNLA
                     AADPYVGLQLITALFYATTFKLGGETGANTMSPAMKKIFTYMPLIAVPMTMSLPASVC
                     MYFALNGVLSVGQTFLLQNKTFRNKVGLAPIVKPAMNPEDNLSIMETLKQSFEKTKQR
                     AEKAQREAERELRLKKEKEAEERSKYVQFTKKPRK"
     gene            complement(<425996..>427117)
                     /gene="LPX1"
                     /locus_tag="AWJ20_2111"
                     /db_xref="GeneID:30033987"
     mRNA            complement(<425996..>427117)
                     /gene="LPX1"
                     /locus_tag="AWJ20_2111"
                     /product="Lpx1p"
                     /transcript_id="XM_018879039.1"
                     /db_xref="GeneID:30033987"
     CDS             complement(425996..427117)
                     /gene="LPX1"
                     /locus_tag="AWJ20_2111"
                     /note="Peroxisomal matrix-localized lipase; required for
                     normal peroxisome morphology; contains a peroxisomal
                     targeting signal type 1 (PTS1) and a lipase motif;
                     peroxisomal import requires the PTS1 receptor, Pex5p and
                     self-interaction; transcriptionally activated by Yrm1p
                     along with genes involved in multidrug resistance; oleic
                     acid inducible; GO_component: GO:0005782 - peroxisomal
                     matrix [Evidence IEA]; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 12135984];
                     GO_component: GO:0005777 - peroxisome [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016298 - lipase activity [Evidence
                     IDA] [PMID 18199283]; GO_function: GO:0016298 - lipase
                     activity [Evidence ISS] [PMID 9200815]; GO_function:
                     GO:0004806 - triglyceride lipase activity [Evidence IDA]
                     [PMID 24187129]; GO_process: GO:0007031 - peroxisome
                     organization [Evidence IEP] [PMID 12135984]; GO_process:
                     GO:0019433 - triglyceride catabolic process [Evidence IGI]
                     [PMID 24187129]"
                     /codon_start=1
                     /product="Lpx1p"
                     /protein_id="XP_018736993.1"
                     /db_xref="GeneID:30033987"
                     /translation="MTITKERFVIDAHHPRESFDSTVSPDDRLKLVYNVYKDDRFDNS
                     TADPTTLINLVFAHGTQMNKEIWQYMIELFYNDFGARLGNVVAIDAINHGESLILNNG
                     KLGPYITWSDGGKDINCVIRALNNVGPTILIGQSMGGAMCTYAVIHEPGLIDSIVIID
                     PVLYLDPEYYTNEHVTALTSDRFKKLEKYIKTKFQNREEYETYMSKKTISRGFHPRVL
                     KDYIDTSAIENPDGTISTINSLDQQLISYLSSQPTLRDLYSLLTAIDSEVLYVCGDIA
                     DWNPPDAHEKVIERLRYGSLKIIPGGKHLVVFDMPDETYAAIKDFVDRRGKRGSELIQ
                     KARARSNYSLNQRLEFAHEGRKYQLESLAAGKRFVYSKL"
     gene            <429657..>431081
                     /gene="GAL83"
                     /locus_tag="AWJ20_2112"
                     /db_xref="GeneID:30033988"
     mRNA            <429657..>431081
                     /gene="GAL83"
                     /locus_tag="AWJ20_2112"
                     /product="Gal83p"
                     /transcript_id="XM_018879040.1"
                     /db_xref="GeneID:30033988"
     CDS             429657..431081
                     /gene="GAL83"
                     /locus_tag="AWJ20_2112"
                     /note="One of three possible beta-subunits of the Snf1
                     kinase complex; allows nuclear localization of the Snf1
                     kinase complex in the presence of a nonfermentable carbon
                     source; contains glycogen-binding domain; GAL83 has a
                     paralog, SIP2, that arose from the whole genome
                     duplication; GO_component: GO:0031588 - AMP-activated
                     protein kinase complex [Evidence IDA] [PMID 12393914];
                     GO_component: GO:0031588 - AMP-activated protein kinase
                     complex [Evidence IPI] [PMID 7813428]; GO_component:
                     GO:0031588 - AMP-activated protein kinase complex
                     [Evidence IPI] [PMID 9121458]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 17237508]; GO_component:
                     GO:0005641 - nuclear envelope lumen [Evidence IDA] [PMID
                     17237508]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 11331606]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 17237508]; GO_function: GO:0004679 -
                     AMP-activated protein kinase activity [Evidence IGI] [PMID
                     10990457]; GO_function: GO:0004679 - AMP-activated protein
                     kinase activity [Evidence IMP] [PMID 7813428]; GO_process:
                     GO:0007155 - cell adhesion [Evidence IMP] [PMID 12556493];
                     GO_process: GO:0001403 - invasive growth in response to
                     glucose limitation [Evidence IMP] [PMID 12556493];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IGI] [PMID 10990457]; GO_process: GO:0043254 - regulation
                     of protein complex assembly [Evidence IGI] [PMID 9121458];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IGI] [PMID 10990457]"
                     /codon_start=1
                     /product="Gal83p"
                     /protein_id="XP_018736994.1"
                     /db_xref="GeneID:30033988"
                     /translation="MGNSSSQEDDAANKQQQQQHQQQQHHRHHFHHSHHKGSNTSTPS
                     HDQEEFPPVPPQGFDQIPIAGVGVTATTSVSKEQATVSPPGGTSGNTGSLNQHQRSSS
                     FHHEEFASASHEENVRQVPATATTPSSATTAQPPAASAGVGGSNKPVVQPLQSYDANS
                     TNSNDGAKRPPLRRKSTLLLDEPAEMDEEEMELSKLKLTNELKPLSRAGSGEEVVLTN
                     QDDYQGNVFSTVIDWKQGGNKVYVTGTFTGWRKMIRLSKVSEEQLQNQKAHADASGDN
                     QQPPLASTPPTISKDLFSVVLKLPKGTHRLRFVVDNELRCSDFLPTATDSMGNLVNYI
                     EVGVEEDRPVQSQSQAVAGGIGGDDEGDGEYEKFNEDDEMLREPVLQYGNEIPSVFTD
                     PEVMDQFVSSDFVTPPQLPPHLEGVILNSNSTEKDNNSILPIPNHVVLNHLATTSIKH
                     NVLAVASISRYSRKYVTQILYAPL"
     gene            <435444..>441317
                     /gene="BEM2"
                     /locus_tag="AWJ20_2113"
                     /db_xref="GeneID:30033989"
     mRNA            <435444..>441317
                     /gene="BEM2"
                     /locus_tag="AWJ20_2113"
                     /product="Bem2p"
                     /transcript_id="XM_018879041.1"
                     /db_xref="GeneID:30033989"
     CDS             435444..441317
                     /gene="BEM2"
                     /locus_tag="AWJ20_2113"
                     /note="Rho GTPase activating protein (RhoGAP); involved in
                     the control of cytoskeleton organization and cellular
                     morphogenesis; required for bud emergence; potential GAP
                     for Rho4p; GO_component: GO:0005938 - cell cortex
                     [Evidence IDA] [PMID 17914457]; GO_component: GO:0005934 -
                     cellular bud tip [Evidence IDA] [PMID 17914457];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     17914457]; GO_component: GO:0000131 - incipient cellular
                     bud site [Evidence IDA] [PMID 17914457]; GO_component:
                     GO:0005622 - intracellular [Evidence IEA]; GO_component:
                     GO:0043332 - mating projection tip [Evidence IDA] [PMID
                     17914457]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 17914457]; GO_component: GO:0005628 - prospore
                     membrane [Evidence IDA] [PMID 24390141]; GO_function:
                     GO:0005096 - GTPase activator activity [Evidence IEA];
                     GO_function: GO:0005100 - Rho GTPase activator activity
                     [Evidence IDA] [PMID 7962098]; GO_function: GO:0005085 -
                     guanyl-nucleotide exchange factor activity [Evidence IEA];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_process: GO:0030036 - actin
                     cytoskeleton organization [Evidence IGI] [PMID 7579704];
                     GO_process: GO:0030010 - establishment of cell polarity
                     [Evidence IC] [PMID 7579704]; GO_process: GO:0035024 -
                     negative regulation of Rho protein signal transduction
                     [Evidence IGI,IMP] [PMID 17914457]; GO_process: GO:0043547
                     - positive regulation of GTPase activity [Evidence IEA];
                     GO_process: GO:0043087 - regulation of GTPase activity
                     [Evidence IEA]; GO_process: GO:0051056 - regulation of
                     small GTPase mediated signal transduction [Evidence IEA];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IEA]; GO_process: GO:0007264 - small GTPase mediated
                     signal transduction [Evidence IEA]"
                     /codon_start=1
                     /product="Bem2p"
                     /protein_id="XP_018736995.1"
                     /db_xref="GeneID:30033989"
                     /translation="MERRTQALRGGSAAGGSDGLNAAKDGWVNRHASSASATTAVAGS
                     GSGAGISSSASSNTLVPSGSISSNLTALASGPGGSGGTNGAAVTSQVYSWRLTRAVLK
                     NGTLLLYKPPTDLGIKSFDPSLEPAHPLSPNLSSPTSATSGGGGHKRVGSVSTATAAS
                     SSSASVSAAAAAAGSRSFHSLSYRGFDVHPDLLFDSQGKIVNGSFEAICHSILFTGDE
                     DFATTAVLTIPLMGDVVRALEMMKEYVLSVARQAHSGGGGPNAQAIAVRVKLVIDTML
                     TNFKGMLLNNSIHASLQQLADSVSSYNDQISTALKLSIYQKHQRMNKMLTYTREDTEV
                     LWSMQQKVTDSMSERLHAFLGRIDSSIGSDSISSIANLPPRQQVAHNLSGSGSGGGSG
                     GTGGVGGGLSAQQLNIPPDLFIELTSTDFLANQISCFHLKFYKQWSPAIDISLLFKTN
                     YSYHRYNPLVFDANNLHFLGVLLIDHLLSPKYSKLFDNSYRGRLLTHWINLGNSLKVC
                     GDLVGWVAIVTAICSPAILRLRECWAYVPIELRENVGKDWGHELFELDRRAKMDLMSK
                     RTFRVATEDIGVTYPKERSISFFADLTVKIDEGATSYKMCEDRVNRVRTVINSWKYFF
                     DRIPQNDTFGLPPQPNAAVQKLLHSLLVTNYETPQLTQEEIFKLSLSVDPPKFGNYLK
                     YHYSQQSPLMTGSFLPLIFTDTNATYKLFTKSSLISALSGVAGTGGASALSSSNKRLV
                     RSGTTRSSDGTNASTIPTSASSNFYTHGGHSTLSTSSTLLSGGRNASTNLHRSNSFPP
                     SNTKSSAMTTGVQDIDYFSREFVAKYASQHILMKNIRDVLNMGAKLYHINEDIVLKSL
                     SEEYNSRPSSMIEAPSKHLSMSSRRVSTQFGSTVSPRTSVNGGTPDFSKVFESFAVSI
                     DVVVKSANLERLVDILVLGVNGFASFVNQQDVDRQGNLPDFRIDMNVHTLTFFATFRS
                     FCSPLELLTSLRKRFVGARSAAMSIDELTDKEREVAFDDVQFPNWDPVCEIPLDNNRA
                     WGIVAQIQIGVLEACHLWVSQYFSDFADNVSLKEQFLELTEIFGTDIASWKGLQASSQ
                     INEDYSGYLETMEVLQKKVRNLFYKKSYRPNDVCPLIPQNPVGMRYENLPVGNTNVTF
                     MKLEKFIDDINLVVSEYLGMVSVKEWMELFETLELQSAEINGFFHYSPPPYSSEDDFV
                     IQDIFTYLESLYRENANGERAKTLDFFPPSIQELFRLRHNIISYLTYQIGDPLIHKDD
                     RIQRMISILRMIGISKARMTFLDLFPKDETTDSDQLWMSQADNSGISTSVPSFIESCV
                     IASVLRPESRLFANSWMQASREICKLYHRSSNPTSFASLEMFVPVIRGENLVFSGSKQ
                     PLSPCVGWTIERMFEIVCYVPNMSVENSSLINFDKRRFIYNLITNVSEMKGEIEDDNE
                     DGSRVSNGSHRIQTVARRIAYIVNPDKTLYYTDKRTLKESVARDTKEYPRSYSKNKVF
                     TSYVTLEAEKLKRDVRQRELIERQYRDVKKSLKSRYGSSSSSSGTIGSQTLSDKKSQR
                     SRFGGLFKAVRPISMAFSGTFIPPSDRIVSVYELPDISTISDSKCKLLASINLANCDI
                     IAVPNQHGNYGLFKVVVQDNNGSELVFQGLSDEDAAEWVRLATTGKRYATLRGQLQPS
                     SSSSSPNAPASPVAFTRVFGVPIAVVCEREARDIPMVVDVLLNEIESRGLDEVGLYRV
                     SGSLASVHALKAAFDSGQEVDMEDDRWFDINTVAGCFKLYLRELREPLLTTELFPEFV
                     QCGSSGAGTEDMLKQLRVSIRKLPAPNYNLLRRLLRHLGQVAEHEANNKMKTPNLAIV
                     FSMSFLPASAVDQMKAMQNVLNTMIIHHERLFGDDQPVEYSTEAAEITANTADLSLGE
                     TTNSHDQNHNTASDNQPDSSEPSTTHSGTENTDSQLPTGNQAGSKHDRDSFTEVSAY"
     gene            <442341..>443831
                     /gene="MDM34"
                     /locus_tag="AWJ20_2114"
                     /db_xref="GeneID:30033990"
     mRNA            <442341..>443831
                     /gene="MDM34"
                     /locus_tag="AWJ20_2114"
                     /product="ERMES complex subunit MDM34"
                     /transcript_id="XM_018879042.1"
                     /db_xref="GeneID:30033990"
     CDS             442341..443831
                     /gene="MDM34"
                     /locus_tag="AWJ20_2114"
                     /inference="similar to AA sequence:KEGG_Orthology:K17775"
                     /codon_start=1
                     /product="ERMES complex subunit MDM34"
                     /protein_id="XP_018736996.1"
                     /db_xref="GeneID:30033990"
                     /translation="MSFKFNWNSFNDESFYTRAKKLLTDALNKSNKPPIIVDKIIVQD
                     LSLGSEAPDLEILEIGDLADDRFRGIFKLTYSGNASITLATKVQANPLNVYAQNAPGF
                     CMPQFLGASSSLAMPLNLTLSDIVLSGIIILVFSKAKGLTLVFRNDPLEKIKVSSTFD
                     ALPGIAKFLQVQIENQIRVLFREELPTILHKLSQKWTPSGSEMSELMSLKSHTSSPIS
                     TEPSSPRLKPVSLMEINPDMPEFSPTNMLKLEALCASQRTLNLFTPAIPEAVYRSSLE
                     SFENARRKNGRDVQSLVGGDDLYDVMRLQTKQAQNRSSNITPKRRVIKIKRNKASDST
                     NSDTPSAEASAASTPISSSTPTSASTATSASSNTTSSTNTSSSLSPSSSNTSSNSSAD
                     LNSSKTTSIAFLPVIDESLASTSAIPSLDLKLPRQRRESILKPTSILEQDGKQAPSSK
                     HEHEHVHWTHENALPKDKLFKDFFSRNVNIRPDDHTNNPPPPAYVA"
     gene            complement(<444091..>445053)
                     /locus_tag="AWJ20_2115"
                     /db_xref="GeneID:30033991"
     mRNA            complement(<444091..>445053)
                     /locus_tag="AWJ20_2115"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879043.1"
                     /db_xref="GeneID:30033991"
     CDS             complement(444091..445053)
                     /locus_tag="AWJ20_2115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018736997.1"
                     /db_xref="GeneID:30033991"
                     /translation="MKIGTHSGTFHADESLAVYMLRLLPRFKDAELLRSRDNEQLETC
                     DIIVDVGGKYEAPKYFDHHQREFNDTFDDEHKTRLSSAGLIYKHFGKEIIAQLTEVSV
                     DDASIDVLYNKIYNEFIEAIDANDNGISAYPEDTPSSYRTGGITLPSLVSKLNPLWTE
                     PNTDEVLDAKFLKASELMGTAFVSVVENYGKGWYPAKQHVQAAFDARDQYGSEGRIVV
                     FDTFVPWKEHLYTIEKELGKEGEVLYVLYSDGKGWRIQAVAQSSSSFTSRKPLPEPWR
                     GARDEKMSEITGVPGCVFTHVSGFIGGHKTREGALELAKLALQA"
     gene            complement(<445482..>448082)
                     /locus_tag="AWJ20_2116"
                     /db_xref="GeneID:30033992"
     mRNA            complement(<445482..>448082)
                     /locus_tag="AWJ20_2116"
                     /product="putative carboxylic ester hydrolase"
                     /transcript_id="XM_018879044.1"
                     /db_xref="GeneID:30033992"
     CDS             complement(445482..448082)
                     /locus_tag="AWJ20_2116"
                     /note="Putative acyltransferase with similarity to Eeb1p
                     and Eht1p; has a minor role in medium-chain fatty acid
                     ethyl ester biosynthesis; may be involved in lipid
                     metabolism and detoxification; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IEA]; GO_function:
                     GO:0016746 - transferase activity, transferring acyl
                     groups [Evidence ISS] [PMID 16361250]; GO_process:
                     GO:0051792 - medium-chain fatty acid biosynthetic process
                     [Evidence IGI] [PMID 16361250]"
                     /codon_start=1
                     /product="putative carboxylic ester hydrolase"
                     /protein_id="XP_018736998.1"
                     /db_xref="GeneID:30033992"
                     /translation="MVEQEAPARELWFFHDSPVELEDPSTPLPTATATPPQGTPTQSP
                     RRSREKSPATFGAHFSESLRSRGRERSVSTGTPVNGTSGNTLKPRPSSGSLKDEESQN
                     TPAKGSISYPVFSVTSLVGSVTPNLNWQAFSPYDCRLLNKEYNKPLEEEEEPVPVGCN
                     RLYQVSLQSMDMTPIYWAPLTSPYNVHCSSWFFSTSLTPIEPSLEDAIEEAFQEIKPW
                     TSTYLAELEAAITVPEAMTKLKTPITYFDGRSDVSVEVVFAPTFKRDSANELQPEQEE
                     EEKEEEEEEDSNDKKGQDIDLAKGESEKNDQTAKEEDGAKDVNSDAASIASSVASGPE
                     SYPVAYIFSASSSVSIPYIFSSTSPAQLISSLVAGKAPPGTLFTVQRHFSWQDWKALR
                     NLPDRPSDGDEYAPRKITQLVLVFHGIGQKLTERVESFNFTYAINSFRIQVSNFVDSQ
                     QLSQYIKEDTNILTLPINWRRIIDFENLKGTENKPKNSEFSLSDITMKSIPSVRNLIS
                     DVMLDIPYYMSRHKKLLLDAAAQEANRVYSLFTKINPEFEKSGGTVNIIGHSLGSSIA
                     VDLLSSQPTDVTKCKPEELEKKRTLKFNVHNLFLVGSPVGFFLLLENAQLHPRELYDR
                     KNKIDPGDTTHKYPYGCIAVRNVYNILHYSDPIAYYIGPTVDRLQVSLIETATLPSEK
                     AFIVAQAADAAGWVNALTSRIPFMGSPKNESTKDITIQEKEKQMPDEEDAEVQILDEK
                     TKPLKELLPGVTLNSEYVEVEPVTNPTDAQLPKPGQTVELEDRDFEKESSGEEKLILL
                     NENGQIDWVIPLTVSLESVSQYVSMLTAHSGYWDSKDFARMVAIECGRAKGVDNTISQ
                     YRARKKNKSS"
     gene            <450004..>451929
                     /gene="LSC1"
                     /locus_tag="AWJ20_2117"
                     /db_xref="GeneID:30033993"
     mRNA            <450004..>451929
                     /gene="LSC1"
                     /locus_tag="AWJ20_2117"
                     /product="succinate--CoA ligase (GDP-forming) subunit
                     alpha"
                     /transcript_id="XM_018879045.1"
                     /db_xref="GeneID:30033993"
     CDS             450004..451929
                     /gene="LSC1"
                     /locus_tag="AWJ20_2117"
                     /inference="similar to AA sequence:KEGG_Orthology:K01648"
                     /note="Alpha subunit of succinyl-CoA ligase; succinyl-CoA
                     ligase is a mitochondrial enzyme of the TCA cycle that
                     catalyzes the nucleotide-dependent conversion of
                     succinyl-CoA to succinate; phosphorylated; GO_component:
                     GO:0042645 - mitochondrial nucleoid [Evidence IDA] [PMID
                     15692048]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 9874242]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA]; GO_function: GO:0003878 - ATP
                     citrate synthase activity [Evidence IEA]; GO_function:
                     GO:0005525 - GTP binding [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0048037 - cofactor binding [Evidence IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0004775 - succinate-CoA ligase
                     (ADP-forming) activity [Evidence IEA,IEA]; GO_function:
                     GO:0004775 - succinate-CoA ligase (ADP-forming) activity
                     [Evidence IDA,IMP,ISS] [PMID 9874242]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0006104 - succinyl-CoA metabolic process [Evidence TAS]
                     [PMID 9175438]; GO_process: GO:0006104 - succinyl-CoA
                     metabolic process [Evidence IDA] [PMID 9874242];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA,IEA]; GO_process: GO:0006099 - tricarboxylic
                     acid cycle [Evidence TAS] [PMID 9175438]"
                     /codon_start=1
                     /product="succinate--CoA ligase (GDP-forming) subunit
                     alpha"
                     /protein_id="XP_018736999.1"
                     /db_xref="GeneID:30033993"
                     /translation="MSLNGTAPPAYELFSNKTRAFVYGLQPRACQGMLDFDFICKRDV
                     PSVAGVIYPFGGQFVTKMYWGTKETLLPVYQQVEKAAAKHPEVDVVVNFASSRSVYSS
                     TMELLEYPQFRTIAIIAEGVPERRAREILYKAQKKGVTIIGPATVGGIKPGCFKIGNT
                     GGMMDNIVASKLYRPGSVAYVSKSGGMSNELNNIIAQTTNGVYEGVAIGGDRYPGTTF
                     IDHILRYQADPNCKIIALLGEVGGVEEYRVIEAVKSGKITKPIVAWAIGTCASMFKTE
                     VQFGHAGSMANSDLETATAKNAAMKAAGFHVPDTFEDFPETLAQVYETLVKKGVIVPQ
                     PEPEVPKIPIDYSWAQELGLIRKPAAFISTISDDRGQELLYAGIPISDVFKDDIGIGG
                     VMSLLWFRRRLPAYASKFLEMVLMLTADHGPAVSGAMNTIITTRAGKDLISSLVSGLL
                     TIGTRFGGALDGAATEFTNAFDKGLSPRQFVDTMRKQNKLIPGIGHKVKSRNNPDFRV
                     ELVKDFVKKNFPSTTLLDYALAVEEVTTSKKDNLILNVDGAIAVSFIDLMRSSGAFTP
                     EEVDEYLKNGVLNGLFVLGRSIGLIAHHLDQKRLKTGLYRHPWDDITYLVGQDAVSSA
                     NKRVEVDAKGVSKAKSK"
     gene            complement(<452244..>453203)
                     /gene="GTR2"
                     /locus_tag="AWJ20_2118"
                     /db_xref="GeneID:30033994"
     mRNA            complement(<452244..>453203)
                     /gene="GTR2"
                     /locus_tag="AWJ20_2118"
                     /product="Gtr2p"
                     /transcript_id="XM_018879046.1"
                     /db_xref="GeneID:30033994"
     CDS             complement(452244..453203)
                     /gene="GTR2"
                     /locus_tag="AWJ20_2118"
                     /inference="similar to AA sequence:KEGG_Orthology:K16186"
                     /note="Putative GTP binding protein; negatively regulates
                     Ran/Tc4 GTPase cycle; activates transcription; subunit of
                     EGO and GSE complexes; required for sorting of Gap1p;
                     localizes to cytoplasm and to chromatin; homolog of human
                     RagC and RagD; GO_component: GO:0034448 - EGO complex
                     [Evidence IPI] [PMID 15989961]; GO_component: GO:0034448 -
                     EGO complex [Evidence IDA] [PMID 16732272]; GO_component:
                     GO:1990131 - Gtr1-Gtr2 GTPase complex [Evidence IPI] [PMID
                     10388807]; GO_component: GO:1990131 - Gtr1-Gtr2 GTPase
                     complex [Evidence IPI] [PMID 16143306]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 10388807];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     11073942]; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 15989961]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0031902 - late endosome
                     membrane [Evidence IDA] [PMID 16732272]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_component:
                     GO:0000790 - nuclear chromatin [Evidence IDA] [PMID
                     18258182]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_component: GO:0005634 - nucleus [Evidence IDA]
                     [PMID 10388807]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 11073942]; GO_component: GO:0005774 -
                     vacuolar membrane [Evidence IEA]; GO_component: GO:0005773
                     - vacuole [Evidence IEA]; GO_function: GO:0005525 - GTP
                     binding [Evidence IEA,IEA]; GO_function: GO:0005525 - GTP
                     binding [Evidence ISA] [PMID 10388807]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0006914 - autophagy [Evidence IEA];
                     GO_process: GO:0016237 - microautophagy [Evidence IMP]
                     [PMID 15989961]; GO_process: GO:0032008 - positive
                     regulation of TOR signaling [Evidence IGI,IMP] [PMID
                     19748353]; GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 18258182]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Gtr2p"
                     /protein_id="XP_018737000.1"
                     /db_xref="GeneID:30033994"
                     /translation="MQPLETLYIESTAKPTYERFDSLVNFAVQELPGQLDMFEPSYDS
                     ERIFAQVGSLIYVIDSQDEYLYALQNLQQIIEYAFKINPAINFEVLIHKVDGLSDDFR
                     LDTQRDIMQRVTDELVDANLEGVNIAFHLTSIFDHSIYEAFSRIIQKLVPELPVLENL
                     LDILCQHSGIEKAFLFDVNSKIYLATDSSPVDVETYQVCSDFIDVAVDLDLLYKPSYT
                     QQQQQPQTQQTPESNNSPGLAAVTNGSGPSQTPEGPGLKCTSKLHNGMVLYLSQMIRG
                     LALVGMIRSEGVQKMTLVDYNVEIFRQGLTRVYAEDPLHPHPA"
     gene            <454004..>454867
                     /gene="TYW3"
                     /locus_tag="AWJ20_2119"
                     /db_xref="GeneID:30033995"
     mRNA            <454004..>454867
                     /gene="TYW3"
                     /locus_tag="AWJ20_2119"
                     /product="Tyw3p"
                     /transcript_id="XM_018879047.1"
                     /db_xref="GeneID:30033995"
     CDS             454004..454867
                     /gene="TYW3"
                     /locus_tag="AWJ20_2119"
                     /inference="similar to AA sequence:KEGG_Orthology:K15450"
                     /note="tRNA methyltransferase required for synthesis of
                     wybutosine; a modified guanosine found at the 3'-position
                     adjacent to the anticodon of phenylalanine tRNA which
                     supports reading frame maintenance by stabilizing
                     codon-anticodon interactions; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0008168
                     - methyltransferase activity [Evidence IEA]; GO_function:
                     GO:0008175 - tRNA methyltransferase activity [Evidence
                     IDA,IMP] [PMID 16642040]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0032259 - methylation [Evidence IEA]; GO_process:
                     GO:0030488 - tRNA methylation [Evidence IDA,IMP] [PMID
                     16642040]; GO_process: GO:0008033 - tRNA processing
                     [Evidence IEA]; GO_process: GO:0031591 - wybutosine
                     biosynthetic process [Evidence IMP] [PMID 16642040];
                     GO_process: GO:0031591 - wybutosine biosynthetic process
                     [Evidence IMP] [PMID 17150819]"
                     /codon_start=1
                     /product="Tyw3p"
                     /protein_id="XP_018737001.1"
                     /db_xref="GeneID:30033995"
                     /translation="MRESDSEEMSQNPFDQKKRAILSQIESTDETHPDASPKGTLDVL
                     LLPLIDVINSHSDYVTTSSCSGRVSVFLEGMKTASELGGKGDGGKWLFITHDPEELKS
                     TDWWSLVTDHREHVSESDVSAGVSSIGNGEPAKYDGQRYVLYKFEAMILHVKCRDRAS
                     ASALYTAAMSCGFRESGIGSNDLVGIRISLRLDVPIAYLNNDGTTTPLVPRQYIDHLQ
                     TISLDLFNKNTAKINQLHRTVASMIQAQQTAANKPQTAKETKEQRRERKHREGLLIQA
                     QTRQITPEAPL"
     gene            <455207..>456886
                     /gene="DPS1"
                     /locus_tag="AWJ20_2120"
                     /db_xref="GeneID:30033997"
     mRNA            <455207..>456886
                     /gene="DPS1"
                     /locus_tag="AWJ20_2120"
                     /product="aspartate--tRNA ligase DPS1"
                     /transcript_id="XM_018879049.1"
                     /db_xref="GeneID:30033997"
     CDS             455207..456886
                     /gene="DPS1"
                     /locus_tag="AWJ20_2120"
                     /inference="similar to AA sequence:KEGG_Orthology:K01876"
                     /note="Aspartyl-tRNA synthetase, primarily cytoplasmic;
                     homodimeric enzyme that catalyzes the specific
                     aspartylation of tRNA(Asp); class II aminoacyl tRNA
                     synthetase; binding to its own mRNA may confer
                     autoregulation; shares five highly conserved amino acids
                     with human that when mutated cause leukoencephalopathy
                     characterized by hypomyelination with brain stem and
                     spinal cord involvement and leg spasticity (HBSL);
                     GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 16113655]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 16113655]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA,IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IDA] [PMID 12888345];
                     GO_function: GO:0004812 - aminoacyl-tRNA ligase activity
                     [Evidence IEA,IEA]; GO_function: GO:0004815 -
                     aspartate-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004815 - aspartate-tRNA ligase activity
                     [Evidence IDA] [PMID 8263943]; GO_function: GO:0016874 -
                     ligase activity [Evidence IEA]; GO_function: GO:0003676 -
                     nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA,IEA];
                     GO_process: GO:0006422 - aspartyl-tRNA aminoacylation
                     [Evidence IEA]; GO_process: GO:0006422 - aspartyl-tRNA
                     aminoacylation [Evidence IDA] [PMID 8263943]; GO_process:
                     GO:0006418 - tRNA aminoacylation for protein translation
                     [Evidence IEA]; GO_process: GO:0006412 - translation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="aspartate--tRNA ligase DPS1"
                     /protein_id="XP_018737002.1"
                     /db_xref="GeneID:30033997"
                     /translation="MSEEIVKKTEELKIEEGSAAAAGAPAGEVVLGADGKPLSKSALK
                     KLEKERAKEEKKRQIAERLAAEKAAREASEVDYSKEFYGKQPLNQSGEKTGEQRVQIS
                     NIDKSWAGKEVIFRARVHNSRMQSSKMCFMSLRQQDAVIQALLVVDSDTISKQMVKWA
                     GSINLESIVVVYGKVEASPEEISSATVKDAEIKITKIFTIAETPAQLPILIEDASRSE
                     AEAKEVGLPYVNLDTRLDARVIDLRTATNQAIFKISSGVCELFREFLIKKGFVEIHTP
                     KIIPAASEGGANVFKVNYFKGEAFLAQSPQLYKQMLIAADFEKVFEIAPVFRAENSNT
                     HRHMTEFVGLDLEMAFEEHYDEVIDVLVEMFMFIFTELKNRYAKEIALVRKQYPVEEF
                     KLPKDGKMVRLHFKEGIQLLREVGGVDVPDLEDLSTEHEKLLGKIVREKYDTDFYILD
                     KFPLAVRPFYTMPDAADSNYSNSYDFFMRGEEILSGAQRIHDANFLKTRMAAHEVDSN
                     TVKDYVDAFSYGAPPHAGGGIGLERVVMFFLDLKNIRRASLFPRDPKRVRP"
     gene            <460693..>461982
                     /locus_tag="AWJ20_2121"
                     /db_xref="GeneID:30033998"
     mRNA            <460693..>461982
                     /locus_tag="AWJ20_2121"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879050.1"
                     /db_xref="GeneID:30033998"
     CDS             460693..461982
                     /locus_tag="AWJ20_2121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737003.1"
                     /db_xref="GeneID:30033998"
                     /translation="MEKFNLDFRPDFKRDVKPDFKPDFKIGEKQQSPPISTQFVQSPS
                     SHSHLNRSSSSSPSSTVSSNTDQHSNNSNNSNNSSSNRLVRVIDTVVALYSYQSDKPF
                     SLSFKKGDNIYVISKLPSGWWEGVTPSGSQGWFPSNYTQVVPGAQQNQLLFDSRPSIA
                     SHTSNDSMDPLAPATLADDDPWVSNLSSSTTSAHSSSASYARSNSIGGMTGTGIPLTT
                     TLSSNSGIYTGSRKGSVTSYESSITEELTHNAAATDNGFTATKSTNAPCESYTRVNTS
                     SDTYNYPPSFWLPQINNSGKLIFMNAGRLHVSSQIPWEKVDVNSLDKEIIYPNSLTVP
                     QDLIQAPRVPTSISEGNRLFEKSVDPYADLVSFLWPPRCLRRLGLRPRPWLLLSLRSS
                     RCVDEPSLSCEAGATRVWGGAPAAGGMCPSCTMLTRL"
     gene            <462016..>464856
                     /gene="CDC25"
                     /locus_tag="AWJ20_2122"
                     /db_xref="GeneID:30033999"
     mRNA            <462016..>464856
                     /gene="CDC25"
                     /locus_tag="AWJ20_2122"
                     /product="Ras family guanine nucleotide exchange factor
                     CDC25"
                     /transcript_id="XM_018879051.1"
                     /db_xref="GeneID:30033999"
     CDS             462016..464856
                     /gene="CDC25"
                     /locus_tag="AWJ20_2122"
                     /inference="similar to AA sequence:KEGG_Orthology:K03099"
                     /codon_start=1
                     /product="Ras family guanine nucleotide exchange factor
                     CDC25"
                     /protein_id="XP_018737004.1"
                     /db_xref="GeneID:30033999"
                     /translation="MDYTSISLETSLMTLQEFSDEDFEETWPEIIAKLEKSASKLESH
                     VSPDEEYEFVMGFADLAGIIQKIALYVGVPPGAFPSSGNEFAGISLAFRRMINTLSRI
                     SISHSIGSMIRHQSVGSLEEPDQAADSDKLKSAIQQLVTYAKDLIFQTRSKIQEENSL
                     NDSFEANETGEMKLPEKIEIPLSKFDVKYFVDGLWTNIVVNRSGQLVPQDSSIPGSLT
                     LLEQKFASSRSSTSQEPTNRLRMPLETYNTSLAVDTEVISVLEMRIKTVKNILNQFVK
                     LSNTASSTKSLDATQDRRKILGSSLQALINVSKVIVNIIESIDLTAFYACRASVAESH
                     SSMTRLFAFLEAKQAIYDALAELEVVRNQNEAGDSNFIAALAEKFEKSKLEEIYFTYE
                     QTNEQQIKEKVFKLDAVLASVVESAKNLSTELRSIVAVDSRLLDTTGTSSFPRELAAA
                     AAAAAAVAVSSTAGGNSSNGAMSPRSTYSAKRKESAVDSFSIGSHSIREDGPWFLQLE
                     HGDEIVYDKKGSSIRGGSQRALVEQLTLHSRLNSEFNVAMLLTFQSFMDATNLFEQLV
                     ERFLIQPPEGLTSEEFALWAEKKQRPTRLRVVNILKTWLENYWFEDDSEDLTSEARSS
                     LFESMSKFAEQLKAQKFPGGASLYNIVEKRMNDKEPSFKRMIVTTTTQPPPPILPRNL
                     KKFKLTEIDPVEMARQLSVREFKLLVVITSHECLLRGCGGLGKSSNSGGRKIGEFIRN
                     SNCLTNWVAYAILRHSEAKRRASTIRYFIHVAEACRALNNFSSMTAIISALYSSTIHR
                     MKKTWDYVSSKNTAKLENMNRLMNSSRNFNEYRDLLNLVPPPAVPFFGVYLTDLTFVE
                     DGNPDYLDTEHKIVNFAKRQKTATIIENIRQFQIVPYNFEELADVQLFLDRGFEEAPP
                     IEEQYDTSLNFEPREKPGTDKVAKLFEENGIL"
     gene            complement(<466522..>467007)
                     /locus_tag="AWJ20_2123"
                     /db_xref="GeneID:30034000"
     mRNA            complement(<466522..>467007)
                     /locus_tag="AWJ20_2123"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879052.1"
                     /db_xref="GeneID:30034000"
     CDS             complement(466522..467007)
                     /locus_tag="AWJ20_2123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737005.1"
                     /db_xref="GeneID:30034000"
                     /translation="MPSTLVPCRSATVAADPMTPDRPISRAQAAFFDLKLEAVNMFAI
                     IVLYPVAVIAAPFHLFYLQSVEWKDRRQNKKLLRSLPITVYNSHPDPVNNSLNLSWGC
                     SENCNICLDDYVDGKSKLMTLPCGHQFHSTCAVRWIAQQMIAEKKNPAITCPVCKCDI
                     R"
     gene            complement(<468365..>468910)
                     /gene="CCS1"
                     /locus_tag="AWJ20_2124"
                     /db_xref="GeneID:30034001"
     mRNA            complement(<468365..>468910)
                     /gene="CCS1"
                     /locus_tag="AWJ20_2124"
                     /product="Ccs1p"
                     /transcript_id="XM_018879053.1"
                     /db_xref="GeneID:30034001"
     CDS             complement(468365..468910)
                     /gene="CCS1"
                     /locus_tag="AWJ20_2124"
                     /inference="similar to AA sequence:KEGG_Orthology:K04569"
                     /note="Copper chaperone for superoxide dismutase Sod1p;
                     involved in oxidative stress protection; Met-X-Cys-X2-Cys
                     motif within the N-terminal portion is involved in
                     insertion of copper into Sod1p under conditions of copper
                     deprivation; required for regulation of yeast copper genes
                     in response to DNA-damaging agents; protein abundance
                     increases in response to DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     9295278]; GO_component: GO:0005743 - mitochondrial inner
                     membrane [Evidence IDA] [PMID 11500508]; GO_component:
                     GO:0005758 - mitochondrial intermembrane space [Evidence
                     IEA]; GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA]; GO_component: GO:0005634 - nucleus [Evidence IDA]
                     [PMID 18977757]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA,IEA]; GO_function: GO:0016532 -
                     superoxide dismutase copper chaperone activity [Evidence
                     IGI,IMP,ISS] [PMID 9295278]; GO_function: GO:0008270 -
                     zinc ion binding [Evidence IBA]; GO_process: GO:0015680 -
                     intracellular copper ion transport [Evidence IMP,ISS]
                     [PMID 9295278]; GO_process: GO:0030001 - metal ion
                     transport [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0019430 - removal of superoxide radicals [Evidence
                     IBA]; GO_process: GO:0006801 - superoxide metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /product="Ccs1p"
                     /protein_id="XP_018737006.1"
                     /db_xref="GeneID:30034001"
                     /translation="MQNIGKDAIVRGTGEPNSAAVCILESFEDEKNPVKGLARIVGVS
                     PTRALFDITLNGLPKGKYYPSIRVSGDLSQGAVSTGPQLVELGEIDVSAQLSTSDSFL
                     ANQPKGFSGHAVFTKDVSISDIIGRGLTVSKSRTANYPDSLVGVIARSAGIWENLKSV
                     CSCSGKTVWEERSDAISSGIH"
     gene            <470307..>472679
                     /gene="IMH1"
                     /locus_tag="AWJ20_2125"
                     /db_xref="GeneID:30034002"
     mRNA            <470307..>472679
                     /gene="IMH1"
                     /locus_tag="AWJ20_2125"
                     /product="Imh1p"
                     /transcript_id="XM_018879054.1"
                     /db_xref="GeneID:30034002"
     CDS             470307..472679
                     /gene="IMH1"
                     /locus_tag="AWJ20_2125"
                     /note="Protein involved in vesicular transport; mediates
                     transport between an endosomal compartment and the Golgi,
                     contains a Golgi-localization (GRIP) domain that interacts
                     with activated Arl1p-GTP to localize Imh1p to the Golgi;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IDA]
                     [PMID 15077113]; GO_component: GO:0000139 - Golgi membrane
                     [Evidence IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 9880327]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0043001 -
                     Golgi to plasma membrane protein transport [Evidence IMP]
                     [PMID 16926193]; GO_process: GO:0000042 - protein
                     targeting to Golgi [Evidence IEA]; GO_process: GO:0015031
                     - protein transport [Evidence IEA]; GO_process: GO:0006950
                     - response to stress [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]; GO_process:
                     GO:0016192 - vesicle-mediated transport [Evidence IMP]
                     [PMID 9880327]"
                     /codon_start=1
                     /product="Imh1p"
                     /protein_id="XP_018737007.1"
                     /db_xref="GeneID:30034002"
                     /translation="MQNAEIRRLTSENSKTIKEATDLKGTLDKAKAEIADLKSNLVKQ
                     RQLEKDAENFKTEIEALKSQGVSKDELLKQQTEKLAKLDKLEEELKSKDQELTKIKEE
                     SEKSANAVSADKEKELAILQEKLEKEVSALNEKEEELVKLKSEKEQATVALAKEKDDE
                     INRLKEIHSKEISELSLKLKEVEESASAASAPPVGSDLADQISTPTSTPSKKKNKKKK
                     KGGAMATEPPETENTSLPSSDGEISKLQAEIRSKEEHIQELNGMITAIGQDLVVAREE
                     LANRDNEVTGTKESALQASEELKALKEDMDRQLEEARNKLKEESAALEDTKSKLKEES
                     ATLEDTKSKLKEESAILEDVRLGLEKAEKLAATRLDELNRSKADYESQISKLKADHGN
                     STALIDKYKGEISTLTSVVADKEKHISELETKVKSLETSYSKLNAEHNSLKKQQGAEI
                     ESLQKTNAEARGKLQRELAAVKASKASFEKDHSKLLVEASEAKSKLSAAETEKATAIS
                     NLQLLQREVDELKQIADESSKRSDSLQEELSDLRKHLQDRTREAQTLTNLRNETEHSY
                     QTKVKELEAKVRALTEQRDEYESDLLTMQSRKSRELDELRTQNGDLKRQLHMFEEEKN
                     RYDRDLKDIRKMRDRVQEELTSAKEELASIRKELESSRSQLSAAQTRAVEFEKSASSL
                     KRAAEESQEKNEVLQRNYRVLTGDLETMRKEIVDLKNKSRDTVHSRQSSIVSLSGQDN
                     DQVRNERLYTKNFLLNYVDKKEQRSAMLGSLATFLELNDSERQRFATAFR"
     gene            complement(<472748..>473860)
                     /gene="CDA2"
                     /locus_tag="AWJ20_2126"
                     /db_xref="GeneID:30034003"
     mRNA            complement(<472748..>473860)
                     /gene="CDA2"
                     /locus_tag="AWJ20_2126"
                     /product="chitin deacetylase CDA2"
                     /transcript_id="XM_018879055.1"
                     /db_xref="GeneID:30034003"
     CDS             complement(472748..473860)
                     /gene="CDA2"
                     /locus_tag="AWJ20_2126"
                     /inference="similar to AA sequence:KEGG_Orthology:K01452"
                     /note="Chitin deacetylase; together with Cda1p involved in
                     the biosynthesis ascospore wall component, chitosan;
                     required for proper rigidity of the ascospore wall;
                     GO_component: GO:0005631 - chitosan layer of spore wall
                     [Evidence ISS] [PMID 8940152]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0004099
                     - chitin deacetylase activity [Evidence IEA]; GO_function:
                     GO:0004099 - chitin deacetylase activity [Evidence
                     IDA,ISS] [PMID 8940152]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0016810
                     - hydrolase activity, acting on carbon-nitrogen (but not
                     peptide) bonds [Evidence IEA]; GO_process: GO:0030476 -
                     ascospore wall assembly [Evidence IDA,IMP] [PMID 8940152];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA,IEA]; GO_process: GO:0006032 - chitin
                     catabolic process [Evidence IEA]; GO_process: GO:0000272 -
                     polysaccharide catabolic process [Evidence IEA];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="chitin deacetylase CDA2"
                     /protein_id="XP_018737008.1"
                     /db_xref="GeneID:30034003"
                     /translation="MKLYATALLVFSTVATAKSNDETKPINPLLLSSPRNIDHSAKYI
                     NLPISPGKLRENLQNHASGPQTYGTGSKPSHLDRTLADYTVPSRQEIGIGGGISGNNQ
                     GVKIYAQFKQPFPDWLQSITGLTKWPDENAPYIPLDDIDLSVVPKIPKRSLGDCSNVE
                     RSHCSFECYRCVAPDDIITCPVMSQTFDDGPSPSTPKLLDQLPIKTTFFTQGINVVRF
                     PETVRLQHQEGHLLASHTWSHANLPGLSNEDIAAQIQWSIWAINATAGVVPRYFRPPY
                     GAIDDRVRTITRQFGLVAVFWDKDTFDWRVNDRSKTENEVYQEVRQWQAETPGALILE
                     HDSTIKTVNVGIEVSRLIHSKQMTVADCVNGPWYND"
     gene            <474181..>475200
                     /gene="ARA2"
                     /locus_tag="AWJ20_2127"
                     /db_xref="GeneID:30034004"
     mRNA            <474181..>475200
                     /gene="ARA2"
                     /locus_tag="AWJ20_2127"
                     /product="D-arabinose 1-dehydrogenase (NAD(P)(+)) ARA2"
                     /transcript_id="XM_018879056.1"
                     /db_xref="GeneID:30034004"
     CDS             474181..475200
                     /gene="ARA2"
                     /locus_tag="AWJ20_2127"
                     /inference="similar to AA sequence:KEGG_Orthology:K00062"
                     /note="NAD-dependent arabinose dehydrogenase; involved in
                     biosynthesis of dehydro-D-arabinono-1,4-lactone; similar
                     to plant L-galactose dehydrogenase; GO_component:
                     GO:0005575 - cellular_component [Evidence ND];
                     GO_function: GO:0047816 - D-arabinose 1-dehydrogenase
                     (NAD) activity [Evidence IEA]; GO_function: GO:0045290 -
                     D-arabinose 1-dehydrogenase [NAD(P)+] activity [Evidence
                     IDA,IMP] [PMID 17097644]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_process:
                     GO:0070485 - dehydro-D-arabinono-1,4-lactone biosynthetic
                     process [Evidence IMP] [PMID 17097644]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence IEA]"
                     /codon_start=1
                     /product="D-arabinose 1-dehydrogenase (NAD(P)(+)) ARA2"
                     /protein_id="XP_018737009.1"
                     /db_xref="GeneID:30034004"
                     /translation="MTQSEVIIKPITTNIPKSIEDLPDIVLGAGVFNYQYTDDPHGLS
                     AENVLRKAFDLGIRALDTSAYYGPSEEIVGKALKSMASEYPRDTYLICTKAGRVAENN
                     FDYSAASIRSSVLRSLERLNTTYLDVLYIHDVEFVETKQCLEAIDEAFALKKAGYIKN
                     VGISGYPLDFLLYLATLAKNTLSHGSLDIILSYSNFCMQNTLLEDYVTKFKTEAGVRV
                     VLNASPLSMSLLRAVPPHPFHPASLELRKAVSEASVYTSQHGVDISDLAVRFVYTHWT
                     HGPTVFGLQTVREVETAVQQYWQAKTAAQSKEDEVLLKGVREILGSTLNQTWPSGIEH
                     PDMTA"
     gene            complement(<475553..>476314)
                     /locus_tag="AWJ20_2128"
                     /db_xref="GeneID:30034005"
     mRNA            complement(<475553..>476314)
                     /locus_tag="AWJ20_2128"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879057.1"
                     /db_xref="GeneID:30034005"
     CDS             complement(475553..476314)
                     /locus_tag="AWJ20_2128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737010.1"
                     /db_xref="GeneID:30034005"
                     /translation="MKNSTDFQATSPRSQPIFHIENIPASASISSTSLSPTSLAATNS
                     GPPPIATPGRHSRQSSSSSIYSNSSFQTPAPPTPILGHEPRGLESRGRQASLNNRSSV
                     SGTSSGGGISTTLAGQGPTKFTGPMSSVEIYDVLEKEQEAIVNKLQREINHLKTERSR
                     SRSQSTSSSSSMTRNPSIRSIYSVSDAEEQYPGSSAPAGSVATAAATHRRGSRPSFGS
                     VIDDSSVINSLRKENEVLKKKIAELSIKCKCSQVF"
     gene            complement(<477351..>477443)
                     /locus_tag="AWJ20_2129"
                     /db_xref="GeneID:30034006"
     tRNA            complement(<477351..>477443)
                     /locus_tag="AWJ20_2129"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:30034006"
     gene            <477651..>477722
                     /locus_tag="AWJ20_2130"
                     /db_xref="GeneID:30034008"
     tRNA            <477651..>477722
                     /locus_tag="AWJ20_2130"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:30034008"
     gene            <479962..>481737
                     /gene="SRF1"
                     /locus_tag="AWJ20_2131"
                     /db_xref="GeneID:30034009"
     mRNA            <479962..>481737
                     /gene="SRF1"
                     /locus_tag="AWJ20_2131"
                     /product="Srf1p"
                     /transcript_id="XM_018879059.1"
                     /db_xref="GeneID:30034009"
     CDS             479962..481737
                     /gene="SRF1"
                     /locus_tag="AWJ20_2131"
                     /note="Regulator of phospholipase D (Spo14p); interacts
                     with Spo14p and regulates its catalytic activity; capable
                     of buffering the toxicity of C16:0 platelet activating
                     factor, a lipid that accumulates intraneuronally in
                     Alzheimer's patients; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0016042 -
                     lipid catabolic process [Evidence IEA]; GO_process:
                     GO:0006629 - lipid metabolic process [Evidence IEA];
                     GO_process: GO:0043085 - positive regulation of catalytic
                     activity [Evidence IMP] [PMID 21347278]"
                     /codon_start=1
                     /product="Srf1p"
                     /protein_id="XP_018737011.1"
                     /db_xref="GeneID:30034009"
                     /translation="MASGGGGGDLGLQGIQEANGTSSGSGSGSGSVSWNPHPTTSQGG
                     GNRSTPITPQKTRSHRSGSAASKVTTPKNPPLSRQETPTKSTASSGSYNVGLVAGTGG
                     YRLEPRPYPVWAAMSMISKDDKTNESDPPTARSSSGTSKQAYGLGINRGALDRPVFRY
                     PKLRSETKDKDPVQLVHADDIKQQRNISSSSVNNNEKDEPNDFSQPNAKSTNQQEQAV
                     SDTIPGTGGPAFFDYSPSAPDPNADTELNEKSKMDVSPGQAFDDRDFSEAQPVPYRRQ
                     SISYSERDDYKFPARATPSFVIPNNISDNMTRGTSKWQELLAMTARHEFYESQGIIDE
                     VALNRQGDLDRLWKAHVEEERQLRLEKLRRNRISRLGRLRHFFRKQREPDSTHPGNSG
                     RDTEPLHISSARYLVSHESRQKYKPRLRKIFLNNPFIPLTLRATIFILSIIALAVSSS
                     IYKRSHDAKPNRINQQPSTIMAIVVQSTALVYLVYITYDEYSGKPLGLRDARAKMRLI
                     MLDLLFIIFSAANLSLTFNTLYDRTWVCQDFSFSSSSVTIFLPYISKICDLQKVLASF
                     LFMVLVMWILTFTVSIFRLVERVAQ"
     gene            <483005..>484786
                     /gene="CDC53"
                     /locus_tag="AWJ20_2132"
                     /db_xref="GeneID:30034010"
     mRNA            <483005..>484786
                     /gene="CDC53"
                     /locus_tag="AWJ20_2132"
                     /product="cullin CDC53"
                     /transcript_id="XM_018879060.1"
                     /db_xref="GeneID:30034010"
     CDS             483005..484786
                     /gene="CDC53"
                     /locus_tag="AWJ20_2132"
                     /inference="similar to AA sequence:KEGG_Orthology:K03347"
                     /note="Cullin; structural protein of SCF complexes (which
                     also contain Skp1p, Cdc34p, Hrt1p and an F-box protein)
                     involved in ubiquitination; SCF promotes the G1-S
                     transition by targeting G1 cyclins and the Cln-CDK
                     inhibitor Sic1p for degradation; GO_component: GO:0019005
                     - SCF ubiquitin ligase complex [Evidence IDA] [PMID
                     19882662]; GO_component: GO:0019005 - SCF ubiquitin ligase
                     complex [Evidence IDA,IPI] [PMID 9346238]; GO_component:
                     GO:0019005 - SCF ubiquitin ligase complex [Evidence
                     IDA,IPI] [PMID 9346239]; GO_component: GO:0031461 -
                     cullin-RING ubiquitin ligase complex [Evidence IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0003688 - DNA replication origin binding
                     [Evidence IPI] [PMID 16421250]; GO_function: GO:0030674 -
                     protein binding, bridging [Evidence IMP,IPI] [PMID
                     9499404]; GO_function: GO:0061630 - ubiquitin protein
                     ligase activity [Evidence IDA] [PMID 9346238];
                     GO_function: GO:0031625 - ubiquitin protein ligase binding
                     [Evidence IEA]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence IDA]
                     [PMID 10385629]; GO_function: GO:0004842 -
                     ubiquitin-protein transferase activity [Evidence IDA]
                     [PMID 9346239]; GO_process: GO:0000082 - G1/S transition
                     of mitotic cell cycle [Evidence IMP] [PMID 8943317];
                     GO_process: GO:0000086 - G2/M transition of mitotic cell
                     cycle [Evidence IGI] [PMID 7954792]; GO_process:
                     GO:0000086 - G2/M transition of mitotic cell cycle
                     [Evidence IGI] [PMID 9736614]; GO_process: GO:0031146 -
                     SCF-dependent proteasomal ubiquitin-dependent protein
                     catabolic process [Evidence IDA] [PMID 9346238];
                     GO_process: GO:0031146 - SCF-dependent proteasomal
                     ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 9346239]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0051301 - cell division
                     [Evidence IEA]; GO_process: GO:0042787 - protein
                     ubiquitination involved in ubiquitin-dependent protein
                     catabolic process [Evidence IDA] [PMID 9346238];
                     GO_process: GO:0042787 - protein ubiquitination involved
                     in ubiquitin-dependent protein catabolic process [Evidence
                     IDA] [PMID 9346239]; GO_process: GO:0006511 -
                     ubiquitin-dependent protein catabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="cullin CDC53"
                     /protein_id="XP_018737012.1"
                     /db_xref="GeneID:30034010"
                     /translation="MIERQRNGEDIPSSSLKQIILSFVSLGLDEQNTKRINLTVYQDF
                     FETAFLENTRTYYTNESKEFLAHNSVVEYVKKANNRLNEEYQRVKMYLHQYTEERLMS
                     TCDQVLISDHAAAIQNEFQVLLGDDRQEDFHTMYKLLSRVEGGLVPIQQALQAHVEKQ
                     GMEAVQKLQSQTTGGPVDPKAYVDSLLVVHMKYSALVSESFENNKDLVRALDNGCRAF
                     INNNIIAKPTQQLDKDSKTPELLAKYADSLLKKSSKNTGEADIDASLNGIMRIFQYLD
                     EKDAFEKFYSRLLSKRLVNNSSTSEDAETSMVAKLKEACGYEYTNKLQRMFQDMKTSA
                     DLQNQFKNTLEKKDVDFTAYVLAQSIWPLPDLKPTFELPKQLVGTFDRFQNFYGTKHS
                     GRKLMWLWNFCKGEIRANYPKTSKTGYTFQVSVFQIAILLPFNDADTLSFQQLKEITG
                     LSKEYLANSLHFLLKAKVLLQNPENTEISDESNSFSYNPNFKSKKVRINLNLPLKTEQ
                     KQDTEDTQKKIQDDRHLFLQAIIVRIMKARKELTHVNLVQETLEQSRRFKPRVPDIKK
                     TIDTLIEREYLQRVVKANNTTSYQYLA"
     gene            complement(<484899..>488738)
                     /gene="SPO71"
                     /locus_tag="AWJ20_2133"
                     /db_xref="GeneID:30034011"
     mRNA            complement(<484899..>488738)
                     /gene="SPO71"
                     /locus_tag="AWJ20_2133"
                     /product="Spo71p"
                     /transcript_id="XM_018879061.1"
                     /db_xref="GeneID:30034011"
     CDS             complement(484899..488738)
                     /gene="SPO71"
                     /locus_tag="AWJ20_2133"
                     /note="Meiosis-specific protein required for spore wall
                     formation; localizes to prospore membrane (PSM) and is
                     required for PSM closure during sporulation; mediates PSM
                     size; interacts with Spo1p and Vps13p and recruits Vps13p
                     to the PSM during sporulation; mutants exhibit reduction
                     in PSM PtdIns-phosphate pools; dispensable for both
                     nuclear divisions during meiosis; contains two PH domains;
                     GO_component: GO:0005628 - prospore membrane [Evidence
                     IDA] [PMID 24036347]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0030476 -
                     ascospore wall assembly [Evidence IMP] [PMID 22611022];
                     GO_process: GO:0030476 - ascospore wall assembly [Evidence
                     IEP,IMP] [PMID 9784122]; GO_process: GO:1902657 - protein
                     localization to prospore membrane [Evidence IDA] [PMID
                     24036347]; GO_process: GO:0030435 - sporulation resulting
                     in formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="Spo71p"
                     /protein_id="XP_018737013.1"
                     /db_xref="GeneID:30034011"
                     /translation="MTSSLSATLEEMDPEADHKDPNIIRKSSYTALRLYNEVPSQIDQ
                     ETRIIFVGPVPMEWLVANKKTYGSWGKMKSLFPKVYSRLWTDQGSQAAANDDVRKITN
                     AAVAAAANRMAAEQQNGNPVEGVATSSGSIPNTGGPLVAGPEGVIRAIDDLVIAPRIS
                     VDSTDPMTSFDAVSDDDAWISTDDRPDLVPNHSSDLVPQRYVAADDLVSLNLDSSSIA
                     EHVLENEDPEPEEEPGENEESSYPHADRTDDLMLSRYLTTEGATSTLRTLPAASDEYP
                     YNSGSQNSSQQSLSRGSHFYSNTRSSRNENVSHDGDSPLASYGNGPTGIISDDDSRMS
                     PSPRSTSHLLGDTSRPPSQLDLSSSHSKTFQPALVYKTTPHTNSASEPTPLFTATDSS
                     VSTMGSMQSYFTARESVVSTGRSDSESSRNNSYFPPQDDYIASNAADSVQSNGSTDDS
                     STSTVKPNKPHEHSLSGTVPLAAETSTATAVNQIVSPSAKSYLADILERDVAALKKKQ
                     TSEENKNAQQKQAKKATSVRAPTSKLSNTIQKAKKKPANAGRRVKQKYQKHKHSFMVS
                     TDKLLKRKRVGEVVMIEKLLVLVKAAPEDRRIPSDFNEMEQIDTRLVQRWREYVVVAR
                     KSDSSESPIDLQFYKSRQISKIETHDQQHKRKSDKPDFSVGVGSHCEVNLYSSLDKSI
                     VLWNRTSLGVEPSKKKDSMIYILRARSDASALNWLSFLASIVGICAESLITVKVPDLG
                     VTIDVEIPFQDIETIRRFEDRSQLVSLKHMMKHSSHPSWMGTYIVEKCLDAMYQVEPI
                     RKQLDQNWRGIVKAGLVWRRYDRLEWMFDLRGAQMQSSWAMMKTHHELELRPKVPFSL
                     PIMIQGNPTPLAEPFPIEGFVTRLTTWRGEVRKQKLLNRSYFHTHDNLLFYALPIRAL
                     PPYVGSDTKDIPLICEIAPYKTDSHGRIEWLNHIKNVEEFDQYDLIAQFEMKRRIASI
                     SRSDGFVDLIELRDIRPEDDDKVVLVFKSGTILRFQVHDLETRNMWLKQLHDLMIYWK
                     YRRRERMIRTNAIRQQNLDILHIDEDAEAFVGEAAAKWETDRGVADPLTYNIAGIACS
                     RSLYMNGILFQKPTKFSTFRKYYVVLTLTDLILYLPSPSSVHWTEGGYCLTERLKSTY
                     TRVNNYRVQSVSLSECYVYSGPVTSSDLLNRENTFDKENPGRHALPRAYADGWKSAEE
                     ESLRCFVLWFGKKSYAPTSRKDKKLSFKTVNRLGAGGTSMVFMARSRHDRDLWVTALN
                     TVMSRLAVDSHEDIVVT"
     gene            complement(<489511..>490152)
                     /gene="ATP5"
                     /locus_tag="AWJ20_2134"
                     /db_xref="GeneID:30034012"
     mRNA            complement(<489511..>490152)
                     /gene="ATP5"
                     /locus_tag="AWJ20_2134"
                     /product="F1F0 ATP synthase subunit 5"
                     /transcript_id="XM_018879062.1"
                     /db_xref="GeneID:30034012"
     CDS             complement(489511..490152)
                     /gene="ATP5"
                     /locus_tag="AWJ20_2134"
                     /inference="similar to AA sequence:KEGG_Orthology:K02137"
                     /note="Subunit 5 of the stator stalk of mitochondrial F1F0
                     ATP synthase; F1F0 ATP synthase is a large, evolutionarily
                     conserved enzyme complex required for ATP synthesis;
                     homologous to bovine subunit OSCP (oligomycin
                     sensitivity-conferring protein); phosphorylated;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IEA,IEA];
                     GO_component: GO:0005753 - mitochondrial
                     proton-transporting ATP synthase complex [Evidence IDA]
                     [PMID 10066811]; GO_component: GO:0000274 - mitochondrial
                     proton-transporting ATP synthase, stator stalk [Evidence
                     IMP,ISS] [PMID 2146269]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IDA] [PMID
                     20691145]; GO_function: GO:0046933 - proton-transporting
                     ATP synthase activity, rotational mechanism [Evidence IMP]
                     [PMID 7866306]; GO_process: GO:0006754 - ATP biosynthetic
                     process [Evidence IEA]; GO_process: GO:0015986 - ATP
                     synthesis coupled proton transport [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IMP] [PMID 15254373]; GO_process:
                     GO:0015986 - ATP synthesis coupled proton transport
                     [Evidence IDA] [PMID 20691145]; GO_process: GO:0015986 -
                     ATP synthesis coupled proton transport [Evidence IMP,ISS]
                     [PMID 2146269]; GO_process: GO:0006811 - ion transport
                     [Evidence IEA]; GO_process: GO:0015992 - proton transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="F1F0 ATP synthase subunit 5"
                     /protein_id="XP_018737014.1"
                     /db_xref="GeneID:30034012"
                     /translation="MFVRALRQPMALRAIARTYATKASTAPPVQLFGIDGSYASALYT
                     ASAKDSTIEATEKGLTSLKSLISEDAKLATIIANPALSASDKKTVVEAISQSAGLDKT
                     VSNFLSVLADNNRLSLLPEVITKFEVLSNAHQGFVDATVTSASPLDDKTLGRLKAAIS
                     QSEFVGEGKKLRITNDVKSEILGGLVVEIGDRTVDLSVSAKIARLNKLLTDSV"
     gene            <490818..>492041
                     /gene="RML2"
                     /locus_tag="AWJ20_2135"
                     /db_xref="GeneID:30034013"
     mRNA            <490818..>492041
                     /gene="RML2"
                     /locus_tag="AWJ20_2135"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="XM_018879063.1"
                     /db_xref="GeneID:30034013"
     CDS             490818..492041
                     /gene="RML2"
                     /locus_tag="AWJ20_2135"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit (L2); has similarity to E. coli L2 ribosomal
                     protein; mutant allele (fat21) causes inability to utilize
                     oleate, and induce oleic acid oxidation; may interfere
                     with activity of the Adr1p transcription factor;
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0015934 - large ribosomal subunit
                     [Evidence IEA]; GO_component: GO:0005762 - mitochondrial
                     large ribosomal subunit [Evidence IDA] [PMID 9445368];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA]; GO_component: GO:0030529 - ribonucleoprotein
                     complex [Evidence IEA]; GO_component: GO:0005840 -
                     ribosome [Evidence IEA,IEA]; GO_function: GO:0003723 - RNA
                     binding [Evidence IEA]; GO_function: GO:0003735 -
                     structural constituent of ribosome [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IDA] [PMID 9445368]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IMP] [PMID 9079633]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="XP_018737015.1"
                     /db_xref="GeneID:30034013"
                     /translation="MSLRLFGLARSTISVASRHRTATGIRFSSTTPSPEENSDPVAVD
                     QSAGSKRKSTRSEFADSAQSNQLQEELNKLEIVPFGQRSNLTELEEQDNEMKRQLKLF
                     KTAVKMKSPKPISPSLRWYKWPIYPYLHKGKPVKELTVPRKKHSGRNHHGLITVRHQG
                     GGAKRRIRLIDFFRLDGGVHEVVRIEYDPNRSSHIALVKNEETSALSYILACVGLRAG
                     DKVESFRDGIPQRIIDKMGGENDPGILATHIAKKGNCMPLSMIPLGSIIHNIGVSKIG
                     PGKLCRAAGTYGRLHEKLPEKKKAVIRLQSGEYRYVALDACATLGMVSNPDHQHRSFG
                     KAGRSRHFGIRPRVRGVAMNKVDHPLGGGRGKSKGNKVPQSPWGTPSKSGYKTRRGKN
                     INHNKIRDRPRGKNK"
     gene            complement(<492244..>494664)
                     /gene="ASG1"
                     /locus_tag="AWJ20_2136"
                     /db_xref="GeneID:30034014"
     mRNA            complement(<492244..>494664)
                     /gene="ASG1"
                     /locus_tag="AWJ20_2136"
                     /product="Asg1p"
                     /transcript_id="XM_018879064.1"
                     /db_xref="GeneID:30034014"
     CDS             complement(492244..494664)
                     /gene="ASG1"
                     /locus_tag="AWJ20_2136"
                     /note="Zinc cluster protein proposed to be a
                     transcriptional regulator; regulator involved in the
                     stress response; null mutants have a respiratory
                     deficiency, calcofluor white sensitivity and slightly
                     increased cycloheximide resistance; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19111667]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 19158363]; GO_function: GO:0000981 -
                     sequence-specific DNA binding RNA polymerase II
                     transcription factor activity [Evidence IEA]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0006357 - regulation of transcription from RNA
                     polymerase II promoter [Evidence IEA]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA,IEA]; GO_process: GO:0006950 - response to
                     stress [Evidence IEA]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Asg1p"
                     /protein_id="XP_018737016.1"
                     /db_xref="GeneID:30034014"
                     /translation="MPCTNCAAFGCECRIPEVRMKKGQRASKKQKTEDGEQAAPGISG
                     GIAAGLKAQAAFARGKLTPNSKVSARSAITEELREAGDGKSGFTRSILSGKDNWKQFL
                     DQNLRQPGKMSYLGSTSHVNLIFDNIPDSEAFYFAAAAAAGASNSRVQQMDREEIEIL
                     KIKGAFLLPAQELCDDLVESYFEKIHPLIPIINRTQFMRQYNDPANPPSLLLRQAVLV
                     AGSRVCQNPALMDESGSSKLATATFYKRAKALFDANYETDRIAIVQSTLLMAWFLAGP
                     DYVTDNVYFWTRVSLTIAQSIGLHRSVEKSNVPDIEKRMCKRIWWSLFARDRSTACAM
                     GRPVMINLDDSDVPMIELEDFDESEPDKPSPYPINREHALYFIAHVKLSEIMGLTIRE
                     QYSIGAESSRRQNKVPNVNQCDMAMAAWMNNLPPELKYSLKDKRSHDFFKALLHSQYY
                     TVLCLVHRSNILYRRTPNANGSKIPSYPSWGIAFQAAHMIVRIAENLKSFNELPFCPA
                     FMVYSLFSAMIILIYQMESPSKSVVESAKRGVESCHGILEILGQVWDTADQICKMARY
                     LNSDPMLRQKIIFSAKRLAAATSSEEGTENPSAVNSPGPSGVDSGLPTADSSRPGSAP
                     LKRSYEEEYDPNKIPEVTSPNVSYVRGNQPQPQPQAQRPAHIPGMTPLQPNYQATHLG
                     QAVPPNMDFPSELFLVTNTPPNPVFFENFQPSQLFPESVRSNSVGQQSSPEMTSDRGA
                     NMLPDALFASHESFGDVFYENFNSPPEDVGTVPNTLNLGDWYKFLMSTSTASHFPDLR
                     NVPVKSDV"
     gene            <499144..>500355
                     /locus_tag="AWJ20_2137"
                     /db_xref="GeneID:30034015"
     mRNA            <499144..>500355
                     /locus_tag="AWJ20_2137"
                     /product="putative cysteine synthase"
                     /transcript_id="XM_018879065.1"
                     /db_xref="GeneID:30034015"
     CDS             499144..500355
                     /locus_tag="AWJ20_2137"
                     /inference="similar to AA sequence:KEGG_Orthology:K01738"
                     /note="Putative cysteine synthase; localized to the
                     mitochondrial outer membrane; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16407407]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0004124 - cysteine
                     synthase activity [Evidence IEA]; GO_function: GO:0003674
                     - molecular_function [Evidence ND]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0008150 - biological_process [Evidence ND];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]; GO_process: GO:0019344 - cysteine
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0006535 - cysteine biosynthetic process from serine
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative cysteine synthase"
                     /protein_id="XP_018737017.1"
                     /db_xref="GeneID:30034015"
                     /translation="MAWDQTRLLAVATLSTALVLGSLWYNDVVTVEIKWPVRGKKGIS
                     KMKTGFVAPKGIEQLIGNTPMVRINSLSDATGCEIYGKMEVQNPGGSAKDRVALAIIE
                     NAEAQNLITPHSGDMIFEGTSGSTGISLAMLCRAKGYIAHIVVPDDTSQEKVDLLENL
                     GAVVHKVRPAGIADPKQYVNYAKAAAMEINNNPENKHRALFADQFENEANWKTHYDHT
                     GPEIYSQISEVLPKGKTLDAFITGAGTGGTISGVSKYLKERLPHVKVVISDPPGSGFY
                     NKVKYGVMFDLKEKEGTRRRHQVDTVVEGIGLNRITRNFSAGSDYIDDAIRVKDEESV
                     KMAKYLVDNDGLFVGSSSAVNCVATYKYAKQLGPGHTIVTILCDSGSRHLSKFWKLAK
                     ESASIKDLSQL"
     gene            <502421..>504133
                     /locus_tag="AWJ20_2138"
                     /db_xref="GeneID:30034016"
     mRNA            <502421..>504133
                     /locus_tag="AWJ20_2138"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879066.1"
                     /db_xref="GeneID:30034016"
     CDS             502421..504133
                     /locus_tag="AWJ20_2138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737018.1"
                     /db_xref="GeneID:30034016"
                     /translation="MSRSRFGTGRPFSSPPVNGKTRSTPAPAASGSAVFDFYPMTPDE
                     QLRTFFIGNLPKGIPDDRVIAFLELISGFQKFVRVTNASGKPLNFGFVRFATPPGTKV
                     ALDVLPDVEYTDNDGARSKLKLSVESNTLEWLSVKFPHITPEVHQGSSKRDLVTKVNF
                     VISKWQQASRESKNDENPEDSIDEGDLIEFLNQSIKGSQSQEFASSVSPAMADVLRKE
                     IKAFREQALRLEKARILETEAYERKKQQELEEKSAKLLQGSLESKATNGDSIITSSEL
                     GPLMKEFEEYDLSEEELPLVDDEGNNEQRDLKLETKQLERSREDRERLFRKRQERWVN
                     RELAHLEAVKREKERESNMEERLKTAQENALREYASFSDYDPQSMQKYDYYSDHAHWS
                     KERNSYRRREIERDNNDIEDERKENEALPDTAIRTTAVNKKISLSLSTAKDRKQVEKP
                     VQPLKDNEVNASEIIAQLKNDIENKENIFDWDVQWDSLTEDILSNTLRPLVENQILEY
                     LGIQEEDLVNFVLDHLRSHKPAGELVSELEMTLDEDAPVFVRTLWKQLILEIEMEKRL
                     KPTN"
     gene            complement(<504214..>506610)
                     /gene="SYF1"
                     /locus_tag="AWJ20_2139"
                     /db_xref="GeneID:30034017"
     mRNA            complement(<504214..>506610)
                     /gene="SYF1"
                     /locus_tag="AWJ20_2139"
                     /product="Syf1p"
                     /transcript_id="XM_018879067.1"
                     /db_xref="GeneID:30034017"
     CDS             complement(504214..506610)
                     /gene="SYF1"
                     /locus_tag="AWJ20_2139"
                     /inference="similar to AA sequence:KEGG_Orthology:K12867"
                     /note="Member of the NineTeen Complex (NTC); that contains
                     Prp19p and stabilizes U6 snRNA in catalytic forms of the
                     spliceosome containing U2, U5, and U6 snRNAs; null mutant
                     has splicing defect and arrests in G2/M; relocalizes to
                     the cytosol in response to hypoxia; homologs in human and
                     C. elegans; GO_component: GO:0000974 - Prp19 complex
                     [Evidence IDA] [PMID 11842115]; GO_component: GO:0071006 -
                     U2-type catalytic step 1 spliceosome [Evidence IDA] [PMID
                     11105756]; GO_component: GO:0071006 - U2-type catalytic
                     step 1 spliceosome [Evidence IDA] [PMID 11842115];
                     GO_component: GO:0071007 - U2-type catalytic step 2
                     spliceosome [Evidence IDA] [PMID 11105756]; GO_component:
                     GO:0071008 - U2-type post-mRNA release spliceosomal
                     complex [Evidence IDA] [PMID 11105756]; GO_component:
                     GO:0071004 - U2-type prespliceosome [Evidence IDA] [PMID
                     11105756]; GO_component: GO:0005829 - cytosol [Evidence
                     IDA] [PMID 22932476]; GO_component: GO:0005622 -
                     intracellular [Evidence IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 22932476]; GO_component:
                     GO:0005681 - spliceosomal complex [Evidence IEA];
                     GO_function: GO:0000384 - first spliceosomal
                     transesterification activity [Evidence IC] [PMID
                     11105756]; GO_function: GO:0000384 - first spliceosomal
                     transesterification activity [Evidence IC] [PMID
                     11842115]; GO_function: GO:0000386 - second spliceosomal
                     transesterification activity [Evidence IC] [PMID
                     11105756]; GO_process: GO:0006396 - RNA processing
                     [Evidence IEA]; GO_process: GO:0008380 - RNA splicing
                     [Evidence IEA]; GO_process: GO:0007049 - cell cycle
                     [Evidence IEA]; GO_process: GO:0000349 - generation of
                     catalytic spliceosome for first transesterification step
                     [Evidence IDA] [PMID 19617314]; GO_process: GO:0006397 -
                     mRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="Syf1p"
                     /protein_id="XP_018737019.1"
                     /db_xref="GeneID:30034017"
                     /translation="MSTELSLIQEDDILYEQEILKQPGELGPWLRYLEFTADAPISKR
                     IFVFERACDLFKRSYKLWKMYLDIRVDYVARSHAWILSQQGLNEFSREQLKSEIEKVD
                     RLYVKALVLLNKMPRLWQDYLEYLLRWKPHSITHIRHTFDNALRALPLSQHHRIWPLY
                     INFANRHAHISSATAKNIWLRYILFFPDETENCIEQLIDLEYYEQASQLLTKLLNNPN
                     YVSVKGKSRHQLWEELADILVVPHDNWKPDSFYVERVIKSGIKRYPDQKGKLCVQLAT
                     YWINNGNFEKARDVFEQGLEDVKTVRDFSQIFDSYCEFEESLIAKLMDEEEQGDLDRL
                     MESFEQLMDRRPFMINSVLLEQNPNNVVEWEKRAGLWGSSMDQVVQTYEKAIETIVPK
                     KASGKLYQLWTNYAKLYEKAGDLSTARIIFDKATKVPYKSVNELCDLWIEWAEMELRS
                     ENLDGAIKIMETATKGPKNSKVDYFDESLSPQERLHKSMKLWSFYVDLVESIGTLEEV
                     KPIYDRIFELKIGTTLTIVNYANLLEENNYFEEAFKVYERGIEMFSYPISFEIWNIYL
                     QKAIKRKLGIERLRDLFEQALEDCPSKLCKPLYLLYGKLEEERGLVSNAIKIYERATK
                     AVDNKDKLETYRYYIARVAENFGLPGTRPIFQTAIDNLNDHDANIIGQEFIKIEEKLG
                     EIDRVRVLYGFLSQFNDPRTNEEFWSKWDQFEVMHGSEDTYKEMLRIKRSVIAQFNTD
                     ANYLAAKVSDNNSMSRLDKQTASPIGFVASETLQPSKSEAIDTNDVENPDAIDIEIED
                     "
     gene            <507240..>508622
                     /gene="APE1"
                     /locus_tag="AWJ20_2140"
                     /db_xref="GeneID:30034019"
     mRNA            <507240..>508622
                     /gene="APE1"
                     /locus_tag="AWJ20_2140"
                     /product="Ape1p"
                     /transcript_id="XM_018879069.1"
                     /db_xref="GeneID:30034019"
     CDS             507240..508622
                     /gene="APE1"
                     /locus_tag="AWJ20_2140"
                     /inference="similar to AA sequence:KEGG_Orthology:K01268"
                     /note="Vacuolar aminopeptidase yscI; zinc
                     metalloproteinase that belongs to the peptidase family
                     M18; often used as a marker protein in studies of
                     autophagy and cytosol to vacuole targeting (CVT) pathway;
                     protein increases in abundance and relative distribution
                     to cytoplasmic foci increases upon DNA replication stress;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0000324 - fungal-type vacuole
                     [Evidence IDA] [PMID 1400574]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA,IEA]; GO_function: GO:0004177 -
                     aminopeptidase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0070006 - metalloaminopeptidase
                     activity [Evidence IDA] [PMID 3882418]; GO_function:
                     GO:0008237 - metallopeptidase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0006508 - proteolysis [Evidence
                     IEA,IEA]; GO_process: GO:0007039 - vacuolar protein
                     catabolic process [Evidence ISS] [PMID 2651436];
                     GO_process: GO:0007039 - vacuolar protein catabolic
                     process [Evidence ISS] [PMID 2689224]"
                     /codon_start=1
                     /product="Ape1p"
                     /protein_id="XP_018737020.1"
                     /db_xref="GeneID:30034019"
                     /translation="MGNNYSEAFIKAIYENPTVYHWCNYTSEFLTARGFQYLPERENW
                     DGKIKRGGSYYTTRNGSSIVAFKIGSKWKLGDNGVGVIGCHIDALTAKIKPISKKAFK
                     QGYRQLGVAPYSGGMSSVWWDRDLSIGGRVIVKSQDGSFSTKLAHVEHPIARIPTLAE
                     HFGKPSEGPFNKETQMTPIIGHETTDEDNATDEEKKSPLYGRHDIKLLRAIAQNVGVS
                     VSELYQLELELFDSQPGALGGLDREFMFCPRLDDKLCSFGAIQALVETSAPSDAINCV
                     ALFDNEEIGSLLRQGAKGGLFQHAIQRVFQQLGDFDDDYLRQTFANSFFISSDVTHAV
                     NPNFSDSYLENHKPKLNTGLVVKLDPNGHTTSDGVSTAFIEEVARRTGNKLQYFHIRN
                     DGVSGGTIGPMFSSATGIRSVDAGIPQLSMHSIRATTGSRDLELGVKMYSGFFNTWTS
                     VDADFRKGDI"
     gene            complement(<508767..>510092)
                     /gene="THP1"
                     /locus_tag="AWJ20_2141"
                     /db_xref="GeneID:30034020"
     mRNA            complement(<508767..>510092)
                     /gene="THP1"
                     /locus_tag="AWJ20_2141"
                     /product="Thp1p"
                     /transcript_id="XM_018879070.1"
                     /db_xref="GeneID:30034020"
     CDS             complement(508767..510092)
                     /gene="THP1"
                     /locus_tag="AWJ20_2141"
                     /note="Nuclear pore-associated protein; component of
                     TREX-2 complex (Sac3p-Thp1p-Sus1p-Cdc31p) involved in
                     transcription elongation and mRNA export from the nucleus;
                     involved in post-transcriptional tethering of active genes
                     to the nuclear periphery and to non-nascent mRNP; contains
                     a PAM domain implicated in protein-protein binding;
                     GO_component: GO:0005635 - nuclear envelope [Evidence
                     IEA]; GO_component: GO:0005635 - nuclear envelope
                     [Evidence IDA] [PMID 12206772]; GO_component: GO:0005643 -
                     nuclear pore [Evidence IDA,IGI] [PMID 12411502];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11139493]; GO_component: GO:0070390 - transcription export
                     complex 2 [Evidence IDA] [PMID 15311284]; GO_function:
                     GO:0003723 - RNA binding [Evidence IDA] [PMID 12702719];
                     GO_function: GO:0003690 - double-stranded DNA binding
                     [Evidence IDA] [PMID 12702719]; GO_process: GO:0000282 -
                     cellular bud site selection [Evidence IMP] [PMID
                     11452010]; GO_process: GO:0031124 - mRNA 3'-end processing
                     [Evidence IMP] [PMID 18614048]; GO_process: GO:0006406 -
                     mRNA export from nucleus [Evidence IMP] [PMID 12411502];
                     GO_process: GO:0051028 - mRNA transport [Evidence IEA];
                     GO_process: GO:0071033 - nuclear retention of pre-mRNA at
                     the site of transcription [Evidence IMP] [PMID 18003937];
                     GO_process: GO:0000973 - posttranscriptional tethering of
                     RNA polymerase II gene DNA at nuclear periphery [Evidence
                     IMP] [PMID 18003937]; GO_process: GO:0006368 -
                     transcription elongation from RNA polymerase II promoter
                     [Evidence IMP] [PMID 11139493]; GO_process: GO:0006283 -
                     transcription-coupled nucleotide-excision repair [Evidence
                     IMP] [PMID 17537816]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Thp1p"
                     /protein_id="XP_018737021.1"
                     /db_xref="GeneID:30034020"
                     /translation="MSVDLWLTRVKEISLIETPVKESSSLLGELFSVDIQNPQVSSLQ
                     NDILDNGININQKVDAVDIYDGDWPGFVELTKSYLLFCRDVDPSNMVESFYSYGQFLS
                     DLQTAFSNVRGAILEETVYITTKVVVPQALSLDSQDSQFEMIRTSFLASVLLKIFNSI
                     RGEKSVGEPLTKKTVIIFVATVLCRLYFKLDQPANCASVFSNIHTANIRFSLYSLAQR
                     VEYRYWLGRFYLNKNQLSHSYNHLLWSFKNCHSSSPNKRLILLYLLAPAILLGKIPRY
                     ELLQAYNLDSIYWPLIHSIKRANYQQFMTHLESNEAFFYDHRILVLLQSRSVIILYRM
                     ILWRLVITSRQLANNDEKAASLVSFPNLQIAVRLSMGSFFPQSAVTDDYQFIESIAVS
                     LISQGFVKANIYPRMKLIRLKPINALPPVHDVHNANELNLTGRERWMET"
     gene            <510271..>511653
                     /locus_tag="AWJ20_2142"
                     /db_xref="GeneID:30034021"
     mRNA            <510271..>511653
                     /locus_tag="AWJ20_2142"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879071.1"
                     /db_xref="GeneID:30034021"
     CDS             510271..511653
                     /locus_tag="AWJ20_2142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737022.1"
                     /db_xref="GeneID:30034021"
                     /translation="MAEINASRRILKPNGNGEPASSTGSIKDAVKLLRQQAAPAKSPT
                     PPVQAHPEPEKLKVVIRLLPPEIKEKAVLDLLSPWVNINTCNYIYFSEGHVSKKGTKD
                     PLPSTAYAGFKNAGLLKTFIREFRTLDIQGKLPELGPNVAIEYAPYQKGLRPSKPDPL
                     AGTLEDDPVYKSFVQRLSDPTVVQVPLIAEEERSKNESKNKGKNKAVAKPSPGSLPKS
                     ADKNKKRGENSQSVENSREAVKSKTNSLTPTELAAQLTSVPSAGPQSSKKSSSAKAST
                     QPIGEIANSGEKGSKGSGASSESKSKRGKAKGPKNVLTQNTAAKEETGIPTGPKSQAT
                     KKKGKAKVVNGDSAPKETSSQNKNASSDNVAPAVPTDPKQKSVRKPAKSKKHSNAENV
                     SPGPAEPSSSANATGDSTSTTKPKKAHPPRRPAKSKPAADGESPKARPPPRKRDQNSP
                     KPQPQSQPQP"
     gene            complement(<512040..>512807)
                     /locus_tag="AWJ20_2143"
                     /db_xref="GeneID:30034022"
     mRNA            complement(<512040..>512807)
                     /locus_tag="AWJ20_2143"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879072.1"
                     /db_xref="GeneID:30034022"
     CDS             complement(512040..512807)
                     /locus_tag="AWJ20_2143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737023.1"
                     /db_xref="GeneID:30034022"
                     /translation="MVAESKVYLITGANRGIGFSLTKFLSERPNTVVIGTARQPEKAQ
                     ELQALAKEKSNVHVAKYDAAGKDDAKELAKQVSKITDGVDVLIANAAISDPISFTTVK
                     DAPDHTWLDHHTINVLGPIRLYQAFYDLLKAHETRQIVFVSSLAGSITGYAGLSSSAY
                     GQSKAALNYTMKEISFEAKEDNFTVISIHPGVVMSDMGEAAKAKVVAEAPQFADFFET
                     LGITPDESASAQLKVIDALKPEDSGKFLTYLGEETAF"
     gene            <514387..>515328
                     /gene="SIT4"
                     /locus_tag="AWJ20_2144"
                     /db_xref="GeneID:30034023"
     mRNA            <514387..>515328
                     /gene="SIT4"
                     /locus_tag="AWJ20_2144"
                     /product="type 2A-related serine/threonine-protein
                     phosphatase SIT4"
                     /transcript_id="XM_018879073.1"
                     /db_xref="GeneID:30034023"
     CDS             514387..515328
                     /gene="SIT4"
                     /locus_tag="AWJ20_2144"
                     /inference="similar to AA sequence:KEGG_Orthology:K15427"
                     /note="Type 2A-related serine-threonine phosphatase;
                     functions in the G1/S transition of the mitotic cycle;
                     regulator of COPII coat dephosphorylation; required for ER
                     to Golgi traffic; interacts with Hrr25p kinase;
                     cytoplasmic and nuclear protein that modulates functions
                     mediated by Pkc1p including cell wall and actin
                     cytoskeleton organization; similar to human PP6;
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 1848673]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA,IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0004721 - phosphoprotein phosphatase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004722 -
                     protein serine/threonine phosphatase activity [Evidence
                     IMP] [PMID 23864707]; GO_process: GO:0006281 - DNA repair
                     [Evidence IMP] [PMID 15150670]; GO_process: GO:0000082 -
                     G1/S transition of mitotic cell cycle [Evidence IGI] [PMID
                     1848673]; GO_process: GO:0031929 - TOR signaling [Evidence
                     IMP] [PMID 15367655]; GO_process: GO:0030036 - actin
                     cytoskeleton organization [Evidence IMP] [PMID 12080055];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0051301 - cell division [Evidence IEA];
                     GO_process: GO:0034599 - cellular response to oxidative
                     stress [Evidence IMP] [PMID 18357452]; GO_process:
                     GO:0016311 - dephosphorylation [Evidence IMP] [PMID
                     15367655]; GO_process: GO:0031505 - fungal-type cell wall
                     organization [Evidence IMP] [PMID 12080055]; GO_process:
                     GO:0035556 - intracellular signal transduction [Evidence
                     IMP] [PMID 12080055]; GO_process: GO:0007067 - mitotic
                     nuclear division [Evidence IEA]; GO_process: GO:0001302 -
                     replicative cell aging [Evidence IMP] [PMID 15843932];
                     GO_process: GO:0002098 - tRNA wobble uridine modification
                     [Evidence IMP] [PMID 18755837]"
                     /codon_start=1
                     /product="type 2A-related serine/threonine-protein
                     phosphatase SIT4"
                     /protein_id="XP_018737024.1"
                     /db_xref="GeneID:30034023"
                     /translation="MFDSRAARKTVISESELQLLDKQMFPSPYFLQERGLTSLESNIQ
                     PVQSPVTVCGDIHGQFHDLLELFRVSGGLPDDVNYIFLGDFVDRGYFSLETFTLLMCL
                     KALYPNRLTLVRGNHESRQITQVYGFYEECLSKYGSTTVWKYCCQVFDFLTLAAIIDG
                     RILCVHGGLSPEIRMLDQIRVLSRAQEIPHEGGFCDLVWSDPDDVETWAVSPRGAGWI
                     FGANVAREFNHVNGLNLIARAHQLVMEGFKYHFKDKDVVTVWSAPNYCYRCGNVASVM
                     KVEDDLVPKFTIFNAVPDDAIKMRLAPQKTQRSEYFL"
     gene            complement(<517358..>518506)
                     /gene="LPX1"
                     /locus_tag="AWJ20_2145"
                     /db_xref="GeneID:30034024"
     mRNA            complement(<517358..>518506)
                     /gene="LPX1"
                     /locus_tag="AWJ20_2145"
                     /product="Lpx1p"
                     /transcript_id="XM_018879074.1"
                     /db_xref="GeneID:30034024"
     CDS             complement(517358..518506)
                     /gene="LPX1"
                     /locus_tag="AWJ20_2145"
                     /note="Peroxisomal matrix-localized lipase; required for
                     normal peroxisome morphology; contains a peroxisomal
                     targeting signal type 1 (PTS1) and a lipase motif;
                     peroxisomal import requires the PTS1 receptor, Pex5p and
                     self-interaction; transcriptionally activated by Yrm1p
                     along with genes involved in multidrug resistance; oleic
                     acid inducible; GO_component: GO:0005782 - peroxisomal
                     matrix [Evidence IEA]; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 12135984];
                     GO_component: GO:0005777 - peroxisome [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016298 - lipase activity [Evidence
                     IDA] [PMID 18199283]; GO_function: GO:0016298 - lipase
                     activity [Evidence ISS] [PMID 9200815]; GO_function:
                     GO:0004806 - triglyceride lipase activity [Evidence IDA]
                     [PMID 24187129]; GO_process: GO:0007031 - peroxisome
                     organization [Evidence IEP] [PMID 12135984]; GO_process:
                     GO:0019433 - triglyceride catabolic process [Evidence IGI]
                     [PMID 24187129]"
                     /codon_start=1
                     /product="Lpx1p"
                     /protein_id="XP_018737025.1"
                     /db_xref="GeneID:30034024"
                     /translation="MVDEHNLTLTIGNGIKISPKITEANYPRGHSRAVLYPDARLKIA
                     YNVFTLFKNSGNIRPEEALNLVFCHGAQMCKELWNYTIELFFNDPDLGPKLGKVLAID
                     YVAHGDSYLANTESISFENSWEDASRDINAVVKEEKLIGTTILIGHSMGGMQGLWSAF
                     YEPGLYDSVVTIDPQGYREEIDPVKSAKILGKKFSKLYDTRALDTFKNYDEYYHYMTK
                     IGLSAKFHPRCQKDYIDASFVQQEDGSVIMKTPRWSQVSVYISGQTVYRDSLKVLGSL
                     DCEVLHIFPTQGYKEGSDAIRAALRFATLVDIPNTGHLVPFEQPVETFEAMKGFVLRR
                     YQRGLAIERQTYARASFSPAQRKQFVKTNFEQIFWGLKQGKSPLHSRL"
     gene            complement(<519024..>519986)
                     /locus_tag="AWJ20_2146"
                     /db_xref="GeneID:30034025"
     mRNA            complement(<519024..>519986)
                     /locus_tag="AWJ20_2146"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879075.1"
                     /db_xref="GeneID:30034025"
     CDS             complement(519024..519986)
                     /locus_tag="AWJ20_2146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737026.1"
                     /db_xref="GeneID:30034025"
                     /translation="MDRFCSAATGWNTSLTSSDVKRRLPVEGTLWRDEYDGKTPYFNI
                     SQNSLNPVDDMNALGGYAYLVEATEFLDRIVNFLRRESVDFSSSDDGFSRWFNVFQEL
                     DSMLVRWKASLPEKWQVSRVHSNGWMDQNLTLAHVTHNASVILLHQNLAYATPDERIQ
                     ILSSIASETCLTAASEIATIAKKFLYYTENIVAPQFCLCIFIAARALLAHSEFFDSPL
                     KGEFDSLLSALKEGSKRWPTDQTSQDNLAKQFMDRLEAARDSHTALNVRSAAFEDEAK
                     LSFSFPQFPDINGILSLSNSLEPTQYLQELDRIVLWDDGVAELE"
     gene            complement(<521272..>522444)
                     /locus_tag="AWJ20_2147"
                     /db_xref="GeneID:30034026"
     mRNA            complement(<521272..>522444)
                     /locus_tag="AWJ20_2147"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879076.1"
                     /db_xref="GeneID:30034026"
     CDS             complement(521272..522444)
                     /locus_tag="AWJ20_2147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737027.1"
                     /db_xref="GeneID:30034026"
                     /translation="MTYPSSLSLYKEILDTAHLKKIIEVAKLKPTIPTGFPHCTPTGN
                     TKEYIYEPFEWWTSGFFPGSLWAVKERLTKTDVVGLDENELNALAEDWKTRLEPHQFN
                     TDTHDIGFLIMPAFWREYQLNRSKKAGEIIVQAAKSLMTRWSDTVQAFRSWTTTTSKR
                     YNFDNPESDFLVIIDNMMNLDLLYAASIITGDSTYADHATKHADTTMKNQFRDDYSSY
                     HLIVFDSKTGTKKIGLTCQGYSDSSCWSRGQAWALYGYASVYKYTKNPKYLEFAEKLA
                     DYFLSRVENGAVFWDFDAPKPCILDISAAMIACSGLLLICELRNDLKYKSKVDTILDF
                     TMSHAATSSDSVVILDHSTVNNNATANHRIYDSGLVYADYYFLEVGNRLLDMNLLN"
     gene            complement(<523091..>524659)
                     /gene="HXT13"
                     /locus_tag="AWJ20_2148"
                     /db_xref="GeneID:30034027"
     mRNA            complement(<523091..>524659)
                     /gene="HXT13"
                     /locus_tag="AWJ20_2148"
                     /product="hexose transporter HXT13"
                     /transcript_id="XM_018879077.1"
                     /db_xref="GeneID:30034027"
     CDS             complement(523091..524659)
                     /gene="HXT13"
                     /locus_tag="AWJ20_2148"
                     /inference="similar to AA sequence:KEGG_Orthology:K08139"
                     /codon_start=1
                     /product="hexose transporter HXT13"
                     /protein_id="XP_018737028.1"
                     /db_xref="GeneID:30034027"
                     /translation="MSDTKEVLDLVQEEKTLVDVTPKLERFWVFYPHILKLNTLLVGA
                     ILAQIVSGFDGSMMNGLQSLVPWQQFFDHPTGGRLGTMSNGVTIGTLIAVPFASLMTD
                     AIGRRFTIIVGCIIIVIGAILQGAAQNFSMFIGARILLGVGGCWASTAAGPLLAECAY
                     PTQRPTVSAFLLASWPLGSFVAALVTWGPYRSDLKTSNWSWRIPSLLQGFFPLLQILL
                     AFLGPESPRYLISKGREDEARAFFTKYHAAGDSEHPVVKFQMAEITAALELEKNDTLS
                     LKNYLAWFKTKAMRHRLFICIVVPAFQQLSGNAIISYYLTLILNSIGITDSLTQLKIN
                     IGMTTVSLTADVISAIVVSAYRRRRLFLTGYTSMLLVYIVFTVLSAENQRKNFTDHSL
                     ASGVVAMIFVYQIAYHIAAPIAIAYIMEVCPYNQRATGSMLYQLSANVVGTFNNYVNP
                     IAMAAINWRYYIVWICQLVFQISIVYFVFPETAGKDLEDIAEVFGEVGARRAIANSAG
                     LTEKMEAIEHVESV"
     gene            <525656..>526498
                     /gene="GPI12"
                     /locus_tag="AWJ20_2149"
                     /db_xref="GeneID:30034028"
     mRNA            <525656..>526498
                     /gene="GPI12"
                     /locus_tag="AWJ20_2149"
                     /product="Gpi12p"
                     /transcript_id="XM_018879078.1"
                     /db_xref="GeneID:30034028"
     CDS             525656..526498
                     /gene="GPI12"
                     /locus_tag="AWJ20_2149"
                     /inference="similar to AA sequence:KEGG_Orthology:K03434"
                     /note="ER membrane protein involved in the second step of
                     GPI anchor assembly; the second step is the
                     de-N-acetylation of the
                     N-acetylglucosaminylphosphatidylinositol intermediate;
                     functional homolog of human PIG-Lp; GPI stands for
                     glycosylphosphatidylinositol; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IEA]; GO_component:
                     GO:0005789 - endoplasmic reticulum membrane [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence ISS] [PMID 10085243]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0000225 - N-acetylglucosaminylphosphatidylinositol
                     deacetylase activity [Evidence IEA]; GO_function:
                     GO:0000225 - N-acetylglucosaminylphosphatidylinositol
                     deacetylase activity [Evidence ISS] [PMID 10085243];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_process: GO:0006506 - GPI anchor biosynthetic
                     process [Evidence IEA,IEA]; GO_process: GO:0006506 - GPI
                     anchor biosynthetic process [Evidence ISS] [PMID
                     10085243]"
                     /codon_start=1
                     /product="Gpi12p"
                     /protein_id="XP_018737029.1"
                     /db_xref="GeneID:30034028"
                     /translation="MNLLLPILVFALPRFIWSIITRTIPYGAPFDLTNKNITFLISHP
                     DDEVMFFGPSLALLTIPEFNNTVSIVSLSSGNSEGLGATRKIELARSAWYFAIPPSRL
                     FVVENEEDFPDSMEAAWDPKLISDVLGDIPAISNTDAIVTFDSQGVSAHTNHIATGKG
                     ASLYVQEHSDVGLWKLETVSIYRKYLMFFDAFISYYAVPWVRKVHEQIYDSEWAAKYD
                     LLKHIPEPTAEPVRASIISRQVQFTQAKSAMIKAHESQMKWYRHGWVIFSRYMIVNDL
                     IKEN"
     gene            complement(<526666..>528402)
                     /locus_tag="AWJ20_2150"
                     /db_xref="GeneID:30034030"
     mRNA            complement(<526666..>528402)
                     /locus_tag="AWJ20_2150"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879080.1"
                     /db_xref="GeneID:30034030"
     CDS             complement(526666..528402)
                     /locus_tag="AWJ20_2150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737030.1"
                     /db_xref="GeneID:30034030"
                     /translation="MITRCSRAGPLLVSSAVARSLKSTASNFLRNETKLMSTSQPFAK
                     DIFIRSEPYREPFDLEGLKSGLVDASMPSDHLETDLDQKFRGDPTSIFKRSEVATAHG
                     RLGSPIIPSVSHSPNVERLGQFIASKDLNSALHTFQKLIDEDENGLSHFTATQCSQLL
                     AMIPLGPIKAPQYWPLAQKIASAIKASGHKLQAHDYARLIECAFKAHDYDSIDQIWNE
                     VQTNLPVSLHSTDLWNKYIMTTCNAYPKFWRQWAGMQVKRNEFRMFKPDETPLAVNDA
                     VRLLGNMLENNIHPNARTYELVILYLCQKGDLADVRSIIWSIWHITTEPNVLRRSRSK
                     YRKQLRPSKDSPLAPTISTLKAVIDGFCMNGKVTEALRLMNRLQKEYRIDISGGSRGG
                     KAIHLWSAVLSWAFITQRPIEGAFTPADTFENVWTIMTEQYGIKPTDEMYRLRGRFFD
                     SNEKYEDLIADIPEILNSGNPHRLEIARRNLQKAVKGIARQGQIDEAVSIVNEWSQAL
                     GEFEQVRENLIKYVNTSSTIQRLIAERSPNETNSNTKSSSHDLHDNSIHGETNPFDSN
                     VNKTNSARLDTV"
     gene            complement(<528970..>532134)
                     /gene="YEF3"
                     /locus_tag="AWJ20_2151"
                     /db_xref="GeneID:30034031"
     mRNA            complement(<528970..>532134)
                     /gene="YEF3"
                     /locus_tag="AWJ20_2151"
                     /product="translation elongation factor EF-3"
                     /transcript_id="XM_018879081.1"
                     /db_xref="GeneID:30034031"
     CDS             complement(528970..532134)
                     /gene="YEF3"
                     /locus_tag="AWJ20_2151"
                     /inference="similar to AA sequence:KEGG_Orthology:K03235"
                     /note="Translational elongation factor EF-3; member of the
                     ABC superfamily; stimulates EF-1 alpha-dependent binding
                     of aminoacyl-tRNA by the ribosome; normally expressed in
                     zinc deficient cells; HEF3 has a paralog, YEF3, that arose
                     from the whole genome duplication; GO_component:
                     GO:0022626 - cytosolic ribosome [Evidence IPI] [PMID
                     9544245]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0016887 - ATPase activity
                     [Evidence IEA]; GO_function: GO:0016887 - ATPase activity
                     [Evidence IDA] [PMID 9544245]; GO_function: GO:0003723 -
                     RNA binding [Evidence IEA]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_function: GO:0003746 - translation elongation
                     factor activity [Evidence IEA]; GO_function: GO:0003746 -
                     translation elongation factor activity [Evidence IGI,ISS]
                     [PMID 9544245]; GO_process: GO:0006200 - ATP catabolic
                     process [Evidence IEA]; GO_process: GO:0006412 -
                     translation [Evidence IEA]; GO_process: GO:0006414 -
                     translational elongation [Evidence IEA,IEA]; GO_process:
                     GO:0006414 - translational elongation [Evidence IGI] [PMID
                     9544245]"
                     /codon_start=1
                     /product="translation elongation factor EF-3"
                     /protein_id="XP_018737031.1"
                     /db_xref="GeneID:30034031"
                     /translation="MAAAAEKGESIKVLNELFAKLVVADSVDERKSVAHDVASFINGP
                     IEEHDLPEKFFADLKGAINNKKDVRAKQNGIEAYGSIAASKELAPSVEPLLVSLTSDV
                     LEKAGDKNVEVRDAASLAVKELAKNVTPHAVKALLPHLTNSIANSNKWTEKVAALEAL
                     SILVDSARDQIALRMPELIPVLSEAMWDTKPEVKKAATATITKSTETIDNKDIINFIP
                     ALIACIAKPTEVPETVHLLGATTFVSEVTTATLSIMVPLLSRGLAERDTAIKRKAAVI
                     ADNMCKLVDDPQVVAPFLSKLYPALKQNYSNIADPEARDVTLRAINTLKRVGEIGDDD
                     KIPEISTAGDTGVNLAIIKDLLKDKKVDKRFDVIIEYAAAIAGDLIDERLINEGDWAE
                     TLRPFLVVFLHDGEARTLIEELRKKSVANIPGGPAFDEEDDEGEDLCNCEFSLAYGAK
                     ILLNRTQLRLKRARRYGLCGPNGAGKSTLMRAIANGQVEGFPTQDECKTVYVEHDIDG
                     THADTNVVDYVIATAGEEVGSKETVTKTLVEFGFVNGMTEMPITSLSGGWKMKLALAT
                     AVLRNADILLLDEPTNHLDTVNVAWLINYLTTCNITSIIVSHDSGFLDKVCQYIIHYE
                     RYKLRKYKGNLSEFVKKVPAAKSYYELGASDLEFKFPEPGYLEGVKTKQKAIVKVSNM
                     SFQYPGTSKPQIRDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGDVYVHEN
                     CRIAYIKQHAFAHIDNHLDKTPSEYIQWRFQTGEDRETMDRANRQISESDEEAMNKIY
                     KIEGTPRRVNEVLARRKFKNSYEYECSFFLGENIGMKNERWIAMGSVDNAWIPRSELI
                     ETHSKLVAEVDMKEALASGQFRPLTRKEIESHCAMLGLEAELVSHSRIRGLSGGQKVK
                     LVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKAIKEFEGGVVIITHSAEFTKNLTEE
                     VWAVLDGKMTPSGHNWVTGQGAGPRLDQKEDEEDKFDAFGNKIEAKKKAKKLSAAELR
                     KKKKERMKKKKELGDAYVSSDDEF"
     gene            <534748..>534829
                     /locus_tag="AWJ20_2152"
                     /db_xref="GeneID:30034032"
     tRNA            <534748..>534829
                     /locus_tag="AWJ20_2152"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:30034032"
     gene            complement(<535972..>537381)
                     /gene="RCK2"
                     /locus_tag="AWJ20_2153"
                     /db_xref="GeneID:30034033"
     mRNA            complement(<535972..>537381)
                     /gene="RCK2"
                     /locus_tag="AWJ20_2153"
                     /product="serine/threonine protein kinase RCK2"
                     /transcript_id="XM_018879082.1"
                     /db_xref="GeneID:30034033"
     CDS             complement(535972..537381)
                     /gene="RCK2"
                     /locus_tag="AWJ20_2153"
                     /codon_start=1
                     /product="serine/threonine protein kinase RCK2"
                     /protein_id="XP_018737032.1"
                     /db_xref="GeneID:30034033"
                     /translation="MRQLNHKNVVELIDFKETKDHYFIVLELIPGGELFHQIVRLTYF
                     SEDLARHVIVQVAEAVRYLHEVAGVVHRDIKPENLLFYPIDFIPSKNKTIRKGEDESK
                     EDEGQFVPGLGAGGIGVIKLADFGLSKVIWDSKTMTPCGTVGYTAPEIVKDERYSKSV
                     DMWALGCVLYTVLCGFPPFYDESIEVLTEKVAKGQYTFLSPWWDEISAGAKDLVSHLL
                     TVDPDSRYTIDQFLQHPWITGATSRHAGPAAVAAAATASTGIVGSTGNSLGVIPEIKF
                     TGSNNSVGTATTDITMINAVPERSQAASASTKEFPTPVVATLKEVFDVSNAVHRMEEE
                     NARNNRWKGRFQDNLLEEEEEEEEEEDDTAGHGSVTHNEYTMDVEPAYNDPSLDGVEQ
                     KLQRVSVSKAVPISTTSSKTKASHAVPRSSRKPHNHQHHHGPLATGGLFELHLEGATL
                     IERRKRAGKQPPITHSLVT"
     gene            complement(<537421..>538278)
                     /locus_tag="AWJ20_2154"
                     /db_xref="GeneID:30034034"
     mRNA            complement(<537421..>538278)
                     /locus_tag="AWJ20_2154"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879083.1"
                     /db_xref="GeneID:30034034"
     CDS             complement(537421..538278)
                     /locus_tag="AWJ20_2154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737033.1"
                     /db_xref="GeneID:30034034"
                     /translation="MGQQPLLDPAAGVGIAGVPQQVGAPGAGPTGSLGHGYDTRQSVS
                     EPNLVQTTQQQQQQPQQHTHIQSSQRKEAYDNAVKQIIAEENEERSKIHRYPGLERFD
                     LIEKMGDGAFSIVYKAYDRTNKTYVAVKIIHKQELSTNQVCFLTRASLLTKHWPPVAA
                     RDCLNQRTGPVARACAASSPGIPSSVADTVLERPPFGPRCQKSRHFYSGEAWAGGGVP
                     PAAGAPPQTLVAPLASLESGVGWPANGGWDTWPSPAKTTRAKREEQPGSGAEPQPPEA
                     DPPLRVSQN"
     gene            <541873..>543564
                     /gene="EMP70"
                     /locus_tag="AWJ20_2155"
                     /db_xref="GeneID:30034035"
     mRNA            <541873..>543564
                     /gene="EMP70"
                     /locus_tag="AWJ20_2155"
                     /product="Emp70p"
                     /transcript_id="XM_018879084.1"
                     /db_xref="GeneID:30034035"
     CDS             541873..543564
                     /gene="EMP70"
                     /locus_tag="AWJ20_2155"
                     /inference="similar to AA sequence:KEGG_Orthology:K17086"
                     /note="Protein with a role in cellular adhesion and
                     filamentous growth; also endosome-to-vacuole sorting;
                     similar to Tmn3p; member of Transmembrane Nine family of
                     proteins with 9 transmembrane segments; EMP70 has a
                     paralog, TMN2, that arose from the whole genome
                     duplication; GO_component: GO:0005768 - endosome [Evidence
                     IEA]; GO_component: GO:0005768 - endosome [Evidence IDA]
                     [PMID 8314797]; GO_component: GO:0010008 - endosome
                     membrane [Evidence IEA]; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     20681974]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006878 - cellular copper
                     ion homeostasis [Evidence IGI,IMP] [PMID 20681974];
                     GO_process: GO:0016197 - endosomal transport [Evidence
                     IMP] [PMID 20526336]; GO_process: GO:0001403 - invasive
                     growth in response to glucose limitation [Evidence IMP]
                     [PMID 18178563]; GO_process: GO:0007124 - pseudohyphal
                     growth [Evidence IGI] [PMID 18178563]; GO_process:
                     GO:0007034 - vacuolar transport [Evidence IGI] [PMID
                     20526336]"
                     /codon_start=1
                     /product="Emp70p"
                     /protein_id="XP_018737034.1"
                     /db_xref="GeneID:30034035"
                     /translation="MRAAPSLVYNWNIDHLPVTENLKHLESEHDDDDDDDDDDDDDGD
                     DNAKLNKLFGGRRINRQVWYKGDGIRFGRYDRHKPYIMFYNHFNFEIEYHEHVPGQYR
                     VVGAAVTPESKNYTTQESAAKCSAPKSPISFPAGRPQNAQSINITYSYSVKWIKSDVR
                     WASRWDKYLALRGSRIRWKPLITLIVVSTSTILCAVLSEIAFCFVLQEVTKIQQAKSN
                     PNTITSGLKSLKEVALRSPKNTLLLSVLVGNGCHLFVLALLTIVFAAIGVLSPEKRGS
                     IATMAIYTYSFTSIIAGYTAAYCFRAYKGEDFVQDEDENEETIIKTDLTLWSTLFLLT
                     PVLIPGLVFATFLVLNLVIVVRGSDGAVPFPAILKLTGLWFFVSIPLSLLGSLIGKKR
                     PMNGYKKLVFKSNSPAPEIPKLPFLLKPITRTMLAGLLPFTAVAAELALIANSLWLNQ
                     VFFMFGFLMATYIILVLGSVVITIGTVYLMLLAGDYRWQWSSFILSGSPAIYVFLSCL
                     SLLIFRYSYNGLTAILLYVSYSFLLSAAIFFITGSIGFLSTWAFVHYIYSSVRND"
     gene            <544524..>546212
                     /gene="EMP70"
                     /locus_tag="AWJ20_2156"
                     /db_xref="GeneID:30034036"
     mRNA            <544524..>546212
                     /gene="EMP70"
                     /locus_tag="AWJ20_2156"
                     /product="Emp70p"
                     /transcript_id="XM_018879085.1"
                     /db_xref="GeneID:30034036"
     CDS             544524..546212
                     /gene="EMP70"
                     /locus_tag="AWJ20_2156"
                     /inference="similar to AA sequence:KEGG_Orthology:K17086"
                     /note="Protein with a role in cellular adhesion and
                     filamentous growth; also endosome-to-vacuole sorting;
                     similar to Tmn3p; member of Transmembrane Nine family of
                     proteins with 9 transmembrane segments; EMP70 has a
                     paralog, TMN2, that arose from the whole genome
                     duplication; GO_component: GO:0005768 - endosome [Evidence
                     IEA]; GO_component: GO:0005768 - endosome [Evidence IDA]
                     [PMID 8314797]; GO_component: GO:0010008 - endosome
                     membrane [Evidence IEA]; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     20681974]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0006878 - cellular copper
                     ion homeostasis [Evidence IGI,IMP] [PMID 20681974];
                     GO_process: GO:0016197 - endosomal transport [Evidence
                     IMP] [PMID 20526336]; GO_process: GO:0001403 - invasive
                     growth in response to glucose limitation [Evidence IMP]
                     [PMID 18178563]; GO_process: GO:0007124 - pseudohyphal
                     growth [Evidence IGI] [PMID 18178563]; GO_process:
                     GO:0007034 - vacuolar transport [Evidence IGI] [PMID
                     20526336]"
                     /codon_start=1
                     /product="Emp70p"
                     /protein_id="XP_018737035.1"
                     /db_xref="GeneID:30034036"
                     /translation="MRTANSLAYSWNIDHLPVTENPEHRESEHDDDDDDDVDHDDDDD
                     NSKLNHFFGERRINRQLWYQGNGVRFGVLDFRGEPHIMFYNHFDFEIEYHEHAPGQYR
                     VVGAAVTPESKNYTTQESAAKCSAPKSPISFPARRLRGNAQSINITYSYSVKWIKSDV
                     RWASRWDKYLALRGSRIRWKPLITLIVVSTILCVVLSGIAFYFVQKEVTKIQQAKSNP
                     NTIMSGLKSLKDVALRSPKNTLLLSVLVGNGSHLFVLALLTIVFAAIGVLSPEKRGSI
                     ATMAIYTYSFTSIIAGYTAAYCFRAYKGEDFVQDEDENEETIIKTDLTLWSTLFLLTP
                     VLIPGLVFATFLVLNLVIVVRGSDGAVPFPAILKLTGLWFFVSIPLSLLGSLIGKKRP
                     MNGYKKLVFKSNSPAPEIPKLPFLLKPITRTMLAGLLPFTAVAAELALIANSLWLNQV
                     FFMFGFLMATYIILVLGSVVITIGTVYLMLLAGDYRWQWSSFILSGSPAIYVFLSCLS
                     LLIFRYSYNGLTAILLYVSYSFLLSAAIFFITGSIGFLSTWAFVHYIYSFVRND"
     gene            complement(<546281..>548509)
                     /gene="KAR3"
                     /locus_tag="AWJ20_2157"
                     /db_xref="GeneID:30034037"
     mRNA            complement(<546281..>548509)
                     /gene="KAR3"
                     /locus_tag="AWJ20_2157"
                     /product="Kar3p"
                     /transcript_id="XM_018879086.1"
                     /db_xref="GeneID:30034037"
     CDS             complement(546281..548509)
                     /gene="KAR3"
                     /locus_tag="AWJ20_2157"
                     /inference="similar to AA sequence:KEGG_Orthology:K10405"
                     /note="Minus-end-directed microtubule motor; functions in
                     mitosis and meiosis, localizes to the spindle pole body
                     and localization is dependent on functional Cik1p,
                     required for nuclear fusion during mating; potential
                     Cdc28p substrate; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA]; GO_component: GO:0005881 - cytoplasmic
                     microtubule [Evidence IDA] [PMID 2138512]; GO_component:
                     GO:0005856 - cytoskeleton [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005871 -
                     kinesin complex [Evidence IEA]; GO_component: GO:0005874 -
                     microtubule [Evidence IEA]; GO_component: GO:0005874 -
                     microtubule [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0000922 - spindle pole [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005816 - spindle pole
                     body [Evidence IEA]; GO_component: GO:0005816 - spindle
                     pole body [Evidence IDA] [PMID 11729143]; GO_component:
                     GO:0005816 - spindle pole body [Evidence IDA] [PMID
                     2138512]; GO_component: GO:0005816 - spindle pole body
                     [Evidence IDA] [PMID 8106549]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0008017 -
                     microtubule binding [Evidence IEA]; GO_function:
                     GO:0008017 - microtubule binding [Evidence IDA] [PMID
                     22734002]; GO_function: GO:0003777 - microtubule motor
                     activity [Evidence IEA]; GO_function: GO:0008569 -
                     minus-end-directed microtubule motor activity [Evidence
                     IDA] [PMID 8041770]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0046982 - protein
                     heterodimerization activity [Evidence IPI] [PMID
                     16107877]; GO_process: GO:0007049 - cell cycle [Evidence
                     IEA]; GO_process: GO:0051301 - cell division [Evidence
                     IEA]; GO_process: GO:0000741 - karyogamy [Evidence IEA];
                     GO_process: GO:0000742 - karyogamy involved in conjugation
                     with cellular fusion [Evidence IMP] [PMID 2138512];
                     GO_process: GO:0007126 - meiotic nuclear division
                     [Evidence IDA,IMP] [PMID 11729143]; GO_process: GO:0008152
                     - metabolic process [Evidence IEA]; GO_process: GO:0007018
                     - microtubule-based movement [Evidence IEA]; GO_process:
                     GO:0007067 - mitotic nuclear division [Evidence IGI] [PMID
                     9201713]; GO_process: GO:0007064 - mitotic sister
                     chromatid cohesion [Evidence IGI,IMP] [PMID 14742714];
                     GO_process: GO:0000743 - nuclear migration involved in
                     conjugation with cellular fusion [Evidence IMP] [PMID
                     16380440]; GO_process: GO:0000743 - nuclear migration
                     involved in conjugation with cellular fusion [Evidence
                     IMP] [PMID 19386762]; GO_process: GO:0000743 - nuclear
                     migration involved in conjugation with cellular fusion
                     [Evidence IMP] [PMID 2138512]"
                     /codon_start=1
                     /product="Kar3p"
                     /protein_id="XP_018737036.1"
                     /db_xref="GeneID:30034037"
                     /translation="MELQFLENIPPKTNNANSNATRLQRPTTVRKPTLKSSIPSSRSV
                     LQERQNIEVTSSKPYSVKRTALPISRNVPIQGRSIKELAPQNHISAIPSIEPRQDQSE
                     THLQTEIARLRTDEAKLKFERDKLEDKLKAFHDKATEREDTIRREKDQIINSLQNELH
                     STKDACHLKIVEFQREYNDALSEKIESERQRYQELLSQQQSHYQTQLETHRQQIEHEK
                     QLEKAASEQKLLHEMELIKHEYERENQKLIFEVENSRSELEKIREESSRQLQEVVGEL
                     KRENLRLITELQEELKQKEHMYSQEKEAFLTQLQSQREQLNQNMTQISIQARELETTK
                     MQLTDALANSHSHQTLEKSQQSTIYELQLLLRTAEEHKNIAEKERDIAKEKLFKEETV
                     RRKLHNQLQELKGNIRVFCRVRPPLQSEQNNQPVAKITFPDKDMESQQLLVCGPASES
                     AVGSVTTKVHPFAFDKVFPPSSSNEEVFDEVSELIQSALDGYNVCIFAYGQTGSGKTY
                     TMSGNNGMIPKAVTKIFEASETLKERGWRYVITGEFLEIYNETMRDLLNSSEENKLEI
                     RHDAKQQKTSIINITSVKLDSPSTVYSVLRQADSNRSVAATAANERSSRSHSVFILRI
                     TGENVETGEKSEGTLNLIDLAGSERLAHSQATGIRLKETQAINKSLSYLGDVICALGS
                     EDKSHIPYRNSKLTYLLQYSLSGNSKTLMFVNVSPLEPHVNESLSSLRFATKVNNTKM
                     KK"
     gene            <548971..>549747
                     /gene="RRP15"
                     /locus_tag="AWJ20_2158"
                     /db_xref="GeneID:30034038"
     mRNA            <548971..>549747
                     /gene="RRP15"
                     /locus_tag="AWJ20_2158"
                     /product="Rrp15p"
                     /transcript_id="XM_018879087.1"
                     /db_xref="GeneID:30034038"
     CDS             548971..549747
                     /gene="RRP15"
                     /locus_tag="AWJ20_2158"
                     /note="Nucleolar protein; constituent of pre-60S ribosomal
                     particles; required for proper processing of the 27S
                     pre-rRNA at the A3 and B1 sites to yield mature 5.8S and
                     25S rRNAs; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0030687 -
                     preribosome, large subunit precursor [Evidence IDA] [PMID
                     15769876]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0000466 - maturation of 5.8S
                     rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15769876];
                     GO_process: GO:0000463 - maturation of LSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 15769876]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Rrp15p"
                     /protein_id="XP_018737037.1"
                     /db_xref="GeneID:30034038"
                     /translation="MAKGSTNVQASKPKGSIKLQKKADVSPPQLKRKREEEAQEEEDE
                     DASEDNEEEDSDDFEGDSGDYSDDLNDEFSEAEADSSEMEDDQFESEDENVPSKSRLE
                     AKKEKEQESFAKAMSAILQSKVKAHDRENPILVRSKKTAKDLETSRLDAKARRALAAE
                     KKQVQDKDRVRNLLEVRPQEDGSEPQTVQQLLEQEKKLRKIAQRGVVRLFNAVLASQT
                     VVNTASNSGEKILGLTKKEEQMTEMSKDTFLDLIRSGGKK"
     gene            complement(<550014..>550577)
                     /gene="YAH1"
                     /locus_tag="AWJ20_2159"
                     /db_xref="GeneID:30034039"
     mRNA            complement(<550014..>550577)
                     /gene="YAH1"
                     /locus_tag="AWJ20_2159"
                     /product="Yah1p"
                     /transcript_id="XM_018879088.1"
                     /db_xref="GeneID:30034039"
     CDS             complement(550014..550577)
                     /gene="YAH1"
                     /locus_tag="AWJ20_2159"
                     /note="Ferredoxin of the mitochondrial matrix; required
                     for formation of cellular iron-sulfur proteins; involved
                     in heme A biosynthesis; homologous to human adrenodoxin;
                     GO_component: GO:0005759 - mitochondrial matrix [Evidence
                     IEA]; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IDA] [PMID 10375636]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_function: GO:0051537 - 2
                     iron, 2 sulfur cluster binding [Evidence IEA];
                     GO_function: GO:0009055 - electron carrier activity
                     [Evidence IEA]; GO_function: GO:0051536 - iron-sulfur
                     cluster binding [Evidence IEA,IEA]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0016653 - oxidoreductase activity, acting
                     on NAD(P)H, heme protein as acceptor [Evidence IGI,IMP]
                     [PMID 11788607]; GO_process: GO:0006784 - heme a
                     biosynthetic process [Evidence IGI,IMP] [PMID 11788607];
                     GO_process: GO:0016226 - iron-sulfur cluster assembly
                     [Evidence IMP] [PMID 12970193]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0006744 - ubiquinone biosynthetic process [Evidence
                     IMP] [PMID 20534343]; GO_process: GO:0006744 - ubiquinone
                     biosynthetic process [Evidence IMP] [PMID 21944752]"
                     /codon_start=1
                     /product="Yah1p"
                     /protein_id="XP_018737038.1"
                     /db_xref="GeneID:30034039"
                     /translation="MTLRLISKLASPSALRRCALASSKSQAFGTASLLQRSAIRNAVS
                     GPGGNIYTARSLHTTAIAHHGHVHKPNPGEELHVTFITKEGEQIQLEVAEGDNLLDIA
                     QAHNMDMEGACGGSCACSTCHVIVDPDYYDKMEEPDDDENDMLDLAFGLTETSRLGCQ
                     IKMTKELDGVRVALPAMTRNLQARDFQ"
     gene            complement(<553737..>556373)
                     /gene="STE6"
                     /locus_tag="AWJ20_2160"
                     /db_xref="GeneID:30034041"
     mRNA            complement(<553737..>556373)
                     /gene="STE6"
                     /locus_tag="AWJ20_2160"
                     /product="ATP-binding cassette alpha-factor transporter
                     STE6"
                     /transcript_id="XM_018879090.1"
                     /db_xref="GeneID:30034041"
     CDS             complement(553737..556373)
                     /gene="STE6"
                     /locus_tag="AWJ20_2160"
                     /inference="similar to AA sequence:KEGG_Orthology:K05658"
                     /note="Plasma membrane ATP-binding cassette (ABC)
                     transporter; required for the export of a-factor,
                     catalyzes ATP hydrolysis coupled to a-factor transport;
                     contains 12 transmembrane domains and two ATP binding
                     domains; expressed only in MATa cells; GO_component:
                     GO:0005794 - Golgi apparatus [Evidence IDA] [PMID
                     8045256]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0043332 - mating projection
                     tip [Evidence IDA] [PMID 12374868]; GO_component:
                     GO:0043332 - mating projection tip [Evidence IDA] [PMID
                     7679674]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 7679674]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IEA]; GO_function: GO:0042626 -
                     ATPase activity, coupled to transmembrane movement of
                     substances [Evidence IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0017111
                     - nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_function: GO:0015440 - peptide-transporting
                     ATPase activity [Evidence IDA,IMP] [PMID 11389139];
                     GO_function: GO:0015440 - peptide-transporting ATPase
                     activity [Evidence IDA,IMP] [PMID 8626301]; GO_process:
                     GO:0006200 - ATP catabolic process [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence
                     IEA,IEA]; GO_process: GO:0000770 - peptide pheromone
                     export [Evidence IMP] [PMID 2569166]; GO_process:
                     GO:0019236 - response to pheromone [Evidence IEA];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]; GO_process: GO:0006810 - transport [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="ATP-binding cassette alpha-factor transporter
                     STE6"
                     /protein_id="XP_018737039.1"
                     /db_xref="GeneID:30034041"
                     /translation="MCHILITIKINFKYPTRNEMILDGFNINIKAGQLSFIVGRSGSG
                     KSTLGHILLKQYERASGAIFIDGLVFDTISPRWLCDNIFVVEQQSILFDVSIDENIKL
                     AASRATNTESIRNACDQFFVSEFVGELPQGWKTNAGLQGKNLSGGQKQRISLARARLR
                     NTPIMIFDESFSALDPQMRAKCLEEIRKYRADKTTIIITHELAQINPDDYLYIMESGN
                     IVEHGLRKDLEADSARLNFLADLSNSSNRASEDLSFSENWFPDLPSKRHSRVDESIAH
                     RRQSTIDPYNQFISEDEQIDSKVQAWKSKKRISTTKLLFQLINSLPNKIVFGIGIVSA
                     VLNAITNPLFSFAFSNLLNGIIYQKQMGTSDYSLTRWTVIVIAIAIGDGITTYGRTAL
                     DIASETWLRHARVRSLRNILDRELLDLNTDTESSLTSLLMNDSESVRLLVSRFTSGVI
                     SCVILGVFAIVWSMISGWQLSLVGLSFIPCFYFSSAWYKSIVTKWEALYREETTSVIG
                     LIDEVVAGIKSVKLLALENYFKKEVDKREMTLNAIAFRRAIFIGLGFGVNQIFMYITQ
                     AIILYYGMTLISDGKYSVQQAMMVFTLLIFSLVTLEQTVGTIPILSNGFETCREILDL
                     MKRSPSMEKAKAHYDITKGSIKFENVGFWYSSTTSTEDSELEGSGTSPVLLNFNLEVN
                     SNEVVAITGRSGCGKSTLARLVTKLYSPQRGTISVDGNDISDLSTRSLRKKIAIVSQM
                     PLSFFEGTIADNLRYGMKDDRTTPERQQMDLMRQACRESGLDEFIMSLEEGYETKMGS
                     SSSSGSLLSGGQLQRLGIARALLRSPKILILDECTSALDAESIDIIKQMIKYHRTVRD
                     MTIIIITHQEEMTDGVDRVIKM"
     gene            <558783..>559064
                     /gene="OPI3"
                     /locus_tag="AWJ20_2161"
                     /db_xref="GeneID:30034042"
     mRNA            <558783..>559064
                     /gene="OPI3"
                     /locus_tag="AWJ20_2161"
                     /product="bifunctional phosphatidyl-N-methylethanolamine
                     N-methyltransferase/phosphatidyl-N-dimethylethanolamine
                     N-methyltransferase"
                     /transcript_id="XM_018879091.1"
                     /db_xref="GeneID:30034042"
     CDS             558783..559064
                     /gene="OPI3"
                     /locus_tag="AWJ20_2161"
                     /inference="similar to AA sequence:KEGG_Orthology:K00550"
                     /note="Methylene-fatty-acyl-phospholipid synthase;
                     catalyzes the last two steps in phosphatidylcholine
                     biosynthesis; also known as phospholipid
                     methyltransferase; GO_component: GO:0005783 - endoplasmic
                     reticulum [Evidence IEA]; GO_component: GO:0005789 -
                     endoplasmic reticulum membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 2445736];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0008170 -
                     N-methyltransferase activity [Evidence IEA]; GO_function:
                     GO:0008168 - methyltransferase activity [Evidence IEA];
                     GO_function: GO:0080101 -
                     phosphatidyl-N-dimethylethanolamine N-methyltransferase
                     activity [Evidence IEA]; GO_function: GO:0080101 -
                     phosphatidyl-N-dimethylethanolamine N-methyltransferase
                     activity [Evidence IDA,IGI] [PMID 2445736]; GO_function:
                     GO:0080101 - phosphatidyl-N-dimethylethanolamine
                     N-methyltransferase activity [Evidence IMP] [PMID
                     2684666]; GO_function: GO:0000773 -
                     phosphatidyl-N-methylethanolamine N-methyltransferase
                     activity [Evidence IEA]; GO_function: GO:0000773 -
                     phosphatidyl-N-methylethanolamine N-methyltransferase
                     activity [Evidence IDA,IGI] [PMID 2445736]; GO_function:
                     GO:0000773 - phosphatidyl-N-methylethanolamine
                     N-methyltransferase activity [Evidence IMP] [PMID
                     2684666]; GO_function: GO:0004608 -
                     phosphatidylethanolamine N-methyltransferase activity
                     [Evidence IEA]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0032259 -
                     methylation [Evidence IEA]; GO_process: GO:0006656 -
                     phosphatidylcholine biosynthetic process [Evidence IEA];
                     GO_process: GO:0006656 - phosphatidylcholine biosynthetic
                     process [Evidence IMP] [PMID 23000174]; GO_process:
                     GO:0006656 - phosphatidylcholine biosynthetic process
                     [Evidence IDA,IGI] [PMID 2445736]; GO_process: GO:0006656
                     - phosphatidylcholine biosynthetic process [Evidence IMP]
                     [PMID 6337128]; GO_process: GO:0008654 - phospholipid
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0006644 - phospholipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="bifunctional phosphatidyl-N-methylethanolamine
                     N-methyltransferase/phosphatidyl-N-dimethylethanolamine
                     N-methyltransferase"
                     /protein_id="XP_018737040.1"
                     /db_xref="GeneID:30034042"
                     /translation="MWALGVTGTYLGDYFGILMDERVTGFPFNVTDNPMYYGSFLSFL
                     GTGLWFAKPAGIAVSGFVLVMYLIALRFEEPFTAEIYAKRERERAKKAK"
     gene            complement(<559225..>561030)
                     /gene="FRE1"
                     /locus_tag="AWJ20_2162"
                     /db_xref="GeneID:30034043"
     mRNA            complement(<559225..>561030)
                     /gene="FRE1"
                     /locus_tag="AWJ20_2162"
                     /product="Fre1p"
                     /transcript_id="XM_018879092.1"
                     /db_xref="GeneID:30034043"
     CDS             complement(559225..561030)
                     /gene="FRE1"
                     /locus_tag="AWJ20_2162"
                     /note="Ferric reductase and cupric reductase; reduces
                     siderophore-bound iron and oxidized copper prior to uptake
                     by transporters; expression induced by low copper and iron
                     levels; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0005886 - plasma membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 17507646]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 8164662];
                     GO_function: GO:0052851 - ferric-chelate reductase (NADPH)
                     activity [Evidence IEA]; GO_function: GO:0000293 -
                     ferric-chelate reductase activity [Evidence IDA] [PMID
                     8164662]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0016491 - oxidoreductase
                     activity [Evidence IEA,IEA]; GO_process: GO:0015677 -
                     copper ion import [Evidence IDA] [PMID 7814363];
                     GO_process: GO:0006825 - copper ion transport [Evidence
                     IEA]; GO_process: GO:0006811 - ion transport [Evidence
                     IEA]; GO_process: GO:0055072 - iron ion homeostasis
                     [Evidence IEA]; GO_process: GO:0006826 - iron ion
                     transport [Evidence IDA] [PMID 8164662]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence
                     IEA,IEA]"
                     /codon_start=1
                     /product="Fre1p"
                     /protein_id="XP_018737041.1"
                     /db_xref="GeneID:30034043"
                     /translation="MLASSRSLPPSYSITNQQQHGNEPTEESPFRYDSPFEGPFREEL
                     IAEIYKGRDLLVYYEYILLGTFLLIVVAHWTNKLLWYIRNKQRNPGLPIYNRNENSTE
                     ESLISEDTGASSSETDPLLGNRQHSMFKRIYYRTMAFFMFQPEGKGMENYGVTMMLIV
                     YELMTIFFALYQIRFWIILAFRLGLLATINIPLMYVLGAKHSPLSYLTGWSYEQVNVF
                     HRLCGAICFFLVIPHLIIFACYFRFDYLLTHLWSVAGIIAGIAFIAIGFSSSLKFRES
                     FYELFYVVHIVGFLVSIPAVYLHYPTARPYAVAAGLSVLYDRLTRLLLDYRIMKCIIR
                     PASGETVIMDIPFSPGPKDGTGGFFGRPFAWTTGQHIYITVIGCGTFESHPYTIASTM
                     KCSKYLRLIIRARDGFSRRLLELAESKHGLDENEPVQQWCILHGPYGVHPPEMPSSAS
                     PPRNNTKLILVAGGAGVAFTYPLYQEYHLANKLLESQTKLVGQSSPSKFDINFLWVLP
                     HSSFSEWLVEHGETVVDTTKMDIWATREKGRPDINQLILGYISKANGVSSSEDHCWVA
                     ACGPDPLLREVRNAVANLRGQGMSNVHYYAERFGW"
     gene            <561745..>563682
                     /gene="COG6"
                     /locus_tag="AWJ20_2163"
                     /db_xref="GeneID:30034044"
     mRNA            <561745..>563682
                     /gene="COG6"
                     /locus_tag="AWJ20_2163"
                     /product="Cog6p"
                     /transcript_id="XM_018879093.1"
                     /db_xref="GeneID:30034044"
     CDS             561745..563682
                     /gene="COG6"
                     /locus_tag="AWJ20_2163"
                     /note="Component of the conserved oligomeric Golgi
                     complex; a cytosolic tethering complex (Cog1p through
                     Cog8p) that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0017119 - Golgi transport complex
                     [Evidence IEA]; GO_component: GO:0017119 - Golgi transport
                     complex [Evidence IPI] [PMID 11703943]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0032258 - CVT pathway [Evidence IMP] [PMID 20065092];
                     GO_process: GO:0006891 - intra-Golgi vesicle-mediated
                     transport [Evidence IEA]; GO_process: GO:0006891 -
                     intra-Golgi vesicle-mediated transport [Evidence IGI,IPI]
                     [PMID 11703943]; GO_process: GO:0015031 - protein
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Cog6p"
                     /protein_id="XP_018737042.1"
                     /db_xref="GeneID:30034044"
                     /translation="MSVSLELLSGKEDVSSGANPDNAISQLITNILSTSYNDPSLRQA
                     LSVLDTKMEENTAENRRQLRSNIETSVLKSGSTILKDFTKLHQKLSSLGDSIQELNNQ
                     YNHMEKVVSQATKDTLLIQKQAEELRSSEETISIKKRLLEAYENNFVLTDQELDILNN
                     GLLASGADEVEQFFQVLQKVNHIHNDCQVLLSADDTSQTGMEIMGQMSAHLDKGYERI
                     LIAVENEFKKMVSGQYLQISKSLRRYLTILSSERPNLFDSALNGLIDTRQKNLTNEFI
                     KALTVETSTSKPIDFYAYDILRYVGDIMAWIHSAIVGEQEILETLLLDDKKTLLQKID
                     KATTSLVKPLRLRIEQVISTEDNLVDIYKVGNVLNFYYSIFIKIFSNESSAIMTAISR
                     LEEACSRQFSQCLQNKIASQKDGLGAVTRPGSSLLRDLQPPEFFSDALADAKAILSSY
                     EASINFTSPPSNQFKQTLHDLIEPYLELCNRVSESLPSVDSEIFVINCFDATKSTLSL
                     FPFVQYKIDQMNNRTDELAEVLEDSQYYKFLSSSGVNSILNADKTLNREKISGNTQLI
                     QELAASLDNFLPAANMESSVLLHRLSSPRLSSSITLRASQRFVDIFQQIKQCLDELYG
                     EEAAVLMPRSVSEVKTLLAIE"
     gene            <564464..>565045
                     /gene="DET1"
                     /locus_tag="AWJ20_2164"
                     /db_xref="GeneID:30034045"
     mRNA            <564464..>565045
                     /gene="DET1"
                     /locus_tag="AWJ20_2164"
                     /product="acid phosphatase DET1"
                     /transcript_id="XM_018879094.1"
                     /db_xref="GeneID:30034045"
     CDS             564464..565045
                     /gene="DET1"
                     /locus_tag="AWJ20_2164"
                     /codon_start=1
                     /product="acid phosphatase DET1"
                     /protein_id="XP_018737043.1"
                     /db_xref="GeneID:30034045"
                     /translation="MREQDFGNFQGDSEEMQRIWTARARYGHFFFRIPNGESAADVYD
                     RCAGFNESLFRQFNQPHFPEVLVLVSHGIWARVFLMKWYGWSYEKFESLRNVRHCQFL
                     QMDLCPVKKRYTLMTRLRTWDDTDEEDVREASDGGEIEELEIASNNNISLIDIKKIAA
                     KEKQIMEEYKSARQDSPGPSYHQNDHEKTIDQH"
     gene            complement(<565208..>566482)
                     /gene="DPH1"
                     /locus_tag="AWJ20_2165"
                     /db_xref="GeneID:30034046"
     mRNA            complement(<565208..>566482)
                     /gene="DPH1"
                     /locus_tag="AWJ20_2165"
                     /product="Dph1p"
                     /transcript_id="XM_018879095.1"
                     /db_xref="GeneID:30034046"
     CDS             complement(565208..566482)
                     /gene="DPH1"
                     /locus_tag="AWJ20_2165"
                     /inference="similar to AA sequence:KEGG_Orthology:K07561"
                     /note="Protein required for synthesis of diphthamide;
                     required along with Dph2p, Kti11p, Jjj3p, and Dph5p;
                     diphthamide is a modified histidine residue of translation
                     elongation factor 2 (Eft1p or Eft2p); may act in a complex
                     with Dph2p and Kti11p; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0005737
                     - cytoplasm [Evidence IDA] [PMID 11914276]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0017183 - peptidyl-diphthamide
                     biosynthetic process from peptidyl-histidine [Evidence
                     IEA,IEA]; GO_process: GO:0017183 - peptidyl-diphthamide
                     biosynthetic process from peptidyl-histidine [Evidence
                     IMP] [PMID 15485916]"
                     /codon_start=1
                     /product="Dph1p"
                     /protein_id="XP_018737044.1"
                     /db_xref="GeneID:30034046"
                     /translation="MSEQIGETVPVAPRRKFVGRKKATADAERNGNSNIEDIGAGSLT
                     QSKRGPVRTVNRIPDDILNDEELNQAIKILPKNYNFEIHKTIWHIRKSNAKRVALQMP
                     EGLLLYSCIISDILEQFCGVETVIMGDVTYGACCIDDFTALSLNCDFLVHYAHSCLVP
                     VDVTRMKVLYVFVTIDIDKTHLIATLGKNFAPSSRLALVGTIQFNPTLHAIHDDLLTK
                     HQIITSTPQAMPLSKGEVLGCTSARLSSKEIDAIVYIGDGRFHLESAMIHNPEIPAYK
                     YDPYNREFTIETFDHEEMHSIRRAAIKEAKNAKKVGIILGALGRQGNMGTLDLIEKGF
                     KEKNIETVLVLLSEIFPGKLAQFDDVDCWIQVACPRLSIDWGYAFPRPLLTPYEAMVS
                     LEKDQPWDKAYPMDYYSKDGYGRGKIPQRIVA"
     gene            <566854..>568209
                     /gene="SHQ1"
                     /locus_tag="AWJ20_2166"
                     /db_xref="GeneID:30034047"
     mRNA            <566854..>568209
                     /gene="SHQ1"
                     /locus_tag="AWJ20_2166"
                     /product="Shq1p"
                     /transcript_id="XM_018879096.1"
                     /db_xref="GeneID:30034047"
     CDS             566854..568209
                     /gene="SHQ1"
                     /locus_tag="AWJ20_2166"
                     /inference="similar to AA sequence:KEGG_Orthology:K14764"
                     /note="Chaperone protein; required for the assembly of box
                     H/ACA snoRNPs and thus for pre-rRNA processing; functions
                     as an RNA mimic; forms a complex with Naf1p and interacts
                     with H/ACA snoRNP components Nhp2p and Cbf5p; homology
                     with known Hsp90p cochaperones; relocalizes to the cytosol
                     in response to hypoxia; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 22932476]; GO_component: GO:0005654 -
                     nucleoplasm [Evidence IDA] [PMID 12228251]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 22932476];
                     GO_function: GO:0051082 - unfolded protein binding
                     [Evidence IDA] [PMID 19426738]; GO_process: GO:0000493 -
                     box H/ACA snoRNP assembly [Evidence IMP,IPI] [PMID
                     12228251]"
                     /codon_start=1
                     /product="Shq1p"
                     /protein_id="XP_018737045.1"
                     /db_xref="GeneID:30034047"
                     /translation="MITPQFSVDQDDEFIYIKIKAPYIKAQNIEFVVDENVFIFSLHP
                     YYLRLRFPGKIIDDDDRSSANYDLKTSMVSVKLPKEVKGEHFEDLDMITKLLARKNEE
                     TTRAAKPTIEEIDTEGGKSGNGDLSVGDSSNEIASATQELDEKNANTKLSSLGEEFDW
                     EIEQTIPAPLTDSEDQKAVMANKYGFDNGYSGLMSMSVMNGNDINDLSDPDKLSPSER
                     AKERTELEIEKFDPDYYLSDLFDNPMIEEIISWTETSDDSLTSQESDRLARLSKKTYL
                     LDSEKQTYIGLVSLLFGSCYDKRINMGDSTVESAWTIGKLSPLISCLDNSFASVQDIM
                     IGCTRRSLCYPLYRSWALSLAVWNDVYHVLKRGKRAVLKELAKLVLMFDIDLYNVYNQ
                     ILLEDYAVWIQYSSENVIRSLAHEVHKTTISKESMGFDLLEYEEAAKEALADQDMDQV
                     D"
     gene            <568798..>568871
                     /locus_tag="AWJ20_2167"
                     /db_xref="GeneID:30034048"
     tRNA            <568798..>568871
                     /locus_tag="AWJ20_2167"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:30034048"
     gene            complement(<570067..>570158)
                     /locus_tag="AWJ20_2168"
                     /db_xref="GeneID:30034049"
     tRNA            complement(<570067..>570158)
                     /locus_tag="AWJ20_2168"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:30034049"
     gene            <571177..>572403
                     /gene="CDC50"
                     /locus_tag="AWJ20_2169"
                     /db_xref="GeneID:30034050"
     mRNA            <571177..>572403
                     /gene="CDC50"
                     /locus_tag="AWJ20_2169"
                     /product="aminophospholipid translocase regulatory protein
                     CDC50"
                     /transcript_id="XM_018879097.1"
                     /db_xref="GeneID:30034050"
     CDS             571177..572403
                     /gene="CDC50"
                     /locus_tag="AWJ20_2169"
                     /note="Endosomal protein that interacts with phospholipid
                     flippase Drs2p; interaction with Cdc50p is essential for
                     Drs2p catalytic activity; mutations affect cell polarity
                     and polarized growth; similar to Lem3p; CDC50 has a
                     paralog, YNR048W, that arose from the whole genome
                     duplication; GO_component: GO:0005768 - endosome [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence IEA]; GO_component: GO:0031902 - late
                     endosome membrane [Evidence IEA]; GO_component: GO:0031902
                     - late endosome membrane [Evidence IDA] [PMID 12589066];
                     GO_component: GO:0016020 - membrane [Evidence IEA,IEA];
                     GO_component: GO:0005802 - trans-Golgi network [Evidence
                     IDA] [PMID 15090616]; GO_function: GO:0004012 -
                     phospholipid-translocating ATPase activity [Evidence IGI]
                     [PMID 15090616]; GO_process: GO:0051666 - actin cortical
                     patch localization [Evidence IGI] [PMID 16195350];
                     GO_process: GO:0006897 - endocytosis [Evidence IGI] [PMID
                     16195350]; GO_process: GO:0006886 - intracellular protein
                     transport [Evidence IMP] [PMID 16956384]; GO_process:
                     GO:0045332 - phospholipid translocation [Evidence IGI]
                     [PMID 15090616]"
                     /codon_start=1
                     /product="aminophospholipid translocase regulatory protein
                     CDC50"
                     /protein_id="XP_018737046.1"
                     /db_xref="GeneID:30034050"
                     /translation="MDSDTDSIDRPVETKQKSRRPPNTAFRQQRLKAWQPILTPKTVL
                     PLFFCIAIIFAPIGGLLLYASNQVQEIVIDYSYCSQQAPTDNFANIPSRFVSSQTFSG
                     GKQPANPPQWKLQVNHDTTPGADNATCFLRFDVPTEMGNPIFMFYRLTNFFQNHRRYV
                     QSFNEDQLNGKAVSASSLKSPDDCKPLTLAPDGRPYYPCGLIANSWFNDSFSSPVLLN
                     AAGSSRDNETYVMTDIGIAWSTDRNRFKKSQYKNDEVVPPPNWIKRYPNGYNDDTPIP
                     DISTWESFQNWMRTAGLPTFSKLALRNDTAPLGTGTYQVAIGLNFEVLEFNGSKSLVL
                     STRTVIGGRNPFLGIAYLCVAGLCFVLGILFLIKHLIKPRKLGDHSYLSWNQEPAAAG
                     QATGTDQGNLQQRRHI"
     gene            <573306..>574433
                     /gene="ERG6"
                     /locus_tag="AWJ20_2170"
                     /db_xref="GeneID:30034052"
     mRNA            <573306..>574433
                     /gene="ERG6"
                     /locus_tag="AWJ20_2170"
                     /product="sterol 24-C-methyltransferase"
                     /transcript_id="XM_018879099.1"
                     /db_xref="GeneID:30034052"
     CDS             573306..574433
                     /gene="ERG6"
                     /locus_tag="AWJ20_2170"
                     /inference="similar to AA sequence:KEGG_Orthology:K00559"
                     /note="Delta(24)-sterol C-methyltransferase; converts
                     zymosterol to fecosterol in the ergosterol biosynthetic
                     pathway by methylating position C-24; localized to lipid
                     particles, the plasma membrane-associated endoplasmic
                     reticulum, and the mitochondrial outer membrane;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IDA] [PMID 11298754]; GO_component: GO:0005783 -
                     endoplasmic reticulum [Evidence IDA] [PMID 9450962];
                     GO_component: GO:0005811 - lipid particle [Evidence IDA]
                     [PMID 10515935]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 24868093]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16407407]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0008168 - methyltransferase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003838 - sterol
                     24-C-methyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0003838 - sterol 24-C-methyltransferase
                     activity [Evidence IDA] [PMID 18563465]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0006696 - ergosterol biosynthetic process
                     [Evidence IMP] [PMID 2677674]; GO_process: GO:0006696 -
                     ergosterol biosynthetic process [Evidence IMP] [PMID
                     6363386]; GO_process: GO:0006629 - lipid metabolic process
                     [Evidence IEA]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0032259 - methylation
                     [Evidence IEA]; GO_process: GO:0006694 - steroid
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0008202 - steroid metabolic process [Evidence IEA];
                     GO_process: GO:0016126 - sterol biosynthetic process
                     [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="sterol 24-C-methyltransferase"
                     /protein_id="XP_018737047.1"
                     /db_xref="GeneID:30034052"
                     /translation="MSTAKLAPKDFKADAEFAKAMHGSGERGGFTAVLSKNRDAQQAA
                     VDGYFKHWDNKGPKEETEEDKQARLDDYSSLTKHYYNLVTDFYEYGWGSSFHFSRYYP
                     GEAFKQATARHEHYLALKMGINENMKVLDVGCGVGGPAREIHRFTGAEVVGLNNNDYQ
                     ISRGNAYAKKFGLENKLSFVKGDFMQMDFPDNSFDAVYAIEATVHAPDLAGVYGEIYR
                     VLKPGGTFGVYEWVLTDNYDESNARHREIAYGIEIGDGIPKMFKSEVAEAALKKVGFE
                     IVHQQDMADVGDKIPWYYPLTGDWKYIQTLGDFFTFCRTSKFGRMFTMEATGLLEKVG
                     VAPKGSKKVTIALEEAAVHLVNGAKEGLFTPMMLYVCKKAE"
     gene            <575960..>577597
                     /gene="HXT6"
                     /locus_tag="AWJ20_2171"
                     /db_xref="GeneID:30034053"
     mRNA            <575960..>577597
                     /gene="HXT6"
                     /locus_tag="AWJ20_2171"
                     /product="hexose transporter HXT6"
                     /transcript_id="XM_018879100.1"
                     /db_xref="GeneID:30034053"
     CDS             575960..577597
                     /gene="HXT6"
                     /locus_tag="AWJ20_2171"
                     /inference="similar to AA sequence:KEGG_Orthology:K08139"
                     /codon_start=1
                     /product="hexose transporter HXT6"
                     /protein_id="XP_018737048.1"
                     /db_xref="GeneID:30034053"
                     /translation="MSEPDNNSLSIKEQPSDDEASSHGPKPVTAKPPLSSYFLVSMLC
                     MFAAMGGFIFGYDTGTISGYVNMPVFLEKLGSTDANGVHYLSKVRSGLLIGIFSIGAC
                     IGGIFLSRLGDMYGRKIGVWVGTGVYIVGVLIQVTTYNAWYQFLIGRLIGGMGVGTIA
                     VLVPMFQSEVAPQEIRGTLVSSYQLMITLGIFIGYIVCYATNTRPDATSYKIPLSLGF
                     VWSVILIVGLIFLPESPRYLMSKDRNEEAQKIMCWINRRDPNDPLIVETVANVAAAIE
                     HERNAGKAKWTEVITGKPRVGYRLMVGVMVLALQQLVGANYFFYFGTTIFKGIGMNNS
                     YLASIIFGAVNFGSTFFGLYFVERFGRRNVLLYGAAGMFIFFVIYASMGAKALYPNGS
                     DNDANVQVGKAMIFVTCGYIFCFATTWAPCAFVLVSELFPIRTRSKGMSLGLGANWLA
                     NFLLSFFTPFITGAIHFYYGFVFAGCNLFAIVFVYFFVHETKGLSLEQIDQLFVSGVM
                     PWRSSGWVAPAIVDPSTYNEEAPKDTHPNAIHDEHIV"
     gene            <578598..>579479
                     /gene="AGC1"
                     /locus_tag="AWJ20_2172"
                     /db_xref="GeneID:30034054"
     mRNA            <578598..>579479
                     /gene="AGC1"
                     /locus_tag="AWJ20_2172"
                     /product="Agc1p"
                     /transcript_id="XM_018879101.1"
                     /db_xref="GeneID:30034054"
     CDS             578598..579479
                     /gene="AGC1"
                     /locus_tag="AWJ20_2172"
                     /note="Mitochondrial amino acid transporter; acts both as
                     a glutamate uniporter and as an aspartate-glutamate
                     exchanger; involved in nitrogen metabolism and nitrogen
                     compound biosynthesis; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005743 - mitochondrial
                     inner membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence ISS]
                     [PMID 10930523]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0015183 - L-aspartate transmembrane transporter
                     activity [Evidence IDA] [PMID 14622413]; GO_function:
                     GO:0005313 - L-glutamate transmembrane transporter
                     activity [Evidence IDA] [PMID 14622413]; GO_function:
                     GO:0015297 - antiporter activity [Evidence IDA] [PMID
                     14622413]; GO_function: GO:0015292 - uniporter activity
                     [Evidence IDA] [PMID 14622413]; GO_process: GO:0015813 -
                     L-glutamate transport [Evidence IDA] [PMID 14622413];
                     GO_process: GO:0006865 - amino acid transport [Evidence
                     IEA]; GO_process: GO:0015810 - aspartate transport
                     [Evidence IDA] [PMID 14622413]; GO_process: GO:0044271 -
                     cellular nitrogen compound biosynthetic process [Evidence
                     IMP] [PMID 14622413]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Agc1p"
                     /protein_id="XP_018737049.1"
                     /db_xref="GeneID:30034054"
                     /translation="MALETIAASVLGAVGSKLVFYPLDTIRTLQQTSTNFSYFLPIRS
                     YFRGLGASLSLSAPAFTVYMVAYRETKRELAPYLGEAALANYIVSGAVSQLTSSFIWT
                     PMEVLKARMQIHQGPKISTLNLASSIYRMDGIKGFFRGYWMGVAVFLPHSVVWWTTYE
                     YSKELLSKEDQPLKTIDYGIASASASSSAALASNFLDVIKTRQQVAVSEEIARIRPDD
                     RQGVFKVARNLIKEVGFFRAFFKGLHIRLLHSLPSSALAMMIVESINPDRLRGTAPAK
                     FTNDELLPPPALEEIEA"
     gene            complement(<579704..>581923)
                     /gene="FAA2"
                     /locus_tag="AWJ20_2173"
                     /db_xref="GeneID:30034055"
     mRNA            complement(<579704..>581923)
                     /gene="FAA2"
                     /locus_tag="AWJ20_2173"
                     /product="medium-chain fatty acid-CoA ligase FAA2"
                     /transcript_id="XM_018879102.1"
                     /db_xref="GeneID:30034055"
     CDS             complement(579704..581923)
                     /gene="FAA2"
                     /locus_tag="AWJ20_2173"
                     /inference="similar to AA sequence:KEGG_Orthology:K01897"
                     /note="Medium chain fatty acyl-CoA synthetase; activates
                     imported fatty acids; accepts a wide range of fatty acid
                     chain lengths with a preference for medium chains,
                     C9:0-C13:0; localized to the peroxisome; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005777 -
                     peroxisome [Evidence IDA] [PMID 8670886]; GO_function:
                     GO:0005524 - ATP binding [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0004467 - long-chain fatty acid-CoA ligase
                     activity [Evidence IEA]; GO_function: GO:0004467 -
                     long-chain fatty acid-CoA ligase activity [Evidence IDA]
                     [PMID 8206942]; GO_function: GO:0031956 - medium-chain
                     fatty acid-CoA ligase activity [Evidence IDA] [PMID
                     8206942]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA]; GO_function: GO:0031957 - very long-chain
                     fatty acid-CoA ligase activity [Evidence IGI] [PMID
                     9988704]; GO_process: GO:0006631 - fatty acid metabolic
                     process [Evidence IEA]; GO_process: GO:0006629 - lipid
                     metabolic process [Evidence IEA]; GO_process: GO:0001676 -
                     long-chain fatty acid metabolic process [Evidence IGI,IMP]
                     [PMID 7962057]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="medium-chain fatty acid-CoA ligase FAA2"
                     /protein_id="XP_018737050.1"
                     /db_xref="GeneID:30034055"
                     /translation="MASQNENGFTEETLRRIWKYNFVLPDGINENTSPFDTTLSSHAA
                     QGKPQALPVPGTKQPGYSEIYRNQCSPDKVISGYHPSVKTFYDAFLTVATTYPKRDCI
                     ADREYDQKLKKWGNYKWLSFEETAKRRTKIAAGLVHAVRKATGFDPADKKYIVSVYAP
                     NCVNWILTDLACQTQSLPTVCLYDTLGPHTSEYILNLCESPIVVCSLANVPRILSLKH
                     KLPHVKVIVSTNSFESVPGQFEPAGQSKKELLNVWANDQGVALYSLNEIEALGADFPI
                     ADRPPKPEDIYAINFTSGTTGNPKGAILTHANVVAAIAMGRHCLGKNFKPDQVATVYS
                     FLPLAHIYERIAMCIIMSLGHRQAYPHGPVTEIFEDIQILKPTNVNMVPRVLNRVAAA
                     LRASTIEAPGLAGAISRKAHEAKLNHLYATGSPNHPIWDFLWSRKIRKKLGFDNLNSL
                     VSGSAPLSKATVEFLKVALAAELLQGYGLTESMSGISVSQPEEPLAGSCGAVAPTTEL
                     RFRDVPELGYTANDKPFPRGEIMLRGPQMFTGYYKNNEKTLEAFDEDGWFHTGDVGTV
                     DKLGRIFIIDRVKNFFKLSQGEYVAAEKIENTYLANSSLITQIFVHGDSTESYLVAIA
                     GINPDSYATLANKVLHKRIRPTDLAALAATYDVPEVKAAFIKALNGSTGNLLQGFEKI
                     KNVLLRFEPLTPENDTLTPTLKIKRPAAVKLFKAEIDAMYKEGPLSDSGALNSTPKL"
     gene            complement(<582911..>583297)
                     /gene="NHP6B"
                     /locus_tag="AWJ20_2174"
                     /db_xref="GeneID:30034056"
     mRNA            complement(<582911..>583297)
                     /gene="NHP6B"
                     /locus_tag="AWJ20_2174"
                     /product="Nhp6bp"
                     /transcript_id="XM_018879103.1"
                     /db_xref="GeneID:30034056"
     CDS             complement(582911..583297)
                     /gene="NHP6B"
                     /locus_tag="AWJ20_2174"
                     /note="High-mobility group (HMG) protein; binds to and
                     remodels nucleosomes; involved in recruiting FACT and
                     other chromatin remodelling complexes to the chromosomes;
                     functionally redundant with Nhp6Ap; required for
                     transcriptional initiation fidelity of some tRNA genes;
                     homologous to mammalian HMGB1 and HMGB2; NHP6B has a
                     paralog, NHP6A, that arose from the whole genome
                     duplication; GO_component: GO:0005694 - chromosome
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 3169249]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0008301 - DNA
                     binding, bending [Evidence IDA] [PMID 7721780];
                     GO_function: GO:0031491 - nucleosome binding [Evidence
                     ISS] [PMID 11432837]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     19158363]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA]; GO_process: GO:0070898 - RNA polymerase III
                     transcriptional preinitiation complex assembly [Evidence
                     IGI] [PMID 11287614]; GO_process: GO:0070898 - RNA
                     polymerase III transcriptional preinitiation complex
                     assembly [Evidence IDA] [PMID 17178828]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0006338 - chromatin
                     remodeling [Evidence IGI] [PMID 14739928]; GO_process:
                     GO:0001195 - maintenance of transcriptional fidelity
                     during DNA-templated transcription elongation from RNA
                     polymerase III promoter [Evidence IDA] [PMID 16407207];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IGI] [PMID 8946917]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Nhp6bp"
                     /protein_id="XP_018737051.1"
                     /db_xref="GeneID:30034056"
                     /translation="MFGQLTRGAMALPAVRPLALATSAVSMRTPGLIANAHSKASGDD
                     KVKRKKKDPNAPKRASSAYMFFVKANRDEVLSENPGITFGETGRALGKKWNNLSSAEK
                     APYEEKANEDKIRYQEAKAAYDASKA"
     gene            complement(<583770..>584735)
                     /gene="ENV9"
                     /locus_tag="AWJ20_2175"
                     /db_xref="GeneID:30034057"
     mRNA            complement(<583770..>584735)
                     /gene="ENV9"
                     /locus_tag="AWJ20_2175"
                     /product="Env9p"
                     /transcript_id="XM_018879104.1"
                     /db_xref="GeneID:30034057"
     CDS             complement(583770..584735)
                     /gene="ENV9"
                     /locus_tag="AWJ20_2175"
                     /note="Protein proposed to be involved in vacuolar
                     functions; mutant shows defect in CPY processing and
                     defects in vacuolar morphology; has similarity to
                     oxidoreductases, found in lipid particles; required for
                     replication of Brome mosaic virus in S. cerevisiae, a
                     model system for studying replication of positive-strand
                     RNA viruses in their natural hosts; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0005811 - lipid particle [Evidence
                     IEA,IEA]; GO_component: GO:0005811 - lipid particle
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence ISS] [PMID
                     8972580]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]; GO_process:
                     GO:0006624 - vacuolar protein processing [Evidence IMP]
                     [PMID 21912603]; GO_process: GO:0007033 - vacuole
                     organization [Evidence IMP] [PMID 21912603]"
                     /codon_start=1
                     /product="Env9p"
                     /protein_id="XP_018737052.1"
                     /db_xref="GeneID:30034057"
                     /translation="MTFDSKTSSEEVAQAFSSEIKGKVFLVTGATWGGIGADNARVLS
                     GHGAKLVIVTGRSQSKLDETIGNIKKENPNANIRGLILDLSSFKSIRKAAEEVNNYSE
                     NIDVLINNAGVMACPYSKTEDGFELQFGTNHLGHFLFTNLILKKILSSPHPRVVNLSS
                     MGHGLAPIIFGDIGFSDGATYERFHAYGQSKTANVLFSRELSRRYKSQGLVSFSVHPG
                     AIMDTNLGRHMNFDGDINNIGIPKDYWGTDDFYHDMANVRMKNVTQGGATTLVAALDP
                     AIASQSGAYLDDCQIHEDFCRNHAKQPNDAFKLWNLSEELVGQKF"
     gene            complement(<585581..>587191)
                     /gene="DIP5"
                     /locus_tag="AWJ20_2176"
                     /db_xref="GeneID:30034058"
     mRNA            complement(<585581..>587191)
                     /gene="DIP5"
                     /locus_tag="AWJ20_2176"
                     /product="Dip5p"
                     /transcript_id="XM_018879105.1"
                     /db_xref="GeneID:30034058"
     CDS             complement(585581..587191)
                     /gene="DIP5"
                     /locus_tag="AWJ20_2176"
                     /inference="similar to AA sequence:KEGG_Orthology:K16261"
                     /note="Dicarboxylic amino acid permease; mediates
                     high-affinity and high-capacity transport of L-glutamate
                     and L-aspartate; also a transporter for Gln, Asn, Ser,
                     Ala, and Gly; relocalizes from plasma membrane to vacuole
                     upon DNA replication stress; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     22842922]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005886 - plasma membrane
                     [Evidence ISS] [PMID 10654085]; GO_component: GO:0005886 -
                     plasma membrane [Evidence IDA] [PMID 22842922];
                     GO_function: GO:0015171 - amino acid transmembrane
                     transporter activity [Evidence IEA]; GO_function:
                     GO:0015171 - amino acid transmembrane transporter activity
                     [Evidence IDA] [PMID 10654085]; GO_process: GO:0003333 -
                     amino acid transmembrane transport [Evidence IEA];
                     GO_process: GO:0006865 - amino acid transport [Evidence
                     IEA,IEA]; GO_process: GO:0006865 - amino acid transport
                     [Evidence IDA] [PMID 10654085]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Dip5p"
                     /protein_id="XP_018737053.1"
                     /db_xref="GeneID:30034058"
                     /translation="MSEDYGNEKNFKVTIYDDSASDEITVGVFKEDKTRLTKGLKQRH
                     IQMIALVGVIGTGLFLYSGGALQSAGPLGMLLAYLLVGTIVGFNQIAVAEVSAFMPTT
                     GSTIRQLEHFIDPAFGFAFGYLQFWWAVIPSEFVAASVVVSYWSDLNPAIWLTIFIVL
                     AILANSWSIRLYGEIEFFFACLKILLILGLILTGLIIDLGGVKGQPRLGFHYWKHPGV
                     WAEFMKTGAAGRTIGFFSVMNGAVYSFGGLQTVALLAGETQNPRRNIPKAAKRILARV
                     LTFYMLALFIVSLIVPYDNPDISNGSGNASGSPFVVAMKLAGIKVLPSIVNAMVLCSA
                     WSAASGSLVQGSRILFSLAANNQAPKVFLRTNKRGLPWVGLIVTGLFLPLSYMSLSSS
                     SSKVFGYLVNVTSSIILIQWILIASIHFKMNKALDIQGHSRHELPYHFKGGRYLGIIS
                     GIGSLLLLLIGGFTIFISWSTSQFVSAYVSIPLFLAFSLFWKLYKKTKWVEADKVDLK
                     SLFLEIENNPEPEEVPLRGWHRLEFLWA"
     gene            <588233..>588670
                     /gene="RPS23B"
                     /locus_tag="AWJ20_2177"
                     /db_xref="GeneID:30034059"
     mRNA            <588233..>588670
                     /gene="RPS23B"
                     /locus_tag="AWJ20_2177"
                     /product="ribosomal 40S subunit protein S23B"
                     /transcript_id="XM_018879106.1"
                     /db_xref="GeneID:30034059"
     CDS             588233..588670
                     /gene="RPS23B"
                     /locus_tag="AWJ20_2177"
                     /inference="similar to AA sequence:KEGG_Orthology:K02973"
                     /note="Ribosomal protein 28 (rp28) of the small (40S)
                     ribosomal subunit; required for translational accuracy;
                     homologous to mammalian ribosomal protein S23 and
                     bacterial S12; RPS23B has a paralog, RPS23A, that arose
                     from the whole genome duplication; deletion of both RPS23A
                     and RPS23B is lethal; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0022627 - cytosolic
                     small ribosomal subunit [Evidence IDA] [PMID 6814480];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0005840 - ribosome
                     [Evidence IEA,IEA]; GO_component: GO:0015935 - small
                     ribosomal subunit [Evidence IEA]; GO_function: GO:0003735
                     - structural constituent of ribosome [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IDA] [PMID 6814480]; GO_process:
                     GO:0000462 - maturation of SSU-rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IGI]
                     [PMID 16246728]; GO_process: GO:0006450 - regulation of
                     translational fidelity [Evidence IGI,IMP] [PMID 8415737];
                     GO_process: GO:0006450 - regulation of translational
                     fidelity [Evidence IGI,IMP] [PMID 8950190]; GO_process:
                     GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="ribosomal 40S subunit protein S23B"
                     /protein_id="XP_018737054.1"
                     /db_xref="GeneID:30034059"
                     /translation="MGKGKPRGLNSARKLRTTRRDNRWADLSYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            complement(<589164..>590843)
                     /gene="RRP9"
                     /locus_tag="AWJ20_2178"
                     /db_xref="GeneID:30034060"
     mRNA            complement(<589164..>590843)
                     /gene="RRP9"
                     /locus_tag="AWJ20_2178"
                     /product="Rrp9p"
                     /transcript_id="XM_018879107.1"
                     /db_xref="GeneID:30034060"
     CDS             complement(589164..590843)
                     /gene="RRP9"
                     /locus_tag="AWJ20_2178"
                     /inference="similar to AA sequence:KEGG_Orthology:K14793"
                     /note="Protein involved in pre-rRNA processing; associated
                     with U3 snRNP; component of small ribosomal subunit (SSU)
                     processosome; ortholog of the human U3-55k protein;
                     GO_component: GO:0030686 - 90S preribosome [Evidence IDA]
                     [PMID 12150911]; GO_component: GO:0031428 - box C/D snoRNP
                     complex [Evidence IDA] [PMID 11081632]; GO_component:
                     GO:0005730 - nucleolus [Evidence IEA]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 12150911];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0032040 - small-subunit
                     processome [Evidence IDA] [PMID 12068309]; GO_function:
                     GO:0030515 - snoRNA binding [Evidence IPI] [PMID
                     11105764]; GO_process: GO:0000154 - rRNA modification
                     [Evidence TAS] [PMID 10690410]; GO_process: GO:0006364 -
                     rRNA processing [Evidence IEA]; GO_process: GO:0006364 -
                     rRNA processing [Evidence TAS] [PMID 10690410];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Rrp9p"
                     /protein_id="XP_018737055.1"
                     /db_xref="GeneID:30034060"
                     /translation="MVDSFFVNPTKRRKTASSSGGSGSNKRAATSNGIRKNGPSRVNG
                     RSNNKSQNGRASDDENNDDEGLESDDLDSDVSMEDDDNVNSDDSEDEFGNETEADKRR
                     RLAKQYLENIQTELTEAGDDAFDAKDLDREIISRRLKEDVAETVGKVYRFIGDSFDFK
                     SVSPKNGTAQLIQAKAYGITSVATNYPFAYTTSKDLTLTKWDISNAKKPRVVRFVKGN
                     HRVKTPEERETFKGHFDEILCVAASSDGKYVVTGGRDRRLVVWSAESLAPIKVFETRD
                     RKGVVMGLVFRRNTNELYASCADLKVRTFNLDQLAQVEILFGHQDEVADIAALGQERC
                     VSVGSRDRTAIIWKIAEETRLTFRGADTVSGSTSNKSGSKSKVNDSGYDAYAPTKKIL
                     EGSIDCCSMIDDQLFVTGSDNGNVSLWSVNKKKPLFVLREAHGRDESLLPDQVSAETA
                     AGVSVPPPPALPRYITSIYAIPFSDTFFTGSWDGQIRAWKLSADLRTFEPLATVSGAS
                     GIVNRISVVETGSKGKETFTIVGAVAKELRLGRWLKVKGKNGLFTATIARK"
     gene            complement(<593497..>595758)
                     /locus_tag="AWJ20_2179"
                     /db_xref="GeneID:30034061"
     mRNA            complement(<593497..>595758)
                     /locus_tag="AWJ20_2179"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879108.1"
                     /db_xref="GeneID:30034061"
     CDS             complement(593497..595758)
                     /locus_tag="AWJ20_2179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737056.1"
                     /db_xref="GeneID:30034061"
                     /translation="MQAARNLEKRFSLDSISSRIIARHWDQEQLDQLDQQQQNEPPFD
                     TSQPTQSHLKYQRPRPRQRQRRTQDLGQSLRDQNQDPSHILTHILDQNSPESSQQQEQ
                     QETQNSLSRNYNCHCTNSPCDCFVLLTKKIDMLQKDLNVAVEVGQALLKTHEDYVAES
                     QAEAAQMEESINSMTLNLQSVMRENDKLLVNNSELISQLHENSKALQESDSKIEKLSH
                     ELNSSKDRIIRLNTFMLQAKELEAQISSLEMIRQGLQDDLQQTEREKQLAELKWRKAE
                     RLLEKLTDQYEKLEEESVQSQKPTASRLAFLNDQSIKKTISDLQKNVLGANERANIPA
                     TSTPVKYKHETWSANTSSQQPQFPMLISPPSSGKRGRSHLRNSSKSTLNGQPLGPLYE
                     DESFREFFGDESADSSFPYYSSNQHDIKREYVLSSPLHSRQNSCLANEYRTASDNYGS
                     ASGKDSPLDSSSHEPIRNTVEFNNGLPTPNDTLEHEIDLPETQTSSDDINHEERMDES
                     INQDSDRSVTSNTESVESTPAGPSSPTDSIKSSASTATSIPSSALTPISPRYEPMLRR
                     AASHESIFSVFVETHLHNGHSRNSSTTTAAIDLSPALGPFSHKGLPSFYSQRTGVALA
                     EISTEMSLAPPSKLLNPEYSNSQRSRQLLFAAISNNTKQAVKIPARRNSIESSTTSDL
                     SGSSDQDRPSSSWASLFSRLRNPTSTTNTTPTSTPRSPADTLIAKILADPIQTHVLAS
                     PSDVSEAMNSTIL"
     gene            <598692..>602078
                     /gene="ALK2"
                     /locus_tag="AWJ20_2180"
                     /db_xref="GeneID:30034063"
     mRNA            <598692..>602078
                     /gene="ALK2"
                     /locus_tag="AWJ20_2180"
                     /product="protein kinase ALK2"
                     /transcript_id="XM_018879110.1"
                     /db_xref="GeneID:30034063"
     CDS             598692..602078
                     /gene="ALK2"
                     /locus_tag="AWJ20_2180"
                     /inference="similar to AA sequence:KEGG_Orthology:K16315"
                     /codon_start=1
                     /product="protein kinase ALK2"
                     /protein_id="XP_018737057.1"
                     /db_xref="GeneID:30034063"
                     /translation="MDTAVETKQRKKLFGHNRSGSLFQSFSSTTSKTYGKKKANPTLA
                     KAQAGFQQWSQIRAADASNANIINNSQASGPGPVLASGDDLEDDDADIQNDSRKEVHA
                     TTAPIGLGIDSLIPLEIDTSNKENISWEAETTEVLRKIRPTSKSSLRGINVNGVNPGG
                     AGSVTGSATTSATASINGEIAEDSPKQNRLSRLVRTISGLSTTSTSSKDTIDGTKLNR
                     NSTATVSRVSHRSSLSTIHRFSIGSTSSSTDATPVKPQSNRYSALLDVGNLRRSSVAN
                     NLSQILNNSDLDTDEEDEEDDMDEGTGKRAIPGIVVPFENDLEGSKKNRESWNDNYSK
                     QRTRPSSEYRDVSHDVGLLNIPSNYPPMASSNRMSYMSLRKPAPPALTISSTSPQSST
                     VTSPALSHYSNVSIPSISSGSGHSPLLSYKKETGSIKHKRVTKDSISGPTSLVNHQEF
                     FAPRPSFESDFDSYSNGRSASQPANTISGGPSSISTSVSSTGTSNSSASRTSRYGSSF
                     LTSITPHSSLLSLRSTKAKERSGTSTSDFVPNKSPTSAASISSSINLPASSSNTTAKS
                     STKSKHAHKLSLVNGFTKKPSIQDMKRYISFSPSSSSLFRNASNSPTNGSATMTKSPS
                     ILGDSFDKTMISLPIPVDGSREKLRNKLRASTSLLSLARSDTSGSLTVGIPIAEYEQS
                     QLQTLLSLCSCAEIEDFSDYIDHGYDNLEKLAEASFSEVFIQRSSNSSRILKIIPFGN
                     EELDQLPVQDIIQELTIARMLMPLDGYVDVLDSTIVRGTYPQRLLELWDDYDQQKRSE
                     NYRPDFFKHDQMYCIVVMANAGTDLEHFDLSSWQDAESIFWQVVQSLALAEEKFEFEH
                     RDLHWGNVVIEEVSKGVSQTTDLLNNLSLEDEQRNTSKRTNPKDKYGFRYDEDEADGE
                     IDDDLYEEKELKVTLIDYTLSRAMTDDGTVVFTRLDHPDFFRGKGDYQFDIYRFMRTF
                     IGGASASYLSPNPANHATQLASTSPGLGHPSPDLAKLNQQTNWSLFCPRTNILWLHYL
                     VDKLLNAKSLPRVSTTRSGRLSFGGGSNGSLRDAYLKGNNVSHNDEARACAALEIIHK
                     TLDPRKKRFGGKKHNSPMSFQDFSSARDVLRWGVRNKYVS"
     gene            <605132..>606229
                     /gene="CKB1"
                     /locus_tag="AWJ20_2181"
                     /db_xref="GeneID:30034064"
     mRNA            <605132..>606229
                     /gene="CKB1"
                     /locus_tag="AWJ20_2181"
                     /product="casein kinase 2 regulatory subunit CKB1"
                     /transcript_id="XM_018879111.1"
                     /db_xref="GeneID:30034064"
     CDS             605132..606229
                     /gene="CKB1"
                     /locus_tag="AWJ20_2181"
                     /inference="similar to AA sequence:KEGG_Orthology:K03115"
                     /note="Beta regulatory subunit of casein kinase 2 (CK2); a
                     Ser/Thr protein kinase with roles in cell growth and
                     proliferation; CK2, comprised of CKA1, CKA2, CKB1 and
                     CKB2, has many substrates including transcription factors
                     and all RNA polymerases; GO_component: GO:0034456 - UTP-C
                     complex [Evidence IDA] [PMID 17515605]; GO_component:
                     GO:0005956 - protein kinase CK2 complex [Evidence IEA];
                     GO_component: GO:0005956 - protein kinase CK2 complex
                     [Evidence IDA] [PMID 8135547]; GO_function: GO:0019887 -
                     protein kinase regulator activity [Evidence IEA];
                     GO_function: GO:0019887 - protein kinase regulator
                     activity [Evidence IMP] [PMID 11827175]; GO_function:
                     GO:0019887 - protein kinase regulator activity [Evidence
                     IPI] [PMID 8135547]; GO_function: GO:0030291 - protein
                     serine/threonine kinase inhibitor activity [Evidence IDA]
                     [PMID 18265947]; GO_process: GO:0006974 - cellular
                     response to DNA damage stimulus [Evidence IDA] [PMID
                     11551505]; GO_process: GO:0006468 - protein
                     phosphorylation [Evidence IMP] [PMID 16607517];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IDA] [PMID 16952051]; GO_process: GO:0045859 - regulation
                     of protein kinase activity [Evidence IEA]; GO_process:
                     GO:0006356 - regulation of transcription from RNA
                     polymerase I promoter [Evidence IDA] [PMID 11551505];
                     GO_process: GO:0006359 - regulation of transcription from
                     RNA polymerase III promoter [Evidence IDA] [PMID
                     11551505]"
                     /codon_start=1
                     /product="casein kinase 2 regulatory subunit CKB1"
                     /protein_id="XP_018737058.1"
                     /db_xref="GeneID:30034064"
                     /translation="MSNLRDTPEKQPQRQQQATAAAAAAFRQVDRPGASNASASSLAS
                     STKNASNVKREPTLSSTQQPPSNIEEDEEEEEEEEEIQDGTAGATGAAGDKYNFMFDE
                     SDDASSGSLDFESWIKSFCSIVGHEFFAEVSEEFIEDDFNLTGLGPLIPHYKEALELI
                     LDLEPETPPKLPTIPIIEQSAEQLYGMIHARFILSRPGLQIMAQKFHYQQFGTCPRYF
                     CHGTGLLPVGRHDMPGFETVRLYCPCCMDIYVPPNSRFLSIDGAFFGTSFPGLFLKAY
                     PEIEKECARRRKQQGQFELTIYGFKIAESSKSGSRMKWLRQVPVNDSELDEHVSEIQD
                     GARSISSSSHNNPTNTNDNESMMSISMNGET"
     gene            complement(<606784..>607383)
                     /gene="JAC1"
                     /locus_tag="AWJ20_2182"
                     /db_xref="GeneID:30034065"
     mRNA            complement(<606784..>607383)
                     /gene="JAC1"
                     /locus_tag="AWJ20_2182"
                     /product="Jac1p"
                     /transcript_id="XM_018879112.1"
                     /db_xref="GeneID:30034065"
     CDS             complement(606784..607383)
                     /gene="JAC1"
                     /locus_tag="AWJ20_2182"
                     /inference="similar to AA sequence:KEGG_Orthology:K04082"
                     /note="Specialized J-protein that functions in Fe-S
                     cluster biogenesis; functions with Hsp70 in Fe-S cluster
                     biogenesis in mitochondria; involved in iron metabolism;
                     contains a J domain typical to J-type chaperones;
                     localizes to the mitochondrial matrix; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 11278728]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0051087 - chaperone binding [Evidence IEA];
                     GO_function: GO:0051087 - chaperone binding [Evidence IMP]
                     [PMID 11278728]; GO_function: GO:0051087 - chaperone
                     binding [Evidence ISS] [PMID 9813017]; GO_process:
                     GO:0009060 - aerobic respiration [Evidence IMP] [PMID
                     9813017]; GO_process: GO:0016226 - iron-sulfur cluster
                     assembly [Evidence IMP] [PMID 11278728]; GO_process:
                     GO:0006457 - protein folding [Evidence IEA]; GO_process:
                     GO:0051259 - protein oligomerization [Evidence IEA];
                     GO_process: GO:0006950 - response to stress [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Jac1p"
                     /protein_id="XP_018737059.1"
                     /db_xref="GeneID:30034065"
                     /translation="MRTVSVSTRLLQTFTKRFATKAGGESGYYSFFPQSFPNGPPPKG
                     PFEINAKQLKQEFLKLQAQTHPDKAGSVDPNNELRKKFELRSSQLNIAYKSLLNPLDR
                     AQHLLLLRGIDALSERDSLQDEDLLMDVLMAREAIADSNSREDLLSLQQENDKRLSES
                     ETALISAFSEDDLESAKNETIRLSYWQNIKNQISDALNQ"
     gene            complement(<609663..>611222)
                     /gene="HXT13"
                     /locus_tag="AWJ20_2183"
                     /db_xref="GeneID:30034066"
     mRNA            complement(<609663..>611222)
                     /gene="HXT13"
                     /locus_tag="AWJ20_2183"
                     /product="hexose transporter HXT13"
                     /transcript_id="XM_018879113.1"
                     /db_xref="GeneID:30034066"
     CDS             complement(609663..611222)
                     /gene="HXT13"
                     /locus_tag="AWJ20_2183"
                     /inference="similar to AA sequence:KEGG_Orthology:K08139"
                     /codon_start=1
                     /product="hexose transporter HXT13"
                     /protein_id="XP_018737060.1"
                     /db_xref="GeneID:30034066"
                     /translation="MTIEEKNEVHMVEDIRPEGETMEDVLPDYGKFAFLRVPHLLRLN
                     LLLLLCMISSTNNGYDGSMLNGLQSMDSWQDTFNHPKGQHLGGLANGMMFGGIATWPI
                     LPYITDRWGRKLPIAGGCVLIIVGAIIQAVSNDYAVFLVGRLILGFGSSFCTGCSPLL
                     LAESSYPAHRHVVTAIYNTLWYLGSIIAAWLTLGTSYVTTTWSWRIPCICQGFLPLIQ
                     LLMIYWVPESPRYLIDKHRYAEARALLVKHHAGGDVNSKLVDYEMAEISSALELEKIQ
                     NETSYLDFLKTKANKHRLFLIIMIPINMQMSGNGLVSYYLNLVLDSIGITDQRQQLYL
                     NGGLQIYNFFWAVFWTFFVESLGRRRLFLISFSGMLVTYIIWTALSGAGTPSNFANKS
                     LANGVLAMIFLYYFCYGIALNGPAVLYYTEILPYQLRAKGLNITQIVTTLTLIYNGFV
                     NPVAMDAIGWKYYIVWCCVIAVELVICYFFYPETKGHTLETVGSVFGEEVHVTSDLGV
                     GLGRENEKPVA"
     gene            <615264..>616211
                     /locus_tag="AWJ20_2184"
                     /db_xref="GeneID:30034067"
     mRNA            <615264..>616211
                     /locus_tag="AWJ20_2184"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879114.1"
                     /db_xref="GeneID:30034067"
     CDS             615264..616211
                     /locus_tag="AWJ20_2184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737061.1"
                     /db_xref="GeneID:30034067"
                     /translation="MTSPKYNCLTQEQVDHFLEKGYVVIHDAFSKEHAAWMLKDVWVR
                     LGLDPNNRESWTKPRIHMPKQRSILVSEFAPKAWDAIKDLLGGDENIADAGKYWNDSL
                     IVNFGRDQFEPHLVSGDPKQLDNWHTDGNFFRHFLDSPEQALLVIPIFSDEIKPKGGA
                     TYIAPDSIPHIAKLLDDHPEGLLPGKPFNYPELVNKCNEFVEVTGKVGDVVLMHPFMM
                     HSASPNQLRIPRFITNPPVSLKTPFRFDRPLDQLNLVEQKTLKSLGKSSPYHFKPTAD
                     RVIFPSEQHDMWIRMQNEEKQRLKDYGTLESFTAIGVKP"
     gene            complement(<616842..>617744)
                     /gene="YHI9"
                     /locus_tag="AWJ20_2185"
                     /db_xref="GeneID:30034068"
     mRNA            complement(<616842..>617744)
                     /gene="YHI9"
                     /locus_tag="AWJ20_2185"
                     /product="Yhi9p"
                     /transcript_id="XM_018879115.1"
                     /db_xref="GeneID:30034068"
     CDS             complement(616842..617744)
                     /gene="YHI9"
                     /locus_tag="AWJ20_2185"
                     /note="hypothetical protein; null mutant is defective in
                     unfolded protein response; possibly involved in a membrane
                     regulation metabolic pathway; member of the PhzF
                     superfamily, though most likely not involved in phenazine
                     production; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016853 -
                     isomerase activity [Evidence IEA]; GO_function: GO:0003674
                     - molecular_function [Evidence ND]; GO_process: GO:0009058
                     - biosynthetic process [Evidence IEA]; GO_process:
                     GO:0030968 - endoplasmic reticulum unfolded protein
                     response [Evidence IMP] [PMID 16582425]"
                     /codon_start=1
                     /product="Yhi9p"
                     /protein_id="XP_018737062.1"
                     /db_xref="GeneID:30034068"
                     /translation="MTTAPFTTVDVFSDTRFLGNQLAIVELAGENTDLSTDNLQQIAR
                     EFNYSETIYIYPPSTANTYPVRIFTPDTELPFAGHPTIGAADHVIGLVTAGTSSATLV
                     PPAGPIPVQKSSDGVVRAHIPHNVHFHKATAKDLPDPVGFSSDPVIAEAERNAPLFSI
                     VKGLSFALIRLPSVEVLSRVKMSSTPLNLAPLLDHEWNSGFVGQLYYVLEDEHTVRAR
                     MILLDQFEDPATGSANSALGAYLALTTGKNQNIQVTQGVEIGRRSVIGVEVELDGDKI
                     NTLILSGKTVKVTKGDIIVSADKL"
     gene            <618341..>619315
                     /gene="HIS6"
                     /locus_tag="AWJ20_2186"
                     /db_xref="GeneID:30034069"
     mRNA            <618341..>619315
                     /gene="HIS6"
                     /locus_tag="AWJ20_2186"
                     /product="imidazole-4-carboxamide isomerase HIS6"
                     /transcript_id="XM_018879116.1"
                     /db_xref="GeneID:30034069"
     CDS             618341..619315
                     /gene="HIS6"
                     /locus_tag="AWJ20_2186"
                     /inference="similar to AA sequence:KEGG_Orthology:K01814"
                     /codon_start=1
                     /product="imidazole-4-carboxamide isomerase HIS6"
                     /protein_id="XP_018737063.1"
                     /db_xref="GeneID:30034069"
                     /translation="MLDSSAARGATGSGAEPQPPEAETPLPAAGLILSFRICTRYMQH
                     EETEDRVISRVIKYQIRRAMTKFRGCIDIHNGQVKQIVGGTLTSAESQLKTNFVATQP
                     AEYFGRLYRKNEVYGTHVIKLGPGCDEAAEEALAEWPGQLQVGGGITAENAQSWIQEK
                     KASKVIVTSYLFPDGKLSIPRLEKLVSLVGKEHLVIDLSCRKKIVDGEPRWIVAMNRW
                     QTLTDTEVNKSTLDELSRYCSEFLIHAADVEGLCRGIDEDLVAALGNWVTIPTVYAGG
                     AKSLNDLELVAKLSHGKVDLTFGSALDIFGGDKVAFSSCVAWNQSQSQ"
     gene            complement(<619501..>620109)
                     /gene="RPB3"
                     /locus_tag="AWJ20_2187"
                     /db_xref="GeneID:30034070"
     mRNA            complement(<619501..>620109)
                     /gene="RPB3"
                     /locus_tag="AWJ20_2187"
                     /product="DNA-directed RNA polymerase II core subunit
                     RPB3"
                     /transcript_id="XM_018879117.1"
                     /db_xref="GeneID:30034070"
     CDS             complement(619501..620109)
                     /gene="RPB3"
                     /locus_tag="AWJ20_2187"
                     /inference="similar to AA sequence:KEGG_Orthology:K03011"
                     /note="RNA polymerase II third largest subunit B44; part
                     of central core; similar to prokaryotic alpha subunit;
                     GO_component: GO:0005665 - DNA-directed RNA polymerase II,
                     core complex [Evidence IDA] [PMID 1331084]; GO_component:
                     GO:0005665 - DNA-directed RNA polymerase II, core complex
                     [Evidence IDA] [PMID 2183013]; GO_component: GO:0005665 -
                     DNA-directed RNA polymerase II, core complex [Evidence
                     IDA] [PMID 2186966]; GO_component: GO:0005654 -
                     nucleoplasm [Evidence IDA] [PMID 15520468]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_function:
                     GO:0003677 - DNA binding [Evidence IEA]; GO_function:
                     GO:0003899 - DNA-directed RNA polymerase activity
                     [Evidence IEA,IEA]; GO_function: GO:0001055 - RNA
                     polymerase II activity [Evidence IDA] [PMID 8288647];
                     GO_function: GO:0003968 - RNA-directed RNA polymerase
                     activity [Evidence IDA] [PMID 18004386]; GO_function:
                     GO:0046872 - metal ion binding [Evidence IEA];
                     GO_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA]; GO_process: GO:0006369 - termination of
                     RNA polymerase II transcription [Evidence IMP] [PMID
                     16537912]; GO_process: GO:0006366 - transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 2685562];
                     GO_process: GO:0006351 - transcription, DNA-templated
                     [Evidence IEA]"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase II core subunit
                     RPB3"
                     /protein_id="XP_018737064.1"
                     /db_xref="GeneID:30034070"
                     /translation="MEIYTRDLVVHLPKDGRRDESIGQPVFSDPAKKGVLICKLRKHQ
                     ELRLKCIAKKGIAKEHAKWSPVAAVGFEYDPWNKLHHTDYWYEESIEEEWPKSKNADW
                     EEPPKENEPFDYTAKPDKFYYTVETVGSLKPNEVVERGIRVLQNKLAEIVLAVDKLDG
                     RGPGMDLGGGATGRHGGATDYGGATTNMGNYGSPRMDGNQWF"
     gene            complement(<621866..>623555)
                     /locus_tag="AWJ20_2188"
                     /db_xref="GeneID:30034071"
     mRNA            complement(join(<621866..622651,623514..>623555))
                     /locus_tag="AWJ20_2188"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879118.1"
                     /db_xref="GeneID:30034071"
     CDS             complement(join(621866..622651,623514..623555))
                     /locus_tag="AWJ20_2188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737065.1"
                     /db_xref="GeneID:30034071"
                     /translation="MSMYIWSHISHVRVSANNYAGQQPSVTPGYPNYASSGTVPQQPA
                     AATSSVASVPAPATAPVNQGVPSVPAVPQQATETASAVPAVPAVSTQTPAASNSVPAA
                     ATAPSVSSNNGGDASVQGTHAGRGDSGASSRPKHNNRNGQGQKPKVVLPEFNFDASNA
                     KFSKEDITKEESVIPKAPAEGFYDKKSSFFDNISSTTKEQIEGSSDNKTAYQRRGEER
                     QLNMETFGQAESNHGNWRGGRGGRGRGRGGHRGRGNGNWRGGRGGFNNNNNNSNNFS"
     gene            complement(<623783..>623877)
                     /locus_tag="AWJ20_2189"
                     /db_xref="GeneID:30034072"
     tRNA            complement(<623783..>623877)
                     /locus_tag="AWJ20_2189"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:30034072"
     gene            <625411..>625941
                     /gene="NAT3"
                     /locus_tag="AWJ20_2190"
                     /db_xref="GeneID:30034074"
     mRNA            <625411..>625941
                     /gene="NAT3"
                     /locus_tag="AWJ20_2190"
                     /product="Nat3p"
                     /transcript_id="XM_018879120.1"
                     /db_xref="GeneID:30034074"
     CDS             625411..625941
                     /gene="NAT3"
                     /locus_tag="AWJ20_2190"
                     /inference="similar to AA sequence:KEGG_Orthology:K17972"
                     /note="Catalytic subunit of the NatB N-terminal
                     acetyltransferase; NatB catalyzes acetylation of the
                     amino-terminal methionine residues of all proteins
                     beginning with Met-Asp or Met-Glu and of some proteins
                     beginning with Met-Asn or Met-Met; GO_component:
                     GO:0031416 - NatB complex [Evidence IDA] [PMID 12783868];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA,IEA];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_function: GO:0008080 - N-acetyltransferase
                     activity [Evidence IEA]; GO_function: GO:0004596 - peptide
                     alpha-N-acetyltransferase activity [Evidence IEA];
                     GO_function: GO:0004596 - peptide
                     alpha-N-acetyltransferase activity [Evidence IMP,ISS]
                     [PMID 10545125]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016746 -
                     transferase activity, transferring acyl groups [Evidence
                     IEA]; GO_process: GO:0017196 - N-terminal
                     peptidyl-methionine acetylation [Evidence IMP] [PMID
                     10545125]; GO_process: GO:0007010 - cytoskeleton
                     organization [Evidence IGI,IMP] [PMID 12808144];
                     GO_process: GO:0000001 - mitochondrion inheritance
                     [Evidence IGI,IMP] [PMID 12808144]"
                     /codon_start=1
                     /product="Nat3p"
                     /protein_id="XP_018737066.1"
                     /db_xref="GeneID:30034074"
                     /translation="MTTPASRTSQTLIADRPESKMTSITPLKATDLLSLNSINLDVLT
                     ENYHLGFYLQYLSDWPAMFFKSTNPADRCTGYMMGKSEGRGLEWHSHITAVTVDCDYR
                     RLGIAKDLVDHLVTCSEESTQDCYFMDLYVRATNRLAIDMYKKFGFSVFRRVVAYYSM
                     GEPSDDGEDAFGKYHQ"
     gene            <626823..>627266
                     /locus_tag="AWJ20_2191"
                     /db_xref="GeneID:30034075"
     mRNA            <626823..>627266
                     /locus_tag="AWJ20_2191"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_018879121.1"
                     /db_xref="GeneID:30034075"
     CDS             626823..627266
                     /locus_tag="AWJ20_2191"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_018737067.1"
                     /db_xref="GeneID:30034075"
                     /translation="MSRLTVDSAADGLSSTQNLLDSTRQLLGKGLGSHLTGNVDDLIE
                     GNATVVLDVLLLLSVSWGFLKSSDEERRGRGNNRDSGLTVLDGQLNSDTDTLEVLGGL
                     GDIFTDLLGGETKRTDLGGKSGRSTNFTTDSTEEEDFNFVGVDLN"
     gene            complement(<628197..>631256)
                     /gene="UBA1"
                     /locus_tag="AWJ20_2192"
                     /db_xref="GeneID:30034076"
     mRNA            complement(<628197..>631256)
                     /gene="UBA1"
                     /locus_tag="AWJ20_2192"
                     /product="E1 ubiquitin-activating protein UBA1"
                     /transcript_id="XM_018879122.1"
                     /db_xref="GeneID:30034076"
     CDS             complement(628197..631256)
                     /gene="UBA1"
                     /locus_tag="AWJ20_2192"
                     /inference="similar to AA sequence:KEGG_Orthology:K03178"
                     /note="Ubiquitin activating enzyme (E1); involved in
                     ubiquitin-mediated protein degradation and essential for
                     viability; protein abundance increases in response to DNA
                     replication stress; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 7629121]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 22842922];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     7629121]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_function: GO:0008641 - small
                     protein activating enzyme activity [Evidence IEA];
                     GO_function: GO:0004839 - ubiquitin activating enzyme
                     activity [Evidence IDA] [PMID 1989885]; GO_process:
                     GO:0006464 - cellular protein modification process
                     [Evidence IEA]; GO_process: GO:0016567 - protein
                     ubiquitination [Evidence IEA]; GO_process: GO:0016567 -
                     protein ubiquitination [Evidence IDA] [PMID 1989885]"
                     /codon_start=1
                     /product="E1 ubiquitin-activating protein UBA1"
                     /protein_id="XP_018737068.1"
                     /db_xref="GeneID:30034076"
                     /translation="MNVDAEAPSGEIDEGLYSRQLYVLGRDAMKRMAQSNVLIVGLKG
                     LGAEIAKNVTLAGVKSIALYDPGAVKIEDLSSQFFLYESDVGSGKSRAELTAPRLSEL
                     NQYVPVSVVDGELTEDVLAKFQVVVLTNTDIETQVKINSFTHANNINFISTDIRGLFG
                     SVFVDFGDKFQVFDPTGEEPQSGIISAIEPDGTVAALDETRHGLEDGDWVKFTEVEGL
                     EALNDGQPREVKVTGPYTFNIGDVSGLGSYVKGGIFTQVKKPLELSFQSLADQLAKPE
                     YLVTDFAKFDRPAQLHIGFLALHGFANQHGGELPRPYNKEDANQVAHLAKSVAAQYPE
                     VLGETAIDEDLIRKLSFQSRGDYAPLAAVFGGLVAQEVLKACSGKFVPVRQFSYFDSL
                     ESLPSKEEITEEDAAPSGSRYDGNVAIFGKKFVEKLRNLKVFLVGSGAIGCEMLKNWA
                     LLGVGSGPEGRIIVTDNDSIEKSNLNRQFLFRPSDVGKQKSSVAAAAVVKINPDLKGK
                     IEARSDKVGPETEDIFNDKFWNSLDFVTNALDNVDARTYVDRRCVFFRKPLLESGTLG
                     TKGNVQVVYPDLTESYSSSQDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFVDSA
                     ENVNLYLSQPNFVESHLKQSGDQKTILETIYSFLVSDRPLTFEQCIAWARLEFEKKFN
                     NDIQQLLYNFPKDAVTSTGTPFWSGPKRAPTPLKFDINNEDHFNFIVAGANLHAFNYG
                     LKSDVSTREEYTRVLQTISVPEFKPRSGVSIQANDNDPVPEANLGDDQDEIQKLAQSL
                     PPPASLAGFRLIPVEFEKDDDTNYHIDFITAGSNLRALNYGIDPADKSKTKFIAGRII
                     PAIATTTSLVTGLVCLELTKVVDGENKTIEDFKNGFINLALPFFGFSEPIASAKIKYN
                     DKEIDKIWGRFDVHNKDITLKELIEHFKTEEGLEINMLSTGTTLLYASFHPASKKKER
                     LGLKLRDLVEQVSKKPIPPHTETMIFEIVADDSEGEDVEVPFITLHL"
     gene            <632569..>632672
                     /locus_tag="AWJ20_2193"
                     /db_xref="GeneID:30034077"
     tRNA            <632569..>632672
                     /locus_tag="AWJ20_2193"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:30034077"
     gene            complement(<635302..>636210)
                     /locus_tag="AWJ20_2194"
                     /db_xref="GeneID:30034078"
     mRNA            complement(join(<635302..635914,636185..>636210))
                     /locus_tag="AWJ20_2194"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879123.1"
                     /db_xref="GeneID:30034078"
     CDS             complement(join(635302..635914,636185..636210))
                     /locus_tag="AWJ20_2194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737069.1"
                     /db_xref="GeneID:30034078"
                     /translation="MLPAPTLWKLETAPVGAPQEVAGAELAGGGGAADEAAADEAAAD
                     EAAADEAAADEAAADEAAADEAAADEAAADEAAADEAAADEAAAEEAAAEEAAAEEAA
                     ADEAAAEEAAADEAAADEAAAEEAAAEEAAAEEAAADEAAADEAAAEEAAADDEGAAD
                     DEGAADDEQALLDGLGLEAIVTEYLLAAAAKAASILEKSLITSAKTEQSNLS"
     gene            complement(<637869..>637979)
                     /locus_tag="AWJ20_2195"
                     /db_xref="GeneID:30034079"
     tRNA            complement(<637869..>637979)
                     /locus_tag="AWJ20_2195"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:30034079"
     gene            <638621..>639715
                     /locus_tag="AWJ20_2196"
                     /db_xref="GeneID:30034080"
     mRNA            <638621..>639715
                     /locus_tag="AWJ20_2196"
                     /product="reverse transcriptase"
                     /transcript_id="XM_018879124.1"
                     /db_xref="GeneID:30034080"
     CDS             638621..639715
                     /locus_tag="AWJ20_2196"
                     /codon_start=1
                     /product="reverse transcriptase"
                     /protein_id="XP_018737070.1"
                     /db_xref="GeneID:30034080"
                     /translation="MHVDNQRTSKKRQLRLVLPSGERRQASPTLKLLGVTLDSQWKFS
                     KHVEAIAIKGKMVLGIIRRLGGITWGVTGASMRNLYQGCVRPILEYASPVWYPKITKQ
                     EREQLQRIQNTGLRAILGGYHQTPIDCLHRDTDIMPLEQRYDTLQDNYIVRLHRNVDP
                     ENPVNAESTWWRKHMEHNELVQRLYEVLPKEEIFQDRIRRRKPPWKKEDMESESKAWK
                     VKSELKKKIYQRHHTIWETQYRTSAKGEFYRSYTLPRLYNADHKNPLRYFLNECSKNE
                     LSKLVQLRTAKGAFGMFFKRFKINNRPHQCECGEEEDVKHLLCECPVTENHRQILRDA
                     SATLDIKVLLDSKKGLKAVLAFLAKAPQLL"
     gene            complement(<641223..>644366)
                     /gene="POL92"
                     /locus_tag="AWJ20_2197"
                     /db_xref="GeneID:30034081"
     mRNA            complement(<641223..>644366)
                     /gene="POL92"
                     /locus_tag="AWJ20_2197"
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 3"
                     /transcript_id="XM_018879125.1"
                     /db_xref="GeneID:30034081"
     CDS             complement(641223..644366)
                     /gene="POL92"
                     /locus_tag="AWJ20_2197"
                     /note="allele of CaO19.8194"
                     /codon_start=1
                     /product="polyprotein of L1-like non-LTR retrotransposon
                     Zorro 3"
                     /protein_id="XP_018737071.1"
                     /db_xref="GeneID:30034081"
                     /translation="MFADFDLLLLQEPGLNLGQHPIQHSAWVAVHTQSQTGRINAITY
                     INKRIYGQSQLKMVGELTTENVVTIQIGQLYITNIYNRISEDIHPVEYYKTLLPQIPE
                     LIIIAGDFNLHHPMWQSTEHVTREANSWADWVNDNGLLLATVPNVPTHIFGNTIDLTF
                     TTPNITITPEKSEDVGSDHYLQKWRIDTNPLAIELLQTYGGRYNYKRADWENFEKVLN
                     SRAAMVTIPKELRGYSNGKSTHKVADRYASKLIGLLCNCLDETVPKLKIVPRSKRWWT
                     PELRQAKRDVGRARRRARSKPTEENIRLRQQANEEYASKILEAKNTTWNSFLASRRGG
                     EIYDAHKMIKPREQESVMPALRLETGELAQTFEEQEDELYRGLFPHVTPSTRRVLKVV
                     KTGQWKSLRTQEIEDAIRDQAPHKAPGPDGVKTVAIKRAWVVKRFRKLLKGLLKYCIR
                     VGYHPKCFREGITVVIPKRKRDPTLARSYRPITLLSTLGKVLEKIMQRRLTALTSGML
                     PVDQYGGRHGSSAVEAAHKLVHHAEKRMKRGQVTSVLAIDIKGAFDHVHRDTLLDTMG
                     GMGLPTAVQNWVYQFMRGRRTSLVIDGKRTKERRIATGIPQGSPISPLLFLIYTSPLY
                     PLIKSMGGKVIGFIDDITIYVSSTRYAENTAKLSNILARCHEWATSAHAFIDYGEKLG
                     FMHIAKRVTPKGCRRLILPTGERIQATGSLRLLGVTIDRQLKFDEHAKSVISKGQSAL
                     NIIRRLGGVTRGVTGATMRCLYKSCVRPILEYASPIWYNRIGKGLKEAIQRIQNAALR
                     SILGAYKPTAIDSLHRDAEIPPVEHRMLETEQYYLVRLHRDLHRYNPHRIRARKLYSG
                     TILGDRLDELYRTVEATDIKKDRYRLWKPPWASRDSEAISKASSQKKSIRKEIRSQCY
                     QKWEIEYTQSPKGAFYRSFTAPRLYSTKHANALRPFLYESPRGELSKLVQLRTGMGAM
                     GSFFQRFRISNRRYDCRCGVEETVEHILRDCPLTEEHRQILREASRELDLPSLLDTRK
                     GLKAVASFLKANPSLLS"
     gene            <646666..>646739
                     /locus_tag="AWJ20_2198"
                     /db_xref="GeneID:30034082"
     tRNA            <646666..>646739
                     /locus_tag="AWJ20_2198"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:30034082"
     gene            <648850..>649974
                     /gene="BAT1"
                     /locus_tag="AWJ20_2199"
                     /db_xref="GeneID:30034083"
     mRNA            <648850..>649974
                     /gene="BAT1"
                     /locus_tag="AWJ20_2199"
                     /product="branched-chain-amino-acid transaminase BAT1"
                     /transcript_id="XM_018879126.1"
                     /db_xref="GeneID:30034083"
     CDS             648850..649974
                     /gene="BAT1"
                     /locus_tag="AWJ20_2199"
                     /inference="similar to AA sequence:KEGG_Orthology:K00826"
                     /note="Mitochondrial branched-chain amino acid (BCAA)
                     aminotransferase; preferentially involved in BCAA
                     biosynthesis; homolog of murine ECA39; highly expressed
                     during logarithmic phase and repressed during stationary
                     phase; BAT1 has a paralog, BAT2, that arose from the whole
                     genome duplication; GO_component: GO:0005759 -
                     mitochondrial matrix [Evidence IEA]; GO_component:
                     GO:0005759 - mitochondrial matrix [Evidence IDA] [PMID
                     8798704]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0052656 -
                     L-isoleucine transaminase activity [Evidence IEA];
                     GO_function: GO:0052654 - L-leucine transaminase activity
                     [Evidence IEA]; GO_function: GO:0052655 - L-valine
                     transaminase activity [Evidence IEA]; GO_function:
                     GO:0004084 - branched-chain-amino-acid transaminase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004084 -
                     branched-chain-amino-acid transaminase activity [Evidence
                     IDA] [PMID 8798704]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0008483 -
                     transaminase activity [Evidence IEA]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0019509 - L-methionine salvage from
                     methylthioadenosine [Evidence IEA]; GO_process: GO:0009082
                     - branched-chain amino acid biosynthetic process [Evidence
                     IEA]; GO_process: GO:0009082 - branched-chain amino acid
                     biosynthetic process [Evidence IDA,IMP] [PMID 8798704];
                     GO_process: GO:0009083 - branched-chain amino acid
                     catabolic process [Evidence IMP] [PMID 8702755];
                     GO_process: GO:0009081 - branched-chain amino acid
                     metabolic process [Evidence IEA]; GO_process: GO:0008652 -
                     cellular amino acid biosynthetic process [Evidence IEA];
                     GO_process: GO:0009097 - isoleucine biosynthetic process
                     [Evidence IEA]; GO_process: GO:0009098 - leucine
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0009099 - valine biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="branched-chain-amino-acid transaminase BAT1"
                     /protein_id="XP_018737072.1"
                     /db_xref="GeneID:30034083"
                     /translation="MTVTYSELSAKGLVIEKHPNPTQFENHSDLPSSRATDYLLEVTW
                     TIDQGWGTPSLHPYGPLSLDPASSVLHYATTCFEGMKAYRSFDGKKVTLFRPLDNINR
                     LNDSCARASLPQLEPNAALALLEKFVEMEARFIAPGSFIYLRPMVMGTNAHLGLTTPT
                     EAKFLIMASMMPKLNAAPLKLCSSPPDQIRAWKGGFGYAKLGANYGPTLKANNEAIKN
                     GFSQVLWLMGEEGIVTEAGGANFFAVIKNEKTGKDEIMTCPLTTGVILPGVTRRSVLE
                     LLRNKYTSEGVEVNEKEFTISDIEKASDEGRLVEAFAVGTAYFIAPVQTIRTPAGKDI
                     SVPMSIGTSGDYAHYIKETLSQIMWSKVEHPWSHPVASAQ"
     gene            complement(<650082..>651068)
                     /gene="ZTA1"
                     /locus_tag="AWJ20_2200"
                     /db_xref="GeneID:30034086"
     mRNA            complement(<650082..>651068)
                     /gene="ZTA1"
                     /locus_tag="AWJ20_2200"
                     /product="Zta1p"
                     /transcript_id="XM_018879129.1"
                     /db_xref="GeneID:30034086"
     CDS             complement(650082..651068)
                     /gene="ZTA1"
                     /locus_tag="AWJ20_2200"
                     /inference="similar to AA sequence:KEGG_Orthology:K00344"
                     /note="NADPH-dependent quinone reductase; GFP-tagged
                     protein localizes to the cytoplasm and nucleus; has
                     similarity to E. coli quinone oxidoreductase and to human
                     zeta-crystallin; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 14562095]; GO_function:
                     GO:0032440 - 2-alkenal reductase [NAD(P)] activity
                     [Evidence IDA] [PMID 21276778]; GO_function: GO:0017091 -
                     AU-rich element binding [Evidence IDA] [PMID 17497241];
                     GO_function: GO:0017091 - AU-rich element binding
                     [Evidence IDA] [PMID 19007762]; GO_function: GO:0003960 -
                     NADPH:quinone reductase activity [Evidence IEA];
                     GO_function: GO:0003960 - NADPH:quinone reductase activity
                     [Evidence IDA] [PMID 17497241]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0034599 - cellular response to oxidative stress
                     [Evidence IMP] [PMID 17497241]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Zta1p"
                     /protein_id="XP_018737073.1"
                     /db_xref="GeneID:30034086"
                     /translation="MAIPTTQKAIRIHETGGPEVVKLEEIPVPEITETQVLVKNEYAG
                     VNFIETYFRKGIYKAQLPVTLGREGAGEVVKVGSKVSNYSVGDKVGFVGSAFAEYVAI
                     EAVGKALKITKIPKGLDTKTVGAGLIQGLTALVLTTQSVALKKGDSVLVHAAAGGTGA
                     LIVQLAKAFGATVIGTTSSAEKAKIAKAAGADHVINYRTEDVTARVKEITNGAGVTGT
                     LDGVGKDTFNISIASTANSGTVASFGNASGVVPEFSLLSLERNIKVQRPSLFNALTTT
                     EDWEALTKQFFDLLLSGDLKLDISKVYPLAETSQAISDLESGKTTGKLVIQI"
     gene            complement(<651923..>652004)
                     /locus_tag="AWJ20_2201"
                     /db_xref="GeneID:30034087"
     tRNA            complement(<651923..>652004)
                     /locus_tag="AWJ20_2201"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:30034087"
     gene            complement(<653395..>655200)
                     /locus_tag="AWJ20_2202"
                     /db_xref="GeneID:30034088"
     mRNA            complement(<653395..>655200)
                     /locus_tag="AWJ20_2202"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879130.1"
                     /db_xref="GeneID:30034088"
     CDS             complement(653395..655200)
                     /locus_tag="AWJ20_2202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737074.1"
                     /db_xref="GeneID:30034088"
                     /translation="MAAQYVSNISPLRLVSYSFSDEGEFPHFATVVTEKASNAAIAAA
                     AASASASFGINTYSNGTNPGGPDDHISYLDLSFLTLQAVSQTVIICLFGYFAARAKIL
                     TPAVQRQVSMLNVQIFTPCLIFSKLASSLSLSALVDIAIIPVLFVITTGISMLCAKIT
                     SRIFRFNLRESNFVTAMAVFGNSNSLPVSLTVSLAYTLPSLAWPDIPDDNQDDVASRG
                     ILYLLIFQQLGQILRWSWGYNTLLAKPKDEDEFCEEDEDDEISSIEEGAVANESAHVG
                     TAKNKHSVNRKRRKQRGVDYSAVNADDVESQLGPQKSPVIITEDNASSPSSSSSSSVV
                     ETGFSTRVGSENGLAELGSESAPLIVGDENTVSLASPTSHTSHVVSRISSNATVLSRN
                     DESCNASTPLLPQTLSRKIISSVQKVFMSFLSFMNPPLWSMVIAIIVASIPAAKHELF
                     ETNGFVNHAITGAVTQVGGIAIPMILVVLGSNLAPDESTAPASKRHSSIVFASLISRM
                     ILPSIFLLPIIALSVKYIKLSILDDPIFLLVAFILTISPPAIQLSQISQLNGVFEKEM
                     ASVLFWGYVVLTLPSTIAIVVASLEVLDWAGTTRS"
     gene            complement(<657616..>658770)
                     /locus_tag="AWJ20_2203"
                     /db_xref="GeneID:30034089"
     mRNA            complement(<657616..>658770)
                     /locus_tag="AWJ20_2203"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879131.1"
                     /db_xref="GeneID:30034089"
     CDS             complement(657616..658770)
                     /locus_tag="AWJ20_2203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737075.1"
                     /db_xref="GeneID:30034089"
                     /translation="MYPKIEGLDPDETKRTFQGVYAHSARWDPETPLEDKDVIVIGNG
                     CSGAQIVPACAKTAKSVTQFFRAKHWLVPTPKMDPLKVRDKVNNVLGVRLSRMLLFLF
                     LEAQFPMFSNDGYWANKVRDFNTNKARTHMLKTAPQKYHDMIMPDFKIGCKRRIIDYG
                     YLQSLHNENVLLSDDPIVSVSEHHVHTKSGKSYHADVIFAATGFDVQSSSGNIPIYGL
                     DKEENITEFWDRTGVSAYNVSQVAGYPNLFYLLGPNAGTGHTSALLQIENTLTYIDNV
                     AGYVLRGEASSVDVKLTAYLEWKREINEASKQTVQMKGGCSSWYIKNGTNSVFYPWSQ
                     IRYWWRAVWPKYEDQTYRWTRNDVIQTKRRRRHTLLAVLLSIILKFTYFK"
     gene            complement(<659778..>660935)
                     /gene="JLP1"
                     /locus_tag="AWJ20_2204"
                     /db_xref="GeneID:30034090"
     mRNA            complement(<659778..>660935)
                     /gene="JLP1"
                     /locus_tag="AWJ20_2204"
                     /product="Jlp1p"
                     /transcript_id="XM_018879132.1"
                     /db_xref="GeneID:30034090"
     CDS             complement(659778..660935)
                     /gene="JLP1"
                     /locus_tag="AWJ20_2204"
                     /note="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase; involved in sulfonate catabolism for use as a
                     sulfur source; contains sequence that resembles a J domain
                     (typified by the E. coli DnaJ protein); induced by sulphur
                     starvation; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0051213 - dioxygenase
                     activity [Evidence IEA]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0000907 - sulfonate dioxygenase activity [Evidence IDA]
                     [PMID 10482536]; GO_process: GO:0046306 - alkanesulfonate
                     catabolic process [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0044273 - sulfur compound catabolic process
                     [Evidence IMP] [PMID 10482536]"
                     /codon_start=1
                     /product="Jlp1p"
                     /protein_id="XP_018737076.1"
                     /db_xref="GeneID:30034090"
                     /translation="MSPPTAVEPPKPVILDSKQFKKAGGDYKGLSPFFDKPTEGPSYQ
                     PNTKPLKASGALDEKYSFSEVSPVIGREYTGAQLRDILQDQELLRDLAITVSRRGVVF
                     FRNQALTAEEQKELADKLGVLTGKPSTSKLHIHPRTPGGGFLKPDGSEIDPEITIISS
                     KLQKSLYENRNRYKENASRGWHADFAFEPIPSTYSVLKIIEKPEVGGDTLWISGNGLY
                     DKLSPSFREYLETLYATFQGSGIEKAAQGKFDLFAGPRGAPENVGTELKAVHPAIRTN
                     PVTGWKSLYAAGAQFSHFNDITEDESGALQRYLKSVLIGSHDLQARFKWGKNDVAIWD
                     NRSVFHSATNDYFETAVERLGVRTVGLGERPYFDPKSKSRSDDLRESGLSV"
     gene            <662044..>663009
                     /locus_tag="AWJ20_2205"
                     /db_xref="GeneID:30034091"
     mRNA            <662044..>663009
                     /locus_tag="AWJ20_2205"
                     /product="putative epoxide hydrolase"
                     /transcript_id="XM_018879133.1"
                     /db_xref="GeneID:30034091"
     CDS             662044..663009
                     /locus_tag="AWJ20_2205"
                     /note="similar to several putative epoxide hydrolases; has
                     match to alpha/beta hydrolase fold; allele of CaO19.6709"
                     /codon_start=1
                     /product="putative epoxide hydrolase"
                     /protein_id="XP_018737077.1"
                     /db_xref="GeneID:30034091"
                     /translation="MSRFEVKLHANNLTFSAYSSYTEHQLAQVTPDRIILLLHGFPDT
                     RQSFDEIWPILEKKYPAPSTLLLAPSLRGYEPETVLPSRLSYTPTDIASDVIGWIKEI
                     IGDKKIPVHLIGHDWGALATFRTASLQPDLITSISTLAIPYMVNLSPLELLWHVPEQI
                     YLSSYMVRMQTSYFYGSRLYEDAVTTVVGAQGKERKVLPYIEYLWKYWSPGWKFTQDE
                     LADFCEAVQKPGVVDATTGYYRSLAAKRDRYWRVDFNKVPGLLIGGRDDGCMSYRLYD
                     LQREKLAPYGENVKIALVDKVGHFMHRENPVTIAELCIDWIDSHE"
     gene            <664660..>664944
                     /gene="UGA4"
                     /locus_tag="AWJ20_2206"
                     /db_xref="GeneID:30034092"
     mRNA            <664660..>664944
                     /gene="UGA4"
                     /locus_tag="AWJ20_2206"
                     /product="Uga4p"
                     /transcript_id="XM_018879134.1"
                     /db_xref="GeneID:30034092"
     CDS             664660..664944
                     /gene="UGA4"
                     /locus_tag="AWJ20_2206"
                     /note="GABA (gamma-aminobutyrate) permease; serves as a
                     GABA transport protein involved in the utilization of GABA
                     as a nitrogen source; catalyzes the transport of
                     putrescine and delta-aminolevulinic acid (ALA); localized
                     to the vacuolar membrane; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     14985124]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005774 - vacuolar membrane
                     [Evidence IEA]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA]; GO_function: GO:0015171 - amino acid
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015495 - gamma-aminobutyric acid:proton
                     symporter activity [Evidence IGI] [PMID 8455553];
                     GO_function: GO:0015489 - putrescine transmembrane
                     transporter activity [Evidence IGI] [PMID 14985124];
                     GO_process: GO:0003333 - amino acid transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA]; GO_process: GO:0015812 -
                     gamma-aminobutyric acid transport [Evidence IGI] [PMID
                     14985124]; GO_process: GO:0015812 - gamma-aminobutyric
                     acid transport [Evidence IEP,IGI] [PMID 8455553];
                     GO_process: GO:0015847 - putrescine transport [Evidence
                     IGI] [PMID 14985124]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IGI] [PMID
                     8455553]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Uga4p"
                     /protein_id="XP_018737078.1"
                     /db_xref="GeneID:30034092"
                     /translation="MGNNSEEIVRQETLQGVPTTEKPTVTDDDHLLMQLGYKPELRRN
                     FSVIQVFGIAFSIMSLLPSIASVLALNLPAGGCATWGWLAASVCILTVGM"
     gene            <665026..>666414
                     /gene="UGA4"
                     /locus_tag="AWJ20_2207"
                     /db_xref="GeneID:30034093"
     mRNA            <665026..>666414
                     /gene="UGA4"
                     /locus_tag="AWJ20_2207"
                     /product="Uga4p"
                     /transcript_id="XM_018879135.1"
                     /db_xref="GeneID:30034093"
     CDS             665026..666414
                     /gene="UGA4"
                     /locus_tag="AWJ20_2207"
                     /note="GABA (gamma-aminobutyrate) permease; serves as a
                     GABA transport protein involved in the utilization of GABA
                     as a nitrogen source; catalyzes the transport of
                     putrescine and delta-aminolevulinic acid (ALA); localized
                     to the vacuolar membrane; GO_component: GO:0000329 -
                     fungal-type vacuole membrane [Evidence IDA] [PMID
                     14985124]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA,IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence ISM] [PMID
                     12192589]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005774 - vacuolar membrane
                     [Evidence IEA]; GO_component: GO:0005773 - vacuole
                     [Evidence IEA]; GO_function: GO:0015171 - amino acid
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015495 - gamma-aminobutyric acid:proton
                     symporter activity [Evidence IGI] [PMID 8455553];
                     GO_function: GO:0015489 - putrescine transmembrane
                     transporter activity [Evidence IGI] [PMID 14985124];
                     GO_process: GO:0003333 - amino acid transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA]; GO_process: GO:0015812 -
                     gamma-aminobutyric acid transport [Evidence IGI] [PMID
                     14985124]; GO_process: GO:0015812 - gamma-aminobutyric
                     acid transport [Evidence IEP,IGI] [PMID 8455553];
                     GO_process: GO:0015847 - putrescine transport [Evidence
                     IGI] [PMID 14985124]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IGI] [PMID
                     8455553]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Uga4p"
                     /protein_id="XP_018737079.1"
                     /db_xref="GeneID:30034093"
                     /translation="MAEMGSALPTSGGLYWWTFKFAPEALKKPLCFLAGYSNTLGLVG
                     GVVSIDYGFASMVLSVPSIADPHFTPNKYQTYGVFVACVLSHMVIGSVATTVMSRLQT
                     FCIVINMLVIVITVIAVPIGAKNLRSGHEVFTDTTNLNDWPYGWTWMLSWMSAIWTIG
                     AFDSCVHLSEEATNAATAVPFGIVLSISMCGVLGFAILAVLISSISDFSAVINTATGQ
                     PMAQIYLDALGKKWTIAMMIMLFIVQWFMGLSLLVAASRQTWAFSRDGALPLSWWVRK
                     INMKLQVPVRAVIFDGVLCLVIGLLVLVDTAAALALFSLAPASNGLAWLLPIFCRHVW
                     FDKDAFKPGPFYLGHFFSRLNGLFASVYLIFVVFVLSMWPASGPDPTPQDMNYTCVIN
                     GAVWVGSLLYYFLSARKWFEGPQQTLDTEEIHGVDLIATHSQHHHGEGHEHQHQHEQP
                     QEVFEHAEKTPF"
     gene            <666928..>668013
                     /gene="GLE2"
                     /locus_tag="AWJ20_2208"
                     /db_xref="GeneID:30034094"
     mRNA            <666928..>668013
                     /gene="GLE2"
                     /locus_tag="AWJ20_2208"
                     /product="RNA export factor GLE2"
                     /transcript_id="XM_018879136.1"
                     /db_xref="GeneID:30034094"
     CDS             666928..668013
                     /gene="GLE2"
                     /locus_tag="AWJ20_2208"
                     /inference="similar to AA sequence:KEGG_Orthology:K14298"
                     /note="RNA export factor associated with the nuclear pore
                     complex (NPC); associates with NUP116p; required for
                     polyadenylated RNA export but not for protein import;
                     homologous to S. pombe Rae1p and human RAE1; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 15210706];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0031965 -
                     nuclear membrane [Evidence IEA]; GO_component: GO:0005643
                     - nuclear pore [Evidence IEA,IEA]; GO_component:
                     GO:0005643 - nuclear pore [Evidence IDA] [PMID 10684247];
                     GO_component: GO:0005643 - nuclear pore [Evidence IDA]
                     [PMID 8970155]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0051028 -
                     mRNA transport [Evidence IEA]; GO_process: GO:0031081 -
                     nuclear pore distribution [Evidence IMP] [PMID 9725905];
                     GO_process: GO:0016973 - poly(A)+ mRNA export from nucleus
                     [Evidence IMP] [PMID 8970155]; GO_process: GO:0000973 -
                     posttranscriptional tethering of RNA polymerase II gene
                     DNA at nuclear periphery [Evidence IMP] [PMID 20932479];
                     GO_process: GO:0015031 - protein transport [Evidence IEA];
                     GO_process: GO:2000728 - regulation of mRNA export from
                     nucleus in response to heat stress [Evidence IMP] [PMID
                     15210706]; GO_process: GO:0000972 -
                     transcription-dependent tethering of RNA polymerase II
                     gene DNA at nuclear periphery [Evidence IMP] [PMID
                     20098417]; GO_process: GO:0000972 -
                     transcription-dependent tethering of RNA polymerase II
                     gene DNA at nuclear periphery [Evidence IMP] [PMID
                     20932479]; GO_process: GO:0006810 - transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="RNA export factor GLE2"
                     /protein_id="XP_018737080.1"
                     /db_xref="GeneID:30034094"
                     /translation="MALKLNLDADITVENMPPNDTVSQLDFSPKSNLLSASSWDGIVR
                     VYSVFSPEVDFNKKELNNANAALQASYITGYTHSQPVLTTGWLQDKYQIISGGCDKLV
                     KIFDIGTGHVADIGHHEAPVSSVKSVMIGGSPIIVSSSWDKTLSYWDLRQQQAVCSIQ
                     LDGKALSMDSRDGVIVLVTSDRTTVKIDLSNPTVVSGTFKSRWELQPRVVKCLPGGEC
                     CIIGGTEGRCVVQYFRDVKSSFSFKCHRTTTGTDVHIYSVNDIAVNPIYGSTLTAGSD
                     GSLQIWDHIKQCRLSYSGILPGSVSSCAYNNNGSILAYAVYYDWSKGYQFSRPNYPKL
                     LKLHKIKPETVELWSNKNKIKIKIVYK"
     gene            complement(<668113..>675045)
                     /gene="CSF1"
                     /locus_tag="AWJ20_2209"
                     /db_xref="GeneID:30034095"
     mRNA            complement(<668113..>675045)
                     /gene="CSF1"
                     /locus_tag="AWJ20_2209"
                     /product="Csf1p"
                     /transcript_id="XM_018879137.1"
                     /db_xref="GeneID:30034095"
     CDS             complement(668113..675045)
                     /gene="CSF1"
                     /locus_tag="AWJ20_2209"
                     /note="Protein required for fermentation at low
                     temperature; plays a role in the maturation of secretory
                     proteins; the authentic, non-tagged protein is detected in
                     highly purified mitochondria in high-throughput studies;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006113 -
                     fermentation [Evidence IMP] [PMID 10781556]; GO_process:
                     GO:0051604 - protein maturation [Evidence IMP] [PMID
                     19433630]"
                     /codon_start=1
                     /product="Csf1p"
                     /protein_id="XP_018737081.1"
                     /db_xref="GeneID:30034095"
                     /translation="MNGSPFKGFYATKADPTVLLDYAHIDRDDETSILFVDGLVAHGH
                     RMFGLPPTEPTYFCKWDFDIGDVLIAAPLEVAEAFGRIGRCLVYSYEDMENSLLIPEP
                     PLYDVTFVSAKISKVKAQFSSEKYILELVTSAIDFRFNDLANERYSERVTLEIPSICT
                     SILDRFPYANKAHSIKATFRTSLIVSNFGQKRNMELCREYQQDHIRLHDAPFHRCAFV
                     LDSKRRKSPEYSVAGVRAGPVPSIPILGVPPPITRDTMPILDPNLGSGDLHRHNLGSD
                     EAASSSASTASRFNESLSNSSTDISLSLSDDDESVRYRPGPGNHGHGLTRRPPYAVDT
                     QKDVANNPFLPARGWKLLEKISADLLTDDDFNLQPTSNYNKGEVASPMSVLDPSTKYE
                     NLVIQFGSVEGDVSPFALGAINEIIESMGKEDMETSMDTLQIEFFKRLHMRHVTVLNP
                     EVTNIRLIVPNISIKYGDLEIREESRNVLNLENHIYFDFHGLNLVVRLREQSSVDQML
                     QAQHSPIKHTVYLNLDNSTIGVRKGGETASNIFEGARENSPVVLQIDRTEFWWHEDQE
                     TTGSLRIKAVDSFVMSEQVRWVAEFLDNNIEELKRINVSSTNESNRPKIKKQQQDHNR
                     TAYVLYQLAKAGESFNIQRDPSVLTRPAYIIQSPMHIRASTSWKIIMRLRHILRTVPS
                     EWREYHTEFLLNGSFETPPDIKEQTINIFARWRNWEMTNISSSYVFGYVFMETSLKER
                     LMSVATSTSLDIESIGLRLQYSESEDYLCFDYLKLLFNWSGKQYNEGPDSISPHDSVE
                     EDNNRLLDFESVLSCLHIRSRYSYHLLEVYDSVSDMIFKKNPQEVVKTESTESTAAVE
                     SQAKNTPGVLFPMVAMRTSFLLDQLSSVFILPSAELDLQGHQLKLTAFFEQLDPANRI
                     DAAVNVITNCSSFAIALNKRTPLYGTKLSQEKMLQILVNSSVLTYTSYGPMTTCSKYI
                     AARSTEFNVSMEKDLDQQLDFASQLLRHDWRCLREHVKACQNSSEAPIPKKTDPALQY
                     SGNLYIQLNAVHTKLTLRLLPSLSTIYQAENAFIKANHSEKEDFGVAELSIEEQLFRA
                     GSNLADLEAGFELFAFKMSPAVVLIRKEELKGMKDHSLEVLGSVSELSFNTESVAQLL
                     KLAQSGIWQDEAKALETHINNFKKEVCAVTMLGEPPATETVASQKSVKSLKPPLIRLS
                     MTFGKTSMLIPAYGYNAVMEVDGFGIQASSFIRFEDGFAEGFVTRTPLFITTSMDEFK
                     VLIYRKSSEQEKFVFIRLQTAMQLRLSQDGGKKIKHLLSLKSNFTRISFTPVIIQALV
                     EVVSSFSEDMSKYSVHEKGANPATSEIGEPKISDELGRGFVDKFCRNCTASMLVNDVS
                     VAWLFEDRGPTRFTSHPGLLFGYEVLDIQVVSFASHMVLKNVYLAPASERQIFLTKPV
                     TSRTANSALLPNVELRAEFEHEVSLQLAGESLKLTLLPNCVVLVSMFLDSISAAQALI
                     EQSALSADISTVPETPAPVKPLRFPFSWRLNLKFDGAVIELWDEGEFFDTGKVSKPTV
                     KKNSMYSEEGDTTGPEDEDDFRIPSLSLQTPALKAIFEYNSEGNKGSKDRFGCEISIT
                     PTSNVIYSRVVPVVVSMTRLVKEVVRANHQFNTARKREKNLLVNKTVRKHSAAGNGPT
                     TEDVELLFSAIDANIMIRFESQELTFSCLPTAKVSATVSVDRWFIGVHSGEVAKQGRI
                     VTAAFSIQNFKASLQHQYSRDVSGYIALEDAMIMLTKGKENTPLESIRVAGKISSIIF
                     DLNMKQMQDLEVFQNIWMPSGTLNTQQVREPRMEIASDPDYGMVMKFRRANTTVAIPW
                     SIDFTIIRIQGYIDMGQSIGKFDCKLDRFWISLQKSLDWEQHLSSGIDLIFLQSHGRL
                     DTTVSLEKPHLRTAIKWDKEVESFTVPLVQAVAGFSAFEVKISLEYHVFAMVYINSVH
                     FAMSNQRDHNKILGDRLIAVGELGTVNFFFTALAASYFVDVVYTFKRLRKASHASYEA
                     ILNDSSDKQQTHTNTPKTKRHDRKKLDDEALSNLFSKLRTMFDLRINSLNLYIYPGSF
                     TDSTLFTASLNAAHARFIQEQKDGTLESDLRLNMKSVLVALATSKAAPDLDIGLITVP
                     EFVSFAGQSVRGSTIIFVPVFHVSMRSWQKFGQPVVEYTFTSSIGGRVDIGWNLGSVT
                     FIREMWENHARALAQRQKTYSMTISDSKVIATGADLDKNLKEVELNPVFKYIAREPPD
                     IATPQLRQMGEATPPLEWLGLHRQKFPGLTHQFVIVGLQSLVHNIGKYFVHYEIALLE
                     LNEN"
     gene            complement(<675671..>678307)
                     /gene="CSF1"
                     /locus_tag="AWJ20_2210"
                     /db_xref="GeneID:30034097"
     mRNA            complement(<675671..>678307)
                     /gene="CSF1"
                     /locus_tag="AWJ20_2210"
                     /product="Csf1p"
                     /transcript_id="XM_018879139.1"
                     /db_xref="GeneID:30034097"
     CDS             complement(675671..678307)
                     /gene="CSF1"
                     /locus_tag="AWJ20_2210"
                     /note="Protein required for fermentation at low
                     temperature; plays a role in the maturation of secretory
                     proteins; the authentic, non-tagged protein is detected in
                     highly purified mitochondria in high-throughput studies;
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0006113 -
                     fermentation [Evidence IMP] [PMID 10781556]; GO_process:
                     GO:0051604 - protein maturation [Evidence IMP] [PMID
                     19433630]"
                     /codon_start=1
                     /product="Csf1p"
                     /protein_id="XP_018737082.1"
                     /db_xref="GeneID:30034097"
                     /translation="MRVPLVHGVSVACWRRGRRPRRARRSGVAFGGVEMSSVSAQFTT
                     VSILNNHEFSWVFIVDWILALVLTIFMIFYFNRAVGWLVSFLARWYLWRAHHAQLEVQ
                     SLQVSLLGGRIFFKNLSYVGTNEAICVLEGSFTWRYWLFYTRESLISGFLKDSHKGGS
                     DCEPQDFLGATSDDGAGSGVSGTTATGASSPPNPSPARSSKNRKYPARLVFDVTGVEW
                     FVFNRTPAYDALLDLAKKGSAVNSDQQEQEKQNQGDLDTNHKQNLQNLQKECSGAENT
                     SGTTGPDSLGTVRSSSSASTSSSSSDQSNLTSYDNMMLRMLPLEIRCHNKGAMVIGNK
                     DTSSLLIFHFESGVCSVDAAPPTSDLDKFKVIYKINTVKPILEMRPNVDYKGPDTVGF
                     PSVSPLSILKSMSWQSVLAHLSRLRRSARKKSKKYKKKSKASANKIRGKSKNRTNPRV
                     GRTTSRKTSFADGFGRFMTHRASTIYQTSSSSSSSEQDEEDDYYYDENYHPDENDDND
                     NDKEKPWRGLARYNIYYGNDNRDVSDDIPLDQLVDEYAKYSVILDAAEGTIAYHYDIP
                     GKVPDGIVPSTDDPLGNGRLENSPGRDPEWGVDMSFTSCTIHYGPWADRQRVFIQNML
                     FPRSFTNSTPEPVRMKGQDRLGMEFKLFIEFKEDVIIRIPTREASKNQKFYASYKENP
                     TANSLRAFGWLELKARHLSTMSYTGALVANKQGWNNNFRMDLKAPELRTSVNHGLVFS
                     ADRHTIQSTMKSPLQWNGIQEWDFRFNSEKVETFFLREHVSLLTDLITDFASGPPVTY
                     NQFVPFRYTIQWHISDYGIYLNVNDKNIINNPSDFDDNTFVSFQGQSVDIDILIPMEQ
                     VSSIKNRVDFKIAVSDNSVSKG"
     gene            complement(<679109..>682111)
                     /gene="SAC7"
                     /locus_tag="AWJ20_2211"
                     /db_xref="GeneID:30034098"
     mRNA            complement(<679109..>682111)
                     /gene="SAC7"
                     /locus_tag="AWJ20_2211"
                     /product="Sac7p"
                     /transcript_id="XM_018879140.1"
                     /db_xref="GeneID:30034098"
     CDS             complement(679109..682111)
                     /gene="SAC7"
                     /locus_tag="AWJ20_2211"
                     /note="GTPase activating protein (GAP) for Rho1p;
                     regulator of a Tor2p-mediated, Rho1p GTPase switch that
                     controls organization of the actin cytoskeleton; negative
                     regulator of the RHO1-PKC1-MAPK cell integrity (CWI) and
                     membrane fluidity homeostasis signaling pathways;
                     potential Cdc28p substrate; SAC7 has a paralog, BAG7, that
                     arose from the whole genome duplication; GO_component:
                     GO:0005938 - cell cortex [Evidence IDA] [PMID 23878277];
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_component: GO:0005856 - cytoskeleton [Evidence
                     IEA,IEA]; GO_component: GO:0005622 - intracellular
                     [Evidence IEA]; GO_function: GO:0005096 - GTPase activator
                     activity [Evidence IEA]; GO_function: GO:0005100 - Rho
                     GTPase activator activity [Evidence IDA] [PMID 9038344];
                     GO_process: GO:0035024 - negative regulation of Rho
                     protein signal transduction [Evidence IGI] [PMID 9038344];
                     GO_process: GO:0090038 - negative regulation of protein
                     kinase C signaling [Evidence IMP] [PMID 10625705];
                     GO_process: GO:0090038 - negative regulation of protein
                     kinase C signaling [Evidence IGI] [PMID 11713681];
                     GO_process: GO:0090038 - negative regulation of protein
                     kinase C signaling [Evidence IMP] [PMID 12207708];
                     GO_process: GO:0032321 - positive regulation of Rho GTPase
                     activity [Evidence IDA] [PMID 9038344]; GO_process:
                     GO:0032956 - regulation of actin cytoskeleton organization
                     [Evidence IGI] [PMID 2183030]; GO_process: GO:0032956 -
                     regulation of actin cytoskeleton organization [Evidence
                     IGI] [PMID 9038344]; GO_process: GO:0060237 - regulation
                     of fungal-type cell wall organization [Evidence IGI,IMP]
                     [PMID 10625705]; GO_process: GO:0060237 - regulation of
                     fungal-type cell wall organization [Evidence IGI] [PMID
                     12949174]; GO_process: GO:0007165 - signal transduction
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Sac7p"
                     /protein_id="XP_018737083.1"
                     /db_xref="GeneID:30034098"
                     /translation="MASAASPPSKSSLATWWKQFKQRPHLKDDELDYLSDSEGASGSG
                     SASAEGGASGGIYVSGRPKLRHLSHSSSAIGTIRSPSNQSVSVNGSGGGASGYGSASS
                     GIGGGSGYNSAVGTNAMSPETFQADSGASDNAIFGVPLKQSVDYAWVPISLTDPETGE
                     SFKYGHIPVIVAKCGRYLKKNATSVEGIFRLSGSARRIKELQVIFSTPTRYGKDLDWT
                     GFNVHDAANVLRRYLNNLPEPIVPLQFYEQFRDPLREYPRVVEYLTQQSAATSAALGA
                     GASGLSSLPSYRREQAQAQAFAQAQAQAQAAAGNQGGDDTSNHGPTIPLSASVPRSIT
                     LGLSNEESTSRSRTGSGSSIGAGTTGSIGTGQATASSTTLSASPGQSPFLPARTSSAQ
                     QQLQSTQQNGHTSTQPSQASQTTPEIGSILHSDINAAVDRYQHLISILPPLNRQLLMY
                     ILDLLSVFAARAEENLMPAANLAAIFQPSILSHPNHDMSPQEYHLSRSAIEFLVQHSN
                     KFLTHVENEAIRQHQQDKRDGKTTDLADPRAASSTAGAPGSTGLEPVNINSATESTPE
                     STTTSGNGSVSRTSGTTTTFVTPNPYSKQTYENGSGGSSGGGLTVHRRRHSKSLSSVG
                     SSGPPVPIVGSNYHSIQRVPVASISQEPNTTTAAAGGAPPPLQYQRQPSDDSNGFLTT
                     IKRTVSITRRPSQRRSTSGSSTSSAARLRSSSGAKPTPGTLGGSVVSTPTAQSPAPQA
                     VNIPEIITTNASQVDITTPSPGFEAVSLQNTPGASPPLEPTRSPDSKKGLSNLFSRKS
                     KSPNRGRASSDDYTRPEPSNFSNQSIDQAMAMLSTTGTTDLGSGSSGVPGGMHHIQSS
                     LPPPQQPFLHHSNHSNSSLGQSSTTSGGGAGDSDYDTGNPRPQDDSGSPNRKTKSRWR
                     RSLMMFNMAGVGDSFHDLSNTSTTSSYGASHVPDLQTGDNLSPTNSAIRSQSPGRWFK
                     KKALNRGRSSSRDGNHPDPDAPSDTAPQ"
     gene            complement(<685524..>686900)
                     /gene="RVS167"
                     /locus_tag="AWJ20_2212"
                     /db_xref="GeneID:30034099"
     mRNA            complement(<685524..>686900)
                     /gene="RVS167"
                     /locus_tag="AWJ20_2212"
                     /product="amphiphysin"
                     /transcript_id="XM_018879141.1"
                     /db_xref="GeneID:30034099"
     CDS             complement(685524..686900)
                     /gene="RVS167"
                     /locus_tag="AWJ20_2212"
                     /inference="similar to AA sequence:KEGG_Orthology:K12562"
                     /note="Actin-associated protein with roles in endocytosis
                     and exocytosis; interacts with Rvs161p to regulate actin
                     cytoskeleton, endocytosis, and viability following
                     starvation or osmotic stress; recruited to bud tips by
                     Gyl1p and Gyp5p during polarized growth; homolog of
                     mammalian amphiphysin; GO_component: GO:0030479 - actin
                     cortical patch [Evidence IDA] [PMID 10393809];
                     GO_component: GO:0030479 - actin cortical patch [Evidence
                     IDA] [PMID 16239147]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 24390141]; GO_component: GO:0005856 -
                     cytoskeleton [Evidence IEA,IEA]; GO_component: GO:0043332
                     - mating projection tip [Evidence IDA] [PMID 10393809];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 19053807]; GO_function: GO:0003779 - actin
                     binding [Evidence IEA]; GO_function: GO:0008092 -
                     cytoskeletal protein binding [Evidence IPI,ISS] [PMID
                     10388809]; GO_function: GO:0008289 - lipid binding
                     [Evidence IDA] [PMID 20610658]; GO_process: GO:0051666 -
                     actin cortical patch localization [Evidence IMP] [PMID
                     8590801]; GO_process: GO:0006897 - endocytosis [Evidence
                     IMP] [PMID 8590801]; GO_process: GO:0060988 - lipid tube
                     assembly [Evidence IDA] [PMID 20610658]; GO_process:
                     GO:0016192 - vesicle-mediated transport [Evidence IGI,IPI]
                     [PMID 15802519]"
                     /codon_start=1
                     /product="amphiphysin"
                     /protein_id="XP_018737084.1"
                     /db_xref="GeneID:30034099"
                     /translation="MNIGTHTKDLVYIDAERRFKELEDETKKLHAESTKYSEAVNGML
                     KHQIEFSKAVEEIYKPISGRMSDPNSTRPEGNPEGIQACEQYRDVVFELQATLKPELE
                     MIETRIVAPADELLKVIKAIRKMSVKRDHKQLDLDRHTATLTKLQGKKERSIKDEKNM
                     YTAENNVEIAKQEYDYFNNLLKEELPKLFELEAEFIRPLFQSFYYMQLNIFYTLYNRM
                     EEMKIPYFDLTADIEESFNRKRGDIQEQAEAIGITHFRVGHAKSKLELTKKKYGKETE
                     AGAAGAAAGAGAYGAGAYGAGAAAAGSEGVPPPYQGYGQQPPQEKYVYQAPGAPAAAG
                     YGQQPAYGQPAAAPAGYGQQPAYGQPAATAAQPVYGQPAAAAAAAAVPTAYSPSPVSP
                     VAASPVAPVEYCTALYDYEAQAHGDLSIHAGDRIEIVQRTADPNGWWTGKLNGVQGVF
                     PGNYVQLG"
     gene            complement(<690120..>694215)
                     /gene="UTP10"
                     /locus_tag="AWJ20_2213"
                     /db_xref="GeneID:30034100"
     mRNA            complement(join(<690120..690135,690224..>694215))
                     /gene="UTP10"
                     /locus_tag="AWJ20_2213"
                     /product="Utp10p"
                     /transcript_id="XM_018879142.1"
                     /db_xref="GeneID:30034100"
     CDS             complement(join(690120..690135,690224..694215))
                     /gene="UTP10"
                     /locus_tag="AWJ20_2213"
                     /inference="similar to AA sequence:KEGG_Orthology:K14550"
                     /note="Nucleolar protein; component of the small subunit
                     (SSU) processome containing the U3 snoRNA that is involved
                     in processing of pre-18S rRNA; mutant has increased
                     aneuploidy tolerance; GO_component: GO:0030686 - 90S
                     preribosome [Evidence IDA] [PMID 12150911]; GO_component:
                     GO:0030686 - 90S preribosome [Evidence IDA] [PMID
                     17652137]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_component: GO:0005730 -
                     nucleolus [Evidence IEA]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 12068309]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 12150911];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     17652137]; GO_component: GO:0005730 - nucleolus [Evidence
                     IDA] [PMID 22842922]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_component: GO:0030688 - preribosome,
                     small subunit precursor [Evidence IDA] [PMID 17652137];
                     GO_component: GO:0033553 - rDNA heterochromatin [Evidence
                     IDA] [PMID 15489292]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0032040 - small-subunit processome [Evidence IDA] [PMID
                     12068309]; GO_component: GO:0034455 - t-UTP complex
                     [Evidence IDA] [PMID 17515605]; GO_function: GO:0030515 -
                     snoRNA binding [Evidence IPI] [PMID 12068309]; GO_process:
                     GO:0000480 - endonucleolytic cleavage in 5'-ETS of
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 17652137]; GO_process:
                     GO:0000447 - endonucleolytic cleavage in ITS1 to separate
                     SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic
                     rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 17652137]; GO_process: GO:0000472 -
                     endonucleolytic cleavage to generate mature 5'-end of
                     SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence
                     IMP] [PMID 17652137]; GO_process: GO:0000462 - maturation
                     of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA,
                     5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID 12068309];
                     GO_process: GO:0045943 - positive regulation of
                     transcription from RNA polymerase I promoter [Evidence
                     IMP] [PMID 15489292]; GO_process: GO:0006364 - rRNA
                     processing [Evidence IEA]; GO_process: GO:0042254 -
                     ribosome biogenesis [Evidence IEA]; GO_process: GO:0006351
                     - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Utp10p"
                     /protein_id="XP_018737085.1"
                     /db_xref="GeneID:30034100"
                     /translation="MISLKDSGANDQEIVGRFLPYCSNAISLKKDPDAQTAAYIILAV
                     LGSQFRLNKEVKSAAIQSIILNWSRASVKSGFSCITQLVKLDDTLEPFEKEDWDAIEK
                     IRAIDTEINALSEQYDISQFIVRWALSVLKYSPEKIYLVQSVLASGKFGISHGLDIVL
                     RASIKLATQASDANVKEQLVSLFEFVLSSEEGAKGFKEVLANAGVSFDQLELGVQSSI
                     QTKFAFVRGQEESAAVDDDVEMTQAEELTATVTLTEELKSRSPVKVASFLSLDTNKEF
                     RELVNLFTLGLQSSQSDILKSLQIDAESQPSFLVRIWTGAYANLARVRALELFSAIVE
                     ENPSVDYQAVIPFLLVALSDESERVRRGASSIIRSLATRYPIKKPTVWALDNLYGEGD
                     QSSEVKWLTSTNIKVLLNDVLLPNIDECYLDADYISKRIGEVASDKEFKSLQEPLLTF
                     LTSHVLSMKLPQMKVSLLQILRKWAKSSSTSKLLTPLLTSWIDERDTWVSICEEERVS
                     FDKLETAVVSIVSSGEKSGIAFLEQAIRSSSNLSDKAGQRLVYLWKSAALKPDTQLGL
                     LRFLSDVAVDESITYDSLEVLNNIEITTPHFVSLLDDCKLERDSAAANSSGSRSGTAS
                     PAVPKRRRRSSNSSREKFRGSELISFAEKHLRKLTVILELLDKNKSEGPSCMTLLSQL
                     FTILGEILSLGADSNLPSLYTEQLLANCMISAVEQLKHQRHTKIDSALVRVDIIVSCI
                     RSSSSPQVQNRFLLLVASLAELAPEVVLHSVMPIFTFMGANTVRQDDEFSAHVIQQTI
                     SQVIPALVSNNNGTSNEEIEFLLLSFVAAFAHIPRHRRVKLFGALVRTLKPEASLHKL
                     LILFGNKYSEAKIKRKSADLKSYVQFGTTFVRSFTVVDQVTAIRNFLAVSESIPLTEG
                     ETPSEGGQLFTALTNGNGTNVTDNATLKANVYEFLTNVFGDDDIVGGYPSLRAQILKE
                     EADKAVVMDICSEIIEQLLKTRKATSDNTELSAVPSLAENIFNFLGKMLEVLPMGSFV
                     EVVESLLASSDIDVKVHLLALVQSKFDVELSTDEDAVKAAINCTALLKNYLSSTEDAH
                     IIQLVLDDLDVIIAKFGSQMSPEELLAALTAIVGERGLLNSDIKVFVAAVAASSSIST
                     VLGARMIGLFGKIVPVVFKRFETSLALENKDDAKLIQLATFGLVSGLVKRIPSFMTSS
                     VKKVFEFVLVSNATTVDVRTRVMDVIRNNIEDKQVISALTGTWKYAVDNGMDSINIFL
                     DSLDKVIDVSPKKVVSSQSSIIIGFLLQAFEVRGQGNYGKEDTNRIEAKAVSSAIKVI
                     MKLNDKTFQPFYLEA"
     gene            <696342..>697679
                     /locus_tag="AWJ20_2214"
                     /db_xref="GeneID:30034101"
     mRNA            <696342..>697679
                     /locus_tag="AWJ20_2214"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879143.1"
                     /db_xref="GeneID:30034101"
     CDS             696342..697679
                     /locus_tag="AWJ20_2214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737086.1"
                     /db_xref="GeneID:30034101"
                     /translation="MPDLSESSEFMRMQTESARPGSSSQAGHVPGTYNKSLKSIASNN
                     GNGSSTAVDSVGGFEGLEHRQIRSNDIELESAPRYASESDPYSLSSGLKTKSELKRIR
                     SNEDGKSRSVGRKLQQFYESQNEQIEMLLKPVEDHRAEAKQAEGDNQLKYRIAVYGSF
                     AANIILAALQIYGAASSGSLSLITTMADAIFDPMSNITLILANRAVNHVDSRRFPSGK
                     ARIETVGNITFCFLMSAVGAIIIVLSARDIAGGNSEETKKFHLPSVIAVAVAFCTKFA
                     LWLYCWALKDTYSQVNILWQDHRNDLFINGFGILTSVAGSKLRWWIDPMGAIILSVFI
                     DIVWLRTATQEFLLLIGQTADNSIQQLITYLAVTHSPEIDQVDTVRVYHSGPRLIAEV
                     DVVMNENMTLKETHDIAEALQFKLESLPDVERAYVHVDYETSHKPEHFLKKEL"
     gene            <698523..>701360
                     /gene="ATG11"
                     /locus_tag="AWJ20_2215"
                     /db_xref="GeneID:30034102"
     mRNA            <698523..>701360
                     /gene="ATG11"
                     /locus_tag="AWJ20_2215"
                     /product="autophagy protein ATG11"
                     /transcript_id="XM_018879144.1"
                     /db_xref="GeneID:30034102"
     CDS             698523..701360
                     /gene="ATG11"
                     /locus_tag="AWJ20_2215"
                     /inference="similar to AA sequence:KEGG_Orthology:K08330"
                     /codon_start=1
                     /product="autophagy protein ATG11"
                     /protein_id="XP_018737087.1"
                     /db_xref="GeneID:30034102"
                     /translation="MTQLKLEAIADGQEVFLFDKSLISPGAKTYAENGLVGKEDRGPP
                     LALPPRPAVNTTSSLSDRFMTHSDWTQKCLLVGKDCGNRVNELHMSINIIKRGLKTSL
                     EHMMRHSQGLKKSFDSKVDFAVDLDQNMQATGEWEVYLEKVKKIELLPAFREQGEGRD
                     RLSSWIDESVIRKANKQCSEFDQKIQNNISHLVKVVNEVIERSTRLEQDAMAMASKDA
                     ESDVPAEATSRHVRELLQDLTALANKIQRDSESIGGVSEQTAVRIENLHKREFFPQIE
                     ATVNELIGIHEEWQKAKVKCQNLAIGYLSTLSHIQYDTSMVRPELQKLTMLLQTTEDL
                     RATVAQVIDLPFLYGALIIETVRRNHWTGYIRENVSQTAESLATKRLDEIKRRKKWKN
                     HYGKILPKVVDIINEDIAEIEVNFVSGEVNGDGDASSTDSDQVQAYIKLLTSLGLREA
                     AEELEQEHQSMLSQLESDIADKNLAKLETTKQSDHHTDTSSPAKVFKSGTLAEAYTDE
                     NAALTAKLKGYESRIRILEDLLHKQQFRGESTRSEANRRSASRDKSHSPGSPRMIERL
                     HFLETQKSNDSKIIAQLEQEKRELAESLSAKELALKDVMTVKSDLLANMLSQETEFIQ
                     ERKAHHEEVNELKSRIDELELDLDRADEKLQLENDQLREEVDSYKEKIEQLEQENSNL
                     KQQEEKLHKKIEYYDTRTRDLSQRLFTGFKRSCEVLESMGLQVTKEMDGNLITFKVNR
                     VRGLGRRSSAARSEILEQSLEENGNGNMVSNPTLNEATPEDLRVLYWMDGEPDEERYR
                     EFINEIYIDYDIFRDSACKRLRDVEHLARKLQKESKHLRERKTQIEEELQSRLSLRSF
                     KVGDLALFLPTRDPTRVPNPWAAFNVNAPHYFLKQEDSHQLSNREYLVGRITHIEERV
                     VNKSLDNDEDNPFDLSDGLRWYLLDAVPAEW"
     gene            <703797..>704744
                     /gene="KES1"
                     /locus_tag="AWJ20_2216"
                     /db_xref="GeneID:30034103"
     mRNA            <703797..>704744
                     /gene="KES1"
                     /locus_tag="AWJ20_2216"
                     /product="oxysterol-binding protein KES1"
                     /transcript_id="XM_018879145.1"
                     /db_xref="GeneID:30034103"
     CDS             703797..704744
                     /gene="KES1"
                     /locus_tag="AWJ20_2216"
                     /note="One of seven members of the yeast oxysterol binding
                     protein family; involved in negative regulation of
                     Sec14p-dependent Golgi complex secretory functions,
                     peripheral membrane protein that localizes to the Golgi
                     complex; KES1 has a paralog, HES1, that arose from the
                     whole genome duplication; GO_component: GO:0000139 - Golgi
                     membrane [Evidence IDA] [PMID 11916983]; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     8978672]; GO_component: GO:0019898 - extrinsic component
                     of membrane [Evidence IDA] [PMID 11916983]; GO_function:
                     GO:0008289 - lipid binding [Evidence IDA,IMP] [PMID
                     20008566]; GO_function: GO:0008142 - oxysterol binding
                     [Evidence ISS] [PMID 11238399]; GO_function: GO:0008142 -
                     oxysterol binding [Evidence IMP,IPI] [PMID 16136145];
                     GO_function: GO:0070300 - phosphatidic acid binding
                     [Evidence IDA] [PMID 20729555]; GO_function: GO:0005546 -
                     phosphatidylinositol-4,5-bisphosphate binding [Evidence
                     IMP,IPI] [PMID 11916983]; GO_function: GO:0070273 -
                     phosphatidylinositol-4-phosphate binding [Evidence IDA]
                     [PMID 20729555]; GO_function: GO:0015248 - sterol
                     transporter activity [Evidence IDA,IMP] [PMID 20008566];
                     GO_process: GO:0035621 - ER to Golgi ceramide transport
                     [Evidence IMP] [PMID 24213531]; GO_process: GO:0006897 -
                     endocytosis [Evidence IGI] [PMID 15173322]; GO_process:
                     GO:0006887 - exocytosis [Evidence IGI] [PMID 17004323];
                     GO_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]; GO_process: GO:0030011 - maintenance of cell
                     polarity [Evidence IGI] [PMID 17004323]; GO_process:
                     GO:0010922 - positive regulation of phosphatase activity
                     [Evidence IDA] [PMID 21295699]; GO_process: GO:0006892 -
                     post-Golgi vesicle-mediated transport [Evidence IGI] [PMID
                     11916983]; GO_process: GO:0006892 - post-Golgi
                     vesicle-mediated transport [Evidence IGI] [PMID 8978672];
                     GO_process: GO:0006694 - steroid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0008202 - steroid metabolic
                     process [Evidence IEA]; GO_process: GO:0016126 - sterol
                     biosynthetic process [Evidence IEA]; GO_process:
                     GO:0015918 - sterol transport [Evidence IDA,IGI] [PMID
                     16585271]; GO_process: GO:0015918 - sterol transport
                     [Evidence IDA,IMP] [PMID 20008566]"
                     /codon_start=1
                     /product="oxysterol-binding protein KES1"
                     /protein_id="XP_018737088.1"
                     /db_xref="GeneID:30034103"
                     /translation="MVLVLKWFIGTLRGQYCSRNEKLGSEKKPLNPFLGELFVGKWAG
                     DAESGETVLASEQVSHHPPITGYSIWNDKHGVYLNGYNGMKARIATTTISVKQNGHAT
                     YYLKAFDETYIISLPALHIEGILFGAPYVELEGKSFIHGSSGYSVSIEYTGKGYFSGK
                     KNSFKAKIYKGSEDAALYRVSGQWSESSKIKDEKTGVETPFLDSLKITSESLQVKPEA
                     EQSELESRRAWSKVAAAIREGDYELIHQEKSKIENDQRELRKTEQAEGKTWPSKWFEE
                     VPVSNAPEVYLTLSKAAGVEPETTWTFVRSKFDAADVKP"
     gene            <708842..>709147
                     /gene="NHP6B"
                     /locus_tag="AWJ20_2217"
                     /db_xref="GeneID:30034104"
     mRNA            <708842..>709147
                     /gene="NHP6B"
                     /locus_tag="AWJ20_2217"
                     /product="Nhp6bp"
                     /transcript_id="XM_018879146.1"
                     /db_xref="GeneID:30034104"
     CDS             708842..709147
                     /gene="NHP6B"
                     /locus_tag="AWJ20_2217"
                     /note="High-mobility group (HMG) protein; binds to and
                     remodels nucleosomes; involved in recruiting FACT and
                     other chromatin remodelling complexes to the chromosomes;
                     functionally redundant with Nhp6Ap; required for
                     transcriptional initiation fidelity of some tRNA genes;
                     homologous to mammalian HMGB1 and HMGB2; NHP6B has a
                     paralog, NHP6A, that arose from the whole genome
                     duplication; GO_component: GO:0005694 - chromosome
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA,IEA]; GO_component: GO:0005634 - nucleus
                     [Evidence IDA] [PMID 3169249]; GO_function: GO:0003677 -
                     DNA binding [Evidence IEA]; GO_function: GO:0008301 - DNA
                     binding, bending [Evidence IDA] [PMID 7721780];
                     GO_function: GO:0031491 - nucleosome binding [Evidence
                     ISS] [PMID 11432837]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     19158363]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA]; GO_process: GO:0070898 - RNA polymerase III
                     transcriptional preinitiation complex assembly [Evidence
                     IGI] [PMID 11287614]; GO_process: GO:0070898 - RNA
                     polymerase III transcriptional preinitiation complex
                     assembly [Evidence IDA] [PMID 17178828]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0006338 - chromatin
                     remodeling [Evidence IGI] [PMID 14739928]; GO_process:
                     GO:0001195 - maintenance of transcriptional fidelity
                     during DNA-templated transcription elongation from RNA
                     polymerase III promoter [Evidence IDA] [PMID 16407207];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IGI] [PMID 8946917]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Nhp6bp"
                     /protein_id="XP_018737089.1"
                     /db_xref="GeneID:30034104"
                     /translation="MPKEPGRRRTKEEIRKKKKDPNAPKRALSAYMYFANENRDNIKN
                     ENPDISFGQIGKVLGEQWKALTDAEKVPYEAKATQDKKRYEEEKAAYQASKAQEYSE"
     gene            complement(<709876..>712212)
                     /gene="UBP16"
                     /locus_tag="AWJ20_2218"
                     /db_xref="GeneID:30034105"
     mRNA            complement(<709876..>712212)
                     /gene="UBP16"
                     /locus_tag="AWJ20_2218"
                     /product="Ubp16p"
                     /transcript_id="XM_018879147.1"
                     /db_xref="GeneID:30034105"
     CDS             complement(709876..712212)
                     /gene="UBP16"
                     /locus_tag="AWJ20_2218"
                     /inference="similar to AA sequence:KEGG_Orthology:K11874"
                     /note="Deubiquitinating enzyme anchored to the outer
                     mitochondrial membrane; probably not important for general
                     mitochondrial functioning, but may perform a more
                     specialized function at mitochondria; GO_component:
                     GO:0005737 - cytoplasm [Evidence IC] [PMID 8982460];
                     GO_component: GO:0005741 - mitochondrial outer membrane
                     [Evidence IDA] [PMID 12914939]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16407407]; GO_function: GO:0008234 - cysteine-type
                     peptidase activity [Evidence IEA]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IEA]; GO_function:
                     GO:0008233 - peptidase activity [Evidence IEA];
                     GO_function: GO:0004843 - ubiquitin-specific protease
                     activity [Evidence TAS] [PMID 8982460]; GO_process:
                     GO:0016579 - protein deubiquitination [Evidence TAS] [PMID
                     8982460]; GO_process: GO:0006508 - proteolysis [Evidence
                     IEA]; GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Ubp16p"
                     /protein_id="XP_018737090.1"
                     /db_xref="GeneID:30034105"
                     /translation="MNVLRRKKKSGKYTVGLTNRANDCFANSNIQALAAVPGLVDYLL
                     QLNAAAIALSNPDAVRMSVPGTSVPGNTTAEKRKLASSTEKSLPQTPDSQPAVAIADS
                     PAAGGTATPASSAKTNTNNSGATTDIPTRPTTPSAQIATAVTPKSPSGGYGASMPASN
                     AQTLTPLLSNALLRIIKELNEPILVPKTLSPWTFLGVLEKIYKSRISRNQHDAHELLH
                     LILETLENEYDKIVKESRSRTEKQSIWGNIAASHPSPLEDAELESEQEAPKSFAFSGS
                     TIDRITCSRCGYSPPATPSAFLVLSLMVPQKKSAQLTDLLDGLSSPEYIQDYGCQLCR
                     LKHASMMKNGDQFKQYLSDPSKLPSELEDKLPKNIVSPIAKSTRFHRLPDVLAIHLSR
                     SIYGGFGASRNSCKVSTKEFIELTENETGNIIRYKLMAMIRHKGTHQMGHYECFRRKN
                     LDTWRDILQMLDEDEKDREIKKGLRLHKQQTPSVSSFQGSGTGTGTAQSATPTPRQLA
                     TTASTAGTISANSSPRLDLATGAINGNYGGTAAVPTATATPVASSPTIASMNSSNSSS
                     GASSSITTKSSATEITNYTMSTTPSSPLTTITTPSSSIPETAFSSSATTGDSQSPAPS
                     LASDNVTLSSASSSISGVSAASAPLRLTADTPSSPALSPPPSAIPLPYPADRSMPSPA
                     SVSISEFASAEISLDAIRAVPLSAATLNGTKRPVFTAPTTPTRSPTPTLLSVQQNVSP
                     PSHHEWWKVSDDKVWECTTKEVLREESGAYLLFYERLT"
     gene            <713753..>714229
                     /locus_tag="AWJ20_2219"
                     /db_xref="GeneID:30034106"
     mRNA            <713753..>714229
                     /locus_tag="AWJ20_2219"
                     /product="putative heme/steroid binding protein"
                     /transcript_id="XM_018879148.1"
                     /db_xref="GeneID:30034106"
     CDS             713753..714229
                     /locus_tag="AWJ20_2219"
                     /note="potential heme/steroid binding protein; similar to
                     A. thaliana F17I14_130; allele of CaO19.4522"
                     /codon_start=1
                     /product="putative heme/steroid binding protein"
                     /protein_id="XP_018737091.1"
                     /db_xref="GeneID:30034106"
                     /translation="MSEQPQLGPPPDRKKMLAPPPGNAQSTLFPSINSAQRASGSRAI
                     SGPQPAAAARRKKVALQPGHSALDWANLRNSGANLRVGTCSPPAAGAAPQTPLLLSLR
                     SSRVSGVPFKGSRGLSDASGDDSSGARGATGSGAEPQPTEAHSPVPYSDTNRFSGS"
     gene            <717982..>720456
                     /locus_tag="AWJ20_2220"
                     /db_xref="GeneID:30034108"
     mRNA            <717982..>720456
                     /locus_tag="AWJ20_2220"
                     /product="RNAPII degradation factor (predicted)"
                     /transcript_id="XM_018879150.1"
                     /db_xref="GeneID:30034108"
     CDS             717982..720456
                     /locus_tag="AWJ20_2220"
                     /codon_start=1
                     /product="RNAPII degradation factor (predicted)"
                     /protein_id="XP_018737092.1"
                     /db_xref="GeneID:30034108"
                     /translation="MSSKKYTSALTTLRELFPDWKDDDLLAVLEETSGDIEQSVSLIA
                     EGHVSQWGQVKKKTRESTRGKSKGPANADGKESNTTSAHRHNGSAASHGHGSSTHGSN
                     NTGTGAPRGQRSERGRSRAPKRVNGSTHTHTNANSTTSSAAATANNNNTSDATSTPAA
                     WETDAAGVPAGSAVAAASIAASNASSTSTTDSTAATTNSSTSESAPSAPKTRSWADAL
                     SKKSTTAPVAAKRQSQPQQHQQQERAAQKPQPSASADIDNTTTTTTTTSSSLPESNTA
                     ATSTPAAAATAASTETTAPVSNSAPTAVPALPVAPQKLSWAAIAKPKEEKKPAPAAPV
                     ASTATTNASPASAAASETPVAAATSTETTTQPEQTEAFTQEPAAETVSEPIPVSIPPG
                     LESKPEPAVPAATSNTASTGAAAAAAPRRVTQEVPVILPGSVSRTVDRVGVQFGSLDL
                     NEQTPATESASQTAQPAQQQAQAQQQQQQQQIASETANSSATSTAPAGIPEQGQTAGA
                     AAAAQPAYYGYGQTQAQTAGSVQQKPYENAYSQNHYVYPGTHPGSHPGFATGYSVPTD
                     YQSPYGAGVSDQRNSYNNYYYQQQAAAAGQQQPGLTGNQQQTQSQHNGSLDSSRYGTS
                     AGATGAEAGANSAVAGGAGVAQSSNANSPASVAAGVYQQPSMNPYYMSPAYAAYYYQT
                     YGYNQQAALAAQYGSPAGPQKGFFNQQQSYYDYRQPGVGGQVQGQQGQSQQQAQGQQQ
                     GQSQGQQQQQSQAQGQTSQAGGLTGISDFLQREDTSKQTPGSPQQHQAGLPQQPQYPV
                     QQNLYSYAGYGQYSGQQGQRQGWGYN"
     gene            complement(<720792..>722135)
                     /gene="CPA1"
                     /locus_tag="AWJ20_2221"
                     /db_xref="GeneID:30034109"
     mRNA            complement(<720792..>722135)
                     /gene="CPA1"
                     /locus_tag="AWJ20_2221"
                     /product="carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing) CPA1"
                     /transcript_id="XM_018879151.1"
                     /db_xref="GeneID:30034109"
     CDS             complement(720792..722135)
                     /gene="CPA1"
                     /locus_tag="AWJ20_2221"
                     /inference="similar to AA sequence:KEGG_Orthology:K01956"
                     /note="Small subunit of carbamoyl phosphate synthetase;
                     carbamoyl phosphate synthetase catalyzes a step in the
                     synthesis of citrulline, an arginine precursor;
                     translationally regulated by an attenuator peptide encoded
                     by YOR302W within the CPA1 mRNA 5'-leader; GO_component:
                     GO:0005951 - carbamoyl-phosphate synthase complex
                     [Evidence IDA] [PMID 206535]; GO_component: GO:0005951 -
                     carbamoyl-phosphate synthase complex [Evidence ISS] [PMID
                     6086650]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 22842922]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA]; GO_function: GO:0004088 -
                     carbamoyl-phosphate synthase (glutamine-hydrolyzing)
                     activity [Evidence IEA]; GO_function: GO:0004088 -
                     carbamoyl-phosphate synthase (glutamine-hydrolyzing)
                     activity [Evidence IMP] [PMID 6086650]; GO_function:
                     GO:0004088 - carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing) activity [Evidence IDA] [PMID
                     8626695]; GO_function: GO:0016874 - ligase activity
                     [Evidence IEA]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006526 - arginine
                     biosynthetic process [Evidence IEA,IEA]; GO_process:
                     GO:0006526 - arginine biosynthetic process [Evidence IMP]
                     [PMID 9290206]; GO_process: GO:0070409 - carbamoyl
                     phosphate biosynthetic process [Evidence IEA]; GO_process:
                     GO:0008652 - cellular amino acid biosynthetic process
                     [Evidence IEA]; GO_process: GO:0006543 - glutamine
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="carbamoyl-phosphate synthase
                     (glutamine-hydrolyzing) CPA1"
                     /protein_id="XP_018737093.1"
                     /db_xref="GeneID:30034109"
                     /translation="MLRTLSKSVSAGLKLNASPLARLSSKSYSTVNTALFNSRSDLDR
                     ATFTIRDGPVFHGKSFGANTNISGEAVFSTGMVGYPESMTDPSYRGQILVFTQPLIGN
                     YGVPSSTARDEFGLLKYFESPHCQCIGVVVADAAMQYSHWTAVESLGDWCKREGVAAI
                     TGVDTRSIVTYLREQGSSLARITVGEEYDADEDEAFMDPGAINLVHKVSTKQPFHVPA
                     ATIPGQENIHVAVIDCGVKENILRSLVSRGASITVFPYDYPIHKISHHFDGIFISNGP
                     GDPTHCSSTVYNLKKTMETYDGPIFGICLGHQLLALAAGGKTIKLKYGNRAHNIPALD
                     LMTGKCHITSQNHGYAVDVATLPSEFKPYFINLNDQSNEGMIHESRPIFSTQFHPEAK
                     GGPLDSAFLFDKYLADIQAFKQKKSAQGLVNAAPSPLFVDILPKERVGVEINPQA"
     gene            complement(<724509..>725435)
                     /gene="DUS4"
                     /locus_tag="AWJ20_2222"
                     /db_xref="GeneID:30034110"
     mRNA            complement(<724509..>725435)
                     /gene="DUS4"
                     /locus_tag="AWJ20_2222"
                     /product="Dus4p"
                     /transcript_id="XM_018879152.1"
                     /db_xref="GeneID:30034110"
     CDS             complement(724509..725435)
                     /gene="DUS4"
                     /locus_tag="AWJ20_2222"
                     /inference="similar to AA sequence:KEGG_Orthology:K05545"
                     /note="Dihydrouridine synthase; member of a widespread
                     family of conserved proteins including Smm1p, Dus1p, and
                     Dus3p; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0050660 - flavin
                     adenine dinucleotide binding [Evidence IEA]; GO_function:
                     GO:0016491 - oxidoreductase activity [Evidence IEA];
                     GO_function: GO:0017150 - tRNA dihydrouridine synthase
                     activity [Evidence IEA]; GO_function: GO:0017150 - tRNA
                     dihydrouridine synthase activity [Evidence ISS] [PMID
                     12003496]; GO_function: GO:0017150 - tRNA dihydrouridine
                     synthase activity [Evidence IMP] [PMID 14970222];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0002943 - tRNA
                     dihydrouridine synthesis [Evidence IEA]; GO_process:
                     GO:0006400 - tRNA modification [Evidence ISS] [PMID
                     12003496]; GO_process: GO:0006400 - tRNA modification
                     [Evidence IMP] [PMID 14970222]; GO_process: GO:0008033 -
                     tRNA processing [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Dus4p"
                     /protein_id="XP_018737094.1"
                     /db_xref="GeneID:30034110"
                     /translation="MMLAREFVRNQNARITDFSTNEADTPLIVQFGANNEVDLARAAK
                     MIMPYTDGIGLNCGCPIKEQVREGIGAALMTDPERVASMVRAVKATCGPEFCVEVKIR
                     IHSDLQETVRFARLVEDAGADYITVHGRRKTQRSSEPANWEAIKLIKESVKCPVVANG
                     DAFTMDDVNKIVELTGVDGVMSARGILANPALFSGYNKTPWGAIELFWDYVTSYGLPF
                     RLTQHHFSEMVELEFTRKQKRSLNESNNLPELLDWFDARFDLKRRGEPGFGERVEFPW
                     KSTYHERELDNELNENASLNLASDLASVHLAS"
     gene            <726285..>727235
                     /locus_tag="AWJ20_2223"
                     /db_xref="GeneID:30034111"
     mRNA            <726285..>727235
                     /locus_tag="AWJ20_2223"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879153.1"
                     /db_xref="GeneID:30034111"
     CDS             726285..727235
                     /locus_tag="AWJ20_2223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737095.1"
                     /db_xref="GeneID:30034111"
                     /translation="MPSLNNGSIIGSIFGKGTVYESLDNSEDDNLYNLQLHIDDNQTT
                     TPLGGGVGIDPRAQDPRHDSEYNTSGNGGLAIGSVTETGRSGRRDSARNQPLMNSDDS
                     DESDDDDGPSDDILTERRNIYESAISSPPHVNHGTRLHPNYHHTDNVSDEVQEDGDNE
                     IPQSLMVEPTAKTTVSSGATLGSTANHGTVVKGGHGGSDISAINSNTTLHQMSSPKQA
                     RRIFSANDLGDQPSARFGSPNHTHRRSPLAMASGHGPPSSVLPLYKTDLKGNNLSASS
                     WSAAKSTHNLMIDPKERAKWKWANVENLDIFLQEVSTGSP"
     gene            <727652..>728827
                     /gene="ATG9"
                     /locus_tag="AWJ20_2224"
                     /db_xref="GeneID:30034112"
     mRNA            <727652..>728827
                     /gene="ATG9"
                     /locus_tag="AWJ20_2224"
                     /product="autophagy protein ATG9"
                     /transcript_id="XM_018879154.1"
                     /db_xref="GeneID:30034112"
     CDS             727652..728827
                     /gene="ATG9"
                     /locus_tag="AWJ20_2224"
                     /inference="similar to AA sequence:KEGG_Orthology:K17907"
                     /codon_start=1
                     /product="autophagy protein ATG9"
                     /protein_id="XP_018737096.1"
                     /db_xref="GeneID:30034112"
                     /translation="MQTISWKKVVEKIELLKNQNLGTSGKAATKGSAINSRQKLDKHS
                     IANRIMRKENYLVAMINKDILDLRVPLPFLRKKQFFTRTLEWNLSLCIMDYAFNEQGE
                     LRPIFLRESQRRLLSDGLRRRFLFAGIMNILCAPFIIAYLTLLYFFRYFNEYHRDPSA
                     IGTRQYTPLAEWKMRELNELSHLFQNRLNMSYPAASRYINQFPREKTVSVLRFVAFVC
                     GSFAAVLGIISLVDPELFLGFEITKDRTVLFYIGIFGSIVAISRSMIPDETLVFDPVT
                     SMMYVAEFTHYLPKEWEGRLHSDSVKAEFAAMYDLKIMIILNELASVIIAPFILWFSL
                     PNSCDRIIDFFREFSVHVDGLGYVCSFAMFNFDRVQKKNGVSIGYTHGGFYRLRQGD"
     gene            complement(<729549..>732047)
                     /gene="NOP14"
                     /locus_tag="AWJ20_2225"
                     /db_xref="GeneID:30034113"
     mRNA            complement(<729549..>732047)
                     /gene="NOP14"
                     /locus_tag="AWJ20_2225"
                     /product="Nop14p"
                     /transcript_id="XM_018879155.1"
                     /db_xref="GeneID:30034113"
     CDS             complement(729549..732047)
                     /gene="NOP14"
                     /locus_tag="AWJ20_2225"
                     /inference="similar to AA sequence:KEGG_Orthology:K14766"
                     /note="Nucleolar protein; forms a complex with Noc4p that
                     mediates maturation and nuclear export of 40S ribosomal
                     subunits; also present in the small subunit processome
                     complex, which is required for processing of pre-18S rRNA;
                     GO_component: GO:0030686 - 90S preribosome [Evidence IDA]
                     [PMID 12150911]; GO_component: GO:0030692 - Noc4p-Nop14p
                     complex [Evidence IPI] [PMID 12446671]; GO_component:
                     GO:0005739 - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005730 - nucleolus
                     [Evidence IEA]; GO_component: GO:0005730 - nucleolus
                     [Evidence IDA] [PMID 10684247]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 12068309]; GO_component:
                     GO:0005730 - nucleolus [Evidence IDA] [PMID 12150911];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0032040 - small-subunit
                     processome [Evidence IEA]; GO_component: GO:0032040 -
                     small-subunit processome [Evidence IDA] [PMID 12068309];
                     GO_function: GO:0030515 - snoRNA binding [Evidence IPI]
                     [PMID 12068309]; GO_process: GO:0000480 - endonucleolytic
                     cleavage in 5'-ETS of tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     15489292]; GO_process: GO:0000447 - endonucleolytic
                     cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and
                     LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000472 - endonucleolytic cleavage to
                     generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S
                     rRNA, LSU-rRNA) [Evidence IMP] [PMID 15489292];
                     GO_process: GO:0000462 - maturation of SSU-rRNA from
                     tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 12068309]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IEA]; GO_process:
                     GO:0006364 - rRNA processing [Evidence IMP] [PMID
                     11694595]; GO_process: GO:0042274 - ribosomal small
                     subunit biogenesis [Evidence IMP] [PMID 11694595];
                     GO_process: GO:0042254 - ribosome biogenesis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Nop14p"
                     /protein_id="XP_018737097.1"
                     /db_xref="GeneID:30034113"
                     /translation="MAGSQLKQLKASLKANGLLGQTNTGKKGKRPNSSHDRKDRDKAI
                     QSIREAFNPFDVKVTKQKVDVIGRTIQGAQGKPGISKQVGEENRRRAYEVMAKKNKAG
                     GIIDRRFGENDANMTPEEKMLARFTREKLTGLASRKESLFNLEDDDGEDDTLTHYGQS
                     LSLTDDFEQDDLGVDEDDEETKEIIRKRRMMMVNGNEEEEGESSAPKSKKEVMQEIIA
                     KSKMYKYERQQAKEEDLHIIDELDAQENLDELLEDLNAYDRKHTVPKAESAERDEEYE
                     QRVREMAFDRRAQPTDRTKTEEELAKEKAEKTRKLEQDRLARMDGEIYNDDDDDIGHT
                     SDSGSGEEDEGEGDEDVNDAAEFGLDVRNFSDDYVSDGDNIDGSDEGEFLDEDDEEAE
                     SELSQPSKRRKVSESKPQYTCPETIDDLESILNQQTSSSEYPKVIERILDLYHPSKAV
                     GNKQKLGVFTTVLFEFLQKPNYTSNYPQVFTKMVEQLKTLTTSHVEVLTDFCREQILQ
                     VNEKLTATRLGDSTVAPADVLLFTLIGLVFSTSDHFHLVVTSATLVLAQHLSQSPLRS
                     AKDLLTNIFICDTLLAYQRISQRYIPEIPLFLQRLLTLSTSSEGAKDVAETLDIFVED
                     SDFHFDLDIKALKGLDGTLKLLDFVEPRDNLLERIFLHSLDTISTASNLWRDKLAYIE
                     IFGPITKLLEVHGDIHPLVASTRSKLEKLIAISTKERVPLTLQSHRPLPIQTFAPKFE
                     ENYNVDKKSYDPDRERNEGNKLRAELKKERKGALRDLRRDNAFIAREKIKTKRQTDKE
                     YHEKLARLERTIQTEEGAEKNKYEREKQARKRKH"
     gene            complement(<734402..>738736)
                     /gene="mus7"
                     /locus_tag="AWJ20_2226"
                     /db_xref="GeneID:30034114"
     mRNA            complement(<734402..>738736)
                     /gene="mus7"
                     /locus_tag="AWJ20_2226"
                     /product="DNA repair protein Mus7/Mms22"
                     /transcript_id="XM_018879156.1"
                     /db_xref="GeneID:30034114"
     CDS             complement(734402..738736)
                     /gene="mus7"
                     /locus_tag="AWJ20_2226"
                     /codon_start=1
                     /product="DNA repair protein Mus7/Mms22"
                     /protein_id="XP_018737098.1"
                     /db_xref="GeneID:30034114"
                     /translation="MPLEDGYISDSEGSLYDEVITRSLTAYEPPDYELDHNSRIPLTN
                     EVQSENQRLNADVQQQSDLLLEELSGNGFESGANIELARKPQSSRESATQNKIDLPPG
                     SQEDREQPQLPIIPDSSITTTISAESSTSDGLSTEHPHTAQTSLEENEIVNAVAIVEA
                     RSGRSLRQRTVLQLHPYTLEYELYRRSLKSRGIRPVVVPSQGKSSGPDPQLPQNSSSQ
                     QETPSQSQLYPESMGDDMNSEDIAYEENNETFGTTFSSPPPSSPIPPVSLPSKTTKGR
                     AAKLKALDPDEHLYANAFSQGSSAASSEDEAIDRILLAKQRRRRQLFKTIARPETESH
                     SRPNSGTDSADSSKFNSSSDSGESDSESEPELASEIELLKKKVRGVLPPSFITIDYTL
                     QHQNKNKTNKKKTNSSTENNHKGVARKKIGNSTQRPLSPAPFGFTSSRTASPPAYTRT
                     TPKAPSLTPPVLASPIRTDSVDNNHRPILISSDDDFGLPGQFEPLDDLVDPSDMEDDH
                     IDTMNGPSKGGSSRNPQTRPRKRLAQSTIDGNSKDTRYKHKRPRGSVRHTNHQTRITG
                     KSTKRRPQGHHNSKVTAEARQSQNSTTQQMSIVDLIDNSTSTERNNMPRFSLIAQRSA
                     LLKAHEQRLDSPTHKYIVINDGDESHPELKTLKRWKRGRLRQTNKLGSYSNVRQHHQS
                     VRSDNNYRTAPTSVRERKEQSKPRRKLPTQLLTKKNPSLSVVSRGNSYYQSKSPQFRT
                     TIIEIESGEYSVAKPMNSVRPKQYPALSPLQSISPGMRPMYPLRHENLPRTHSNSSLS
                     FASSRPEVENNRVTREYKSKKQILRPPQRRTEYDDTQLVGDMDHLQPITSLVGAPHLS
                     SMDAVPNRPFQGRRFYSYQFDVQPFAHDVVFATDTIVYNCVVQRPLGSKRDAIFLGNG
                     IGLVEAKVEDHGLRIPKISEAYNRFHIWIEDCLSPEVASKDYSLDVYEFFLFVLPLVS
                     DGNSPSYDQDFVKELSRLTLGLVADILDVWSRPFANTKMSTASSEFAQLTFTTASLCL
                     LLLHRLKDLLKTDPTTMYSHSNAIRNLGGKLVQLIVSNFLPEVSNIMRSHRSTSNRVI
                     TRTSYILEIIYIAIHVLDNEVKGDGFYDMLNSVITLPQLLRNPEDLDSVERVWHSVFI
                     FSAVYKLPKLTLQSNWKLVNILQGLTLTTFDSPGQQTLAIPYQRVFLVRCLKLATDWK
                     WENNPALCISIYKFFAGRRFSNIEPSVPSGLSPFLSNGNFTEVVTTDSAYNIFLKLVA
                     WTICFFQGDDNRLRKFIGILTPLNGRLYPMSSGLKVTDLDALGNQYSLLLVQFKYGRP
                     STRPTIDHFRSFIVLEQSHILARNLSLEAWFVVTKLLLEQDMDLDDTMKWFAEIVDSA
                     LKDTRKTGRYTSNLERELDYQNVVTYQKFFEKAVVSIDKLVSNQAVISKSRQWMNLLT
                     PCKYRQIP"
     gene            <741159..>742592
                     /gene="CLD1"
                     /locus_tag="AWJ20_2227"
                     /db_xref="GeneID:30034115"
     mRNA            <741159..>742592
                     /gene="CLD1"
                     /locus_tag="AWJ20_2227"
                     /product="Cld1p"
                     /transcript_id="XM_018879157.1"
                     /db_xref="GeneID:30034115"
     CDS             741159..742592
                     /gene="CLD1"
                     /locus_tag="AWJ20_2227"
                     /inference="similar to AA sequence:KEGG_Orthology:K13535"
                     /note="Mitochondrial cardiolipin-specific phospholipase;
                     functions upstream of Taz1p to generate
                     monolyso-cardiolipin; transcription increases upon
                     genotoxic stress; involved in restricting Ty1
                     transposition; has homology to mammalian CGI-58;
                     GO_component: GO:0005743 - mitochondrial inner membrane
                     [Evidence IDA] [PMID 23637464]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 19244244];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0004623 - phospholipase A2 activity
                     [Evidence IDA,IMP] [PMID 19244244]; GO_function:
                     GO:0016740 - transferase activity [Evidence IEA];
                     GO_process: GO:0035965 - cardiolipin acyl-chain remodeling
                     [Evidence IMP] [PMID 19244244]; GO_process: GO:0035965 -
                     cardiolipin acyl-chain remodeling [Evidence IMP] [PMID
                     23637464]; GO_process: GO:0032048 - cardiolipin metabolic
                     process [Evidence IDA,IGI] [PMID 19244244]"
                     /codon_start=1
                     /product="Cld1p"
                     /protein_id="XP_018737099.1"
                     /db_xref="GeneID:30034115"
                     /translation="MAEVQQAPASAAINEPSSATQTKSGGRSVTTGAVKKERHVLTYR
                     ESFSQWLKAPSHEEAERNVLSLLDFFPESDGKRVAKVNKVDIGNKLHINEFEIVNVEK
                     PDDVTEAGSEYSKNLVVLHGYGAGLALFYRNFAEWSSIKGSRTMALDLLGFGRSSRPK
                     FSIATKDVSARDENGRFKVVVETENWFIDALEKWRIAKNLDKFTLMGHSMGGYLAAAY
                     AFKYPSRVERLIMVSPAGVERGYTPELDNVRLFGGNSTDSLPKQSAKNKPSSSRQSSD
                     APHIDEEVSVSQSDITHHHHNELHPSDSHSSLVNEASTSNRKLPNWFMYLWNRNISPF
                     VLLRSAAIFAPRMTSNWTSRRFSDVSEKERDIMHMYAYKTFTAPGSGEYGLTRLLAAG
                     AVAREPLVDRVVKGLKCPSVWIYGENDWMNVHAGEEAVLRLNKLGTSSAANAKSHVID
                     YAGHHVYLDNPSDFDRVVVDFLKTTNH"
     gene            <742913..>743299
                     /locus_tag="AWJ20_2228"
                     /db_xref="GeneID:30034116"
     mRNA            <742913..>743299
                     /locus_tag="AWJ20_2228"
                     /product="oxidoreductase"
                     /transcript_id="XM_018879158.1"
                     /db_xref="GeneID:30034116"
     CDS             742913..743299
                     /locus_tag="AWJ20_2228"
                     /inference="similar to AA sequence:KEGG_Orthology:K16066"
                     /note="NADP(+)-dependent serine dehydrogenase and carbonyl
                     reductase; acts on serine, L-allo-threonine, and other
                     3-hydroxy acids; green fluorescent protein fusion protein
                     localizes to the cytoplasm and nucleus; may interact with
                     ribosomes, based on co-purification experiments;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005840 - ribosome [Evidence IDA] [PMID
                     16702403]; GO_function: GO:0004090 - carbonyl reductase
                     (NADPH) activity [Evidence IDA] [PMID 18630881];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IDA] [PMID 17962934];
                     GO_function: GO:0031132 - serine 3-dehydrogenase activity
                     [Evidence IDA] [PMID 12535615]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IC] [PMID 12535615];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_018737100.1"
                     /db_xref="GeneID:30034116"
                     /translation="MKFSVSSFVFKSLTSTLARNSIRKMSSYGSSAGSRIAGKTVLIT
                     GASAGIGEATAYELAEASGGDIRLILSARRVENLSKISKDLEAKYPKVKVLPLALDVS
                     KYKEIPQWVKDIPQEWSNVDVLINNA"
     gene            <743406..>743729
                     /locus_tag="AWJ20_2229"
                     /db_xref="GeneID:30034117"
     mRNA            <743406..>743729
                     /locus_tag="AWJ20_2229"
                     /product="oxidoreductase"
                     /transcript_id="XM_018879159.1"
                     /db_xref="GeneID:30034117"
     CDS             743406..743729
                     /locus_tag="AWJ20_2229"
                     /inference="similar to AA sequence:KEGG_Orthology:K16066"
                     /note="NADP(+)-dependent serine dehydrogenase and carbonyl
                     reductase; acts on serine, L-allo-threonine, and other
                     3-hydroxy acids; green fluorescent protein fusion protein
                     localizes to the cytoplasm and nucleus; may interact with
                     ribosomes, based on co-purification experiments;
                     GO_component: GO:0005737 - cytoplasm [Evidence IDA] [PMID
                     14562095]; GO_component: GO:0016021 - integral component
                     of membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_component: GO:0005840 - ribosome [Evidence IDA] [PMID
                     16702403]; GO_function: GO:0004090 - carbonyl reductase
                     (NADPH) activity [Evidence IDA] [PMID 18630881];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA,IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IDA] [PMID 17962934];
                     GO_function: GO:0031132 - serine 3-dehydrogenase activity
                     [Evidence IDA] [PMID 12535615]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0008152 -
                     metabolic process [Evidence IC] [PMID 12535615];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="oxidoreductase"
                     /protein_id="XP_018737101.1"
                     /db_xref="GeneID:30034117"
                     /translation="MVHGNDKVGDIAPEDIDIMYHTNVLGLITLTQQFIPKFRAQGHG
                     DVINIGSIAGRDPYPGGAIYCSTKAALRSFTETLRKETIDTRIRVIEIQPGAVETEFS
                     SKLRN"
     gene            complement(<744276..>745268)
                     /locus_tag="AWJ20_2230"
                     /db_xref="GeneID:30034119"
     mRNA            complement(<744276..>745268)
                     /locus_tag="AWJ20_2230"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879161.1"
                     /db_xref="GeneID:30034119"
     CDS             complement(744276..745268)
                     /locus_tag="AWJ20_2230"
                     /inference="similar to AA sequence:KEGG_Orthology:K00450"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737102.1"
                     /db_xref="GeneID:30034119"
                     /translation="MTPTSTSTERSQQQSKLIDSLPPHNVEPLWTVMSAMVPPVPQPK
                     AIPNVWNYKELRPLLLESGRVVNEHEAERRVLMLINPALTAPQTTDTLYAGLQLINPG
                     ETAPAHRHQAFALRFIIEGSGGFTAVEGKKLYMERGDVILTPRWEWHDHGKEGEGPMI
                     WLDGLDLPMFQSIPVNFAEGYAEKRYPSTPEVGDSPIKYPWAEVQKTLDSSSSSHAIY
                     NYVSKVKGKQGKHLSTIIGAQAERISPSSSSPLRQESSSFIVHVYSGKGYTVVNHNEQ
                     EQKLIWNQHDTFCIPSWVKFQHFNHSDDEQAYLFSYSDTPLLENLALHRVAKFD"
     gene            <745659..>746543
                     /gene="FMP41"
                     /locus_tag="AWJ20_2231"
                     /db_xref="GeneID:30034120"
     mRNA            <745659..>746543
                     /gene="FMP41"
                     /locus_tag="AWJ20_2231"
                     /product="Fmp41p"
                     /transcript_id="XM_018879162.1"
                     /db_xref="GeneID:30034120"
     CDS             745659..746543
                     /gene="FMP41"
                     /locus_tag="AWJ20_2231"
                     /note="hypothetical protein; GFP-fusion protein is induced
                     in response to the DNA-damaging agent MMS; the authentic,
                     non-tagged protein is detected in highly purified
                     mitochondria in high-throughput studies; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0046872 - metal ion binding
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0006950 -
                     response to stress [Evidence IEA]"
                     /codon_start=1
                     /product="Fmp41p"
                     /protein_id="XP_018737103.1"
                     /db_xref="GeneID:30034120"
                     /translation="MVAWKRLIRFVATDGKVYRGEPIISENQDLGKLAEDGTKLSAKL
                     IKGDDIFSEDTVVTNEVLEVSKLLGPLAPTDVPIVKCVGLNYMKHIQEGGRTPPPYPS
                     IFYKPNFAVADHGEDIPIPKISQENQLDYEGELCVVIGKTGKDIKEEDALSYVAGYTA
                     GNDVSARTWQRDPKYAGGVPQWGFSKSFDKYAPLGPVLVSTSEIQNPGTLELKTLVNG
                     EVRQHTNTDDLLFNVAKIIAFISQGTTLEKGTVIMTGTPSGVAMGMKPTPKYLHANDV
                     VEVYISSIGTLKNKMHFI"
     gene            complement(<746887..>747297)
                     /locus_tag="AWJ20_2232"
                     /db_xref="GeneID:30034121"
     mRNA            complement(<746887..>747297)
                     /locus_tag="AWJ20_2232"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879163.1"
                     /db_xref="GeneID:30034121"
     CDS             complement(746887..747297)
                     /locus_tag="AWJ20_2232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737104.1"
                     /db_xref="GeneID:30034121"
                     /translation="MSAEGSCLCGAVGFTAPTTPIATLACYCSDCRKGSGHLGQILAK
                     YNESDVKIHDDKKVLKEYIVTATQSGFIKKKLFCGECGCTLLTIPTKHEGLYMVRSTL
                     MDDPEIWRNNFVPAKALFDDSRKAYLANVDTQIV"
     gene            <748030..>750690
                     /gene="ASG1"
                     /locus_tag="AWJ20_2233"
                     /db_xref="GeneID:30034122"
     mRNA            <748030..>750690
                     /gene="ASG1"
                     /locus_tag="AWJ20_2233"
                     /product="Asg1p"
                     /transcript_id="XM_018879164.1"
                     /db_xref="GeneID:30034122"
     CDS             748030..750690
                     /gene="ASG1"
                     /locus_tag="AWJ20_2233"
                     /note="Zinc cluster protein proposed to be a
                     transcriptional regulator; regulator involved in the
                     stress response; null mutants have a respiratory
                     deficiency, calcofluor white sensitivity and slightly
                     increased cycloheximide resistance; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19111667]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 19158363]; GO_function: GO:0000981 -
                     sequence-specific DNA binding RNA polymerase II
                     transcription factor activity [Evidence IEA]; GO_function:
                     GO:0008270 - zinc ion binding [Evidence IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0006357 - regulation of transcription from RNA
                     polymerase II promoter [Evidence IEA]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA,IEA]; GO_process: GO:0006950 - response to
                     stress [Evidence IEA]; GO_process: GO:0006366 -
                     transcription from RNA polymerase II promoter [Evidence
                     IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Asg1p"
                     /protein_id="XP_018737105.1"
                     /db_xref="GeneID:30034122"
                     /translation="MDGIKKSHQQVDGQGLESHSIVGERVDRSPIQEYDDSMYNDSSS
                     TKRRRVNLACVQCRDRKVRCDGAQPSCGRCNSRGTNCTYAKKFARARVSAEYVRELEE
                     KLGLVGGSDSRDWSQAPTSPGPRTVSTISLEEATSGVGSAIPSQSEQQGPGVHSINEG
                     MFGENQSNSSQLLHHNSSFAVIPRTSQDSNMHSLGSNQLNANSISPSTTYSINSIDIS
                     PNGTADSNQPGTLSNSLKTSTDAGTSLSASISSRPKTVSSSSAFGDPEDPTTAADAMG
                     ATAKKTNARRQDFYGSSSAMSFMKLVEAAVNAGKGNSNMRANESEGSKNFAPHKYKMA
                     YSCAPSYLTGGSAKEEDWVVPPRRLADHYVQSYFTYVYSLYPFIHQTSFMTAYNSVWV
                     SDSEQTDTNNGNGNGTGTSRSDAFAKGSYGNNRINDGFDDSSDDELNDGHMFYCIMNM
                     VFAFGCLFSSGVESISRESSSQVYFDRAREHLNFDVLATGDSGSLILLQALLLIGQYL
                     QATQRPAACWNVVGLAIRVAQELGLHQEHHIASRPSVIEQELCRRLWYGCTLMDRIVS
                     MTFGRPLMVTQDFKVNPPAFLDDSYITDSGTITPPKSSPPSILGFYQQTILLYDILAD
                     ILQNVYDTHDSTAVDDDEQRLLVLTNILKTDCRLNKFKKNIPPHLQVEKILQHPPSNP
                     FARQTNVLQARILHLEIMLYRPIVLSNSTLKGKQSPLNNDSSLQLSLENTICRLCVMS
                     AINLIKLIFDNKDSPNVPAIWYNIFYIYTSASVLMAAKLRPSLKSELDSESMEAAWKM
                     ALHLLRIFEQTGPSATRCLRILEVLHDKISSASHHQSKPMFDFLPNLVDSEIDFGPDS
                     DLLYSMMNDAYGPFSSNTIDFHYLDNLPGL"
     gene            complement(<750899..>752398)
                     /gene="HOL1"
                     /locus_tag="AWJ20_2234"
                     /db_xref="GeneID:30034123"
     mRNA            complement(<750899..>752398)
                     /gene="HOL1"
                     /locus_tag="AWJ20_2234"
                     /product="Hol1p"
                     /transcript_id="XM_018879165.1"
                     /db_xref="GeneID:30034123"
     CDS             complement(750899..752398)
                     /gene="HOL1"
                     /locus_tag="AWJ20_2234"
                     /note="Putative transporter in the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; mutations in membrane-spanning domains permit
                     cation and histidinol uptake; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005886 - plasma
                     membrane [Evidence ISS] [PMID 8955402]; GO_function:
                     GO:0015665 - alcohol transmembrane transporter activity
                     [Evidence IMP] [PMID 2405251]; GO_function: GO:0022890 -
                     inorganic cation transmembrane transporter activity
                     [Evidence IMP] [PMID 8955402]; GO_process: GO:0006812 -
                     cation transport [Evidence IMP] [PMID 8955402];
                     GO_process: GO:0015850 - organic hydroxy compound
                     transport [Evidence IMP] [PMID 2405251]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Hol1p"
                     /protein_id="XP_018737106.1"
                     /db_xref="GeneID:30034123"
                     /translation="MSDLEIKHPNGSPFTDQEKNIGSQHEEQYPPPSELNTEYILQRH
                     GTLELDPMPSHDPLDPLNWPALKKHLHLALIAYSCMLVTFGAAGIVPAYPGMAEEYGV
                     SIPTCSYFTSAQILISGIVPIFTTPIMNKYGRKKIQVISCLCCCAANIGGGFAKTYGQ
                     QMATRVLVGLFVSPSLGLGAVLVTEMFFSHQRGSKNGWWSLMITLGTPGGPFIMGFVV
                     KYAAIKWVYFILAIMNFVAFLGWMIASETLWERDGIVVNEPDSLFKFKSKSNVTINLW
                     SFIAPLAEAREIRVFIPSLAYAVVFCYANIVLIVETPQVFGPKFGLDAVGLGLQMIAV
                     LVGSIIGEVMSGPLSDWWMTRCVRKRGVKVIEDRLTLSYIGFILAMVGIIVWGVRLEQ
                     ATPMKWNITPLVGAAIAACGNQIVTTILITYSIDVDYKRSIEIGNFINFFRQTYGFIG
                     PFYFPDMFDNLGFSGAGGLMAGLMGVVSLASVLALQLYFTKRAKKTLGI"
     gene            <753434..>754681
                     /locus_tag="AWJ20_2235"
                     /db_xref="GeneID:30034124"
     mRNA            <753434..>754681
                     /locus_tag="AWJ20_2235"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879166.1"
                     /db_xref="GeneID:30034124"
     CDS             753434..754681
                     /locus_tag="AWJ20_2235"
                     /inference="similar to AA sequence:KEGG_Orthology:K00480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737107.1"
                     /db_xref="GeneID:30034124"
                     /translation="MVSVKNKFKIIVCGGGLGGLGCAIGLALNGHHVIVLEAASEINE
                     VGAGIQIPPNCVKVLNEYGVAEKLKKYVTKPANINLRRYSTGEILNATKLDPHMTETY
                     GFPYWLIHRADYQRVLWDYALSIGVAIKTCSRIDSVDDATHTVKLVDGTTYTGDLIVG
                     ADGIRSKVRDSAVVDEEVVLPTPSSNCAYRATVPAEEMLADPVIAHLMTDINSNCWIG
                     YRRHVMAYPIRNGKMYNIVMSHPGQAAVGKWAEPGDIEEMKNHYKNFDPVVVQLLTHV
                     KTVLKWVLADLPTLPRWVSKSGQTVLIGDAAHAMLPYLAQGAAQAIEDGACISSLLSQ
                     CETEKDIPDAMRKYEKRRKLRCEKIQRGARDNGYIWHMPDGEEQEQRDSDMKLQPADK
                     KNPNQWSDPLFQKWMFGWDAFRD"
     gene            complement(<754829..>756262)
                     /gene="CYB2"
                     /locus_tag="AWJ20_2236"
                     /db_xref="GeneID:30034125"
     mRNA            complement(<754829..>756262)
                     /gene="CYB2"
                     /locus_tag="AWJ20_2236"
                     /product="Cyb2p"
                     /transcript_id="XM_018879167.1"
                     /db_xref="GeneID:30034125"
     CDS             complement(754829..756262)
                     /gene="CYB2"
                     /locus_tag="AWJ20_2236"
                     /inference="similar to AA sequence:KEGG_Orthology:K00101"
                     /note="Cytochrome b2 (L-lactate cytochrome-c
                     oxidoreductase); component of the mitochondrial
                     intermembrane space, required for lactate utilization;
                     expression is repressed by glucose and anaerobic
                     conditions; GO_component: GO:0005758 - mitochondrial
                     intermembrane space [Evidence IEA]; GO_component:
                     GO:0005758 - mitochondrial intermembrane space [Evidence
                     IDA] [PMID 3004948]; GO_component: GO:0005758 -
                     mitochondrial intermembrane space [Evidence IDA] [PMID
                     6290489]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 11502169]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0070469 - respiratory chain [Evidence
                     IEA]; GO_function: GO:0010181 - FMN binding [Evidence
                     IEA]; GO_function: GO:0004460 - L-lactate dehydrogenase
                     (cytochrome) activity [Evidence IEA]; GO_function:
                     GO:0004460 - L-lactate dehydrogenase (cytochrome) activity
                     [Evidence IDA] [PMID 3004948]; GO_function: GO:0003824 -
                     catalytic activity [Evidence IEA]; GO_function: GO:0020037
                     - heme binding [Evidence IEA]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0016491
                     - oxidoreductase activity [Evidence IEA,IEA]; GO_process:
                     GO:0006089 - lactate metabolic process [Evidence IMP]
                     [PMID 8492799]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="Cyb2p"
                     /protein_id="XP_018737108.1"
                     /db_xref="GeneID:30034125"
                     /translation="MVKVLAEEIKKHTTKESCWVVLHGKVYDVTDFLSRHPGGQKAIL
                     RVAGKDATEEFDIIHPEGTLKSLSSSAYIGEVEDIENLKDTPETSNESKLGTVALPAL
                     DAMLNLDDFEKTAQKVISAKGWAYYYSASDDLVTKVYNNEVYRKVLLRPRIFKDVETV
                     STVSKIQGLVTTLPLFVSPAAMARLAHPSGEKGIAHACGSEGIVQMISNNASMKFEDI
                     VSDPIVSTQKFFYQLYVQNDRKISENVLSKVIATGRCHAIVLTLDAPTPGKREADERV
                     ANDGKTFSENSGGIAKTETSEGLGRALFAGTSARLLWDDLHWLRKQIPADMPIILKGL
                     QTYEDALIAATQWAPKGLVHGILLSNHGGRAMDQSQPPLMILQEIRKYAPEVFSSIEV
                     YVDGGIRRGTDVVKALCLGAKQVGIGRAALYGLAGYGEQGVQRTIQILREEIETCMRL
                     LGVNSVEELGPQHVNTRQLDNLVYSRL"
     gene            <761325..>762437
                     /locus_tag="AWJ20_2237"
                     /db_xref="GeneID:30034126"
     mRNA            <761325..>762437
                     /locus_tag="AWJ20_2237"
                     /product="protein MET30"
                     /transcript_id="XM_018879168.1"
                     /db_xref="GeneID:30034126"
     CDS             761325..762437
                     /locus_tag="AWJ20_2237"
                     /codon_start=1
                     /product="protein MET30"
                     /protein_id="XP_018737109.1"
                     /db_xref="GeneID:30034126"
                     /translation="MLFSGLKQGVALSKITTGAMVLNVMIWEGSKQASSFGSNSGSSA
                     ASSLTSSVGSGYTSTSGSRTVSSSGSVSSGSDLSTLSPDSSAATGSKAIESGNLELPP
                     LSTGNSTAIVSCADKSIRFYSLTSGKLIRTIKGLHGSSAVRFIRRLSNTHLITAGLDG
                     RLIVSNFTTGEVSAIFRAHSSYITSLDVWGGYVVSTGFDKIVNVFKIIDESGALKNMA
                     SVKLDVCPTGAKIVALDPSNNDIIEKESMDDTLRESSPSSPGHTFKEGFIPAVILCKQ
                     DTTYMFFYSLHSLRLLNKVNLCDADYGSDSFTPLDIAVDEQRLRYAVATNHVPYMRII
                     TGFVGKTTIVNNLAVFSPQDQYSAPQLVWSKSGKVS"
     gene            complement(<762866..>763429)
                     /gene="ANT1"
                     /locus_tag="AWJ20_2238"
                     /db_xref="GeneID:30034127"
     mRNA            complement(<762866..>763429)
                     /gene="ANT1"
                     /locus_tag="AWJ20_2238"
                     /product="Ant1p"
                     /transcript_id="XM_018879169.1"
                     /db_xref="GeneID:30034127"
     CDS             complement(762866..763429)
                     /gene="ANT1"
                     /locus_tag="AWJ20_2238"
                     /note="Peroxisomal adenine nucleotide transporter;
                     involved in beta-oxidation of medium-chain fatty acid;
                     required for peroxisome proliferation; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 11914276];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence ISM] [PMID 12192589];
                     GO_component: GO:0005779 - integral component of
                     peroxisomal membrane [Evidence IDA] [PMID 11566870];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0005778 - peroxisomal membrane [Evidence
                     IEA]; GO_component: GO:0005777 - peroxisome [Evidence
                     IEA]; GO_function: GO:0000295 - adenine nucleotide
                     transmembrane transporter activity [Evidence IMP] [PMID
                     11390660]; GO_function: GO:0000295 - adenine nucleotide
                     transmembrane transporter activity [Evidence IDA] [PMID
                     11566870]; GO_process: GO:0015867 - ATP transport
                     [Evidence IDA] [PMID 11566870]; GO_process: GO:0006635 -
                     fatty acid beta-oxidation [Evidence IGI,IMP] [PMID
                     11390660]; GO_process: GO:0006635 - fatty acid
                     beta-oxidation [Evidence IGI,IMP] [PMID 11566870];
                     GO_process: GO:0006811 - ion transport [Evidence IEA];
                     GO_process: GO:0007031 - peroxisome organization [Evidence
                     IMP] [PMID 11390660]; GO_process: GO:0015992 - proton
                     transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ant1p"
                     /protein_id="XP_018737110.1"
                     /db_xref="GeneID:30034127"
                     /translation="MLGALAGALAQIFTIPISVVTTKQQTSDVQQSLVATAKDVIGED
                     GVSGLWRGLKASLVLVVNPSITYGSFERLKQVLFANKPTLSAGDNFLLGALSKAMATI
                     ATQPMIVAKVMQQSSDKRRRQYKSFVDALVYLSKNEGLKGLFKGLGPQISKGVLVQGL
                     LFMIKDQVELFLILFFRLIKQRLALAT"
     gene            complement(<763913..>764125)
                     /locus_tag="AWJ20_2239"
                     /db_xref="GeneID:30034128"
     mRNA            complement(<763913..>764125)
                     /locus_tag="AWJ20_2239"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879170.1"
                     /db_xref="GeneID:30034128"
     CDS             complement(763913..764125)
                     /locus_tag="AWJ20_2239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737111.1"
                     /db_xref="GeneID:30034128"
                     /translation="MAVISKQLITSATAATTVAAAPLSPWGKAVAGALAAMAANALVY
                     PLDIVKTRLQVQTEDDDLETGEKRVK"
     gene            <765230..>766144
                     /gene="ICL1"
                     /locus_tag="AWJ20_2240"
                     /db_xref="GeneID:30034130"
     mRNA            <765230..>766144
                     /gene="ICL1"
                     /locus_tag="AWJ20_2240"
                     /product="isocitrate lyase 1"
                     /transcript_id="XM_018879172.1"
                     /db_xref="GeneID:30034130"
     CDS             765230..766144
                     /gene="ICL1"
                     /locus_tag="AWJ20_2240"
                     /inference="similar to AA sequence:KEGG_Orthology:K01637"
                     /note="Isocitrate lyase; catalyzes the formation of
                     succinate and glyoxylate from isocitrate, a key reaction
                     of the glyoxylate cycle; expression of ICL1 is induced by
                     growth on ethanol and repressed by growth on glucose;
                     GO_component: GO:0005575 - cellular_component [Evidence
                     ND]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_function: GO:0003824 - catalytic activity
                     [Evidence IEA]; GO_function: GO:0004451 - isocitrate lyase
                     activity [Evidence IEA,IEA]; GO_function: GO:0004451 -
                     isocitrate lyase activity [Evidence IMP,ISS] [PMID
                     1551398]; GO_function: GO:0016829 - lyase activity
                     [Evidence IEA]; GO_process: GO:0019752 - carboxylic acid
                     metabolic process [Evidence IEA]; GO_process: GO:0006097 -
                     glyoxylate cycle [Evidence IEA,IEA]; GO_process:
                     GO:0006097 - glyoxylate cycle [Evidence TAS] [PMID
                     11092862]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0006099 - tricarboxylic
                     acid cycle [Evidence IEA]"
                     /codon_start=1
                     /product="isocitrate lyase 1"
                     /protein_id="XP_018737112.1"
                     /db_xref="GeneID:30034130"
                     /translation="MSSPAAKFRQLLSEPGVIIAPGVYDGLSARAATSSKAFKALYMT
                     GAGTVASRLGAPDVGLASLPDMAANASLIANIDRSVPLIADADTGYGNSAMCARTLSL
                     YSQAGVAALHVEDQVHSKRCGHLLGKQLVSAEEFVSRIKAMAIERKRIQSDIVIIART
                     DSLQSLGVDEAIERSKQAVAVGADVIFVEGVENSEQAKKIVSALNPTPVLVNIVPNGV
                     TPNWSEEEIQELGFKIAIFPGVTLGPAFAAMSASLEALAKTRKDPTGAAAVAQKSSPK
                     EFFLRLGLGEIIALDKAVGGTAFEGSNI"
     gene            <766804..>768255
                     /locus_tag="AWJ20_2241"
                     /db_xref="GeneID:30034131"
     mRNA            <766804..>768255
                     /locus_tag="AWJ20_2241"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879173.1"
                     /db_xref="GeneID:30034131"
     CDS             766804..768255
                     /locus_tag="AWJ20_2241"
                     /inference="similar to AA sequence:KEGG_Orthology:K17724"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737113.1"
                     /db_xref="GeneID:30034131"
                     /translation="MITEPETASDAPSPTVELCKWVESLTWDDVPEEIRTRAKYLILD
                     GITCAIVASHLPWSETAVKAVSSIEGEGPCHVIGWKDLKVGPLQSALLNSTFIQGFEL
                     DDYHSFAPLHSNSIMVPAILALVSYGKHKGISYSGKDFLLAHVVGFEVGPRVGLALHG
                     GEILNRGWHSGPVFGHAASAAASSKFLGLNSEQIEDAFGIACTQTCGLMSAQFESSVK
                     RMQHGFASRNGLFAALMAEQSYKGIKRVFEREYGGFLNVFSLGAEPPVVEELTKDLSE
                     KWITPEINIKPYACMAGIHSTIDALYELFDKKPLQNAMDVVKQVTIEISEPLFKHGGW
                     KATKPLTVIGAQMNNAYICAVILLDGVLTVKNFSEKLMNRPEIWELMEKIDVVHNKEF
                     DTLPRTDRMIAAVKIEFTDGTIKTNTVVRPSGVKAPLSGDEIVDKFRTHTKGLISDEA
                     QANILKTVLEIESSKDVSELVDALNIDILDPLK"
     gene            <768910..>770523
                     /locus_tag="AWJ20_2242"
                     /db_xref="GeneID:30034132"
     mRNA            <768910..>770523
                     /locus_tag="AWJ20_2242"
                     /product="carboxylesterase-lipase family protein"
                     /transcript_id="XM_018879174.1"
                     /db_xref="GeneID:30034132"
     CDS             768910..770523
                     /locus_tag="AWJ20_2242"
                     /codon_start=1
                     /product="carboxylesterase-lipase family protein"
                     /protein_id="XP_018737114.1"
                     /db_xref="GeneID:30034132"
                     /translation="MTSAPTIKRWEKHQLKFAGQGTLDGIKILEDDESGDVKCYRYTG
                     VRYAQAPVGPLRWRRPQKLSKTYDYTGDYTSFKTVCPQPSLSTISANDDIVYDEDCLF
                     ANIWVPGGTPPKEGWPVLYFIHGGFLQVGSPHHYRQADPQDLLAKDSKAKYIIVAAGY
                     RLNLFGFLSSKELLEEDKYNSNFGFWDQRMGMEWVYEHIHHFGGNKDNITVGGLSAGS
                     YSAIFQLAYELYHPEVTQIIKRSLLLSNGLAIQPNTVDKTQDQFDSLLKELDIPKSLS
                     AKEKLEKLRKVPFESLVKAIDGLDRQTFRAITDTYFVSPTLFDDIYSGKFGELVNTSG
                     RSLMSGEVDNEWLIYSLTNAPDTVDELAAKIENYYPRPVTNALIKHYPTPKPDDDDDL
                     QKVFGDIVSDMQVYVSSRLLVNSLAKAGMTTDRVFRYRIAFRGQYLDKYAPPEFRVPH
                     TGDIGIWFYTAFDGITDDEKPLFQQWLEPVAEWITTGTTAKWGTRSITDLRVFNRDGT
                     ITITPDDRWDWAMTVGRVVSSALSPGSKL"
     gene            complement(<770734..>771948)
                     /gene="CLB3"
                     /locus_tag="AWJ20_2243"
                     /db_xref="GeneID:30034133"
     mRNA            complement(<770734..>771948)
                     /gene="CLB3"
                     /locus_tag="AWJ20_2243"
                     /product="B-type cyclin CLB3"
                     /transcript_id="XM_018879175.1"
                     /db_xref="GeneID:30034133"
     CDS             complement(770734..771948)
                     /gene="CLB3"
                     /locus_tag="AWJ20_2243"
                     /inference="similar to AA sequence:KEGG_Orthology:K06659"
                     /codon_start=1
                     /product="B-type cyclin CLB3"
                     /protein_id="XP_018737115.1"
                     /db_xref="GeneID:30034133"
                     /translation="MKSASHSPQTGPYRRRPRKVNDHALDMMAKEMSQQVHSEYGQDI
                     IAHMDKMQRLTAADAGLMDLQPEIEWHMRPFLLDFLIDTHVALRLQPQTLFLAINLID
                     RYCSMRVVYRKHYQLVGCTALWIAAKYEDKKSRIPTINDLTNMCCKAYEGDMFVQMEG
                     HVLNTLNWTIGHPTVQSYLDVLVASESTSPTVRHVAQYLCEISLYHRAFISLTPSAIA
                     SAAFNLAKHLLTANDHAPFPVYLSSEENQTMSLLYQHMNSPSKSLHRKYSSSTLSQAT
                     HLVSSFLARQQRASLRMPPTPPPSSLLTNLTPPSLSSSVSSATNSPGESPIYATTARI
                     IPQHSKTMHIKIPAPFKSEGYLTPPCTPDDINGPLNNRSNSIASVASAASYHHNSAFT
                     SVPMEYTQSMET"
     gene            <782255..>783319
                     /gene="TNA1"
                     /locus_tag="AWJ20_2244"
                     /db_xref="GeneID:30034134"
     mRNA            <782255..>783319
                     /gene="TNA1"
                     /locus_tag="AWJ20_2244"
                     /product="Tna1p"
                     /transcript_id="XM_018879176.1"
                     /db_xref="GeneID:30034134"
     CDS             782255..783319
                     /gene="TNA1"
                     /locus_tag="AWJ20_2244"
                     /note="High affinity nicotinic acid plasma membrane
                     permease; responsible for uptake of low levels of
                     nicotinic acid; expression of the gene increases in the
                     absence of extracellular nicotinic acid or
                     para-aminobenzoate (PABA); GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005887 -
                     integral component of plasma membrane [Evidence ISS] [PMID
                     9678606]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0015663 - nicotinamide mononucleotide transmembrane
                     transporter activity [Evidence IMP] [PMID 10869563];
                     GO_process: GO:0015890 - nicotinamide mononucleotide
                     transport [Evidence IEP,IMP] [PMID 10869563]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Tna1p"
                     /protein_id="XP_018737116.1"
                     /db_xref="GeneID:30034134"
                     /translation="MMAFRFLMGVFETGYSPGVPYYLTFFYYRHEIAWRISVFCVAAP
                     IATTFSGALAYGITKNTNLAIASWRVLFLVESLPTIALGLWGYYALPNSSADSRFLTE
                     HEKNIAKARLARQISKVEMSRSFRVKDFLTSLIDPKVVLPMVMYFSINVSYSSLPVFT
                     PAIIHGMGFTSVNSQGLSAIPYIYTTVIVLLSCYLSDRWRVRGAFVTILSLKGAVGWL
                     LLALCKTTGVRYFALFLASSGIFSCVPLMLTWMSNNQGTEQKRGIGFMFINILGQTGP
                     LVGTRLFPASEAPLYIKGCWISFGFTVFLSTCSVVLALHLIYENRKLERKYGPAEDTT
                     QASNSVSEDGEVNPNFRYIW"
     gene            complement(<783493..>783963)
                     /locus_tag="AWJ20_2245"
                     /db_xref="GeneID:30034135"
     mRNA            complement(<783493..>783963)
                     /locus_tag="AWJ20_2245"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879177.1"
                     /db_xref="GeneID:30034135"
     CDS             complement(783493..783963)
                     /locus_tag="AWJ20_2245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737117.1"
                     /db_xref="GeneID:30034135"
                     /translation="MSRSLSKPSDFTGGIELEKIIASNRTKPLVIFIEGTTSNGKGLL
                     PFVSNVPISALPANTDIYPSVLKYTPPDPSTTPIPGSLPGWVIKVLSTQMTITARIKF
                     ANKLSTNPQNNEAAFANEIADSITRVGRIRKLGPAVDLAAKREFLSAWYRGRSS"
     gene            <784705..>785826
                     /gene="TAZ1"
                     /locus_tag="AWJ20_2246"
                     /db_xref="GeneID:30034136"
     mRNA            <784705..>785826
                     /gene="TAZ1"
                     /locus_tag="AWJ20_2246"
                     /product="Taz1p"
                     /transcript_id="XM_018879178.1"
                     /db_xref="GeneID:30034136"
     CDS             784705..785826
                     /gene="TAZ1"
                     /locus_tag="AWJ20_2246"
                     /inference="similar to AA sequence:KEGG_Orthology:K13511"
                     /note="Lyso-phosphatidylcholine acyltransferase; required
                     for normal phospholipid content of mitochondrial
                     membranes; major determinant of the final acyl chain
                     composition of the mitochondrial-specific phospholipid
                     cardiolipin; mutations in human ortholog tafazzin cause
                     Barth syndrome, a rare X-linked disease characterized by
                     skeletal and cardiomyopathy and bouts of cyclic
                     neutropenia; GO_component: GO:0016021 - integral component
                     of membrane [Evidence IEA]; GO_component: GO:0031307 -
                     integral component of mitochondrial outer membrane
                     [Evidence IDA] [PMID 16135531]; GO_component: GO:0016020 -
                     membrane [Evidence IEA]; GO_component: GO:0005743 -
                     mitochondrial inner membrane [Evidence IDA] [PMID
                     16880272]; GO_component: GO:0005741 - mitochondrial outer
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16880272]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 15304507]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 15588229]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0047184 - 1-acylglycerophosphocholine O-acyltransferase
                     activity [Evidence IEA]; GO_function: GO:0047184 -
                     1-acylglycerophosphocholine O-acyltransferase activity
                     [Evidence IMP] [PMID 15588229]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_function:
                     GO:0016746 - transferase activity, transferring acyl
                     groups [Evidence IEA,IEA]; GO_process: GO:0035965 -
                     cardiolipin acyl-chain remodeling [Evidence IMP] [PMID
                     14651618]; GO_process: GO:0032048 - cardiolipin metabolic
                     process [Evidence IMP] [PMID 14651618]; GO_process:
                     GO:0007007 - inner mitochondrial membrane organization
                     [Evidence IMP] [PMID 14651618]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0042775 -
                     mitochondrial ATP synthesis coupled electron transport
                     [Evidence IMP] [PMID 15304507]; GO_process: GO:0008654 -
                     phospholipid biosynthetic process [Evidence IMP] [PMID
                     14651618]; GO_process: GO:0008654 - phospholipid
                     biosynthetic process [Evidence IMP] [PMID 15588229];
                     GO_process: GO:0006461 - protein complex assembly
                     [Evidence IMP] [PMID 16135531]"
                     /codon_start=1
                     /product="Taz1p"
                     /protein_id="XP_018737118.1"
                     /db_xref="GeneID:30034136"
                     /translation="MSFQQISNNGYKFLTHYPRQNKYWKAASKATLGAVGLWSKLTLG
                     AISTPKMHNTDILTEAYRTSKLENRGLLTVMNHTSVLDEPLVWGGLLPVRHYFMKDGL
                     RWALGADNVCFKNSFTKMFFSLGQVLATKRFGVGPFQGSIDASINLLSSNQTKYSAES
                     ESNNGKGGIVLSASAASDSDSIPMNKSIIDRPGWVHIFPETFVHQPYPPHQHTLKYFH
                     WGVSRLILESSQPPIVVPIYTHGLEKIIPEDESYIGGLRKRLGSKVEFNVGMPLDESA
                     VASFRKEWLGMVRDQHKQGAIQALDISNNIYESLNEPLMTGTAARDLRSRVAAFVREG
                     VDATRLQLGFEQSDPRMADASFWHNQKEVRLAGKMHNRS"
     gene            <786879..>787613
                     /gene="HFI1"
                     /locus_tag="AWJ20_2247"
                     /db_xref="GeneID:30034137"
     mRNA            <786879..>787613
                     /gene="HFI1"
                     /locus_tag="AWJ20_2247"
                     /product="Hfi1p"
                     /transcript_id="XM_018879179.1"
                     /db_xref="GeneID:30034137"
     CDS             786879..787613
                     /gene="HFI1"
                     /locus_tag="AWJ20_2247"
                     /note="Adaptor protein required for structural integrity
                     of the SAGA complex; a histone
                     acetyltransferase-coactivator complex that is involved in
                     global regulation of gene expression through acetylation
                     and transcription functions; GO_component: GO:0005671 -
                     Ada2/Gcn5/Ada3 transcription activator complex [Evidence
                     IDA,IPI] [PMID 9154821]; GO_component: GO:0000124 - SAGA
                     complex [Evidence IDA] [PMID 9674426]; GO_component:
                     GO:0070461 - SAGA-type complex [Evidence IEA];
                     GO_component: GO:0046695 - SLIK (SAGA-like) complex
                     [Evidence IDA] [PMID 12446794]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_function: GO:0003713 -
                     transcription coactivator activity [Evidence IMP] [PMID
                     10048020]; GO_function: GO:0003712 - transcription
                     cofactor activity [Evidence IMP,IPI] [PMID 9154821];
                     GO_process: GO:0016568 - chromatin modification [Evidence
                     IDA] [PMID 9674426]; GO_process: GO:0016573 - histone
                     acetylation [Evidence IDA] [PMID 9674426]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006366 - transcription
                     from RNA polymerase II promoter [Evidence IMP] [PMID
                     9154821]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Hfi1p"
                     /protein_id="XP_018737119.1"
                     /db_xref="GeneID:30034137"
                     /translation="MASPALLMNGNLAKNILNGGSSAGSAASVGTPGPSNGGGLNLEG
                     NGMTGAITPAKTISGSALSTNPTLTVPTKAISANSPQAQSMTGNTSSSKRLDVDTIMI
                     EFQKSLGDNWDRYRDVITSFLIGRLTRFELQEELDQILDKNAIKLHNHFLLTNLANSL
                     RDPPPGEQGSLSGWFKKQKDGARNVKGDSQLAKLKEDILGLSVRERKRIKAIARVRKR
                     HNQPLFQARGSNPESLNSRASTPDSS"
     gene            <787761..>788573
                     /gene="HFI1"
                     /locus_tag="AWJ20_2248"
                     /db_xref="GeneID:30034138"
     mRNA            <787761..>788573
                     /gene="HFI1"
                     /locus_tag="AWJ20_2248"
                     /product="Hfi1p"
                     /transcript_id="XM_018879180.1"
                     /db_xref="GeneID:30034138"
     CDS             787761..788573
                     /gene="HFI1"
                     /locus_tag="AWJ20_2248"
                     /note="Adaptor protein required for structural integrity
                     of the SAGA complex; a histone
                     acetyltransferase-coactivator complex that is involved in
                     global regulation of gene expression through acetylation
                     and transcription functions; GO_component: GO:0005671 -
                     Ada2/Gcn5/Ada3 transcription activator complex [Evidence
                     IDA,IPI] [PMID 9154821]; GO_component: GO:0000124 - SAGA
                     complex [Evidence IDA] [PMID 9674426]; GO_component:
                     GO:0070461 - SAGA-type complex [Evidence IEA];
                     GO_component: GO:0046695 - SLIK (SAGA-like) complex
                     [Evidence IDA] [PMID 12446794]; GO_component: GO:0005634 -
                     nucleus [Evidence IEA,IEA]; GO_function: GO:0003713 -
                     transcription coactivator activity [Evidence IMP] [PMID
                     10048020]; GO_function: GO:0003712 - transcription
                     cofactor activity [Evidence IMP,IPI] [PMID 9154821];
                     GO_process: GO:0016568 - chromatin modification [Evidence
                     IDA] [PMID 9674426]; GO_process: GO:0016573 - histone
                     acetylation [Evidence IDA] [PMID 9674426]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006366 - transcription
                     from RNA polymerase II promoter [Evidence IMP] [PMID
                     9154821]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Hfi1p"
                     /protein_id="XP_018737120.1"
                     /db_xref="GeneID:30034138"
                     /translation="MLPKIPFINEKDKAKLQSGGTAASGAAGSGSSAATPASPNKQNK
                     GASPAVDTSSSSSNNNHSLANPMVWTQDIIHSYEAPLASEIYELPDNDSLNARMLGIS
                     LEHGLLHGIDNGVCDIMIAGLEHYLKDVVQQIFDKARLRKIPDSANTSIFEQSSPRTA
                     SVSGAASALTEPISKRGGSISQTTNPFSAPATSLAGSFEDTMTAEDMAMALDTAPHSF
                     VEMTGPVYRLKNTMLTDEESADPAERPPTPMFNSHIESQPEIANLLKDIMSS"
     gene            complement(<788880..>789293)
                     /locus_tag="AWJ20_2249"
                     /db_xref="GeneID:30034139"
     mRNA            complement(<788880..>789293)
                     /locus_tag="AWJ20_2249"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879181.1"
                     /db_xref="GeneID:30034139"
     CDS             complement(788880..789293)
                     /locus_tag="AWJ20_2249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737121.1"
                     /db_xref="GeneID:30034139"
                     /translation="MIIPNSSLGSESVPKRPYEQLKPVGLGSKFSKAPSASDYLCSLC
                     EASPAKYTCPKCLKLYCSLDCYKGPNHVKCSKLFQESKEQPAEKSSKEEQAKMLKILE
                     DFNLAEPNGWKYELAPELAKKLKIKKDKQTQEQDP"
     gene            <789627..>792329
                     /gene="AEP3"
                     /locus_tag="AWJ20_2250"
                     /db_xref="GeneID:30034141"
     mRNA            <789627..>792329
                     /gene="AEP3"
                     /locus_tag="AWJ20_2250"
                     /product="Pentatricopeptide repeat-containing protein
                     At1g63130, mitochondrial"
                     /transcript_id="XM_018879183.1"
                     /db_xref="GeneID:30034141"
     CDS             789627..792329
                     /gene="AEP3"
                     /locus_tag="AWJ20_2250"
                     /codon_start=1
                     /product="Pentatricopeptide repeat-containing protein
                     At1g63130, mitochondrial"
                     /protein_id="XP_018737122.1"
                     /db_xref="GeneID:30034141"
                     /translation="MRALSRLAAGSLRPRLRNISQQNAGALLVCNSIGLELLEHRLLV
                     PSHGPTPTIIKRNYNPFKKQPKWESDTKKSKNTEECDQLARKLRESLASQADSKQVKK
                     IIFDLVNVSQHRVSGEYIPLIERALQKFHFLSKKSKLLSIDEVQTLYRSVVQLDATAG
                     SNMDADKDKVDPARGWLLQSSVSQSSSESTLITKLYSVLYNSQSQLPTTDRVQNGLLY
                     MKYLRSENLIVESRKLLTALIQDATILASLDEPTILQFTSIIQNINPDVDSLIALYEI
                     LGSTGSLSLTLFHEGILAFTEIASKHPENESTQQLMKFLNSTIFIDSKLEPTRETIII
                     ALDCCLTLSSAECGKRLLRTLVKPRLDDLLADDSDPESSLQFYELLLMSCSKFGEDVA
                     TGKKIVDRILTSFTPDQMAKETWDVLAQWTVYYSPDTDVLETLIDQMVEHGFNPDEVT
                     LSDVVSIAIGAAKRTDKYIDSVVNMFNLKFDVDSNVQTFAFLIDRKLHSCDLEAAQKL
                     FQNSITASGCDWGVDSQRHIPTLDRLLVALCTSPPVDQRNVFEVYQQVLMFTRTVGYN
                     AQCELLKMFLSIGNSYDVELFIKEQFGDRPGLPWQAYSEIYHVMFDYIMTCKDYKLAW
                     DIYGLLNGLIKLPYESYYTAMELFCRLGRPDAALLILKYLRVRSRKEAIPSPDRNMYI
                     LLFNEFGKTLYEEGVQELQGLLRTDLYTESDIEIMNSILGAYCNLQDPHRTKNTWLEI
                     NGFPEGQGVNNDTITIMIKHLTRYSLPEVEKLWVSFPETYNLTPDADNLRQYVIANCY
                     HGYYMRALEVTKHMEQTYGIVPGRDIIEALYNWTMLDSRKKLVEKWAIETHPDTWKQL
                     QESNSLKTYVLPDNVDNDSEDNLRAQTIQTMEADDHKNSTLITR"
     gene            <801844..>804561
                     /gene="ROX1"
                     /locus_tag="AWJ20_2251"
                     /db_xref="GeneID:30034142"
     mRNA            <801844..>804561
                     /gene="ROX1"
                     /locus_tag="AWJ20_2251"
                     /product="Rox1p"
                     /transcript_id="XM_018879184.1"
                     /db_xref="GeneID:30034142"
     CDS             801844..804561
                     /gene="ROX1"
                     /locus_tag="AWJ20_2251"
                     /note="Heme-dependent repressor of hypoxic genes; mediates
                     aerobic transcriptional repression of hypoxia induced
                     genes such as COX5b and CYC7; repressor function regulated
                     through decreased promoter occupancy in response to
                     oxidative stress; contains an HMG domain that is
                     responsible for DNA bending activity; involved in the
                     hyperosmotic stress resistance; GO_component: GO:0000790 -
                     nuclear chromatin [Evidence IC] [PMID 10446242];
                     GO_component: GO:0000790 - nuclear chromatin [Evidence IC]
                     [PMID 10487921]; GO_component: GO:0000790 - nuclear
                     chromatin [Evidence IC] [PMID 7565763]; GO_component:
                     GO:0000790 - nuclear chromatin [Evidence IC] [PMID
                     8413209]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0008301 - DNA binding, bending
                     [Evidence IDA] [PMID 10446242]; GO_function: GO:0008301 -
                     DNA binding, bending [Evidence IDA] [PMID 7565763];
                     GO_function: GO:0001078 - RNA polymerase II core promoter
                     proximal region sequence-specific DNA binding
                     transcription factor activity involved in negative
                     regulation of transcription [Evidence IMP] [PMID
                     10446242]; GO_function: GO:0001135 - RNA polymerase II
                     transcription factor recruiting transcription factor
                     activity [Evidence IMP] [PMID 14665463]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 10446242]; GO_function: GO:0043565 -
                     sequence-specific DNA binding [Evidence IDA] [PMID
                     10487921]; GO_function: GO:0043565 - sequence-specific DNA
                     binding [Evidence IDA] [PMID 19111667]; GO_function:
                     GO:0043565 - sequence-specific DNA binding [Evidence IDA]
                     [PMID 8413209]; GO_process: GO:0000122 - negative
                     regulation of transcription from RNA polymerase II
                     promoter [Evidence IMP] [PMID 10446242]; GO_process:
                     GO:0000122 - negative regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 10487921];
                     GO_process: GO:0000122 - negative regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IGI,IMP] [PMID 16835445]; GO_process: GO:0000122 -
                     negative regulation of transcription from RNA polymerase
                     II promoter [Evidence IMP] [PMID 2546055]; GO_process:
                     GO:0000122 - negative regulation of transcription from RNA
                     polymerase II promoter [Evidence IMP] [PMID 2847035];
                     GO_process: GO:0000122 - negative regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 3062365]; GO_process: GO:0097201 - negative
                     regulation of transcription from RNA polymerase II
                     promoter in response to stress [Evidence IMP] [PMID
                     21299653]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Rox1p"
                     /protein_id="XP_018737123.1"
                     /db_xref="GeneID:30034142"
                     /translation="MSRTDDSNEHDTNKNNLPRVYQNVVTSTTNTSSANPPQQQPITT
                     TTITSGNLCVCANNTPRVPRPRNAFILYRQHQHALVVQEHPGKSNPEISKIIGEQWRS
                     LPQKEKDFWIQLGDEEKKSHLERFPDYRYQPRRSSKRGGSTSGTSTPTGTGQIGEATI
                     CPNCKGLIINGPGYPNSNANNNNNVNVNALANATSNITTAVTVNPNKPLDFGNSAPGA
                     GQTSGTATTPGPGVPQSSISSPAIPSPPLRPYQSAPGTQTPPLPYQQHPQQQQQQHPQ
                     QQQQHSQQHPQQQQQQPQSHVQHSSLPPQHSSSVPPPLHYDNKQYPYQPPHQSPHQLS
                     HQPQHQPPHQTPHQPPHQPQHPSQSYYPYPPPPPPPSQTHVNTLTSLTQVVGSHRASA
                     PQVPSAHQTILPNHQQQGGPRHQSAPEAFPLNPPPLYSSRSPTVSSSSLLTDTSSIAT
                     SHSSISSASSSSAPGSISSASGVSGNLLPRIVPRPQDEILGTLPGSIPKSPIARQLSA
                     GSPFKPRSVSSPAPEGLHPPPEIHPRHSSLDRHASPSWNYPTQSASQSPIPSAATSPS
                     LGSTVPNSSQGISSGTGSTFQLYNRRQTSSVGLRPSASSHSLSSMTHGPGSSIPHAGP
                     VSLLAEEEKSAKRRRTSSHYDPLGPGPAATTNSGPPPSHYHHHVTSPHHGTSRLNQAS
                     APPAPSPVETFGFREKADLLSTICEPLHHHHHHRSTSIVETDRKGRIIAVEGKDLELV
                     EAITERLGARLEGSNCKYTPHLFEQKPYFMYTKSAVNMFKVSCLHQLVSELNLSHFKY
                     GIIGGYLMTLADELADQESPLTAAEQTSHRLTYRHRWMTNVNVLRGLPGPDYLILIDQ
                     DNQADATSVSVTTLNGGSKIIVATLGNLRTNEVIDRAVDGMINGITGKE"
     gene            complement(<805065..>805475)
                     /gene="VTI1"
                     /locus_tag="AWJ20_2252"
                     /db_xref="GeneID:30034143"
     mRNA            complement(<805065..>805475)
                     /gene="VTI1"
                     /locus_tag="AWJ20_2252"
                     /product="Vti1p"
                     /transcript_id="XM_018879185.1"
                     /db_xref="GeneID:30034143"
     CDS             complement(805065..805475)
                     /gene="VTI1"
                     /locus_tag="AWJ20_2252"
                     /inference="similar to AA sequence:KEGG_Orthology:K08493"
                     /note="Protein involved in cis-Golgi membrane traffic;
                     v-SNARE that interacts with two t-SNARES, Sed5p and
                     Pep12p; required for multiple vacuolar sorting pathways;
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0000139 - Golgi membrane [Evidence IEA];
                     GO_component: GO:0031201 - SNARE complex [Evidence IPI]
                     [PMID 10397773]; GO_component: GO:0030173 - integral
                     component of Golgi membrane [Evidence IDA] [PMID 9398683];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0031902 - late endosome
                     membrane [Evidence IEA]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0005484 -
                     SNAP receptor activity [Evidence IDA] [PMID 19805279];
                     GO_process: GO:0006896 - Golgi to vacuole transport
                     [Evidence IMP] [PMID 9199167]; GO_process: GO:0006891 -
                     intra-Golgi vesicle-mediated transport [Evidence IMP]
                     [PMID 9398683]; GO_process: GO:0006886 - intracellular
                     protein transport [Evidence IEA]; GO_process: GO:0015031 -
                     protein transport [Evidence IEA]; GO_process: GO:0006810 -
                     transport [Evidence IEA]; GO_process: GO:0042144 - vacuole
                     fusion, non-autophagic [Evidence IMP] [PMID 10385523];
                     GO_process: GO:0006906 - vesicle fusion [Evidence IDA]
                     [PMID 11739407]; GO_process: GO:0016192 - vesicle-mediated
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="Vti1p"
                     /protein_id="XP_018737124.1"
                     /db_xref="GeneID:30034143"
                     /translation="MAIEVQNIPSSNRSKFNSKLREYRTNVENARKELRKLSETSDRR
                     ALFGDRLASGSPDNIPLDQRQQLLSGQASLERSSQRLRDSQRVANETESIGANILSDL
                     RGQREQLTNSRNVLLEADGYVDKSIRTLRGMARR"
     gene            complement(<805559..>805786)
                     /locus_tag="AWJ20_2253"
                     /db_xref="GeneID:30034144"
     mRNA            complement(<805559..>805786)
                     /locus_tag="AWJ20_2253"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879186.1"
                     /db_xref="GeneID:30034144"
     CDS             complement(805559..805786)
                     /locus_tag="AWJ20_2253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737125.1"
                     /db_xref="GeneID:30034144"
                     /translation="MSSPLDSGAGTELFASYDSDFQLAYSEITQKLDDIPNLTTEQQK
                     PAIKAAERAVEEAYEIVSRKPEVASPINPSL"
     gene            <806909..>808876
                     /locus_tag="AWJ20_2254"
                     /db_xref="GeneID:30034145"
     mRNA            <806909..>808876
                     /locus_tag="AWJ20_2254"
                     /product="Peroxisomal biogenesis factor 8"
                     /transcript_id="XM_018879187.1"
                     /db_xref="GeneID:30034145"
     CDS             806909..808876
                     /locus_tag="AWJ20_2254"
                     /codon_start=1
                     /product="Peroxisomal biogenesis factor 8"
                     /protein_id="XP_018737126.1"
                     /db_xref="GeneID:30034145"
                     /translation="MSYLTDITQVVDSIVRELQNSSIYSSSGPADLARRKALIGRAIQ
                     YLPSLRNEHNVPLLALELLSSPVVALPEPVCSDFLVDGFRSAVARKYSISDPTIPPQE
                     WTKYLVRPVIDRLTAEGALWRILPLLSGLIQASKYEILADIERSERGLRQSKITYVPS
                     VADLRYQQDWYVRVFNQIITLPLESDSDYKKYRDIINMALITLAKCQWALDPDVYSRL
                     VHAETIVRSLQLIYSYPDTSVINSLRLQSSPVIELVNNLLGGFSNIIRQSVESNYRNN
                     LSFNDLDLALNHIHMFAEDLSRTWVRLKHSPDSITKSETEQWQILKQFIFAICLQLQG
                     FAGLLLHVNRPKLVPVAYLSAKILKTLSPVYFILDKIGSATFEPFSFTYNVCIDVLTL
                     SRGTLRQAQESVDSLIRALAGSCNLGAVLDNDMDRGKILFLIDLFEKLIHFSSFQVIN
                     QIILPFIGEFLVPNRDPTNRKLLTPLLESSHSVMLQYLRLSPEVAVINDNVVMNYLDT
                     LLALFPHDLSSPQLLLALKTIAQSVAAPTRPTKQLLHQFLERLYFKCKITLPAIPLTT
                     KAEENGPPTVRSVFVSSLIHSLPLLEPGDFQFWLERTDKLFLRRGPYYSPLFQAENEY
                     LTEDMEKMISGELDLSLADIGIRWWHHSSKL"
     gene            complement(<808942..>810183)
                     /gene="MMM1"
                     /locus_tag="AWJ20_2255"
                     /db_xref="GeneID:30034146"
     mRNA            complement(<808942..>810183)
                     /gene="MMM1"
                     /locus_tag="AWJ20_2255"
                     /product="ERMES complex subunit MMM1"
                     /transcript_id="XM_018879188.1"
                     /db_xref="GeneID:30034146"
     CDS             complement(808942..810183)
                     /gene="MMM1"
                     /locus_tag="AWJ20_2255"
                     /inference="similar to AA sequence:KEGG_Orthology:K17764"
                     /codon_start=1
                     /product="ERMES complex subunit MMM1"
                     /protein_id="XP_018737127.1"
                     /db_xref="GeneID:30034146"
                     /translation="MSTHHSYDISTSRVIPTPTYPAIVVANDDFLPPPTPPQGTSAAV
                     SFAYGLLVGQVSVLIVVVAFIRFFIFTDTSSERKDYVTALSRRDQRNAAKLMGANNVP
                     SENVINTILEKTYYNVETHNAESVDWFTVLIAQVVSQFREDARADDSMLRSLNDLLNG
                     DIIPDFIDKIRVTELNIGDDYPIFSNCKILYNRNELGQSQGQDGLEAQIDVDLTDTVT
                     LGIETRLLLNFPKALFAVLPVSLSVSIVRFSGTLSVSLRKSPAVPKAPNTVPASSNRS
                     ANATSTSNSDDANDGTTYLSFSFDPNYRLEFDIKSLVGARSRLQDIPKIGQFIESRLR
                     KWFTDRCVSPRCQQIPLPSFWPRSKTTAVVPPATNANTNGTNNVNPSGVNGLPPSSPL
                     VLPVDVAESLRRRRQSHLEVR"
     gene            <810952..>812676
                     /gene="KRI1"
                     /locus_tag="AWJ20_2256"
                     /db_xref="GeneID:30034147"
     mRNA            <810952..>812676
                     /gene="KRI1"
                     /locus_tag="AWJ20_2256"
                     /product="Kri1p"
                     /transcript_id="XM_018879189.1"
                     /db_xref="GeneID:30034147"
     CDS             810952..812676
                     /gene="KRI1"
                     /locus_tag="AWJ20_2256"
                     /inference="similar to AA sequence:KEGG_Orthology:K14786"
                     /note="Essential nucleolar protein required for 40S
                     ribosome biogenesis; associate with snR30; physically and
                     functionally interacts with Krr1p; GO_component:
                     GO:0030686 - 90S preribosome [Evidence IDA] [PMID
                     22180534]; GO_component: GO:0005730 - nucleolus [Evidence
                     IEA]; GO_component: GO:0005730 - nucleolus [Evidence IDA]
                     [PMID 11027267]; GO_component: GO:0005634 - nucleus
                     [Evidence IEA]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0000447 -
                     endonucleolytic cleavage in ITS1 to separate SSU-rRNA from
                     5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP] [PMID
                     11027267]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042254 - ribosome
                     biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Kri1p"
                     /protein_id="XP_018737128.1"
                     /db_xref="GeneID:30034147"
                     /translation="MARKKSARRKALEAQAKEQGESPAKVENKDKLGLEEESDEDINT
                     LSINQEYAKRFEHNKSREEKHRQEEKDKAKLLEDSEEDAEDSSDDEDEDDFGELLTED
                     VDDGIQKVLETIRTNPKALLDPSVKFFDNSENAASANGNGTSKAMYLKDYHRQNLLSG
                     GVHDDDEENDNEEKPYAIQNREDRAKLLAEINKDDEDEEDDGDFLTKRKEQRTIEAIE
                     LPDPEQDQKGFLEAYTSSKAWIPSGIDKKTGKEIVPAYGDIVGDEDDEEFDDIADDFE
                     TAYNFRYEDPNAAEIVSYARNESTLRRKGDNSRKRAREQKTELKKQEEQSKKAEVNKI
                     KKKKVNEVLSKFEKLKEVIDDDETAAQFENMDLLEGDFDASEWDKRMEQVFNETFYSK
                     KDKNFAGDDKADEEDKDDETKEEPDEPKENIKEAEDEEPERRSRKDKHEAKKEKQKMR
                     QIAEQFVEANLDLALEQEKIDLVSSGTKFRYREVSPDSYGLTARDILLADDKDLNEFV
                     GIKKLAPFRDEEKKKHDRRKYAKKRRLREWRKAVFSTEDEPTDELFEKLVASQDAGQP
                     KKKKQRKR"
     gene            complement(<812915..>814231)
                     /gene="ARP4"
                     /locus_tag="AWJ20_2257"
                     /db_xref="GeneID:30034148"
     mRNA            complement(<812915..>814231)
                     /gene="ARP4"
                     /locus_tag="AWJ20_2257"
                     /product="Arp4p"
                     /transcript_id="XM_018879190.1"
                     /db_xref="GeneID:30034148"
     CDS             complement(812915..814231)
                     /gene="ARP4"
                     /locus_tag="AWJ20_2257"
                     /inference="similar to AA sequence:KEGG_Orthology:K11400"
                     /note="Nuclear actin-related protein involved in chromatin
                     remodeling; component of chromatin-remodeling enzyme
                     complexes; GO_component: GO:0031011 - Ino80 complex
                     [Evidence IPI] [PMID 10952318]; GO_component: GO:0031011 -
                     Ino80 complex [Evidence IPI] [PMID 24034245];
                     GO_component: GO:0035267 - NuA4 histone acetyltransferase
                     complex [Evidence IDA] [PMID 10911987]; GO_component:
                     GO:0000812 - Swr1 complex [Evidence IDA] [PMID 14645854];
                     GO_component: GO:0000812 - Swr1 complex [Evidence IDA]
                     [PMID 14690608]; GO_component: GO:0000812 - Swr1 complex
                     [Evidence IDA] [PMID 16299513]; GO_component: GO:0000790 -
                     nuclear chromatin [Evidence IDA] [PMID 10436015];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     10911987]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 11011149]; GO_function: GO:0043140 -
                     ATP-dependent 3'-5' DNA helicase activity [Evidence IDA]
                     [PMID 10952318]; GO_function: GO:0003682 - chromatin
                     binding [Evidence IDA] [PMID 10436015]; GO_function:
                     GO:0004402 - histone acetyltransferase activity [Evidence
                     IDA,IMP] [PMID 10911987]; GO_function: GO:0004402 -
                     histone acetyltransferase activity [Evidence IDA] [PMID
                     16088870]; GO_function: GO:0042393 - histone binding
                     [Evidence IDA] [PMID 10911987]; GO_function: GO:0031493 -
                     nucleosomal histone binding [Evidence IDA] [PMID
                     10911987]; GO_process: GO:0006281 - DNA repair [Evidence
                     IEA]; GO_process: GO:0006281 - DNA repair [Evidence IDA]
                     [PMID 12353039]; GO_process: GO:0006281 - DNA repair
                     [Evidence IMP] [PMID 15610740]; GO_process: GO:0006281 -
                     DNA repair [Evidence IDA] [PMID 16135807]; GO_process:
                     GO:0006974 - cellular response to DNA damage stimulus
                     [Evidence IEA]; GO_process: GO:0016568 - chromatin
                     modification [Evidence IEA]; GO_process: GO:0006325 -
                     chromatin organization [Evidence IMP,IPI] [PMID 10436015];
                     GO_process: GO:0006338 - chromatin remodeling [Evidence
                     IDA] [PMID 14645854]; GO_process: GO:0016573 - histone
                     acetylation [Evidence IDA] [PMID 10911987]; GO_process:
                     GO:0051382 - kinetochore assembly [Evidence IMP] [PMID
                     17452364]; GO_process: GO:0006357 - regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IDA] [PMID 10911987]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IMP] [PMID 8598290]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Arp4p"
                     /protein_id="XP_018737129.1"
                     /db_xref="GeneID:30034148"
                     /translation="MEIASPMTDGIVSDWDATEKLWRYGLEDILGAQVTEQPLLITEQ
                     IWNTDENRKKAMEVAFESLDTPAFYIAKRPVCTLFASGKGSGLVVDIGADIASVTPVL
                     DGLTLFKTSKRSRHAGTYINKHIEALLKASDFDLTPRYLVAARQTGLEPGEKATEYKK
                     RSLLAPVTASFHDFQVSRLIEEFKESMAQVQDTPYTDEAASQAGTDVYSNRVFEFPDG
                     SSVEYGSERFKVAEPLFKPRDFLLEGEELLEAPEVKEEDGDDDDNKDDSKENGKDADS
                     KDKEKGKASKGSKDKGQDGDKDKDKEKPTEKSAATAAKELKALVYTDRTQGPFTTTGI
                     SDMIIDAINSCDVDIRANLANNVIITGGTSLIQGFTDRVNEDLVHALPGYKIRIHAPG
                     NLIERKFSAWIGGSILASLGTFHQLWISKKEYEEVGVSKLLEKRFR"
     gene            <815365..>817166
                     /gene="MIC60"
                     /locus_tag="AWJ20_2258"
                     /db_xref="GeneID:30034149"
     mRNA            join(<815365..815371,815470..>817166)
                     /gene="MIC60"
                     /locus_tag="AWJ20_2258"
                     /product="Mic60p"
                     /transcript_id="XM_018879191.1"
                     /db_xref="GeneID:30034149"
     CDS             join(815365..815371,815470..817166)
                     /gene="MIC60"
                     /locus_tag="AWJ20_2258"
                     /inference="similar to AA sequence:KEGG_Orthology:K17785"
                     /note="Component of the MICOS complex; MICOS (formerly
                     MINOS or MitOS) is a mitochondrial inner membrane complex
                     that extends into the intermembrane space and has a role
                     in the maintenance of crista junctions, inner membrane
                     architecture, and formation of contact sites to the outer
                     membrane; Mic60p is also involved in import of
                     intermembrane space (IMS) proteins, probably by
                     positioning Mia40p relative to the TOM complex to receive
                     incoming proteins; ortholog of mammalian mitofilin;
                     GO_component: GO:0061617 - MICOS complex [Evidence IDA]
                     [PMID 21944719]; GO_component: GO:0061617 - MICOS complex
                     [Evidence IDA] [PMID 21987634]; GO_component: GO:0061617 -
                     MICOS complex [Evidence IDA] [PMID 22009199];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0030061 - mitochondrial
                     crista [Evidence IDA] [PMID 19528297]; GO_component:
                     GO:0044284 - mitochondrial crista junction [Evidence IDA]
                     [PMID 22009199]; GO_component: GO:0005743 - mitochondrial
                     inner membrane [Evidence IEA,IEA]; GO_component:
                     GO:0005743 - mitochondrial inner membrane [Evidence IDA]
                     [PMID 19528297]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0042407 -
                     cristae formation [Evidence IMP] [PMID 19528297];
                     GO_process: GO:0042407 - cristae formation [Evidence IMP]
                     [PMID 21944719]; GO_process: GO:0042407 - cristae
                     formation [Evidence IMP] [PMID 21987634]; GO_process:
                     GO:0042407 - cristae formation [Evidence IMP] [PMID
                     22009199]; GO_process: GO:0045041 - protein import into
                     mitochondrial intermembrane space [Evidence IMP,IPI] [PMID
                     21944719]"
                     /codon_start=1
                     /product="Mic60p"
                     /protein_id="XP_018737130.1"
                     /db_xref="GeneID:30034149"
                     /translation="MTVTPPVKVTPPVIEPVVKEAPKQKKSHGFRNFVLSTVFLSSAL
                     YGAGVWYSLKDDTFHDYFTEYVPFSESIIVAIEEREFRSKFRDVNINQGGATASTAVA
                     NGSGPLLQSIPGKLNDLKVKIRPGSSAEPKEISSDQATKSSSSSAVTAASSSSKSADK
                     NASIARPSSSDSSAKNIVTEKKEGIIPSGIGAPTAGGSSSHLLPLIRVPGDINPLVAS
                     SVETLNQFIQSVNTSTYGEDIVHKISQEVSKLSHSINALNKENQETLSKSLESQAAKF
                     AALGEARANEVKEALASQEDKWRQQFQEEQARILKLYNDRLLTEVEATKNLVISHANN
                     RLLAIHAEREKQFAQEIQDRVEKERDGRLSKIKELAEKVEALSHLTEKTSSIISESDS
                     VSQYHIAVGKLNSVLKFSNEPVPLGPYIEEVRKALSDDPLVQSILDNIPEDAYKEGVL
                     TNAQLAARFKLLVPELRSASLLPPNAGVAGHIGSIIFSQLLAGKSGNPVGNDNESIFA
                     RAETALGEGRVVDAVAEVNSLTGWPKKLAADWLSEGRKRSEVDFLAQALADEGKLWAL
                     K"
     gene            complement(<817387..>819852)
                     /gene="PAP2"
                     /locus_tag="AWJ20_2259"
                     /db_xref="GeneID:30034150"
     mRNA            complement(<817387..>819852)
                     /gene="PAP2"
                     /locus_tag="AWJ20_2259"
                     /product="non-canonical poly(A) polymerase PAP2"
                     /transcript_id="XM_018879192.1"
                     /db_xref="GeneID:30034150"
     CDS             complement(817387..819852)
                     /gene="PAP2"
                     /locus_tag="AWJ20_2259"
                     /inference="similar to AA sequence:KEGG_Orthology:K03514"
                     /note="Non-canonical poly(A) polymerase; involved in
                     nuclear RNA degradation as a component of TRAMP; catalyzes
                     polyadenylation of hypomodified tRNAs, and snoRNA and rRNA
                     precursors; required for mRNA surveillance and maintenance
                     of genome integrity, serving as a link between RNA and DNA
                     metabolism; overlapping but non-redundant functions with
                     Trf5p; relocalizes to cytosol in response to hypoxia; PAP2
                     has a paralog, TRF5, that arose from the whole genome
                     duplication; GO_component: GO:0031499 - TRAMP complex
                     [Evidence IDA] [PMID 15828860]; GO_component: GO:0031499 -
                     TRAMP complex [Evidence IDA] [PMID 15935758];
                     GO_component: GO:0031499 - TRAMP complex [Evidence IDA]
                     [PMID 15935759]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 22932476]; GO_component: GO:0005730 -
                     nucleolus [Evidence IDA] [PMID 16541108]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 10066793];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     22932476]; GO_function: GO:0051575 -
                     5'-deoxyribose-5-phosphate lyase activity [Evidence
                     IDA,IMP] [PMID 17983848]; GO_function: GO:0034459 -
                     ATP-dependent 3'-5' RNA helicase activity [Evidence IDA]
                     [PMID 22532666]; GO_function: GO:0003729 - mRNA binding
                     [Evidence IDA] [PMID 23222640]; GO_function: GO:0046872 -
                     metal ion binding [Evidence IEA]; GO_function: GO:0016779
                     - nucleotidyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0004652 - polynucleotide
                     adenylyltransferase activity [Evidence IDA] [PMID
                     12062100]; GO_function: GO:0004652 - polynucleotide
                     adenylyltransferase activity [Evidence IMP,ISS] [PMID
                     15828860]; GO_function: GO:0004652 - polynucleotide
                     adenylyltransferase activity [Evidence IDA] [PMID
                     15935758]; GO_function: GO:0004652 - polynucleotide
                     adenylyltransferase activity [Evidence IDA,IMP] [PMID
                     15935759]; GO_function: GO:0004652 - polynucleotide
                     adenylyltransferase activity [Evidence IDA,IMP] [PMID
                     16260630]; GO_function: GO:0004652 - polynucleotide
                     adenylyltransferase activity [Evidence IDA,IGI] [PMID
                     16374505]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_process: GO:0034475 - U4 snRNA 3'-end
                     processing [Evidence IGI,IMP] [PMID 16373491]; GO_process:
                     GO:0006284 - base-excision repair [Evidence IGI,IMP] [PMID
                     17983848]; GO_process: GO:0007049 - cell cycle [Evidence
                     IEA]; GO_process: GO:0051301 - cell division [Evidence
                     IEA]; GO_process: GO:0071044 - histone mRNA catabolic
                     process [Evidence IGI] [PMID 17179095]; GO_process:
                     GO:0007067 - mitotic nuclear division [Evidence IEA];
                     GO_process: GO:0043629 - ncRNA polyadenylation [Evidence
                     IGI] [PMID 15145828]; GO_process: GO:0043629 - ncRNA
                     polyadenylation [Evidence IDA,IMP] [PMID 15828860];
                     GO_process: GO:0043629 - ncRNA polyadenylation [Evidence
                     IDA] [PMID 15935758]; GO_process: GO:0043629 - ncRNA
                     polyadenylation [Evidence IGI] [PMID 15935759];
                     GO_process: GO:0043629 - ncRNA polyadenylation [Evidence
                     IGI] [PMID 16373491]; GO_process: GO:0043629 - ncRNA
                     polyadenylation [Evidence IGI] [PMID 16374505];
                     GO_process: GO:0043629 - ncRNA polyadenylation [Evidence
                     IMP] [PMID 16431988]; GO_process: GO:0045910 - negative
                     regulation of DNA recombination [Evidence IMP] [PMID
                     23762389]; GO_process: GO:0071031 - nuclear mRNA
                     surveillance of mRNA 3'-end processing [Evidence IGI]
                     [PMID 17410208]; GO_process: GO:0071039 - nuclear
                     polyadenylation-dependent CUT catabolic process [Evidence
                     IGI,IMP] [PMID 15935759]; GO_process: GO:0071039 - nuclear
                     polyadenylation-dependent CUT catabolic process [Evidence
                     IMP] [PMID 16973436]; GO_process: GO:0071039 - nuclear
                     polyadenylation-dependent CUT catabolic process [Evidence
                     IMP] [PMID 18007593]; GO_process: GO:0071039 - nuclear
                     polyadenylation-dependent CUT catabolic process [Evidence
                     IMP] [PMID 18591258]; GO_process: GO:0071040 - nuclear
                     polyadenylation-dependent antisense transcript catabolic
                     process [Evidence IMP] [PMID 18022365]; GO_process:
                     GO:0071042 - nuclear polyadenylation-dependent mRNA
                     catabolic process [Evidence IGI] [PMID 16373491];
                     GO_process: GO:0071035 - nuclear polyadenylation-dependent
                     rRNA catabolic process [Evidence IGI,IMP] [PMID 15935758];
                     GO_process: GO:0071035 - nuclear polyadenylation-dependent
                     rRNA catabolic process [Evidence IMP] [PMID 16431988];
                     GO_process: GO:0071035 - nuclear polyadenylation-dependent
                     rRNA catabolic process [Evidence IGI] [PMID 16541108];
                     GO_process: GO:0071035 - nuclear polyadenylation-dependent
                     rRNA catabolic process [Evidence IMP] [PMID 18007593];
                     GO_process: GO:0071037 - nuclear polyadenylation-dependent
                     snRNA catabolic process [Evidence IMP] [PMID 15935758];
                     GO_process: GO:0071037 - nuclear polyadenylation-dependent
                     snRNA catabolic process [Evidence IMP] [PMID 16431988];
                     GO_process: GO:0071036 - nuclear polyadenylation-dependent
                     snoRNA catabolic process [Evidence IGI,IMP] [PMID
                     15935758]; GO_process: GO:0071036 - nuclear
                     polyadenylation-dependent snoRNA catabolic process
                     [Evidence IGI] [PMID 16373491]; GO_process: GO:0071038 -
                     nuclear polyadenylation-dependent tRNA catabolic process
                     [Evidence IGI] [PMID 15145828]; GO_process: GO:0071038 -
                     nuclear polyadenylation-dependent tRNA catabolic process
                     [Evidence IDA] [PMID 15828860]; GO_process: GO:0071038 -
                     nuclear polyadenylation-dependent tRNA catabolic process
                     [Evidence IDA] [PMID 15935758]; GO_process: GO:0071038 -
                     nuclear polyadenylation-dependent tRNA catabolic process
                     [Evidence IMP] [PMID 16431988]; GO_process: GO:0071038 -
                     nuclear polyadenylation-dependent tRNA catabolic process
                     [Evidence IDA] [PMID 17643380]; GO_process: GO:0071038 -
                     nuclear polyadenylation-dependent tRNA catabolic process
                     [Evidence IMP] [PMID 18456844]; GO_process: GO:0071047 -
                     polyadenylation-dependent mRNA catabolic process [Evidence
                     IMP] [PMID 19369424]; GO_process: GO:0071051 -
                     polyadenylation-dependent snoRNA 3'-end processing
                     [Evidence IGI] [PMID 16373491]; GO_process: GO:0071050 -
                     snoRNA polyadenylation [Evidence IGI] [PMID 18951092];
                     GO_process: GO:0006400 - tRNA modification [Evidence IMP]
                     [PMID 22319136]"
                     /codon_start=1
                     /product="non-canonical poly(A) polymerase PAP2"
                     /protein_id="XP_018737131.1"
                     /db_xref="GeneID:30034150"
                     /translation="MGSKAKKSSPQLASQASSGSLNGLPVGPSAYVAAVEKGTADVGS
                     NNQPQKGLKKLLNKLPKGPKGDSKDQAGNQPKSKAKNKPKKNQPKNQPPEKKPKNQAK
                     SQPNLSKKMSENQLRNQTTSGVNGQIHASEKNHDNYSHQLKPSKSIGTESEMSKKSGI
                     DKIVDGMGNVIEKFKKRQRGSRGGKKRRASMDAIANDYISNVAASGVDHDDAVMDADI
                     NTNDDNEDSGFIAFDSDLSDVAESIHTNTFKAFEDEMSMFLSEDEDDDQEDNAVNVSI
                     MTTSTSRTSRKRKFNPEDEDEKASKRINVLSEFPWVVNHDHSQEQEISDWLTLEIKDF
                     VSYMSPSAAEIIARNNAVKRIRGIVKDLWSDADIHVFGSFATDLYLPGSDIDMVVLSK
                     SGSYDTRAHLYKLSSKLKATGIANSLVVVAKARVPIIKFVEKTSNIHIDISFERRNGV
                     EAVQIIRKWTAEYPCIRFFAIIIKHFLARRKMNEVHSGGLGGFSVICLIVSFLKNHPK
                     VSSGAIDPMHNLGVLLIEFFELYGRNFNYDSIALSVRGDMPYLRKDQNPDLDNPRKFM
                     LAIQDPSDETNNLSRGTFNIRGIKKAFSGAFDLLVARCYELEYLSFSDRLGKSILGNV
                     IKFRGPERDFLDSRSEVQSEYELSIENYTSFNGTENDTNDDIIVPSDFEEDESDADVD
                     GNDGEQQDVIGDIYKKQSNSRPNQKLASPPSRPKPNSPKSKPERKSPSTAEHDGDKRA
                     TRPAAVEYYNISDSDSDSNAERPNDGTRHTSPTQRGASSKSPITILSDDDASSAEDSR
                     SSSVIDKAQKRDYWLSKGAPTIT"
     gene            <821500..>823359
                     /gene="IKS1"
                     /locus_tag="AWJ20_2260"
                     /db_xref="GeneID:30034152"
     mRNA            <821500..>823359
                     /gene="IKS1"
                     /locus_tag="AWJ20_2260"
                     /product="protein kinase IKS1"
                     /transcript_id="XM_018879194.1"
                     /db_xref="GeneID:30034152"
     CDS             821500..823359
                     /gene="IKS1"
                     /locus_tag="AWJ20_2260"
                     /codon_start=1
                     /product="protein kinase IKS1"
                     /protein_id="XP_018737132.1"
                     /db_xref="GeneID:30034152"
                     /translation="MSLLGLCPRPRGSSRFARVGRRRSQQLLPSRSNGVWGSAPAAGS
                     STNGSDRFFISSALLGRGSRGAVYLVEHVLDGFSLGFFALKKVAVGDDHAWLEKVLSE
                     VNLLRMLSHPNLVRYNHVWLEVSSLSSFGPLVPCAYILQEYCNGGTLEEYMMKGRYKP
                     GTDGESDIIPQFQRDPNDRTWTKNDIKAKRDRIRRRMSQQGADGQGYTDFSGRNGGSM
                     SAVVDDNDDEYVAELTIEEIISFMTDIVMGVKYLHQNQIIHRDLKPSNCLLCRIPGQS
                     LPTVLVSDFGEGQIEGLNRMGSGSTGTLEYTAPELVQTVSGRFVAQFSKKTDVFSLGM
                     ILHYLCFSRLPYSNVWQERGDLEALTGEVRQFGGFDINISNSKLHRTDLDPQLLALVD
                     AMVSIDPDRRPTADQVLFILGQVNERYRQQQFHQAQTTAMSTASQTSPPPASSTSGTS
                     TAAATTTAVPEITTNTTATSTSTALPINSTTATLRISDTSSSLMSPTLSPSINTPATS
                     SFDMSSSLSSSLVPTVIYSPDHQRPNMLLRYLPTWIQRLAIRNRRSPRQLTSSLLLTK
                     GTLLLIKLATIYKLAPSPYTQAIYMLLGVELATLSIPVSIGLFLAHLVLYSLA"
     gene            complement(<823599..>824246)
                     /gene="VPS21"
                     /locus_tag="AWJ20_2261"
                     /db_xref="GeneID:30034153"
     mRNA            complement(<823599..>824246)
                     /gene="VPS21"
                     /locus_tag="AWJ20_2261"
                     /product="Rab family GTPase VPS21"
                     /transcript_id="XM_018879195.1"
                     /db_xref="GeneID:30034153"
     CDS             complement(823599..824246)
                     /gene="VPS21"
                     /locus_tag="AWJ20_2261"
                     /inference="similar to AA sequence:KEGG_Orthology:K07889"
                     /note="Endosomal Rab family GTPase; required for endocytic
                     transport and sorting of vacuolar hydrolases; required for
                     endosomal localization of the CORVET complex; required
                     with YPT52 for MVB biogenesis and sorting; involved in
                     autophagy and ionic stress tolerance; geranylgeranylation
                     required for membrane association; protein abundance
                     increases in response to DNA replication stress; mammalian
                     Rab5 homolog; VPS21 has a paralog, YPT53, that arose from
                     the whole genome duplication; GO_component: GO:0005768 -
                     endosome [Evidence IEA]; GO_component: GO:0010008 -
                     endosome membrane [Evidence IEA]; GO_component: GO:0005770
                     - late endosome [Evidence IMP] [PMID 11872141];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0031966 - mitochondrial membrane
                     [Evidence IEA]; GO_component: GO:0005741 - mitochondrial
                     outer membrane [Evidence IDA] [PMID 16407407];
                     GO_component: GO:0005739 - mitochondrion [Evidence IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14576278]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 16823961]; GO_function: GO:0005525 -
                     GTP binding [Evidence IEA,IEA]; GO_function: GO:0003924 -
                     GTPase activity [Evidence IDA] [PMID 11210571];
                     GO_function: GO:0003924 - GTPase activity [Evidence IMP]
                     [PMID 8163546]; GO_function: GO:0000166 - nucleotide
                     binding [Evidence IEA]; GO_process: GO:0006895 - Golgi to
                     endosome transport [Evidence IGI,IMP] [PMID 22748138];
                     GO_process: GO:0006895 - Golgi to endosome transport
                     [Evidence IGI,IMP] [PMID 23612966]; GO_process: GO:0006897
                     - endocytosis [Evidence IMP] [PMID 8163546]; GO_process:
                     GO:0032511 - late endosome to vacuole transport via
                     multivesicular body sorting pathway [Evidence IGI] [PMID
                     22748138]; GO_process: GO:0036258 - multivesicular body
                     assembly [Evidence IGI] [PMID 22748138]; GO_process:
                     GO:0036010 - protein localization to endosome [Evidence
                     IGI] [PMID 23264632]; GO_process: GO:0006623 - protein
                     targeting to vacuole [Evidence IMP] [PMID 8163546];
                     GO_process: GO:0015031 - protein transport [Evidence
                     IEA,IEA]; GO_process: GO:0007264 - small GTPase mediated
                     signal transduction [Evidence IEA]; GO_process: GO:0006810
                     - transport [Evidence IEA]; GO_process: GO:0000011 -
                     vacuole inheritance [Evidence IMP] [PMID 1493335]"
                     /codon_start=1
                     /product="Rab family GTPase VPS21"
                     /protein_id="XP_018737133.1"
                     /db_xref="GeneID:30034153"
                     /translation="MSTPRTSTSSPRFAQFKLVLLGESAVGKSSLVNRFAKDQFDDFR
                     ESTIGAAFLTQTVQVDPNTIVKFEIWDTAGQERYKSLAPMYYRNANCAVVVYDITQSA
                     SLTRAKAWVKELQHQANENIIIALAGNKFDLQESRDVDTSVAEAYAKEAGLLFFETSA
                     KTGENVTELFTAIAKKLPIESVLNRSTRPSGPKGVDLSRSARQPSGANGAGACNC"
     gene            complement(<826242..>826967)
                     /gene="TAE1"
                     /locus_tag="AWJ20_2262"
                     /db_xref="GeneID:30034154"
     mRNA            complement(<826242..>826967)
                     /gene="TAE1"
                     /locus_tag="AWJ20_2262"
                     /product="Tae1p"
                     /transcript_id="XM_018879196.1"
                     /db_xref="GeneID:30034154"
     CDS             complement(826242..826967)
                     /gene="TAE1"
                     /locus_tag="AWJ20_2262"
                     /inference="similar to AA sequence:KEGG_Orthology:K16219"
                     /note="AdoMet-dependent proline methyltransferase;
                     catalyzes the dimethylation of ribosomal proteins Rpl12
                     and Rps25 at N-terminal proline residues; has a role in
                     protein synthesis; fusion protein localizes to the
                     cytoplasm; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 20481588]; GO_function: GO:0071885 -
                     N-terminal protein N-methyltransferase activity [Evidence
                     IDA,IMP] [PMID 20481588]; GO_function: GO:0008168 -
                     methyltransferase activity [Evidence IEA,IEA];
                     GO_function: GO:0016740 - transferase activity [Evidence
                     IEA]; GO_process: GO:0018016 - N-terminal peptidyl-proline
                     dimethylation [Evidence IDA,IMP] [PMID 20481588];
                     GO_process: GO:0002181 - cytoplasmic translation [Evidence
                     IGI,IMP] [PMID 19055778]; GO_process: GO:0032259 -
                     methylation [Evidence IEA]"
                     /codon_start=1
                     /product="Tae1p"
                     /protein_id="XP_018737134.1"
                     /db_xref="GeneID:30034154"
                     /translation="MPLEPDVPADTHINYDDAVSYWSSVPATVDGMLGGFGTGVVPKV
                     DIIGSNAFVRRLNILQKSASGDQLPRHGLDVGAGIGRITKDFLSKICDQVDLVEPVKN
                     FVDQAHESLADLKKEGKVGTIFNVGMQDFTPEEGKYWLIWCQWCVGHLADDRLVEFFQ
                     RCIKGLQPGGYIIVKENNAPVEDDFDDTDSSVTRTDAKFRELFTRAGLDLKLVTKQTG
                     LPRELYPVRMYALRPATDVEPSS"
     gene            <829631..>830581
                     /gene="SEC61"
                     /locus_tag="AWJ20_2263"
                     /db_xref="GeneID:30034155"
     mRNA            <829631..>830581
                     /gene="SEC61"
                     /locus_tag="AWJ20_2263"
                     /product="translocon subunit SEC61"
                     /transcript_id="XM_018879197.1"
                     /db_xref="GeneID:30034155"
     CDS             829631..830581
                     /gene="SEC61"
                     /locus_tag="AWJ20_2263"
                     /inference="similar to AA sequence:KEGG_Orthology:K10956"
                     /note="Conserved ER protein translocation channel;
                     essential subunit of Sec61 complex (Sec61p, Sbh1p, and
                     Sss1p); forms channel for SRP-dependent protein import;
                     with Sec63 complex allows SRP-independent protein import
                     into ER; involved in posttranslational soluble protein
                     import into the ER, ERAD of soluble substrates, and
                     misfolded soluble protein export from the ER;
                     GO_component: GO:0005784 - Sec61 translocon complex
                     [Evidence IDA] [PMID 8612571]; GO_component: GO:0005784 -
                     Sec61 translocon complex [Evidence IDA] [PMID 9252322];
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_function: GO:0015450 -
                     P-P-bond-hydrolysis-driven protein transmembrane
                     transporter activity [Evidence IMP] [PMID 1550957];
                     GO_function: GO:0015450 - P-P-bond-hydrolysis-driven
                     protein transmembrane transporter activity [Evidence IDA]
                     [PMID 9252322]; GO_function: GO:0015197 - peptide
                     transporter activity [Evidence IMP] [PMID 10758167];
                     GO_function: GO:0005048 - signal sequence binding
                     [Evidence IDA] [PMID 12134063]; GO_process: GO:0030433 -
                     ER-associated ubiquitin-dependent protein catabolic
                     process [Evidence IPI] [PMID 19696741]; GO_process:
                     GO:0030433 - ER-associated ubiquitin-dependent protein
                     catabolic process [Evidence IMP] [PMID 24314051];
                     GO_process: GO:0006616 - SRP-dependent cotranslational
                     protein targeting to membrane, translocation [Evidence
                     IDA] [PMID 11076036]; GO_process: GO:0044743 -
                     intracellular protein transmembrane import [Evidence IMP]
                     [PMID 24314051]; GO_process: GO:0070843 - misfolded
                     protein transport [Evidence IMP] [PMID 24314051];
                     GO_process: GO:0031204 - posttranslational protein
                     targeting to membrane, translocation [Evidence IDA] [PMID
                     7758110]; GO_process: GO:0031204 - posttranslational
                     protein targeting to membrane, translocation [Evidence
                     IDA] [PMID 9252322]; GO_process: GO:0031204 -
                     posttranslational protein targeting to membrane,
                     translocation [Evidence IMP] [PMID 9843581]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA,IEA];
                     GO_process: GO:0030970 - retrograde protein transport, ER
                     to cytosol [Evidence IMP] [PMID 10635318]; GO_process:
                     GO:0030970 - retrograde protein transport, ER to cytosol
                     [Evidence IMP] [PMID 9303298]; GO_process: GO:0006810 -
                     transport [Evidence IEA]"
                     /codon_start=1
                     /product="translocon subunit SEC61"
                     /protein_id="XP_018737135.1"
                     /db_xref="GeneID:30034155"
                     /translation="MGGAMLLLIDETLQKGYGFSTGFSLFAVLSVSTKFVWNALSLST
                     QDIGRGKEFIGAIVSLVHGLFTRNFKNALIESFYRTHLPNVFEVYGNILAFGAVVFLL
                     NFRYDINVKSTKVRTPSSNYPIRLLYTGNVPIYMFYAIVSNLFIFSNILFRLFPSNVV
                     VRLIGTWEQHGDNPQLFAVSGLCYYLQPPFGLVEALWDPIKTVIYASTLILAAIYFAK
                     TWTEISGSSPRDIAKQFKDNDIVIVGHRDVAILRELKKIITPAAAIGGALSAAVIVLP
                     DLLGFTGSGLLMFIGASTIYTYFEIIAQESGQPGFSVGNW"
     gene            <831318..>833534
                     /gene="MAK5"
                     /locus_tag="AWJ20_2264"
                     /db_xref="GeneID:30034156"
     mRNA            <831318..>833534
                     /gene="MAK5"
                     /locus_tag="AWJ20_2264"
                     /product="Mak5p"
                     /transcript_id="XM_018879198.1"
                     /db_xref="GeneID:30034156"
     CDS             831318..833534
                     /gene="MAK5"
                     /locus_tag="AWJ20_2264"
                     /inference="similar to AA sequence:KEGG_Orthology:K14805"
                     /note="Essential nucleolar protein; putative DEAD-box RNA
                     helicase required for maintenance of M1 dsRNA virus;
                     involved in biogenesis of large (60S) ribosomal subunits;
                     GO_component: GO:0005730 - nucleolus [Evidence IEA];
                     GO_component: GO:0005730 - nucleolus [Evidence IDA] [PMID
                     13680366]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA]; GO_function: GO:0005524 - ATP binding [Evidence
                     IEA,IEA]; GO_function: GO:0004004 - ATP-dependent RNA
                     helicase activity [Evidence ISS] [PMID 7754712];
                     GO_function: GO:0008026 - ATP-dependent helicase activity
                     [Evidence IEA]; GO_function: GO:0003723 - RNA binding
                     [Evidence IEA]; GO_function: GO:0004386 - helicase
                     activity [Evidence IEA,IEA]; GO_function: GO:0016787 -
                     hydrolase activity [Evidence IEA]; GO_function: GO:0003676
                     - nucleic acid binding [Evidence IEA]; GO_function:
                     GO:0000166 - nucleotide binding [Evidence IEA];
                     GO_process: GO:0006200 - ATP catabolic process [Evidence
                     IEA]; GO_process: GO:0000466 - maturation of 5.8S rRNA
                     from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA,
                     LSU-rRNA) [Evidence IMP] [PMID 13680366]; GO_process:
                     GO:0000463 - maturation of LSU-rRNA from tricistronic rRNA
                     transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [Evidence IMP]
                     [PMID 13680366]; GO_process: GO:0006364 - rRNA processing
                     [Evidence IEA]; GO_process: GO:0042273 - ribosomal large
                     subunit biogenesis [Evidence IMP] [PMID 13680366];
                     GO_process: GO:0042273 - ribosomal large subunit
                     biogenesis [Evidence IMP] [PMID 7739558]; GO_process:
                     GO:0042254 - ribosome biogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Mak5p"
                     /protein_id="XP_018737136.1"
                     /db_xref="GeneID:30034156"
                     /translation="MAGKALKRKLSSKSNGPQKSGLKKAKKTVALDNLAWKSVDVADG
                     GLDDFEGFYGLEEVDGVSVEVENGTLKFKAAESKEDTENEEKEKAPTNGSAKNKASEK
                     VAPYVSPFAEEEEDDYEDSDSEENQGEEEEEEGESEIDESKESKNKTAKGAENKKKSS
                     GLVSLKTPGNPFDLLEETESEVSAELDWSLPDTTLSSSILTALSALKFYKPTDIQAQV
                     IPEILTDSDVIGKAATGSGKTLAYGIPIIEKHIRLSESIKPAKKWPTALIFGPTRELV
                     HQITKHLEQVWKYGNFTGSGVVAITGGLAIQKQRRLIDNNPAIIVATPGRFLEILTEA
                     TSEFRDQFKKCETLVLDEADRLIQEGHFQELEKILDLIGRGRRTRRQTLVFSATFQRD
                     LMKKLDSKRTSSNAGRQASNAGALKILNEKLEFKDKNPVFIDSNPAESVARSVVESIM
                     ECGAMEKDLYLYYFLLTYPARSIVFVNSIDTVKRLVPFLKELGLPSLGLHSDMIQKQR
                     LRSLERFKANDKSILVATDVAARGLDIPLIDHVVHYHLPRTADMYIHRSGRTARAGNE
                     GVSLLLCSPDEASGPLIKLKRALYKDNATNKTAMKTFEVEYDFLNRLKPRITLAKQIS
                     DTVNQSTHKGKTDAWLKKAVEDLGVDLSDDEIENITGDRRKKNKPEQPKGDLRSLRAQ
                     LQSELQRPVGHAGKYLTRGTVNLAQMVTSGKSHQAFLGKEQTSALESLNTKPKSKK"
     gene            complement(<833707..>835023)
                     /gene="SUP45"
                     /locus_tag="AWJ20_2265"
                     /db_xref="GeneID:30034157"
     mRNA            complement(<833707..>835023)
                     /gene="SUP45"
                     /locus_tag="AWJ20_2265"
                     /product="translation termination factor eRF1"
                     /transcript_id="XM_018879199.1"
                     /db_xref="GeneID:30034157"
     CDS             complement(833707..835023)
                     /gene="SUP45"
                     /locus_tag="AWJ20_2265"
                     /inference="similar to AA sequence:KEGG_Orthology:K03265"
                     /note="Polypeptide release factor (eRF1) in translation
                     termination; mutant form acts as a recessive omnipotent
                     suppressor; methylated by Mtq2p-Trm112p in ternary complex
                     eRF1-eRF3-GTP; mutation of methylation site confers
                     resistance to zymocin; has a role in cytokinesis through
                     interaction with Mlc1p; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA,IEA]; GO_component: GO:0010494
                     - cytoplasmic stress granule [Evidence IDA] [PMID
                     23451152]; GO_component: GO:0005829 - cytosol [Evidence
                     IPI] [PMID 1474892]; GO_component: GO:0018444 -
                     translation release factor complex [Evidence IDA] [PMID
                     7556078]; GO_function: GO:0003747 - translation release
                     factor activity [Evidence IDA] [PMID 20947765];
                     GO_function: GO:0016149 - translation release factor
                     activity, codon specific [Evidence IEA]; GO_function:
                     GO:0016149 - translation release factor activity, codon
                     specific [Evidence IMP,ISS] [PMID 9182990]; GO_process:
                     GO:0006353 - DNA-templated transcription, termination
                     [Evidence IMP] [PMID 23109428]; GO_process: GO:0006412 -
                     translation [Evidence IEA]; GO_process: GO:0006415 -
                     translational termination [Evidence IEA]; GO_process:
                     GO:0006415 - translational termination [Evidence IGI,IMP]
                     [PMID 18724935]; GO_process: GO:0006415 - translational
                     termination [Evidence IDA] [PMID 20947765]; GO_process:
                     GO:0006415 - translational termination [Evidence IMP,ISS]
                     [PMID 9182990]"
                     /codon_start=1
                     /product="translation termination factor eRF1"
                     /protein_id="XP_018737137.1"
                     /db_xref="GeneID:30034157"
                     /translation="MAPAQEETDAEKNIQIWKVKKLIKNLEQARGNGTSMISLIIPPK
                     GQIPLTARMLADEYGTASNIKSRVNRLSVLSAITSTQQRLKLYNKVPPNGLVIYCGEI
                     ITEEGKERKVNIDFEPFKPINTSLYLCDNKFHTEALSELLESDSKFGFIVMDGNGALF
                     GTLSGNTREILHKFTVDLPKKHGRGGQSALRFARLRDEKRHNYVRKVAEVAVQNFITA
                     DKVNVTGLVLAGSADFKTELSQSDLFDNRLQAKVIKIVDVSYGGENGFNQAIELSAET
                     LSNVKFIQEKKLINAYFDEISQDSGKFCYGVDDTLKALDMGACETVIVFENLNIMRLT
                     LKSADGESTVVVHAAKDAPNKDHLLDKAGNELEVVEEKPLLEWLAENYQSFGATLEFV
                     TDRSSEGAQFVRGFGGIGAILRYKVNFEQLVDESDDEYFDDDDDYI"
     gene            complement(<835905..>837179)
                     /gene="STE24"
                     /locus_tag="AWJ20_2266"
                     /db_xref="GeneID:30034158"
     mRNA            complement(<835905..>837179)
                     /gene="STE24"
                     /locus_tag="AWJ20_2266"
                     /product="Ste24p"
                     /transcript_id="XM_018879200.1"
                     /db_xref="GeneID:30034158"
     CDS             complement(835905..837179)
                     /gene="STE24"
                     /locus_tag="AWJ20_2266"
                     /inference="similar to AA sequence:KEGG_Orthology:K06013"
                     /note="Highly conserved zinc metalloprotease; functions in
                     two steps of a-factor maturation, C-terminal CAAX
                     proteolysis and the first step of N-terminal proteolytic
                     processing; contains multiple transmembrane spans;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA]; GO_component: GO:0005789 - endoplasmic reticulum
                     membrane [Evidence IEA]; GO_component: GO:0030176 -
                     integral component of endoplasmic reticulum membrane
                     [Evidence IDA] [PMID 11581258]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005741 -
                     mitochondrial outer membrane [Evidence IDA] [PMID
                     16407407]; GO_component: GO:0005637 - nuclear inner
                     membrane [Evidence IMP] [PMID 18923140]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0004222 - metalloendopeptidase
                     activity [Evidence IEA]; GO_function: GO:0004222 -
                     metalloendopeptidase activity [Evidence IDA] [PMID
                     11581258]; GO_function: GO:0004222 - metalloendopeptidase
                     activity [Evidence IMP,ISS] [PMID 9065405]; GO_function:
                     GO:0008237 - metallopeptidase activity [Evidence IEA];
                     GO_function: GO:0008233 - peptidase activity [Evidence
                     IEA]; GO_process: GO:0071586 - CAAX-box protein processing
                     [Evidence IMP] [PMID 9065405]; GO_process: GO:0007323 -
                     peptide pheromone maturation [Evidence IDA] [PMID
                     11581258]; GO_process: GO:0007323 - peptide pheromone
                     maturation [Evidence IMP] [PMID 9065405]; GO_process:
                     GO:0006508 - proteolysis [Evidence IEA,IEA]; GO_process:
                     GO:0019236 - response to pheromone [Evidence IEA]"
                     /codon_start=1
                     /product="Ste24p"
                     /protein_id="XP_018737138.1"
                     /db_xref="GeneID:30034158"
                     /translation="MGFTAGQYLFTTYLSYRQYQVLKKPSPPKELDNVITQETFKKTQ
                     EYGRAKAKFGFFTSFFSFVQNVAILKYDLLPKMFGLAGKFLAAYGHSKWFSGLTAQSI
                     VFLLGFQFVETIISLPLSLYSDFVIEERFGFNKQTIGLFFTDLVKSEILKIVIGAPLI
                     AAILKIIDYFGDQFFFYLWLFMVGFQVVAIAVFPTLIQPLFNKLSPLEDGELKTSVEN
                     LAKRVQFPLNKLYVIDGSKRSSHSNAYFYGLPWSKQIVIFDTLIEKSTVDEVTAVLAH
                     EIGHWALSHTTKMLLVAQAHLFAIFALFSAFIRNQSLYNSFGFFSSSSQYPILVGFIL
                     FGDILQPLESLLSFAMNLMSRSFEFQADDYAVNLNYGPELSKSLIGIHTENLSNVDAD
                     WLYSSYHHSHPILPERLKALRLATEAIQKKKH"
     gene            complement(<838466..>840064)
                     /gene="MUP1"
                     /locus_tag="AWJ20_2267"
                     /db_xref="GeneID:30034159"
     mRNA            complement(<838466..>840064)
                     /gene="MUP1"
                     /locus_tag="AWJ20_2267"
                     /product="Mup1p"
                     /transcript_id="XM_018879201.1"
                     /db_xref="GeneID:30034159"
     CDS             complement(838466..840064)
                     /gene="MUP1"
                     /locus_tag="AWJ20_2267"
                     /note="High affinity methionine permease; integral
                     membrane protein with 13 putative membrane-spanning
                     regions; also involved in cysteine uptake; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016021 - integral component of
                     membrane [Evidence ISM] [PMID 12192589]; GO_component:
                     GO:0005887 - integral component of plasma membrane
                     [Evidence ISS] [PMID 8893857]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA,IEA]; GO_function: GO:0000102 -
                     L-methionine secondary active transmembrane transporter
                     activity [Evidence IDA] [PMID 8893857]; GO_function:
                     GO:0015171 - amino acid transmembrane transporter activity
                     [Evidence IEA]; GO_process: GO:0003333 - amino acid
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006865 - amino acid transport [Evidence IEA];
                     GO_process: GO:0042883 - cysteine transport [Evidence IDA]
                     [PMID 11330701]; GO_process: GO:0044690 - methionine
                     import [Evidence IGI,IMP] [PMID 8893857]; GO_process:
                     GO:0015821 - methionine transport [Evidence IDA] [PMID
                     11330701]; GO_process: GO:0000101 - sulfur amino acid
                     transport [Evidence IMP] [PMID 8893857]; GO_process:
                     GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Mup1p"
                     /protein_id="XP_018737139.1"
                     /db_xref="GeneID:30034159"
                     /translation="MAFWESDKNSSTQVAKSDYESQKSSSPDSEIVVQEGGIQVIAPE
                     TSRSIGVVSATFLIFNRMIGTGIFATPGTIFGQCGSVGLTLFIWVVGALISAAGLMVY
                     LEWGSMIPKNGAEKAYLEYFYRKPRLLMTSLYGSYMFFMAWAASNSIVCGQYLLLAGG
                     VEPDRWNQRGVGLGCITFAFLVHGLALKWGLRIQNVLGIFKLIVIVIIVVIGWVAMSG
                     RLNIERTHAFHNAFENTNADAYGIVNALYNVMWSFIGYSNANYALAETKNPHRILKIA
                     APLAITIVTILYMFVNLAYFAVVPRDQILNSGTILAGNFFGIVWGKRGETAMSVFVAL
                     SALGNVMAVIFSQGRIVQELGREGSLPFSRFFASSRPLNSPLAGLFEHWLICVIIILA
                     VPPGDAYNFLVNLISYPYSIVNAFVALALIVIYINKKRYPEWNPPIKASLPVTVFFFL
                     SSVYLIAAPYVPPRSAADSVYKSLPYYLHCVVAWGIFAVGGIYWLVWARIIPRIRGYT
                     LDFEEYVDDDGWAKKKVVKIYKSD"
     gene            <842283..>843428
                     /locus_tag="AWJ20_2268"
                     /db_xref="GeneID:30034160"
     mRNA            <842283..>843428
                     /locus_tag="AWJ20_2268"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879202.1"
                     /db_xref="GeneID:30034160"
     CDS             842283..843428
                     /locus_tag="AWJ20_2268"
                     /inference="similar to AA sequence:KEGG_Orthology:K01078"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737140.1"
                     /db_xref="GeneID:30034160"
                     /translation="MLKLISLLIGFIAAVSGTPLFGILANPFAPKFSTIQPSNPEITT
                     AAACAPTSNYKDIEYVCGNVFDRIYIIFLENADYMKAVEDCHLKKLQKKGITLCNYWA
                     LTHTSEPNYIAAVGGDYYGLDTDDFVRLPERVFSIVDLLEYRNISWAEYQEHMPFTGY
                     QGFEYKNQCNGANDYVRKHNPLIMYDSVTNNARRLSNIKNFTELYSDVANRALPQWAF
                     ITCNMSNGGHDTTVAKAGEWAYNFLDQLLVDEYCFHKTLLVLTFDEVDRNPKNRVLAL
                     LLGDIPCDLQNTVDETYYDHYSLLSSVEANWDLPNLGRGDCGANTFEVIARTTGYKNK
                     QVDTRFKFNALSPPGWLAESFISIPPPDLNGQGAGGPILPEIARVWQ"
     gene            <847646..>849001
                     /gene="SDS3"
                     /locus_tag="AWJ20_2269"
                     /db_xref="GeneID:30034161"
     mRNA            <847646..>849001
                     /gene="SDS3"
                     /locus_tag="AWJ20_2269"
                     /product="Sds3p"
                     /transcript_id="XM_018879203.1"
                     /db_xref="GeneID:30034161"
     CDS             847646..849001
                     /gene="SDS3"
                     /locus_tag="AWJ20_2269"
                     /note="Component of the Rpd3L histone deacetylase complex;
                     required for its structural integrity and catalytic
                     activity, involved in transcriptional silencing and
                     required for sporulation; relocalizes to the cytosol in
                     response to hypoxia; cells defective in SDS3 display
                     pleiotropic phenotypes; GO_component: GO:0033698 - Rpd3L
                     complex [Evidence IDA] [PMID 16286007]; GO_component:
                     GO:0033698 - Rpd3L complex [Evidence IDA] [PMID 16286008];
                     GO_component: GO:0033698 - Rpd3L complex [Evidence IDA]
                     [PMID 16314178]; GO_component: GO:0033698 - Rpd3L complex
                     [Evidence IDA] [PMID 19040720]; GO_component: GO:0070210 -
                     Rpd3L-Expanded complex [Evidence IDA] [PMID 19040720];
                     GO_component: GO:0005829 - cytosol [Evidence IDA] [PMID
                     22932476]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 22932476]; GO_function: GO:0004407 - histone
                     deacetylase activity [Evidence IMP] [PMID 11024051];
                     GO_process: GO:0016568 - chromatin modification [Evidence
                     IEA]; GO_process: GO:0006342 - chromatin silencing
                     [Evidence IGI,IMP] [PMID 11024051]; GO_process: GO:0016575
                     - histone deacetylation [Evidence IMP,IPI] [PMID
                     11024051]; GO_process: GO:0016575 - histone deacetylation
                     [Evidence IMP] [PMID 16314178]; GO_process: GO:0061188 -
                     negative regulation of chromatin silencing at rDNA
                     [Evidence IMP] [PMID 16286008]; GO_process: GO:0061186 -
                     negative regulation of chromatin silencing at silent
                     mating-type cassette [Evidence IMP] [PMID 16286008];
                     GO_process: GO:0031939 - negative regulation of chromatin
                     silencing at telomere [Evidence IMP] [PMID 16286008];
                     GO_process: GO:0031939 - negative regulation of chromatin
                     silencing at telomere [Evidence IMP] [PMID 19372273];
                     GO_process: GO:0045944 - positive regulation of
                     transcription from RNA polymerase II promoter [Evidence
                     IMP] [PMID 17210643]; GO_process: GO:0061408 - positive
                     regulation of transcription from RNA polymerase II
                     promoter in response to heat stress [Evidence IMP] [PMID
                     20398213]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Sds3p"
                     /protein_id="XP_018737141.1"
                     /db_xref="GeneID:30034161"
                     /translation="MDGTGRMAYAGDIHDQTGYGGGVVHGQYTHGQISGYGPGSAAAA
                     SVMAGGIGGVGVGVSGGIGAGGVGTGTGAGAGGGGAQPASKRDKRRQTLAAKLDQITD
                     MFENERDFHYSEMLRTLQSTLYSLHVGDNPEFLEELTDLEEVRDEQLVMLYLWEKYQI
                     ERADHEYNQDVELANEEHRQMTDMVKEKLMAKLESQRRKLSEDKTLLDIANDHSFFLS
                     SSGLYHSERNSAKDVNSDYGGGSSTAGAFLYPPGSPSGRDFRDGGGMSTRAAAGSGSA
                     AAAAIGAGGGGSGGTGYGIGGYGGTGLNGHVNGLGAGGEGFSSQSGMERRALRRRGGA
                     AYDDSGLSGGEGSGGAGGTGTGGATSTRRRGAYHGTLNGSGAANTNGYRTNNGGSDME
                     TAAAFSDRDLEGMLFSKDREAPTTRHSSKAYHGVRVLKPEEAQEDIDLLRASIRRAKR
                     P"
     gene            <850608..>852578
                     /gene="KTR5"
                     /locus_tag="AWJ20_2270"
                     /db_xref="GeneID:30034163"
     mRNA            <850608..>852578
                     /gene="KTR5"
                     /locus_tag="AWJ20_2270"
                     /product="Ktr5p"
                     /transcript_id="XM_018879205.1"
                     /db_xref="GeneID:30034163"
     CDS             850608..852578
                     /gene="KTR5"
                     /locus_tag="AWJ20_2270"
                     /inference="similar to AA sequence:KEGG_Orthology:K03854"
                     /note="Putative mannosyltransferase involved in protein
                     glycosylation; member of the KRE2/MNT1 mannosyltransferase
                     family; KTR5 has a paralog, KTR7, that arose from the
                     whole genome duplication; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence ISS] [PMID 9090056]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence
                     IEA]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_function: GO:0000030 -
                     mannosyltransferase activity [Evidence IEA]; GO_function:
                     GO:0000030 - mannosyltransferase activity [Evidence ISS]
                     [PMID 9090056]; GO_function: GO:0016740 - transferase
                     activity [Evidence IEA]; GO_function: GO:0016757 -
                     transferase activity, transferring glycosyl groups
                     [Evidence IEA]; GO_process: GO:0097502 - mannosylation
                     [Evidence IC] [PMID 9090056]; GO_process: GO:0006486 -
                     protein glycosylation [Evidence IEA]"
                     /codon_start=1
                     /product="Ktr5p"
                     /protein_id="XP_018737142.1"
                     /db_xref="GeneID:30034163"
                     /translation="MVNLLKSLQSRLIYPAPSNTNHFDEDDDGEELFPTITSSAAMTP
                     VNHSQTGEYFPNYPRKSDSSTGSSNNDSGHGLGINSEKARLSSLSDNLSASASSSAGS
                     SPTMTSSPTHSSSSTNLKLLLEKHRSRKQNQPRSHTIRFIYKLSHKIRYLSAIRIRIK
                     HNVSVPLVVFLLPILSVLIFFLIFFLTRILHDNNSNNNNNNGGFFSKSPPKLREISDQ
                     YDKPFVVGCLEPQVDQPRANAVLVVLARNSEIEGVSQSMISLERHFNRWFNYPYVFLN
                     DEPFNSTFREAVRNITKSKVQFGTIDPVDWNFPEWAEPEDIKEGIAKQGDAAIMYGGM
                     ESYHHMCRFYSGKFYNHPLLASYEWYWRVEPEVKYFCDITYDPFLHMAKNNKVYGFTI
                     IIKELVETVPNLFRHTYGFKQNYGLNTTGLWDLFLTKPEDSDPDFKDANKDSGSVRKR
                     KKQQKKDKAKAKAEENAALSDILPEEAMLLEQGKEKGIQQTLQEEEKLDPYSMNGEKY
                     NMCHFWSNFEIARLDFFRSKQYNDYFETLDRSGGFWNERWGDAPVHSLAAGLFLEPEQ
                     IHYFRDIGYRHTTIQHCPANAPQRQRPHIPYIPDPTNKEQIEEDRYWANPDPEVLNGV
                     GCRCRCDTDIVDVEGKDGSCLADWVDLTGGWV"
     gene            complement(<853112..>854551)
                     /gene="RPN4"
                     /locus_tag="AWJ20_2271"
                     /db_xref="GeneID:30034164"
     mRNA            complement(<853112..>854551)
                     /gene="RPN4"
                     /locus_tag="AWJ20_2271"
                     /product="stress-regulated transcription factor RPN4"
                     /transcript_id="XM_018879206.1"
                     /db_xref="GeneID:30034164"
     CDS             complement(853112..854551)
                     /gene="RPN4"
                     /locus_tag="AWJ20_2271"
                     /codon_start=1
                     /product="stress-regulated transcription factor RPN4"
                     /protein_id="XP_018737143.1"
                     /db_xref="GeneID:30034164"
                     /translation="MLIFRNTNSTIVLSDSENSKTPDVQMFPSMTSFGRNQTAGPVFA
                     AGPSSGYPTTPFKMSSPYYQAELESQRQQLVLPDSHEFVNDLGSSDEQLRFHALSQLN
                     SNYVPPLSSIAPQSMMKSADEFRYERSMPSLYGQKTEGFDEYFSGGVYINPNERPTME
                     GGVSDAMDLLDTPEAMDEDDEEEDDDDDEENMFYVEDDDEDLYNDNYYGESAAPGLDH
                     SPYDATNLLISNPVGPSMPLAMRFQPISEPVQEQVGVLTVNPADLTKMPAQSSEGDLT
                     NPTIDSYDEFLGSSSASSPSSLASLQSSFSSSDEDYDSIYEPRRLDKIIPEPLRVESI
                     ISHENHNHNLDHSHNHHHQDDGRSFNSHVQPVEREQPHGQPQHIMTSSVSPSELNNVS
                     RHEMTKTRRHSAKKNNDLTPPFRCNLVSSESGKECGKVFSRSYDLIRHKDTIHASVRK
                     TFKCDQCGEASRTFSRMDALTRHMRVKHA"
     gene            <857137..>859443
                     /gene="RAD3"
                     /locus_tag="AWJ20_2272"
                     /db_xref="GeneID:30034165"
     mRNA            <857137..>859443
                     /gene="RAD3"
                     /locus_tag="AWJ20_2272"
                     /product="TFIIH/NER complex ATP-dependent 5'-3' DNA
                     helicase subunit RAD3"
                     /transcript_id="XM_018879207.1"
                     /db_xref="GeneID:30034165"
     CDS             857137..859443
                     /gene="RAD3"
                     /locus_tag="AWJ20_2272"
                     /inference="similar to AA sequence:KEGG_Orthology:K10844"
                     /note="5' to 3' DNA helicase; involved in nucleotide
                     excision repair and transcription; subunit of RNA polII
                     initiation factor TFIIH and of Nucleotide Excision Repair
                     Factor 3 (NEF3); homolog of human XPD protein; mutant has
                     aneuploidy tolerance; protein abundance increases in
                     response to DNA replication stress; GO_component:
                     GO:0000439 - core TFIIH complex [Evidence IDA] [PMID
                     14500720]; GO_component: GO:0000439 - core TFIIH complex
                     [Evidence IDA] [PMID 19818408]; GO_component: GO:0005675 -
                     holo TFIIH complex [Evidence IDA] [PMID 19818408];
                     GO_component: GO:0000112 - nucleotide-excision repair
                     factor 3 complex [Evidence IDA] [PMID 8855246];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA,IEA];
                     GO_function: GO:0051539 - 4 iron, 4 sulfur cluster binding
                     [Evidence IEA]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0043141 -
                     ATP-dependent 5'-3' DNA helicase activity [Evidence IDA]
                     [PMID 2827162]; GO_function: GO:0004003 - ATP-dependent
                     DNA helicase activity [Evidence IEA]; GO_function:
                     GO:0008026 - ATP-dependent helicase activity [Evidence
                     IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA,IEA]; GO_function: GO:0000990 - core RNA polymerase
                     binding transcription factor activity [Evidence IC] [PMID
                     19818408]; GO_function: GO:0003684 - damaged DNA binding
                     [Evidence IDA] [PMID 8132553]; GO_function: GO:0004386 -
                     helicase activity [Evidence IEA]; GO_function: GO:0016787
                     - hydrolase activity [Evidence IEA]; GO_function:
                     GO:0016817 - hydrolase activity, acting on acid anhydrides
                     [Evidence IEA]; GO_function: GO:0016818 - hydrolase
                     activity, acting on acid anhydrides, in
                     phosphorus-containing anhydrides [Evidence IEA];
                     GO_function: GO:0051536 - iron-sulfur cluster binding
                     [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0003676 - nucleic
                     acid binding [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA]; GO_process: GO:0006200
                     - ATP catabolic process [Evidence IEA]; GO_process:
                     GO:0032508 - DNA duplex unwinding [Evidence IEA];
                     GO_process: GO:0006281 - DNA repair [Evidence IEA];
                     GO_process: GO:0006974 - cellular response to DNA damage
                     stimulus [Evidence IEA]; GO_process: GO:0006139 -
                     nucleobase-containing compound metabolic process [Evidence
                     IEA]; GO_process: GO:0006289 - nucleotide-excision repair
                     [Evidence IEA]; GO_process: GO:0033683 -
                     nucleotide-excision repair, DNA incision [Evidence IDA]
                     [PMID 8631896]; GO_process: GO:0070816 - phosphorylation
                     of RNA polymerase II C-terminal domain [Evidence IDA]
                     [PMID 19450536]; GO_process: GO:0070816 - phosphorylation
                     of RNA polymerase II C-terminal domain [Evidence IDA]
                     [PMID 19679665]; GO_process: GO:0045951 - positive
                     regulation of mitotic recombination [Evidence IMP] [PMID
                     24189665]; GO_process: GO:0000019 - regulation of mitotic
                     recombination [Evidence IMP] [PMID 10713167]; GO_process:
                     GO:0000019 - regulation of mitotic recombination [Evidence
                     IMP] [PMID 9799251]; GO_process: GO:0006355 - regulation
                     of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0010525 - regulation of transposition,
                     RNA-mediated [Evidence IMP] [PMID 10713167]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IDA] [PMID 19818408]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="TFIIH/NER complex ATP-dependent 5'-3' DNA
                     helicase subunit RAD3"
                     /protein_id="XP_018737144.1"
                     /db_xref="GeneID:30034165"
                     /translation="MCDTKKTLDVGGNCILEMPSGTGKTISLLSLTVAYQMHYPEHRK
                     IVYCSRTMTEIEKALEELKNLMAFRAKELGYVEDFRGLGLSSRKNLCLHPSVKRERKG
                     AIVDERCRSMTNGISKSKIEAGDTRAQLCEYHENLYELEPHNLIPPGVYTFEDLLKYC
                     QERRTCPYFTVRRMMSFCNIVIYSYHYLLDPKIAERVSKELSKDCIIIFDEAHNIDNV
                     CIEALSVDITEDSLRRAAHGAASLGRAVDNVKVNDAEKLQNEYQKLVEGLREAEVARE
                     EDLFMSNPVLPDDLLSEAVPGNIRRAEHFVAFLKRFIEYLKTRMKVLHVISETPNSFL
                     KHLKELTYIDKKPLRFCSERLNSLVRTLELTEIEDFTALKEIVTFATLVSTYEKGFIL
                     ILEPFETEQATVPNPILRFACLDASIAMKPVFDRFSSVIITSGTISPLDMYPRMLNFD
                     TVIQESYTITLARRSFLPIIVTKGSDQVAISTRFQIRNDPSVVRNYGNLLIEFSKLTP
                     DGLVVFFPSYLYMESIISMWQTMGILDEVWKYKLILVETPDGQETALALETYRTACSN
                     GRGAVMFCVARGKVSEGIDFDNQYGRTVLMIGVPFQYTESRILKARLEFLRENFRIKE
                     NDFLSFDAMRHAAQCLGRVIRGKEDYGIMVLADRRFAKKRTQLPKWINEAILDADVNM
                     STDMAVAAAKKFLRTMAQPLDPADQKGVSVWDINDLQAHQQELTGVKGKRIEEVTNKP
                     EHDDQMDVDFDDEGIDDEGIDDSELLNL"
     gene            <860935..>862557
                     /gene="AMD2"
                     /locus_tag="AWJ20_2273"
                     /db_xref="GeneID:30034166"
     mRNA            <860935..>862557
                     /gene="AMD2"
                     /locus_tag="AWJ20_2273"
                     /product="Amd2p"
                     /transcript_id="XM_018879208.1"
                     /db_xref="GeneID:30034166"
     CDS             860935..862557
                     /gene="AMD2"
                     /locus_tag="AWJ20_2273"
                     /inference="similar to AA sequence:KEGG_Orthology:K01426"
                     /note="Putative amidase; GO_component: GO:0005575 -
                     cellular_component [Evidence ND]; GO_function: GO:0004040
                     - amidase activity [Evidence IEA]; GO_function: GO:0004040
                     - amidase activity [Evidence ISS] [PMID 2263500];
                     GO_function: GO:0016884 - carbon-nitrogen ligase activity,
                     with glutamine as amido-N-donor [Evidence IEA];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016811 - hydrolase activity, acting
                     on carbon-nitrogen (but not peptide) bonds, in linear
                     amides [Evidence IEA]; GO_process: GO:0008150 -
                     biological_process [Evidence ND]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA,IEA,IEA]"
                     /codon_start=1
                     /product="Amd2p"
                     /protein_id="XP_018737145.1"
                     /db_xref="GeneID:30034166"
                     /translation="MTVSEISLEKLIDEARKRRESQLPDKYRLKKDQLPHHSVKDITG
                     FFQQSGLFTKHELTITESPVEIILKAIKDQDWTSVEVAEAFCKRAAYTHQITNCLTEM
                     FFDRAVERAKYLDDYYAQHGKLFGPLHGLPVSIKDHHQIKGTTVTIGFTAWSTTVSSE
                     DSAIITMLYELGAVLYCKTTVPVAMMMPDTESHLFGRTLNPNNLDHSPGGSSGGEGAL
                     LACCGAPIGLGSDIGGSIRLPAHSNGIYGLKPTASRFPIAGTRSGLRGQHTIKSVVGP
                     LSRSLESLEYFTKLIFNSNPENYDPTANPIPWREPIIPEKLVFGVIRTDNYVEPTPAV
                     KRAVERTVAALESQGHEVIEWEPYMHARMDDILDKTFVADGGKFVKSSRQGEPLFPYM
                     EPYGKVQESGCSLLWELNYERSEIEMEYFKRWQDSGKLSKSGRRMDGIIVPASPVSSH
                     PPHHFSYVGYTSVFNAIDYPAVVYPVLKSDSSIDGKPAHEPLSEKDRKVWEAYNPEEY
                     DNGCVGLQIVCRRHEDEKALALAKVIRDALQQ"
     gene            complement(<862786..>864387)
                     /gene="HOL1"
                     /locus_tag="AWJ20_2274"
                     /db_xref="GeneID:30034167"
     mRNA            complement(<862786..>864387)
                     /gene="HOL1"
                     /locus_tag="AWJ20_2274"
                     /product="Hol1p"
                     /transcript_id="XM_018879209.1"
                     /db_xref="GeneID:30034167"
     CDS             complement(862786..864387)
                     /gene="HOL1"
                     /locus_tag="AWJ20_2274"
                     /note="Putative transporter in the major facilitator
                     superfamily; member of the 12-spanner drug:H(+) antiporter
                     DHA1 family; mutations in membrane-spanning domains permit
                     cation and histidinol uptake; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0016020 -
                     membrane [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0005886 - plasma
                     membrane [Evidence ISS] [PMID 8955402]; GO_function:
                     GO:0015665 - alcohol transmembrane transporter activity
                     [Evidence IMP] [PMID 2405251]; GO_function: GO:0022890 -
                     inorganic cation transmembrane transporter activity
                     [Evidence IMP] [PMID 8955402]; GO_process: GO:0006812 -
                     cation transport [Evidence IMP] [PMID 8955402];
                     GO_process: GO:0015850 - organic hydroxy compound
                     transport [Evidence IMP] [PMID 2405251]; GO_process:
                     GO:0055085 - transmembrane transport [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /product="Hol1p"
                     /protein_id="XP_018737146.1"
                     /db_xref="GeneID:30034167"
                     /translation="MSKSDNIATENSLEVQSSWDAVPGTLNWENKSSNGDLILYPQPS
                     NDPDDPLNWTKIRKIVNLSLVLFYTFTTGIAGTSTYSILVPISEATGITIAQLNNGTG
                     YLFLLAGWTNLIWQPMALTFGRRPVFLFSILGCVAMSEWAAHISSYGAWAACRCLLGA
                     FVAPVEVLPEQCIAELFFSHERSAWMGIYMLVLASSNYLAPLIAGYMNESIGWQWVQH
                     WCALLLALNFILAFFFYEDTMFNRTTKEAEHVEGSDEDKYGHMITVNSPRNLDYSHKM
                     NYLQKMKLWRVNPLVTKRGFFDMVWRPVYFFFRFPIVAWAGVFYGFGLVWYNVFNATS
                     SAILSAPPYNFSSDGVGLSYLAPLIGAIIGGLYCWSIVNYYAISLARKNNGIREPEQR
                     LWGLVLYNILLPSGLILWGVGAAHEVHWIGLLFGAAFVSICNVLAGSFSLSYLIDCYK
                     DISGEALVSVILCRNTLSFGINYAITPWINHSGLQNTFIVAAVLGLVTGLTFLIMIFG
                     GKALRKKGASAYIKAAETQIIHVAH"
     gene            <867187..>867699
                     /locus_tag="AWJ20_2275"
                     /db_xref="GeneID:30034168"
     mRNA            <867187..>867699
                     /locus_tag="AWJ20_2275"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879210.1"
                     /db_xref="GeneID:30034168"
     CDS             867187..867699
                     /locus_tag="AWJ20_2275"
                     /inference="similar to AA sequence:KEGG_Orthology:K03952"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737147.1"
                     /db_xref="GeneID:30034168"
                     /translation="MSTTREPNSDYAAYVDQTPMPSHIPDVPEIGATSAPLKSASFFI
                     GARCLPYNDDYIMCKQESKGNGELDCLKEGRRVTRCAISVLEDINKHCLEEFRLHWQC
                     LEQNNQQFWGCRPAERLLNKCVFEKLQLEKKIPQVSSDNQIHLKKNPLLKPNTEDYAS
                     VAAAKRGGVL"
     gene            complement(<867921..>870398)
                     /gene="CTF4"
                     /locus_tag="AWJ20_2276"
                     /db_xref="GeneID:30034169"
     mRNA            complement(<867921..>870398)
                     /gene="CTF4"
                     /locus_tag="AWJ20_2276"
                     /product="chromatin-binding protein CTF4"
                     /transcript_id="XM_018879211.1"
                     /db_xref="GeneID:30034169"
     CDS             complement(867921..870398)
                     /gene="CTF4"
                     /locus_tag="AWJ20_2276"
                     /inference="similar to AA sequence:KEGG_Orthology:K11274"
                     /codon_start=1
                     /product="chromatin-binding protein CTF4"
                     /protein_id="XP_018737148.1"
                     /db_xref="GeneID:30034169"
                     /translation="MKIKLNPRQAHTAGIVRVCYSLDGNYLISGGANDLVRKFTTGSD
                     SSEPDSLDHHHDAVLAVDVSDAHFASSSEDGTVHLFDVVSNKPKGVIVRNPLAIREVK
                     FSPDGKWIATSGNDKFVKIISVTDILKVQEMSLPVPVKHISYSISGNLIALSSIDGNL
                     RFYRLEKSENKDGSDEPDGDMENSFRQNTIIPPFNPTLVHSLEGIVPDVRDVDDVRTT
                     AVEFHPDGTHFAIATKTFEVGVYNLSNVSEVARLRHTNGHKKELTGIKWSPNGKYIAT
                     ISLDNKVIIWDATTFTPVESQNVESPISVAWHPTTNELTVATDRGQLITYDVLLDQAS
                     PFGDITPFNTTTSTNGTDSSTKKSVNSVDRIRDYDDYDLELEFTGDATADDVEQANGE
                     GNELDWIEDDDGAGYVGEENGKRSRESTALENGNGYKRAKFVSTEPVHEPFITGSTPW
                     KNGRRYLCMNTIGYIWSVFQEDHNTVTVTFFDRGLHREYHFTDYVQYDLACLTEEAAL
                     FANTKTRKALLRFHDGFTNNWEYTLSDNDLFRCISLSKNIVTFCTAQGYVRTFNIYGS
                     PLSVYRQSRDPVITCASWRNYNYIVRTSPTGSLSYSIENVRTNVIYQKNDEIDIGVGN
                     KLKAVFFTSQGDPCIFDSKGILLVLQNWREPLQTRWVPIVDSNIESAQGRKESYWPIG
                     VIDNKFVCTVLRKGDQHPNIPLPATTELELSVTVDPTTTDYEKEYLTKQVLLQLSRAQ
                     AESDDNIELVSTVSSQELEVDKVVLRLIQACCIDSKPSKALALAYLINKDQALEAASK
                     IALRFDQSAVAEKINELLNARLRQQQQ"
     gene            <870960..>871739
                     /locus_tag="AWJ20_2277"
                     /db_xref="GeneID:30034170"
     mRNA            <870960..>871739
                     /locus_tag="AWJ20_2277"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879212.1"
                     /db_xref="GeneID:30034170"
     CDS             870960..871739
                     /locus_tag="AWJ20_2277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737149.1"
                     /db_xref="GeneID:30034170"
                     /translation="MEHYFDDEDELPSIVQISRKDFSEDEFVVDEFLTKFHKYQTLED
                     LENQLKSWDKELGHELIDVINKDYGDFVGLGNSLSGGENKIQDVKMNLLRFQTETKKV
                     KTELENVVEKTNKLIQDKKDLVWLQDFSREMILYLKKLEDIEKSVHDKTESDLEQISE
                     FAKQYIHLKLLARDLGVKAVQRDALTESRANKLKHSGTHNDDNVNHSIPPILEQKRPR
                     LARVKSTIIELVDTSIKKKSGTGEEQLRLAILKAKLLETYD"
     gene            complement(<871938..>873827)
                     /locus_tag="AWJ20_2278"
                     /db_xref="GeneID:30034171"
     mRNA            complement(<871938..>873827)
                     /locus_tag="AWJ20_2278"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879213.1"
                     /db_xref="GeneID:30034171"
     CDS             complement(871938..873827)
                     /locus_tag="AWJ20_2278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737150.1"
                     /db_xref="GeneID:30034171"
                     /translation="MSISRVVSCIITVILLLVAGVAGDDPQATSEPAPALASATAATS
                     SETGDPQPVGDVNATGLVVPTNQTSNLLPNFVLEVKTANSGLVLSTELSAMTPLNGTV
                     SSTNGLSDLCSGELTLMNSTTNLNYNMIPLLSCDDADLVAGYLVNVEGSNSPCAVLYS
                     LHSQGCEFDSTSTFETQLGTVFSITSAQYSASIISQINRTMGPITASISSKASENNPG
                     NGSPLTSKSTGSTVAMAVLYSITGVVAATFLFIIVSGAIRVHKHPERYGLVSNTTSYD
                     SNHGPGGEGFGSMQYSRRAKGLARAVLDSIPIVQFKVGNDASGRTTASPKEESIGIDD
                     NIGRQYAVDGEKQGRDSYSLDNLKAGNESMVETTNESIDELYTPGKNVVEPPTQTESL
                     PTGPEGAVGTSAVADVSREPVAAKAVPPVSQSVSEVGTETPAASHVNGTQPMETLVGG
                     LNSDEPDCPICFESFKDGDILRILPCKHRFHALCVDPWLLNSSALCPLCRVDLSLEEN
                     EQVSNDPPNGLNASSHHEVEISLFNRLLDIWNAQLLPREARRVALARFHEEAELRRQL
                     RSRQGNNFEEQNSRRWTNFVNSRRRLFQLRRNRRGASDHEEPAHDNDNNPTSDPSAPP
                     PSSQT"
     gene            complement(<875950..>877872)
                     /locus_tag="AWJ20_2279"
                     /db_xref="GeneID:30034172"
     mRNA            complement(<875950..>877872)
                     /locus_tag="AWJ20_2279"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879214.1"
                     /db_xref="GeneID:30034172"
     CDS             complement(875950..877872)
                     /locus_tag="AWJ20_2279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737151.1"
                     /db_xref="GeneID:30034172"
                     /translation="MSNSLPASTSDTSSHPVSISDLQDITSSVPIMTPPSSRKSTSTP
                     SDPIDKYISAKFKKRTSSIVEWLNKTTSKLGGKYVLVVVAPDDGTDIYFNSPMAKFVD
                     NFLLEKDIVEYLSKGSDGDIDPDRPRVPSIATSTKPNTSTKCKAKLDLCNHDRVISFL
                     TQGLVIIQQATCKALAKSWIREIEPKKQTNYPYKLGDMSKPDWWPYGVRHKEPDHLNK
                     DERVQLLVGLLTHEDISIRRIREAAMPSIRDTDPDKLALLEELYIVADSEKQFLNGNL
                     DESDQIVEVTDLNYWDRQTKIAIPSSNPTTTVKKEKESGSQLKSSSGLGQGRLVNIAP
                     KSTSRAVISSPSIAHLKFDAHQHFAAVTSDSNTSISSPRGHSNGANNSSSLRIASLSS
                     TPSSSLSTTTCSSSSSVGSNSTSSSGSSLSTSASSVSNSSFSANSGLSSSFCSNPIQS
                     PNSSNSNLSYTSKGTPLTAAHYLSQFDTWPGATPLSIPVAGITNRMMFLEHASIPSSS
                     PFHDVNISHGFYMANRTPHKPIRTFANQELDETPSRTTSGQKFDDIGTSSSSIEHTPN
                     PFNQLPLQQLPLPFPLPLQIQSENLNVLGKRPMADRFIYLDDDNTHDENRFNKKFDNG
                     NTKVFYQEETVLKFES"
     gene            <880201..>881082
                     /gene="TMT1"
                     /locus_tag="AWJ20_2280"
                     /db_xref="GeneID:30034174"
     mRNA            <880201..>881082
                     /gene="TMT1"
                     /locus_tag="AWJ20_2280"
                     /product="Tmt1p"
                     /transcript_id="XM_018879216.1"
                     /db_xref="GeneID:30034174"
     CDS             880201..881082
                     /gene="TMT1"
                     /locus_tag="AWJ20_2280"
                     /note="Trans-aconitate methyltransferase; cytosolic enzyme
                     that catalyzes the methyl esterification of
                     3-isopropylmalate, an intermediate of the leucine
                     biosynthetic pathway, and trans-aconitate, which inhibits
                     the citric acid cycle; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005829 -
                     cytosol [Evidence IDA] [PMID 11695919]; GO_function:
                     GO:0008168 - methyltransferase activity [Evidence IEA];
                     GO_function: GO:0046547 - trans-aconitate
                     3-methyltransferase activity [Evidence IEA]; GO_function:
                     GO:0046547 - trans-aconitate 3-methyltransferase activity
                     [Evidence IDA] [PMID 11695919]; GO_function: GO:0016740 -
                     transferase activity [Evidence IEA]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]; GO_process:
                     GO:0032259 - methylation [Evidence IEA]"
                     /codon_start=1
                     /product="Tmt1p"
                     /protein_id="XP_018737152.1"
                     /db_xref="GeneID:30034174"
                     /translation="MTTFAKATFNAASYLSARPHYPDSLFKHIFSYFQKHNSAIKGTP
                     TKCVDIGCGPGEATLKLSEYFDSAIGIDPGAGMIESATKSARSAGKSSDQLNYIIGSD
                     KTFTDIIPESSVNIVTAAQASHWFDFPKFIESSAKVLKPNGVLAVWGYVDHVFVNHPK
                     ASEISLEYSYDKKYMGPYWEQPGRGRLASMLSEAEGQLRANDKFSDVEVIRDESITLN
                     PGSFYEMTRTLPLRSVHAYMKTFSAYHEWKAQHPDEPDVVDLCFEAIKKAENWTDDTE
                     VTIKWATVLIMASKKAL"
     gene            complement(<881240..>882298)
                     /gene="HST2"
                     /locus_tag="AWJ20_2281"
                     /db_xref="GeneID:30034175"
     mRNA            complement(<881240..>882298)
                     /gene="HST2"
                     /locus_tag="AWJ20_2281"
                     /product="histone deacetylase HST2"
                     /transcript_id="XM_018879217.1"
                     /db_xref="GeneID:30034175"
     CDS             complement(881240..882298)
                     /gene="HST2"
                     /locus_tag="AWJ20_2281"
                     /inference="similar to AA sequence:KEGG_Orthology:K11121"
                     /note="Cytoplasmic NAD(+)-dependent protein deacetylase;
                     member of the silencing information regulator 2 (Sir2)
                     family of NAD(+)-dependent protein deacetylases; modulates
                     nucleolar (rDNA) and telomeric silencing; possesses
                     NAD(+)-dependent histone deacetylase activity in vitro;
                     contains a nuclear export signal (NES); function regulated
                     by its nuclear export; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 11226170]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 17110954];
                     GO_function: GO:0051287 - NAD binding [Evidence IEA];
                     GO_function: GO:0070403 - NAD+ binding [Evidence IEA];
                     GO_function: GO:0017136 - NAD-dependent histone
                     deacetylase activity [Evidence IDA] [PMID 10811920];
                     GO_function: GO:0017136 - NAD-dependent histone
                     deacetylase activity [Evidence IMP] [PMID 10841563];
                     GO_function: GO:0016787 - hydrolase activity [Evidence
                     IEA]; GO_function: GO:0016811 - hydrolase activity, acting
                     on carbon-nitrogen (but not peptide) bonds, in linear
                     amides [Evidence IEA]; GO_function: GO:0046872 - metal ion
                     binding [Evidence IEA]; GO_function: GO:0008270 - zinc ion
                     binding [Evidence IEA]; GO_process: GO:0000183 - chromatin
                     silencing at rDNA [Evidence IMP] [PMID 11226170];
                     GO_process: GO:0000183 - chromatin silencing at rDNA
                     [Evidence IMP] [PMID 16051752]; GO_process: GO:0001300 -
                     chronological cell aging [Evidence IGI,IMP] [PMID
                     16051752]; GO_process: GO:0031939 - negative regulation of
                     chromatin silencing at telomere [Evidence IMP] [PMID
                     11226170]; GO_process: GO:0045950 - negative regulation of
                     mitotic recombination [Evidence IGI,IMP] [PMID 16051752];
                     GO_process: GO:0006476 - protein deacetylation [Evidence
                     IEA]; GO_process: GO:0006355 - regulation of
                     transcription, DNA-templated [Evidence IEA]; GO_process:
                     GO:0006351 - transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="histone deacetylase HST2"
                     /protein_id="XP_018737153.1"
                     /db_xref="GeneID:30034175"
                     /translation="MSEEDTQLKPTLESVAEQLKEGKFKNVIFMVGAGISTSAGIPDF
                     RTPGTGLYSNLQRLNLPYPEAVFDISYLRRNPLAFYTLASELYPGKFEPTDFHKFMRT
                     VDRKGLLRRLYTQNIDTLERIAGVSGEKIIEAHGSFAKNHCIDCKTEMSNEELKRIVW
                     ESNPGKTTIPKCKKCRGIVKPDIVFFGEGLPRAFFDSMDEDFPESADLVIVAGTSLTV
                     SPFSQLPEMVDDDCIRILFNMDAVGDLGTRDNDLLILGDCDKNVRKFAELCGWSLDEE
                     SEEETSEQEIDDSSKETKKQAKEDAEEEAEEMRKEEGREKAELIAEEISKTLEELDLE
                     EKDANSEKVVEKESDAAE"
     gene            <883327..>886815
                     /gene="TAE2"
                     /locus_tag="AWJ20_2282"
                     /db_xref="GeneID:30034176"
     mRNA            <883327..>886815
                     /gene="TAE2"
                     /locus_tag="AWJ20_2282"
                     /product="Tae2p"
                     /transcript_id="XM_018879218.1"
                     /db_xref="GeneID:30034176"
     CDS             883327..886815
                     /gene="TAE2"
                     /locus_tag="AWJ20_2282"
                     /note="Component of the ribosome quality control complex
                     (RQC); RQC (Rqc1p-Rkr1p-Tae2p-Cdc48p-Npl4p-Ufd1p) is a
                     ribosome-bound complex required for the degradation of
                     polypeptides arising from stalled translation involved in
                     protein translation; monitors translation stress and
                     signals this to Hsf1p; may interact with ribosomes, based
                     on co-purification experiments; green fluorescent protein
                     (GFP)-fusion protein localizes to the cytoplasm;
                     GO_component: GO:1990112 - RQC complex [Evidence IDA]
                     [PMID 23178123]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IEA,IEA]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_component: GO:0010494 -
                     cytoplasmic stress granule [Evidence IDA] [PMID 23222640];
                     GO_component: GO:0022625 - cytosolic large ribosomal
                     subunit [Evidence IDA] [PMID 23479637]; GO_component:
                     GO:0005840 - ribosome [Evidence IDA] [PMID 16702403];
                     GO_function: GO:0003729 - mRNA binding [Evidence IDA]
                     [PMID 23222640]; GO_process: GO:0002181 - cytoplasmic
                     translation [Evidence IGI,IMP] [PMID 20691087];
                     GO_process: GO:1990116 - ribosome-associated
                     ubiquitin-dependent protein catabolic process [Evidence
                     IGI,IMP] [PMID 23479637]; GO_process: GO:0006412 -
                     translation [Evidence IEA]"
                     /codon_start=1
                     /product="Tae2p"
                     /protein_id="XP_018737154.1"
                     /db_xref="GeneID:30034176"
                     /translation="MRNELESQILNYRLQNIYDLTSSSHLFLLKFAVPDSKKLVIVDP
                     GFRIHLTEFSRSTTQSPSGFVAKLRKHLKTRRLSRISLAPLNRLLVFSFSDDFSYHLV
                     LEFFAGGNMILLDKQFKILSLQRTVSATDTQSRCAVGEIYPLDDYLKDDGSADVSFDV
                     KSVKQWLGGSSNNVPEAIAEDDSQSASTNLLNSDLPKTSTSGPKKKKEAKIALKKLLY
                     IKVPGIAAGIFEKALLDQSIDPDIKDFGPLLSSEAEITRLLTAVKNASEISKSLTSKS
                     STPGYIVAKKNAQFQQSTSSDSVDESKFSPETSINNSSIEYLYEEFEPFEPRAFSNPD
                     IKVFEIETFNQAVDKYFSTLESTKLSLKISNQEQQAEKRLNAARDEKEKRVKGLVQVQ
                     QKSSTLGYALQAYASRVEEAIEAVQGLLQQGMDWVDIENLIKVEQSRGNPVANTIALP
                     LNLLKNKITVILPDPDFEQDLEEDDDDKDTSDSESDSDSDSESESESTAKNVKTKKKA
                     APTVKVEIDITLSAWANSRKYFEVKKTAVAKQERTLQQADQAYKSAEKKIKRDLKMAL
                     EKEKGQQHTLHAIRETYWFEKFYWFLSSDGYLCIGGRDSFQNELLLRRYFKKNDIYVH
                     CDVGGASVVIIKNHIADSREVPPATLTQAGVLSVATSKAWDSKMVTSAWWATRDQIPR
                     LTPEGDIVRSDLIIVTGEGKHFLPPSQLDMGLGFLWMVSEDAAAKYSKRGGKNRRDGE
                     TTDVTNENENNSDSDSSEEEFPDTQIDSDEEFPDTQIASDDDLEDENDVAEEDNEEEE
                     ANSELEDILKDESKDALSESEQSDQEADPENEAIADSYDKGDAHNGAGPGEAEADADM
                     DVGADADADSSDISRGPDSENRSGTTGKRISAAERRRLRKQKLRSDSNTPEPESSTAP
                     VSSAVSDIEKALSDLQVSKREKEPAAQKPAKVRGKKGKLKKIASKYADQDEEERSRRM
                     ELLGTTRGLEKAKAQAEQEKAKRQQQEQARRDRQNRAKEQEKKRLLEAEELGDDDEEV
                     DDDSKYPFDKLVPRLSVGDEPQTIVPVFAPWGALQRYKYKMKFQPGTVKKGKAVKDIL
                     YSINNAKVDATASDDDYPWPNEIALVRSLKEPELLLAIGVGRVKISIPGSRQKAVKGG
                     SKGQKGGSKRGKGSKR"
     gene            complement(<887005..>887598)
                     /gene="RET3"
                     /locus_tag="AWJ20_2283"
                     /db_xref="GeneID:30034177"
     mRNA            complement(<887005..>887598)
                     /gene="RET3"
                     /locus_tag="AWJ20_2283"
                     /product="Ret3p"
                     /transcript_id="XM_018879219.1"
                     /db_xref="GeneID:30034177"
     CDS             complement(887005..887598)
                     /gene="RET3"
                     /locus_tag="AWJ20_2283"
                     /note="Zeta subunit of the coatomer complex (COPI); COPI
                     coats Golgi-derived transport vesicles; involved in
                     retrograde transport between Golgi and ER; GO_component:
                     GO:0030126 - COPI vesicle coat [Evidence IMP,ISS] [PMID
                     8617224]; GO_component: GO:0030663 - COPI-coated vesicle
                     membrane [Evidence IEA]; GO_component: GO:0005794 - Golgi
                     apparatus [Evidence IEA]; GO_component: GO:0000139 - Golgi
                     membrane [Evidence IEA]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IEA,IEA]; GO_component: GO:0031410 -
                     cytoplasmic vesicle [Evidence IEA]; GO_component:
                     GO:0016020 - membrane [Evidence IEA]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0015031 - protein transport [Evidence IEA]; GO_process:
                     GO:0006890 - retrograde vesicle-mediated transport, Golgi
                     to ER [Evidence IMP] [PMID 8617224]; GO_process:
                     GO:0006810 - transport [Evidence IEA,IEA]; GO_process:
                     GO:0016192 - vesicle-mediated transport [Evidence IEA]"
                     /codon_start=1
                     /product="Ret3p"
                     /protein_id="XP_018737155.1"
                     /db_xref="GeneID:30034177"
                     /translation="MPSPDISLYSVEAVLILDNDGKRLFAKYYQPPYADSNAAVTDNK
                     LATSVKDQTAFEKGLFAKTNKQNADVILYDSKVIVYKQIVDISLYIVGGMEENEAMLY
                     QVVLGLRDALDILLKHSADKRTVLENYDLVSLAVDETIDSGIILEVDPVIIASRVSKA
                     PTNEPSINNIDLSEQGLLNVYQFARGKLSEKLRQQFQ"
     gene            <888608..>889438
                     /gene="TAF3"
                     /locus_tag="AWJ20_2284"
                     /db_xref="GeneID:30034178"
     mRNA            <888608..>889438
                     /gene="TAF3"
                     /locus_tag="AWJ20_2284"
                     /product="Taf3p"
                     /transcript_id="XM_018879220.1"
                     /db_xref="GeneID:30034178"
     CDS             888608..889438
                     /gene="TAF3"
                     /locus_tag="AWJ20_2284"
                     /inference="similar to AA sequence:KEGG_Orthology:K14650"
                     /note="TFIID subunit (47 kDa); involved in promoter
                     binding and RNA polymerase II transcription initiation;
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_component: GO:0005669 - transcription factor TFIID
                     complex [Evidence IDA] [PMID 10788514]; GO_component:
                     GO:0005669 - transcription factor TFIID complex [Evidence
                     IDA] [PMID 15448131]; GO_function: GO:0001075 - RNA
                     polymerase II core promoter sequence-specific DNA binding
                     transcription factor activity involved in preinitiation
                     complex assembly [Evidence IC] [PMID 15448131];
                     GO_function: GO:0003682 - chromatin binding [Evidence IDA]
                     [PMID 17660549]; GO_process: GO:0051123 - RNA polymerase
                     II transcriptional preinitiation complex assembly
                     [Evidence IC] [PMID 10788514]; GO_process: GO:0006355 -
                     regulation of transcription, DNA-templated [Evidence IEA];
                     GO_process: GO:0006366 - transcription from RNA polymerase
                     II promoter [Evidence IDA] [PMID 12138208]; GO_process:
                     GO:0006366 - transcription from RNA polymerase II promoter
                     [Evidence IDA] [PMID 15448131]; GO_process: GO:0006351 -
                     transcription, DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Taf3p"
                     /protein_id="XP_018737156.1"
                     /db_xref="GeneID:30034178"
                     /translation="MSEEFFFSLVRISCAQIFRAAGIERCSPSLLDKASDLLVRHLTA
                     LSEKASDNAMLSGRNEVVIQDLALAMEELCVIRPRAILDPYDLDPNSFIGYENFIDWV
                     KGPVPEEARRISRIPRVTPIGQKVENTSSGIISISTDGNTGTTPDGIESKDNSDTRAK
                     SEKPEDTRGIDGETRVGSTSSKAPVAASTATKTTSTEASTTQTNTESEKTAGKVHPHD
                     DEEWLTALMKKRIKVGNENKFKGTVLSIEDGLETNPEVKIVGGPVSLDEFQPKNLSVQ
                     "
     gene            complement(<889769..>890290)
                     /gene="LRG1"
                     /locus_tag="AWJ20_2285"
                     /db_xref="GeneID:30034179"
     mRNA            complement(<889769..>890290)
                     /gene="LRG1"
                     /locus_tag="AWJ20_2285"
                     /product="Lrg1p"
                     /transcript_id="XM_018879221.1"
                     /db_xref="GeneID:30034179"
     CDS             complement(889769..890290)
                     /gene="LRG1"
                     /locus_tag="AWJ20_2285"
                     /note="GTPase-activating protein (GAP); contains
                     Rho1p-specific GAP activity, interacting with activated
                     forms of Rho1p; functions along with Sac7p as a negative
                     regulator of the Pkc1p-mediated cell wall integrity
                     signaling pathway; negative regulator of cell wall
                     1,3-beta-glucan biosynthesis; required for efficient cell
                     fusion; contains a RhoGAP domain and three
                     Lin-11-Isl1-Mec-3 (LIM) domains; GO_component: GO:0005933
                     - cellular bud [Evidence IEA]; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IEA]; GO_component: GO:0005935
                     - cellular bud neck [Evidence IDA] [PMID 11447600];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 23613772]; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     11447600]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0000131 - incipient
                     cellular bud site [Evidence IDA] [PMID 11447600];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 15514049]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030427 - site of
                     polarized growth [Evidence IDA] [PMID 23613772];
                     GO_function: GO:0005096 - GTPase activator activity
                     [Evidence IEA]; GO_function: GO:0005100 - Rho GTPase
                     activator activity [Evidence IDA] [PMID 15514049];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0000755 - cytogamy [Evidence IGI,IMP]
                     [PMID 15514049]; GO_process: GO:0035024 - negative
                     regulation of Rho protein signal transduction [Evidence
                     IGI] [PMID 11447600]; GO_process: GO:0035024 - negative
                     regulation of Rho protein signal transduction [Evidence
                     IGI,IMP] [PMID 11713681]; GO_process: GO:0090038 -
                     negative regulation of protein kinase C signaling
                     [Evidence IGI,IMP] [PMID 11713681]; GO_process: GO:0032321
                     - positive regulation of Rho GTPase activity [Evidence
                     IDA] [PMID 15514049]; GO_process: GO:0090334 - regulation
                     of cell wall (1->3)-beta-D-glucan biosynthetic process
                     [Evidence IGI] [PMID 11447600]; GO_process: GO:0060237 -
                     regulation of fungal-type cell wall organization [Evidence
                     IGI] [PMID 11447600]; GO_process: GO:0060237 - regulation
                     of fungal-type cell wall organization [Evidence IGI,IMP]
                     [PMID 11713681]; GO_process: GO:0007165 - signal
                     transduction [Evidence IEA]; GO_process: GO:0030435 -
                     sporulation resulting in formation of a cellular spore
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Lrg1p"
                     /protein_id="XP_018737157.1"
                     /db_xref="GeneID:30034179"
                     /translation="MEVLFYFLNWTASFSHIDEETGSKMDAHNLATVITPNILYIKEG
                     GHEQGDAYFLSIESVNTLIEEQSRFAEVPVEVQVIYRESGLANASADITSKDVISKVE
                     ACIKQIGGVDAVVVNNSTSPSSGSTTPQNLEEPHRPLPIRVNTSDIAALPVPGQEASI
                     KRVNKTEMSPVSP"
     gene            complement(<890454..>894704)
                     /gene="LRG1"
                     /locus_tag="AWJ20_2286"
                     /db_xref="GeneID:30034180"
     mRNA            complement(<890454..>894704)
                     /gene="LRG1"
                     /locus_tag="AWJ20_2286"
                     /product="Lrg1p"
                     /transcript_id="XM_018879222.1"
                     /db_xref="GeneID:30034180"
     CDS             complement(890454..894704)
                     /gene="LRG1"
                     /locus_tag="AWJ20_2286"
                     /note="GTPase-activating protein (GAP); contains
                     Rho1p-specific GAP activity, interacting with activated
                     forms of Rho1p; functions along with Sac7p as a negative
                     regulator of the Pkc1p-mediated cell wall integrity
                     signaling pathway; negative regulator of cell wall
                     1,3-beta-glucan biosynthesis; required for efficient cell
                     fusion; contains a RhoGAP domain and three
                     Lin-11-Isl1-Mec-3 (LIM) domains; GO_component: GO:0005933
                     - cellular bud [Evidence IEA]; GO_component: GO:0005935 -
                     cellular bud neck [Evidence IEA]; GO_component: GO:0005935
                     - cellular bud neck [Evidence IDA] [PMID 11447600];
                     GO_component: GO:0005935 - cellular bud neck [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0005935 - cellular
                     bud neck [Evidence IDA] [PMID 23613772]; GO_component:
                     GO:0005934 - cellular bud tip [Evidence IDA] [PMID
                     11447600]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA,IEA]; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0000131 - incipient
                     cellular bud site [Evidence IDA] [PMID 11447600];
                     GO_component: GO:0005622 - intracellular [Evidence IEA];
                     GO_component: GO:0043332 - mating projection tip [Evidence
                     IDA] [PMID 15514049]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0030427 - site of
                     polarized growth [Evidence IDA] [PMID 23613772];
                     GO_function: GO:0005096 - GTPase activator activity
                     [Evidence IEA]; GO_function: GO:0005100 - Rho GTPase
                     activator activity [Evidence IDA] [PMID 15514049];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_function: GO:0008270 - zinc ion binding [Evidence
                     IEA]; GO_process: GO:0000755 - cytogamy [Evidence IGI,IMP]
                     [PMID 15514049]; GO_process: GO:0035024 - negative
                     regulation of Rho protein signal transduction [Evidence
                     IGI] [PMID 11447600]; GO_process: GO:0035024 - negative
                     regulation of Rho protein signal transduction [Evidence
                     IGI,IMP] [PMID 11713681]; GO_process: GO:0090038 -
                     negative regulation of protein kinase C signaling
                     [Evidence IGI,IMP] [PMID 11713681]; GO_process: GO:0032321
                     - positive regulation of Rho GTPase activity [Evidence
                     IDA] [PMID 15514049]; GO_process: GO:0090334 - regulation
                     of cell wall (1->3)-beta-D-glucan biosynthetic process
                     [Evidence IGI] [PMID 11447600]; GO_process: GO:0060237 -
                     regulation of fungal-type cell wall organization [Evidence
                     IGI] [PMID 11447600]; GO_process: GO:0060237 - regulation
                     of fungal-type cell wall organization [Evidence IGI,IMP]
                     [PMID 11713681]; GO_process: GO:0007165 - signal
                     transduction [Evidence IEA]; GO_process: GO:0030435 -
                     sporulation resulting in formation of a cellular spore
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Lrg1p"
                     /protein_id="XP_018737158.1"
                     /db_xref="GeneID:30034180"
                     /translation="MSTAGREKTKNPHNLFLNLHNSNKEANGRTREHREHRQNPPPTQ
                     GQSPQQPHHYQPPVPQQQRSRQQQPQQQIPAPHQRQYHQQLRQFPGQPPLQSTGNNVP
                     GLSLNSPVHMANSGANRVHKQSASISGYYPVAGDGASPVIGLESPNQFKGQGYVSDSS
                     GASFGGSTGSNSPRQFSGIDSPTRSIPMTSPRYRNFSRPNTFYQTESSSLGNDVFSRD
                     PGNQSYFQNLPTPPLGGTNTATETTVSSNSKPTTGSNTRSFSIRKVSQDGGDPSFNEP
                     VERMPPMPGTNAGPQGQSQSNWSSHLQTNPITTTTNTSNTSMPPPATNSTRNFQNNSN
                     NTDHVYDSNEPSSSNNSNNNNHNNGALPDTNSNNRVYTTNSVYGANSSLSALNTSGLP
                     NNNSTSSITSPISPSKPARSKTCRKCGDPISGQFVRALDAAYHIECFTCADCNDQCSS
                     KFFPTDNPDYDPTAPSNVPAHIPLCETCYFKRLDLLCYACNGALRGSYITALGRKYHV
                     DHFTCSMCDTVFGPEDSYYEHGDSIYCHFHYSTLYASKCEGCQTAILKQFVEIYRGGR
                     EQQWHPECYMIFKFWNVKLCPEGSKPTLNPLRPLSVTAAAPLDQLNHLQVAQHEKEVD
                     ERVYRIWTVLCGYEEATASYISDMLQSASNGKYNEALVATANLVAKVDVLFGALDMLN
                     LVIDPLIKEQEDRRKREDEEDELAVNNTGAHDENVRRPSVTSIPTFTVLGREPKNLCK
                     KIVEFMSMVSKSREKNVKKMGVTLLNLVTSLAHYLKVLIRYGLSNSLLYDRSFPNGNA
                     VDSFLQRVEVHTKSVSVLNNLGVSAMTSDRCVRCESSVEDACVRFGDRLWHVGCFLCD
                     KCGRNLSGEVDTAAWHVSEKMVICQECGGKHNSDESGKLGFVYVTRLRQFVFLVKIAV
                     ARLQLVLSAYEARDKKAKRISGTGDSMSTPALAHYKASTSASDRSNQSAGSSSTAVNE
                     PTQNEKGYMTTLTDIRRLRSAKLDRQVSEMSRRARQSRILAMPDSESALVKNNNDSSN
                     SLEGGGSTTMNSPDEHEQQRRPSNYSEDKVLVNERSRPSVSSQQDPFASTATSSTHDA
                     SSKSQQQTSEGATATTSGSVTTSTNATSGAGSGAGSNKSLLRNAKRTFSIKRRKELKI
                     EELGYKQDPSRLDRTTDLFKNEKTLTLDDIPRIVAAEQAREQLPNAFRHQARTTSMTN
                     SVPMPKSIADSGAKDETRTYMSELSKSELFYIRHVCVVLLQPLVSEWFSQDELLDLIE
                     TRRQQSIWGKFGKAFGGGGGNSNTTAAKKKGTGAVFGTPLEQLVEKYGVDSTLGVGPK
                     PLRIPAFVDDCISSMRQKDMSVEGIFRKNGNIRRLKEFTEKIDKNPDKSSILSEENAI
                     QLAALLKKFLRELPEPLMTSKLQKLWIMTQSKYFPLVP"
     gene            <897720..>900917
                     /locus_tag="AWJ20_2287"
                     /db_xref="GeneID:30034181"
     mRNA            <897720..>900917
                     /locus_tag="AWJ20_2287"
                     /product="Protein BRE4"
                     /transcript_id="XM_018879223.1"
                     /db_xref="GeneID:30034181"
     CDS             897720..900917
                     /locus_tag="AWJ20_2287"
                     /codon_start=1
                     /product="Protein BRE4"
                     /protein_id="XP_018737159.1"
                     /db_xref="GeneID:30034181"
                     /translation="MAVLVSSVITNKDSSKPKGVRRSRSSIENSISERTSLLSSVGGT
                     VRIDSGAATTTHDVFAETAASNEDNASSLQRLIKTYEDARQFIFSRKGKNILKCSVAY
                     FIGSLAVYTPIGTWLYGHSDNKHMICTVCVYFHPARTAGSMTEAILFALFALAFGLII
                     ALSSMIVSALFTDWDLIYVGYVIDLLVFVGGGLGVIAFTKQMVNKPTFNTACSLASIF
                     LVTILTKEGNVQAGTLSLSKLLQSFMFVLSGVILSTTISYLVWPESAILKLKESLNKS
                     MDVHSDLLTFIANKFINGQDINTSEFEKLNEELSKTYKSLQTNLHEAKFELLSTGREC
                     EYEVFQRLIQSSNSLSLHLGGLSNSANIQWHLLNGEESDDESQDESTTNGDTDVTAVR
                     HRVNGSARPDGRDSDDSSVTSIEDIISRRSVSPPVSGESSSAIAPDSVSAELFSIFTF
                     HLGPPMISFFSTIKEILDNLPFGNSPNYEVSLHPQYKASLDLATELYSTAREEALAGV
                     YAHEIFQVERDFDTAADEEAIAASCGNFSYVLEDFGWELSVFITALEDYRNIIENRPR
                     RSFKWARFWESRSKTFDNSTSSGTANDNTGPDVDGADTERGTDPANPLRRSPTANTHN
                     VKSFAELDWLIKKSTTEKKQKTSLSLRIWRSMHAFRRTDVQFGIKVGIGAIIFAIPAF
                     SPSLRPIFSTWRGEWGLITYAIVMSKSVGGTTVTIPIRFLGTLLGAAAAFVAWTLFPE
                     NQYVLSFLGWVMACLCFYIILFWDTKQAFGRFILLTFNLTVLYSYSLTVYDNDDDDDE
                     GGAHPIVREIAFHRFVSVFVGSLWAVFIAFIILPNSARKRLRDILSVQWLKMGLVWKA
                     DCLKTIPRKSAADEPRLVGIQGEADLQSTMVELQTLLGFAPNELRLKGPFPTLQYKNI
                     LNCTQRILDGFQNIGVLVAKYPKPSSNELELIAYTAADRRELCSRIFLFFYLISSAIK
                     LGFPLPDKLPSTTHAIDRMLAKMSDYRQRAIAARSDHGDSSTTASKPPPDEEDFVLFY
                     SYLLVTVSITEELAKIAIQVQDLFGTIEEDMFTVS"
     gene            <901341..>903587
                     /gene="ATG2"
                     /locus_tag="AWJ20_2288"
                     /db_xref="GeneID:30034182"
     mRNA            <901341..>903587
                     /gene="ATG2"
                     /locus_tag="AWJ20_2288"
                     /product="Atg2p"
                     /transcript_id="XM_018879224.1"
                     /db_xref="GeneID:30034182"
     CDS             901341..903587
                     /gene="ATG2"
                     /locus_tag="AWJ20_2288"
                     /note="Peripheral membrane protein required for autophagic
                     vesicle formation; also required for vesicle formation
                     during pexophagy and the cytoplasm-to-vaucole targeting
                     (Cvt) pathway; involved in Atg9p cycling between the
                     phagophore assembly site and mitochondria; essential for
                     cell cycle progression from G2/M to G1 under nitrogen
                     starvation; forms cytoplasmic foci upon DNA replication
                     stress; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 11382760]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0019898 -
                     extrinsic component of membrane [Evidence IDA] [PMID
                     11382760]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0000407 - pre-autophagosomal
                     structure [Evidence IDA] [PMID 11689437]; GO_component:
                     GO:0000407 - pre-autophagosomal structure [Evidence IDA]
                     [PMID 18497569]; GO_component: GO:0034045 -
                     pre-autophagosomal structure membrane [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0032258 - CVT pathway [Evidence IMP]
                     [PMID 11382761]; GO_process: GO:0000045 - autophagic
                     vacuole assembly [Evidence IMP] [PMID 11382761];
                     GO_process: GO:0006914 - autophagy [Evidence IEA,IEA];
                     GO_process: GO:0006914 - autophagy [Evidence IMP] [PMID
                     23382696]; GO_process: GO:0044805 - late nucleophagy
                     [Evidence IMP] [PMID 22768199]; GO_process: GO:0000422 -
                     mitochondrion degradation [Evidence IMP] [PMID 19793921];
                     GO_process: GO:0030242 - peroxisome degradation [Evidence
                     IDA,IEP,IMP] [PMID 11382760]; GO_process: GO:0034727 -
                     piecemeal microautophagy of nucleus [Evidence IMP] [PMID
                     18701704]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Atg2p"
                     /protein_id="XP_018737160.1"
                     /db_xref="GeneID:30034182"
                     /translation="MAPSWLPQNIQKRIFRYILARLEVFSDLDLKNLDVSVGTKTNLT
                     LREVQLDTDKFTLPNGVFVRSGKLGTLNLSIGVGNGVEIDGTDVEFTVALSSSSLDED
                     DLTDLLSRTTADLAVSLLDDNTREKQHGSSAKDSKKSQDTSDSDSDDSGTGVTGYGFG
                     ELPNMVTKVADTALSQLSIMLHGIKLRLIIDEDCSLEIHVSKVQLSTGKDGLRTIRVS
                     EIEILTPKIKDTVENNDDDDILNHETDTERGGEDSFHMDEMQNSLMQSTLFSHEEAST
                     MYMSAMSSMLQSKEQEAQLDRLLWCDFSELSFKGLLRSDFSLNIGTVNISTVPVSHVL
                     STIVNFVLKFESNTTKAKEDASNGLTHNDHDNGNLIASNEVTDNSQATQFTLKAGVKA
                     VHISMSSLLPDGLFESEESLTFEVSSINLNIDNKQQLLTVSNIILRQGNEPVVWFAKK
                     TGDEDEDLVCHLGNKVTVLLPHPASFYFDTDTIVNISEAIKLFSDLQISQPSQSPSSS
                     LSSLRPKDGKNVTAKFNTIEGQINTGSTTVRATIFPSNFENGKLLIDTVRFSIKHNDS
                     TYKAGSIEVQDISIVFGGQSLALSTAIFSPDLEQIQAPVNTQLHVSTVMIGISQPVLD
                     TLISDLKSIHSLVGSALESRSVAQLRQVRIQESELVKFSVVIAKVEVDYSFQSGEESC
                     VIYTDLGQIELNVLESASTQISIYTVFVTHDFKIKDSSSSYVALLYKANPSEKVCLYV
                     TIARHQRH"
     gene            <903791..>906649
                     /gene="ATG2"
                     /locus_tag="AWJ20_2289"
                     /db_xref="GeneID:30034183"
     mRNA            <903791..>906649
                     /gene="ATG2"
                     /locus_tag="AWJ20_2289"
                     /product="Atg2p"
                     /transcript_id="XM_018879225.1"
                     /db_xref="GeneID:30034183"
     CDS             903791..906649
                     /gene="ATG2"
                     /locus_tag="AWJ20_2289"
                     /inference="similar to AA sequence:KEGG_Orthology:K17906"
                     /note="Peripheral membrane protein required for autophagic
                     vesicle formation; also required for vesicle formation
                     during pexophagy and the cytoplasm-to-vaucole targeting
                     (Cvt) pathway; involved in Atg9p cycling between the
                     phagophore assembly site and mitochondria; essential for
                     cell cycle progression from G2/M to G1 under nitrogen
                     starvation; forms cytoplasmic foci upon DNA replication
                     stress; GO_component: GO:0005737 - cytoplasm [Evidence
                     IDA] [PMID 11382760]; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 22842922]; GO_component: GO:0019898 -
                     extrinsic component of membrane [Evidence IDA] [PMID
                     11382760]; GO_component: GO:0016020 - membrane [Evidence
                     IEA]; GO_component: GO:0000407 - pre-autophagosomal
                     structure [Evidence IDA] [PMID 11689437]; GO_component:
                     GO:0000407 - pre-autophagosomal structure [Evidence IDA]
                     [PMID 18497569]; GO_component: GO:0034045 -
                     pre-autophagosomal structure membrane [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0032258 - CVT pathway [Evidence IMP]
                     [PMID 11382761]; GO_process: GO:0000045 - autophagic
                     vacuole assembly [Evidence IMP] [PMID 11382761];
                     GO_process: GO:0006914 - autophagy [Evidence IEA,IEA];
                     GO_process: GO:0006914 - autophagy [Evidence IMP] [PMID
                     23382696]; GO_process: GO:0044805 - late nucleophagy
                     [Evidence IMP] [PMID 22768199]; GO_process: GO:0000422 -
                     mitochondrion degradation [Evidence IMP] [PMID 19793921];
                     GO_process: GO:0030242 - peroxisome degradation [Evidence
                     IDA,IEP,IMP] [PMID 11382760]; GO_process: GO:0034727 -
                     piecemeal microautophagy of nucleus [Evidence IMP] [PMID
                     18701704]; GO_process: GO:0015031 - protein transport
                     [Evidence IEA]; GO_process: GO:0006810 - transport
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Atg2p"
                     /protein_id="XP_018737161.1"
                     /db_xref="GeneID:30034183"
                     /translation="MQLFLRDCVVELNPLDLPSQGLYIIKDSKVDFALGAESTIDLSV
                     KRSALLLVDEVSNLETVGIPAVSGVTEFFLSQGYVSIGSISTLKSVIKIPSNRKPRVD
                     ITIDSVTLNTCADSTQVLIQTLNALKPPVEANDGIRFRTELPNLVDIFSEVDETTFMD
                     GYTSSTALSKMGDDVINDDIPSNLEFVESYYVDQSTRLKWNSGSSSGSLNNGVSRADM
                     LLEQDLSVLAGKSKNSSNSNSIEGSISSVSEASPYASSTSSSSSRNGSQSYARLDNFE
                     QRAYTHDSVLNIEEDHFAKDLPSIYEQPTESGSTSPVSTPRRRRSVTATIPTTEKQEP
                     LITIKARILSVDWLLFDGYDWSFTRDTINKAVNRVEYAADQFHREANGRGVSASDRFT
                     PSPRNSGEVGNNEERGRIRNESPEGEVQTVVGDLLFNSIYIGVPAGDDPDMLRGAINR
                     ELNDDMSEAGSNASTNITSRSSSANRRSVDLGYRRKKKLALKRSKRYKMKISLRDVCA
                     DVIVLGGVNDQVDLSHYSPDTSGIVLNTIDIRVKDLEIFDNVHTSTWNKFLSYMRDAG
                     ERESHASMVHILLDTVKPVDYLAVSEIQLKVSVLPLRLIVDQDALDFLTRFFEFKDER
                     FVVAETNEEIFIQKLDVRSVSVKLDYKPKKVDYMGLKSGRTIEFMNFFTLDGADIVLR
                     HVVLYGIDGFGKVSDLLNGIWMPDIKQNQLGKFLSGLSSVHSLVRLGSGVRDLFVIPL
                     QEYKKDGRVVRGLQKGAWFFAKNTTNELAKLGAKLAAGTQGVLESAEQALGGSGASAR
                     SLGAAYRSPYSDDIVSDDEEPSSPSTDQQHIVSLYANQPGGVSEGLRSAYKSMGKNLT
                     MARDAVADIGVDAAERGNAQGAAIAVMRAAPVVLIRPMIGATEAVSKTLMGVTNQIEP
                     DQLQDVQDVSIISGLLNESQNSQILTFRNTNDSIQIRL"
     gene            complement(<907083..>908549)
                     /gene="GAP1"
                     /locus_tag="AWJ20_2290"
                     /db_xref="GeneID:30034185"
     mRNA            complement(<907083..>908549)
                     /gene="GAP1"
                     /locus_tag="AWJ20_2290"
                     /product="amino acid permease GAP1"
                     /transcript_id="XM_018879227.1"
                     /db_xref="GeneID:30034185"
     CDS             complement(907083..908549)
                     /gene="GAP1"
                     /locus_tag="AWJ20_2290"
                     /inference="similar to AA sequence:KEGG_Orthology:K16261"
                     /note="General amino acid permease; Gap1p senses the
                     presence of amino acid substrates to regulate localization
                     to the plasma membrane when needed; essential for invasive
                     growth; GO_component: GO:0030134 - ER to Golgi transport
                     vesicle [Evidence IDA] [PMID 12499351]; GO_component:
                     GO:0005768 - endosome [Evidence IDA] [PMID 15039776];
                     GO_component: GO:0000328 - fungal-type vacuole lumen
                     [Evidence IDA] [PMID 15039776]; GO_component: GO:0016021 -
                     integral component of membrane [Evidence IEA,IEA];
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence ISM] [PMID 12192589]; GO_component: GO:0005887 -
                     integral component of plasma membrane [Evidence IDA] [PMID
                     9199164]; GO_component: GO:0016020 - membrane [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005771 - multivesicular
                     body [Evidence IMP] [PMID 14523026]; GO_component:
                     GO:0005886 - plasma membrane [Evidence IDA] [PMID
                     15623581]; GO_component: GO:0005886 - plasma membrane
                     [Evidence IDA] [PMID 15707981]; GO_function: GO:0015193 -
                     L-proline transmembrane transporter activity [Evidence
                     IGI] [PMID 14968425]; GO_function: GO:0015171 - amino acid
                     transmembrane transporter activity [Evidence IEA];
                     GO_function: GO:0015171 - amino acid transmembrane
                     transporter activity [Evidence IMP] [PMID 6759873];
                     GO_function: GO:0015203 - polyamine transmembrane
                     transporter activity [Evidence IMP] [PMID 15707981];
                     GO_process: GO:0003333 - amino acid transmembrane
                     transport [Evidence IEA]; GO_process: GO:0006865 - amino
                     acid transport [Evidence IEA,IEA]; GO_process: GO:0006865
                     - amino acid transport [Evidence IMP] [PMID 6759873];
                     GO_process: GO:0015846 - polyamine transport [Evidence
                     IMP] [PMID 15707981]; GO_process: GO:0055085 -
                     transmembrane transport [Evidence IEA]; GO_process:
                     GO:0006810 - transport [Evidence IEA,IEA]"
                     /codon_start=1
                     /product="amino acid permease GAP1"
                     /protein_id="XP_018737162.1"
                     /db_xref="GeneID:30034185"
                     /translation="MERSLDIESSPKLVESSTPSEGSDRGVVLDKKFGFMTQLIDSFR
                     PMDVSEINTSEMTLAERSAAITAKSPLKRGLKSRHLQMIAIGGTIGTGLFVGSGGSLS
                     QGGPASLVIGYILTGMMLFCTLHAVGELAVRFPVAGGFNTYATRFLDPAWGFAMGWIY
                     ALQWLILLPLELVAASLTIQYWRTGGGAAASVNPDAWVAVFFALIIFINVFSVRAYGE
                     TEFIFSTIKVVAVVGFIILGIVLVAGGSPNHIGYIGAKYWINPGPFANGFKGVVSVFV
                     NAAFAYSGSELVGLAAAETQNPHKALPSACKQVFWRITLFYVVALTLVGFLVPYTDPR
                     LLGTSSVDANASPFVIAIINSGIKSLPSVVNAVILISAVSVGSSSVYACSRCCQALAS
                     QGFLPKIFGYIDREGRPMVAIVFTLVFGLLSFLAGSSAEATVFDWLLSFSGMASLFTW
                     GSICLCHIRFRKAMAVQGISLDELTFKSAVGVWGSWFG"
     gene            <909885..>911462
                     /locus_tag="AWJ20_2291"
                     /db_xref="GeneID:30034186"
     mRNA            <909885..>911462
                     /locus_tag="AWJ20_2291"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879228.1"
                     /db_xref="GeneID:30034186"
     CDS             909885..911462
                     /locus_tag="AWJ20_2291"
                     /inference="similar to AA sequence:KEGG_Orthology:K15627"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737163.1"
                     /db_xref="GeneID:30034186"
                     /translation="MSVFRRNSKALNESLPFRLSNLVPNSKLELLAKRTNGKQVTANV
                     KIKINVVDLPPSFSESLVGEFPNTTTIWQILKHFEKKSGINFTRRSVAVPSSGTTSGK
                     IMYEIASVHLFSRSISKLEELNQSLASLGFNSGNSSLKIRFTITDIEYEQALDILNGF
                     PDVGVTAGEILAEEDAKVSESRDHSTVPETISSNIPLSADLETHPTNMTSHSVSAPVP
                     NSSSQFETVTRSKPVSAPPVEVGSETFSKDLPKGGAESTTPLNSEQIEDPNLLSDPRH
                     VSSQQEQISGPKPVDSSMEISEPELSQGNSVPLPSTTVPTLPNIQVYLPGSDTSSARF
                     VSSAEEETKMTQQQFVHYHNQIKAMSEGASNRPLMTKALRESEEAKKLSKIKNYQVRV
                     RLPDQTQIESTFYPDNKASSIYDFVRSVLKEDITTPFALFTSPPKVTLDPQMSLLWDY
                     KFSQRNLVYLEWNGPLTNGGSTALLKDKYLSTAKPISEDPGIKQDQLDKENQATAPAK
                     PRGGLSGTPRWLKMGRK"
     gene            complement(<911524..>913821)
                     /gene="SOV1"
                     /locus_tag="AWJ20_2292"
                     /db_xref="GeneID:30034187"
     mRNA            complement(<911524..>913821)
                     /gene="SOV1"
                     /locus_tag="AWJ20_2292"
                     /product="Sov1p"
                     /transcript_id="XM_018879229.1"
                     /db_xref="GeneID:30034187"
     CDS             complement(911524..913821)
                     /gene="SOV1"
                     /locus_tag="AWJ20_2292"
                     /note="Mitochondrial hypothetical protein; GO_component:
                     GO:0005739 - mitochondrion [Evidence IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 14562095]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0003674 - molecular_function [Evidence ND]; GO_process:
                     GO:0008150 - biological_process [Evidence ND]"
                     /codon_start=1
                     /product="Sov1p"
                     /protein_id="XP_018737164.1"
                     /db_xref="GeneID:30034187"
                     /translation="MFKQSSPRLARHLTRRSLLKRGAPLARTERRRLRASEREPSTVQ
                     PADGSFNIDQLLEALPKLPAHQQDVVRSLLNNQGPAKVDKLLKESYHMVGSKQGPTEQ
                     RKISAGGRINLRNKLIYDPETSLETLQEYFPLVLQNPTAFDKLFWKSVVQFYKITRAQ
                     GAKVSEESPPPYQFFGELFEVAKLQTNTRIRYSCIKIVGDILYSYNTVRMDPFNEVEY
                     MDSLSYFGNSYRAIQIWKSRRTKKDVEGSLYWLEVGILYHQQAKLLAKAEGLAEEMIQ
                     EFGYMQPRVIIGFINSYGPTGNSQLIDKWVNQLTRVIELNNFKLANEKLSEEAEDRID
                     AERASALFNQIKAPSASDLEKVVALLLKNQLWSQTAVLIEYMEKCGMKNSAHRMLQVL
                     DSTTRRLVNEVNTPKTLIPKQFRRSRRLAAPETNRQLMVVISKIISVYPEVLEYPKFY
                     EAWLRGLTGLELYDNAITVLEAMIDRGIKPTPQHIMSLTRSLLGKNKIEIALELLARL
                     EESSSEFSPAPTSSLYGLFISYGARRSDHELVSGIITRMYSQGLDQSPQTFNALLFYY
                     YRHKDFDSLFKLLERVKGLKGFDLSHANYRSIWMILRDYYNLFSLKALAVNGQTMPPN
                     IRELFIQMVQSGNFRLSMNVFEYVLQTFLLAGDYEGAVAILCFMDTITNIKIPGVITV
                     SVLQLASKIHQKTTYAFSRPSRNELIVEPGYEAETAFSWEMVANKVCETLEIDGQSTI
                     SAAKLFVEKIEAPNEYNRLSAADGS"
     gene            complement(<914026..>918042)
                     /gene="YCF1"
                     /locus_tag="AWJ20_2293"
                     /db_xref="GeneID:30034188"
     mRNA            complement(<914026..>918042)
                     /gene="YCF1"
                     /locus_tag="AWJ20_2293"
                     /product="ATP-binding cassette glutathione S-conjugate
                     transporter YCF1"
                     /transcript_id="XM_018879230.1"
                     /db_xref="GeneID:30034188"
     CDS             complement(914026..918042)
                     /gene="YCF1"
                     /locus_tag="AWJ20_2293"
                     /note="Vacuolar glutathione S-conjugate transporter;
                     member of ATP-binding cassette family; ATPase activity
                     required to support vacuole fusion; forms stable complexes
                     with vacuole fusion machinery; regulates Vam7p recruitment
                     to vacuoles; has role in detoxifying metals such as
                     cadmium, mercury, and arsenite; also transports
                     unconjugated bilirubin, selenodigluthatione, and oxidized
                     glutathione; similar to human cystic fibrosis protein
                     CFTR; GO_component: GO:0000329 - fungal-type vacuole
                     membrane [Evidence IDA] [PMID 23658021]; GO_component:
                     GO:0000329 - fungal-type vacuole membrane [Evidence IDA]
                     [PMID 8692889]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA,IEA]; GO_component:
                     GO:0016021 - integral component of membrane [Evidence ISM]
                     [PMID 12192589]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005774 - vacuolar
                     membrane [Evidence IEA]; GO_component: GO:0005773 -
                     vacuole [Evidence IEA]; GO_function: GO:0005524 - ATP
                     binding [Evidence IEA,IEA]; GO_function: GO:0016887 -
                     ATPase activity [Evidence IEA]; GO_function: GO:0042626 -
                     ATPase activity, coupled to transmembrane movement of
                     substances [Evidence IEA]; GO_function: GO:0015127 -
                     bilirubin transmembrane transporter activity [Evidence
                     IGI,IMP] [PMID 10790694]; GO_function: GO:0015431 -
                     glutathione S-conjugate-exporting ATPase activity
                     [Evidence IDA] [PMID 10220408]; GO_function: GO:0015431 -
                     glutathione S-conjugate-exporting ATPase activity
                     [Evidence IDA] [PMID 12383937]; GO_function: GO:0015431 -
                     glutathione S-conjugate-exporting ATPase activity
                     [Evidence IDA] [PMID 12755704]; GO_function: GO:0015431 -
                     glutathione S-conjugate-exporting ATPase activity
                     [Evidence IDA] [PMID 9217966]; GO_function: GO:0017111 -
                     nucleoside-triphosphatase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA,IEA]; GO_process: GO:0006200 - ATP catabolic process
                     [Evidence IEA]; GO_process: GO:0015723 - bilirubin
                     transport [Evidence IGI,IMP] [PMID 10790694]; GO_process:
                     GO:0008152 - metabolic process [Evidence IEA]; GO_process:
                     GO:0046686 - response to cadmium ion [Evidence IEA];
                     GO_process: GO:0010038 - response to metal ion [Evidence
                     IDA] [PMID 10220408]; GO_process: GO:0010038 - response to
                     metal ion [Evidence IDA] [PMID 12755704]; GO_process:
                     GO:0010038 - response to metal ion [Evidence IDA] [PMID
                     9217966]; GO_process: GO:0055085 - transmembrane transport
                     [Evidence IEA]; GO_process: GO:0055085 - transmembrane
                     transport [Evidence IMP] [PMID 10790694]; GO_process:
                     GO:0006810 - transport [Evidence IEA,IEA]; GO_process:
                     GO:0042144 - vacuole fusion, non-autophagic [Evidence IMP]
                     [PMID 23658021]"
                     /codon_start=1
                     /product="ATP-binding cassette glutathione S-conjugate
                     transporter YCF1"
                     /protein_id="XP_018737165.1"
                     /db_xref="GeneID:30034188"
                     /translation="MLLWYWLVALTSSSLKLTNSLLDEEYNSSLLLFLLRTFVTVNSV
                     FVFSLEWLVPRIRNRNVDKDLRNADIFSNLFLLWLNPLINTAFKTDITERDLPEMEDS
                     FSTSELSDKLLDHWNKSSRKGAVGMAFTIARTLRLELVALIGAGFAIDILTYIRPFLL
                     QKILLFVREYNNDRSLPLSIGIYWTLLNGLVSLWIVFLQNRIGLSAVRLSVGVNGAIY
                     GSVFVKALKLSARSRETKTASHIINLMTTDLGQVNNCMQQLLPLFTTPLEIVYCFIVL
                     YSFLGFSFFGGVSIMIIVVPLNAYVSSKFRQLTVDLMKAIDERVKITTSMFSNAKSLK
                     LYAWEGPWLDRLKEARNEHELVLRKKVMFWLTILTGIWSIVPYFIAAGVFGAFLYMED
                     RPLTADIIFPSLSLFNLLSGPLIAIPYGITMLIQSKVSFQRFADLLSADEQPTDQLIH
                     LPPVNDPKSKLPVVKFSNTTVSWSESEDAAVALDEIDFEAYKRQLLCVIGKVGAGKSA
                     LVKTLCGELFLKQGSVSIRGNIAYVPQEPWLLNQSVKDNILFRNKYDPEFYQKTLEAC
                     DLVYDIKNLPDGDETEVGERGISLSGGQKARVSLARAVYARADVYVLDDILSAVDEHV
                     GKHLIDHVLGKHGLLASKTIVLATNNVKVLAEADNIILIEDKKIRESGSPLETIGKKG
                     PIYELMKEFGAAQHETVEELKEEIVTVAVQEEPEEQFDDLRRASIESFRSISEEATKE
                     LERRKKSQDAVESGAVKSSVYLRYFQASGIGRVTLSVIMIIMVGALTTLGSVWLKLWS
                     DQSITGATSESLYYLGVYVLIGIVYGVIHVSSTYIAQAIAGLKAAEVLHDNMAQMVLR
                     SPMSFFEQTPLGQILNRFTTDINEIDNSVANTLASTFRVLMTMFFAVLVVCYSTPIVT
                     IAVLPVTILYWYYQKFYLVASRQLKRLSSAARSPMMANFEESVKGIKVIRAFEKDRHF
                     IHENNIRSDLVLKTVSHAASVDRWLALRLGIMGSLFVLFTGISGVYMAKLGLMTEGVL
                     GLGMSNAMIITSQLWMVVRQSIEIERRGVTIERIFQYHALKSEAPEIVENNRPPAYWP
                     SEGRITFDKFSTRYKEGMKLVLKDINLDIKPREKIGVVGRTGAGKSTLTLSLFRLIEP
                     ASGTVVVDNINTNDIGLLDLRHNMSIIPQDAQIFSGTVRDNLDPFRERDDTDLWRVLE
                     LCHLKDHVSGMEGGLDAALADSGENLSKGQAQLICLARALLHDSNILVLDEATASVDV
                     ETDKIIQQTIRTELKHKTIITIAHRLNTIMDSDRIVVLEKGEIAEFDSPQNLLAKPES
                     LFYGLCEKAGLVGNEDKN"
     gene            complement(<925526..>926143)
                     /gene="SDT1"
                     /locus_tag="AWJ20_2294"
                     /db_xref="GeneID:30034189"
     mRNA            complement(<925526..>926143)
                     /gene="SDT1"
                     /locus_tag="AWJ20_2294"
                     /product="Sdt1p"
                     /transcript_id="XM_018879231.1"
                     /db_xref="GeneID:30034189"
     CDS             complement(925526..926143)
                     /gene="SDT1"
                     /locus_tag="AWJ20_2294"
                     /inference="similar to AA sequence:KEGG_Orthology:K18551"
                     /note="Pyrimidine nucleotidase; responsible for production
                     of nicotinamide riboside and nicotinic acid riboside;
                     overexpression suppresses the 6-AU sensitivity of
                     transcription elongation factor S-II, as well as
                     resistance to other pyrimidine derivatives; SDT1 has a
                     paralog, PHM8, that arose from the whole genome
                     duplication; GO_component: GO:0005575 - cellular_component
                     [Evidence ND]; GO_function: GO:0016787 - hydrolase
                     activity [Evidence IEA]; GO_function: GO:0008252 -
                     nucleotidase activity [Evidence IDA] [PMID 11934891];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA];
                     GO_process: GO:0006206 - pyrimidine nucleobase metabolic
                     process [Evidence IMP] [PMID 11934891]"
                     /codon_start=1
                     /product="Sdt1p"
                     /protein_id="XP_018737166.1"
                     /db_xref="GeneID:30034189"
                     /translation="MQQLIHKYFVTHLELDDESAELLHQRYYKEFGLAIEGLVRFNKI
                     DAMAYNAEVDDALPLDGIMKPDPDLRKMLLSIDRTKVKKLWLLTNAYINHARRVVRLL
                     GVDDLFDGITYCDYAQVPLICKPKREMFHKAMEQAGVDDVNKCYFVDDSYINIVGARK
                     FGFKKPIQYVDADDPLPEKPASDYTVRSLLELPQLVPEVFKIEEN"
     gene            complement(<927087..>928073)
                     /gene="IDH2"
                     /locus_tag="AWJ20_2295"
                     /db_xref="GeneID:30034190"
     mRNA            complement(<927087..>928073)
                     /gene="IDH2"
                     /locus_tag="AWJ20_2295"
                     /product="isocitrate dehydrogenase (NAD(+)) IDH2"
                     /transcript_id="XM_018879232.1"
                     /db_xref="GeneID:30034190"
     CDS             complement(927087..928073)
                     /gene="IDH2"
                     /locus_tag="AWJ20_2295"
                     /inference="similar to AA sequence:KEGG_Orthology:K00030"
                     /note="Subunit of mitochondrial NAD(+)-dependent
                     isocitrate dehydrogenase; complex catalyzes the oxidation
                     of isocitrate to alpha-ketoglutarate in the TCA cycle;
                     phosphorylated; GO_component: GO:0005962 - mitochondrial
                     isocitrate dehydrogenase complex (NAD+) [Evidence IDA]
                     [PMID 16884682]; GO_component: GO:0005759 - mitochondrial
                     matrix [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 11502169];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 11914276]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961]; GO_function:
                     GO:0051287 - NAD binding [Evidence IEA]; GO_function:
                     GO:0003723 - RNA binding [Evidence IEA]; GO_function:
                     GO:0003824 - catalytic activity [Evidence IEA];
                     GO_function: GO:0004449 - isocitrate dehydrogenase (NAD+)
                     activity [Evidence IEA,IEA]; GO_function: GO:0004449 -
                     isocitrate dehydrogenase (NAD+) activity [Evidence IDA]
                     [PMID 16884682]; GO_function: GO:0000287 - magnesium ion
                     binding [Evidence IEA]; GO_function: GO:0046872 - metal
                     ion binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_function:
                     GO:0016616 - oxidoreductase activity, acting on the CH-OH
                     group of donors, NAD or NADP as acceptor [Evidence IEA];
                     GO_process: GO:0006537 - glutamate biosynthetic process
                     [Evidence TAS] [PMID 9175438]; GO_process: GO:0006102 -
                     isocitrate metabolic process [Evidence IDA] [PMID
                     16884682]; GO_process: GO:0008152 - metabolic process
                     [Evidence IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA,IEA];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA,IEA]; GO_process: GO:0006099 - tricarboxylic
                     acid cycle [Evidence TAS] [PMID 9175438]"
                     /codon_start=1
                     /product="isocitrate dehydrogenase (NAD(+)) IDH2"
                     /protein_id="XP_018737167.1"
                     /db_xref="GeneID:30034190"
                     /translation="MIEGDGIGVEISEAVKDIYKAAKVPIDWELADVTPIFVDGKTSI
                     PPEAIESINKNKVALKGPLATPVGKGHVSLNLTLRRTFNLFANVRPCKSVVGFQTPYE
                     DVDTVLIRENTEGEYSGIEHVVVPGVVQSIKLITRAASERVARYAFEYARSIGKKKVL
                     VVHKATVMKYGDGLFLESAQKIAKEFPDIEIHTELIDRTCLNMVTNPAPYKEYVMVMP
                     NLYGDIMSDLSSGLIGGLGLTPSGNMGDEVSIFEAVHGSAPDIAGKGLANPTALLLSS
                     VMMLRHMGLNDEAARIEKAVLDTIASGKENITRDLKGTASTKHFTEQVISRL"
     gene            <927154..>927447
                     /locus_tag="AWJ20_2296"
                     /db_xref="GeneID:30034191"
     mRNA            <927154..>927447
                     /locus_tag="AWJ20_2296"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879233.1"
                     /db_xref="GeneID:30034191"
     CDS             927154..927447
                     /locus_tag="AWJ20_2296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737168.1"
                     /db_xref="GeneID:30034191"
                     /translation="MFSLPEAMVSRTAFSILAASSLRPMCLNIITDESSRAVGLAKPL
                     PAISGADPWTASKMETSSPMLPEGVKPRPPIKPEDKSDMISPYKLGMTMTYSL"
     gene            complement(<933933..>936488)
                     /gene="SRC1"
                     /locus_tag="AWJ20_2297"
                     /db_xref="GeneID:30034192"
     mRNA            complement(<933933..>936488)
                     /gene="SRC1"
                     /locus_tag="AWJ20_2297"
                     /product="Src1p"
                     /transcript_id="XM_018879234.1"
                     /db_xref="GeneID:30034192"
     CDS             complement(933933..936488)
                     /gene="SRC1"
                     /locus_tag="AWJ20_2297"
                     /note="Inner nuclear membrane protein; highly enriched at
                     telomeres and subtelomeric regions; functions in
                     regulation of subtelomeric genes and is linked to TREX
                     (transcription export) factors; SRC1 produces 2 splice
                     variant proteins with different functions; alternative
                     splicing of SRC1 pre-mRNA is promoted by Hub1p; mutant has
                     aneuploidy tolerance; SEC1 has a paralog, HEH2, that arose
                     from the whole genome duplication; GO_component:
                     GO:0000781 - chromosome, telomeric region [Evidence IDA]
                     [PMID 18762579]; GO_component: GO:0016021 - integral
                     component of membrane [Evidence IEA]; GO_component:
                     GO:0005639 - integral component of nuclear inner membrane
                     [Evidence IEA]; GO_component: GO:0016020 - membrane
                     [Evidence IEA]; GO_component: GO:0005635 - nuclear
                     envelope [Evidence IDA] [PMID 16929305]; GO_component:
                     GO:0005637 - nuclear inner membrane [Evidence IEA];
                     GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003674 - molecular_function [Evidence
                     ND]; GO_process: GO:0043007 - maintenance of rDNA
                     [Evidence IMP] [PMID 18997772]; GO_process: GO:0000070 -
                     mitotic sister chromatid segregation [Evidence IGI] [PMID
                     11754482]"
                     /codon_start=1
                     /product="Src1p"
                     /protein_id="XP_018737169.1"
                     /db_xref="GeneID:30034192"
                     /translation="MSRQTGRRSVPPDAGEDERYYLRDGFDPASLTITQLRNVMAVHD
                     VDFPPSGAKKATWVEHFKVHVLPRAAEFLSEYDNISPHGAGIVDAAPPKRSARSRSPA
                     KRSPSKSERKSAVEPIAEIPAATEVPPVAELTAPVVAEPASPSKSRSRTTRAKSPAKG
                     TESTSASTKSKPPPSPSRRSRKTDSTTAPATAIEIETVIESTVTSSEPVPNILESAIS
                     LAPPGTLASAFESTTGDATSTATTKSSTSKASSSPKKTRKTLKQQYVDPSEYELNTQP
                     KTEKTLNPVSITGTSPRKSIKEEPLVGQGSSDRNVFQKPTPQKASESPFSNKNIFQKG
                     SPSSPKARKRAHKEVEESTDSPQPSSAKKRAKDTTPKRSAPKDTFSSIVQFDNDVTMA
                     DDTKSVPYFTPHIPQQPQEVQPQPDLKQPSEFQPVQYSQYVQPLQQEQQQPIPATPGS
                     VRRFTSFPNTPEDDHSNTQATPSRSPPRAPPATAPHNSVRDHSFPRASSSKRLSFMPD
                     VKHLRVSDEFSRQLQQEQQEKKEPAFVLPEQLNDNPKQDQESTEVKNEETEQEAEPVT
                     DGRVGIEVIKKGEVAAEDLHESDLEKYHELEREIEEEDRALKKKLRKQHKKRSKSKAE
                     STDYVELFFSALAYVFRVTATLSLVFYASWWCVERFRIGYCDVLTSPEPRTISIPSQW
                     IEKASPYVSADSLYKFENYINQAIEYGTPECVPCPEHAACYPNFRVACEEGYVPVQSL
                     ISLGGTLPFPPTCVPDMARRNKVAALAKRAVEILRKRNANVKCGITDESTPEISEDKL
                     RQELLKQTIASLSEEEFNDLWRQALKDIENEKDIIVRQDKLTFGYAVQRVQIA"
     gene            <937355..>939925
                     /gene="AMD1"
                     /locus_tag="AWJ20_2298"
                     /db_xref="GeneID:30034193"
     mRNA            <937355..>939925
                     /gene="AMD1"
                     /locus_tag="AWJ20_2298"
                     /product="AMP deaminase"
                     /transcript_id="XM_018879235.1"
                     /db_xref="GeneID:30034193"
     CDS             937355..939925
                     /gene="AMD1"
                     /locus_tag="AWJ20_2298"
                     /inference="similar to AA sequence:KEGG_Orthology:K01490"
                     /note="AMP deaminase; tetrameric enzyme that catalyzes the
                     deamination of AMP to form IMP and ammonia; thought to be
                     involved in regulation of intracellular purine (adenine,
                     guanine, and inosine) nucleotide pools; GO_component:
                     GO:0005737 - cytoplasm [Evidence IDA] [PMID 14562095];
                     GO_function: GO:0003876 - AMP deaminase activity [Evidence
                     IEA,IEA]; GO_function: GO:0003876 - AMP deaminase activity
                     [Evidence IDA,IMP] [PMID 2690949]; GO_function: GO:0019239
                     - deaminase activity [Evidence IEA]; GO_function:
                     GO:0016787 - hydrolase activity [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA]; GO_process: GO:0006188 - IMP biosynthetic process
                     [Evidence IEA]; GO_process: GO:0032264 - IMP salvage
                     [Evidence IEA]; GO_process: GO:0006178 - guanine salvage
                     [Evidence IGI,IMP] [PMID 19635936]; GO_process: GO:0009117
                     - nucleotide metabolic process [Evidence IEA]; GO_process:
                     GO:0006163 - purine nucleotide metabolic process [Evidence
                     IGI] [PMID 15869715]; GO_process: GO:0006163 - purine
                     nucleotide metabolic process [Evidence IGI] [PMID
                     18433446]; GO_process: GO:0006163 - purine nucleotide
                     metabolic process [Evidence IGI,IMP] [PMID 19635936];
                     GO_process: GO:0006163 - purine nucleotide metabolic
                     process [Evidence IMP] [PMID 20087341]; GO_process:
                     GO:0009168 - purine ribonucleoside monophosphate
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="AMP deaminase"
                     /protein_id="XP_018737170.1"
                     /db_xref="GeneID:30034193"
                     /translation="MSVSEIMFQNDDDRMEADKEIEMEDGFDEQELINMSPSSTTAHS
                     YVDEKSLQAMAAKLNALNVHGGGNGSSTAGSVNTGFGGSLDGSGSPGSFHGIGSPHES
                     LHSSPAKSRIASSNTLKSLVDPSLSPKSSHSTTAHAAAAIAAPHPSLDMASQSPHTYG
                     SFQKQYAQGTFHQEGHKEDPDVFRELNTMYSKVQSCIDTRHKYQSISLQRESDNPKNS
                     SEWEIYPPPPKPSWKPQTKEFAATVFEEDENERANENDGVEDGEADDHVNEHVTNGTN
                     PPSRRPRLSRIGSKLEVGDDFDMANCPIPTPSEYIFAADDDSVFQVYESQEALDQGLP
                     IVDVPTLRDYYMDMDRIISISSDGPVKSFAFRRLQYLEAKWNLYSLLNEYQETADSKK
                     TPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKYKMKKFPNEVVIYRDNKLLTLTQVFD
                     SLGLTAYDLSIDTLDMHAHKDSFHRFDKFNLKYNPIGESRLREIFLKTDNYIKGRYLA
                     EITKEVVEDLEQSKYQMAEYRISIYGRDPNEWSKLAAWVIDNKLLSHNVRWLIQIPRL
                     YNIYKEGGIVKNFNDVVENVFKPLFEVTKDPSKDPKLHVFLQRVIGFDSVDDESKVDR
                     RFHKKYPTPKYWDNAQNPPYSYYLYYLYANMSSLNAWRKKLGYNTFVLRPHAGEAGDP
                     EHLVAAFLTSHSISHGILLRKVPFIQYLYYLDQIGIAMSPLSNNALFLNYDKNPFHSY
                     FKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELARNSVIQSGFEAA
                     LKKHWIGKTYTLRGPKGNVMEKTNVPNVRLAYREETFLHEVGLIERYTGISSCLRNER
                     "
     gene            complement(<940172..>942076)
                     /gene="TAH18"
                     /locus_tag="AWJ20_2299"
                     /db_xref="GeneID:30034194"
     mRNA            complement(<940172..>942076)
                     /gene="TAH18"
                     /locus_tag="AWJ20_2299"
                     /product="Tah18p"
                     /transcript_id="XM_018879236.1"
                     /db_xref="GeneID:30034194"
     CDS             complement(940172..942076)
                     /gene="TAH18"
                     /locus_tag="AWJ20_2299"
                     /note="Conserved NAPDH-dependent diflavin reductase;
                     component of an early step in the cytosolic Fe-S protein
                     assembly (CIA) machinery; transfers electrons from NADPH
                     to the Fe-S cluster of Dre2p; plays a pro-death role under
                     oxidative stress; Tah18p-dependent nitric oxide synthesis
                     confers high-temperature stress tolerance; possible target
                     for development of antifungal drugs; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA,IEA];
                     GO_component: GO:0005739 - mitochondrion [Evidence
                     IEA,IEA,IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 19194512]; GO_function: GO:0010181 -
                     FMN binding [Evidence IEA,IEA]; GO_function: GO:0050661 -
                     NADP binding [Evidence IEA]; GO_function: GO:0003958 -
                     NADPH-hemoprotein reductase activity [Evidence IEA];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA]; GO_function: GO:0005506 - iron ion
                     binding [Evidence IEA]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA,IEA]; GO_function:
                     GO:0016651 - oxidoreductase activity, acting on NAD(P)H
                     [Evidence IEA]; GO_function: GO:0016651 - oxidoreductase
                     activity, acting on NAD(P)H [Evidence IDA] [PMID
                     20802492]; GO_process: GO:0016226 - iron-sulfur cluster
                     assembly [Evidence IEA]; GO_process: GO:0016226 -
                     iron-sulfur cluster assembly [Evidence IMP] [PMID
                     20802492]; GO_process: GO:0006809 - nitric oxide
                     biosynthetic process [Evidence IMP] [PMID 23159617];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA,IEA]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IDA] [PMID
                     20802492]"
                     /codon_start=1
                     /product="Tah18p"
                     /protein_id="XP_018737171.1"
                     /db_xref="GeneID:30034194"
                     /translation="MDSIVGSVSPQRSVLILYGTETGNAQDCAEILAKKCQRLRLNPT
                     VCGMDDYDVSQLPLESTIIVICSTTGQGDLPRNALKFWRFLLRKKLPPTLLSHIRFTS
                     FGLGDSSYPRYNWAIRKVHKRLMQLGAREFIGRGEGDEMGTESLDSQFESWIDLISER
                     LLQPDMFPLAPGTEVISDNILLEPRYKLSVDTKKIRRLTSGEAQTATIALTRGDALVG
                     TVVSNKRITAQEHFQDVRNFEFTASQEDSTPSLDYLPGDTVGLYPRNDATDVNELLEH
                     QGWSEIADHPVTVNEEFEKAIIGGLVKPLTLRSLITHHLDISAIPRRSFFAVAWHFST
                     DNEREQERLKEFSTIEGLQDLYDYANRSRRSILETITEFYSLKIPVEYILDLIPILRP
                     RLFSISSPSPGSFRAVNDGVQTSDNEKPSDPVNKTSFSLTIAIVKYKTIIKRIRRGVC
                     TKWVEGLTEGDKIPFSLFRASFKSEDVHDIETPIIMIAPGTGIAPMRSLILTRAAKEA
                     VLQPDTAASMLLFFGCRYKEKDYLYEDDWNRVSNSGHSSLTVIPAFSRENGGYVQDKL
                     YSAKDQVSELLVKQNASIYVCGSAGKMPRQVRITIATILEETQNWSTETTEAYVSSME
                     RTGRYLQETW"
     gene            <944999..>945778
                     /gene="MGE1"
                     /locus_tag="AWJ20_2300"
                     /db_xref="GeneID:30034197"
     mRNA            <944999..>945778
                     /gene="MGE1"
                     /locus_tag="AWJ20_2300"
                     /product="Mge1p"
                     /transcript_id="XM_018879238.1"
                     /db_xref="GeneID:30034197"
     CDS             944999..945778
                     /gene="MGE1"
                     /locus_tag="AWJ20_2300"
                     /inference="similar to AA sequence:KEGG_Orthology:K03687"
                     /note="N-terminus has a leader sequence with features
                     reminiscent of mitochondrial import signals. Translated as
                     a 28KDa precursor protein which is cleaved to a 21KDa
                     mature form."
                     /codon_start=1
                     /product="Mge1p"
                     /protein_id="XP_018737172.1"
                     /db_xref="GeneID:30034197"
                     /translation="MLRRSLMRSSPSSALVSSSVRAATRPVVMARPIARTQMVNSRGL
                     FGFRSYSETANGEKKDAESAANEASSENTKEETQTSESEYANLSVEELQSKLKELQSK
                     FEAKDKEVAKFKEHYTRSVADFRNLQETTKREIQKARDYALQKFAKDLLDSVDNFDRA
                     LAVVPEEKRSDKENHVELANLYEGVKMTQEVFEKTLARHGLVKLNPLGEKFDPNVHEA
                     TFEVPQPDKEPGTVFHVQQTGFALNDRVLRAPKVGVVKGTD"
     gene            complement(<946050..>947468)
                     /gene="MSF1"
                     /locus_tag="AWJ20_2301"
                     /db_xref="GeneID:30034198"
     mRNA            complement(<946050..>947468)
                     /gene="MSF1"
                     /locus_tag="AWJ20_2301"
                     /product="phenylalanine--tRNA ligase"
                     /transcript_id="XM_018879239.1"
                     /db_xref="GeneID:30034198"
     CDS             complement(946050..947468)
                     /gene="MSF1"
                     /locus_tag="AWJ20_2301"
                     /inference="similar to AA sequence:KEGG_Orthology:K01889"
                     /note="Mitochondrial phenylalanyl-tRNA synthetase; active
                     as a monomer, unlike the cytoplasmic subunit which is
                     active as a dimer complexed to a beta subunit dimer;
                     similar to the alpha subunit of E. coli phenylalanyl-tRNA
                     synthetase; GO_component: GO:0005737 - cytoplasm [Evidence
                     IEA]; GO_component: GO:0005759 - mitochondrial matrix
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IDA] [PMID 14576278]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0005739 - mitochondrion [Evidence IMP]
                     [PMID 3029120]; GO_function: GO:0005524 - ATP binding
                     [Evidence IEA,IEA]; GO_function: GO:0004812 -
                     aminoacyl-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0016874 - ligase activity [Evidence IEA];
                     GO_function: GO:0000287 - magnesium ion binding [Evidence
                     IEA]; GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA,IEA]; GO_function: GO:0004826 -
                     phenylalanine-tRNA ligase activity [Evidence IEA,IEA];
                     GO_function: GO:0004826 - phenylalanine-tRNA ligase
                     activity [Evidence IDA] [PMID 16162501]; GO_function:
                     GO:0004826 - phenylalanine-tRNA ligase activity [Evidence
                     IDA] [PMID 1924298]; GO_function: GO:0004826 -
                     phenylalanine-tRNA ligase activity [Evidence IMP,ISS]
                     [PMID 3029120]; GO_function: GO:0000049 - tRNA binding
                     [Evidence IEA]; GO_process: GO:0070156 - mitochondrial
                     phenylalanyl-tRNA aminoacylation [Evidence IMP] [PMID
                     3029120]; GO_process: GO:0006432 - phenylalanyl-tRNA
                     aminoacylation [Evidence IEA]; GO_process: GO:0006432 -
                     phenylalanyl-tRNA aminoacylation [Evidence IDA] [PMID
                     1924298]; GO_process: GO:0043039 - tRNA aminoacylation
                     [Evidence IEA]; GO_process: GO:0006418 - tRNA
                     aminoacylation for protein translation [Evidence IEA];
                     GO_process: GO:0008033 - tRNA processing [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="phenylalanine--tRNA ligase"
                     /protein_id="XP_018737173.1"
                     /db_xref="GeneID:30034198"
                     /translation="MTANISRSSGFLLQRVSAPAVRRWNINARSSIAQSLKRNISTES
                     SSGNATITVLGKEYPTDDFTNLPNSIANLTSRKLHLQPSHPIGILRSLIESRLKDLGF
                     TSYNDFKPVVSTYENFDALGFPEDHPGRSKTDTYYINEKTLLRTHTSAHESECFQTCE
                     TPGYLISADVYRRDTIDRTHYPAFHQMEGARVWSRTEHGDNLAKVIQEDLESIPDSGI
                     IVSDPDPPFHEGNPRQPTMSELETELIGKHLKKTIELLMGHVFHQAREAAIKAGSTDP
                     DLFSPIKARWIEAYFPWTSPSWEIEIWWKGEWLEMCGCGVVKHEVLSGAGVGDKIGWA
                     FGIGLERTAMILFGVPDIRLFWSEDERFLSQFKPNTVSTFKPYSKYPGTFRDVAFWCD
                     MAKEVHINDLMEVVRSIGGDLVENVSLIDEFVHPKTKQKSQCYRINYQSMDRSLTNAE
                     INDLQDAVVSSLSTQFPIKIRD"
     gene            <946438..>946851
                     /locus_tag="AWJ20_2302"
                     /db_xref="GeneID:30034199"
     mRNA            <946438..>946851
                     /locus_tag="AWJ20_2302"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879240.1"
                     /db_xref="GeneID:30034199"
     CDS             946438..946851
                     /locus_tag="AWJ20_2302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737174.1"
                     /db_xref="GeneID:30034199"
                     /translation="MAVRSRPIPKAQPILSPTPAPERTSCFTTPHPHISSHSPFHQIS
                     ISQDGEVQGKYASIQRALMGEKRSGSVDPALIAASRAWWNTWPMSSSIVFFKCLPISS
                     VSSSDIVGWRGLPSWNGGSGSETIMPESGMLSRSS"
     gene            <948033..>948749
                     /gene="MRPL16"
                     /locus_tag="AWJ20_2303"
                     /db_xref="GeneID:30034200"
     mRNA            <948033..>948749
                     /gene="MRPL16"
                     /locus_tag="AWJ20_2303"
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /transcript_id="XM_018879241.1"
                     /db_xref="GeneID:30034200"
     CDS             948033..948749
                     /gene="MRPL16"
                     /locus_tag="AWJ20_2303"
                     /note="Mitochondrial ribosomal protein of the large
                     subunit; homologous to bacterial L16 ribosomal protein;
                     synthetically lethal with hac1 mutant suggesting a role in
                     the maturation of secretory proteins; GO_component:
                     GO:0005622 - intracellular [Evidence IEA]; GO_component:
                     GO:0005762 - mitochondrial large ribosomal subunit
                     [Evidence IDA] [PMID 7478995]; GO_component: GO:0005762 -
                     mitochondrial large ribosomal subunit [Evidence IDA] [PMID
                     9151978]; GO_component: GO:0005739 - mitochondrion
                     [Evidence IEA,IEA]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16823961];
                     GO_component: GO:0030529 - ribonucleoprotein complex
                     [Evidence IEA]; GO_component: GO:0005840 - ribosome
                     [Evidence IEA,IEA]; GO_function: GO:0019843 - rRNA binding
                     [Evidence IEA]; GO_function: GO:0003735 - structural
                     constituent of ribosome [Evidence IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IDA] [PMID 7478995]; GO_function: GO:0003735 - structural
                     constituent of ribosome [Evidence IDA] [PMID 9151978];
                     GO_process: GO:0032543 - mitochondrial translation
                     [Evidence IMP] [PMID 7478995]; GO_process: GO:0051604 -
                     protein maturation [Evidence IMP] [PMID 19433630];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /protein_id="XP_018737175.1"
                     /db_xref="GeneID:30034200"
                     /translation="MFSRVFSALKPSALLAPSSLLTSVGASRTTALTSRFGGSTFQQI
                     RLKHQYEPRVRIKRKAQKGRVPVRTGGSIKGSTLQFGKFGLRLKSEGVRLKAVQLKEA
                     DNAIMRALRPLKGKLFRRLTTNIPVCVKGNETRMGKGKGGFEFWACRVPTGKILFEID
                     GANVHESVARDAFRIAGDKLPGTYEFVNLETAPKAGFQPVNVDGSPVNFYEEAKANPT
                     KQYANVLQGQDPELRKYLRR"
     gene            complement(<949020..>950087)
                     /gene="RFC5"
                     /locus_tag="AWJ20_2304"
                     /db_xref="GeneID:30034201"
     mRNA            complement(<949020..>950087)
                     /gene="RFC5"
                     /locus_tag="AWJ20_2304"
                     /product="replication factor C subunit 5"
                     /transcript_id="XM_018879242.1"
                     /db_xref="GeneID:30034201"
     CDS             complement(949020..950087)
                     /gene="RFC5"
                     /locus_tag="AWJ20_2304"
                     /inference="similar to AA sequence:KEGG_Orthology:K10756"
                     /note="Subunit of heteropentameric Replication factor C
                     (RF-C); RF-C is a DNA binding protein and ATPase that acts
                     as a clamp loader of the proliferating cell nuclear
                     antigen (PCNA) processivity factor for DNA polymerases
                     delta and epsilon; GO_component: GO:0031390 - Ctf18
                     RFC-like complex [Evidence IPI] [PMID 11389843];
                     GO_component: GO:0005663 - DNA replication factor C
                     complex [Evidence IDA] [PMID 7651383]; GO_component:
                     GO:0005663 - DNA replication factor C complex [Evidence
                     IMP] [PMID 8559655]; GO_component: GO:0031391 - Elg1
                     RFC-like complex [Evidence IPI] [PMID 12909721];
                     GO_component: GO:0031391 - Elg1 RFC-like complex [Evidence
                     IPI] [PMID 12912927]; GO_component: GO:0031389 - Rad17
                     RFC-like complex [Evidence IDA] [PMID 12604797];
                     GO_component: GO:0005634 - nucleus [Evidence IEA,IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA,IEA];
                     GO_function: GO:0003689 - DNA clamp loader activity
                     [Evidence IDA] [PMID 12604797]; GO_function: GO:0003689 -
                     DNA clamp loader activity [Evidence IDA] [PMID 8995429];
                     GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IEA]; GO_function: GO:0000166 -
                     nucleotide binding [Evidence IEA,IEA]; GO_process:
                     GO:0006260 - DNA replication [Evidence IEA,IEA];
                     GO_process: GO:0007049 - cell cycle [Evidence IEA];
                     GO_process: GO:0006272 - leading strand elongation
                     [Evidence IDA] [PMID 1346062]; GO_process: GO:0007062 -
                     sister chromatid cohesion [Evidence IPI] [PMID 11389843];
                     GO_process: GO:0007062 - sister chromatid cohesion
                     [Evidence IMP] [PMID 12665596]"
                     /codon_start=1
                     /product="replication factor C subunit 5"
                     /protein_id="XP_018737176.1"
                     /db_xref="GeneID:30034201"
                     /translation="MSLWVHKYMPKSLDTLDYHDGLSKSLKSLAASGEFPHMLMYGPS
                     GAGKKTRVMAVLRELYGPGVSKIKIDGRVFQTNSKKVEFNIVSSVHHLEITPSDMGNN
                     DRVVIQDLLKEIAQTQQVDLSSKQRFKVVVINEADSLTRDAQSALRRTMEKYSPNLRL
                     ILLATSTSNIIGPIKSRTLLVRVAAPTNQEIANVLSKVAKKEKVDLPSSPDDLQYLWD
                     KIARQSQRNLRKSLLILEAMYAQNDKITRDTPVPPADWELVISKLADDTIKKRSVAQL
                     LQIRGTLYELLTHCIPAPVILKSLTFSLLKKVSPEVGADIIEAAGFYDHRLRQGSKAI
                     FHLEAYVARVMNLLETFDMTH"
     gene            complement(<950442..>950783)
                     /gene="STL1"
                     /locus_tag="AWJ20_2305"
                     /db_xref="GeneID:30034202"
     mRNA            complement(<950442..>950783)
                     /gene="STL1"
                     /locus_tag="AWJ20_2305"
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /transcript_id="XM_018879243.1"
                     /db_xref="GeneID:30034202"
     CDS             complement(950442..950783)
                     /gene="STL1"
                     /locus_tag="AWJ20_2305"
                     /codon_start=1
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /protein_id="XP_018737177.1"
                     /db_xref="GeneID:30034202"
                     /translation="MVVMITPVAFANINYYTYTVFAALNLLILVATYIFYPETAGRSL
                     EEIDKIFEKSNPRTPWDVVKIAQELPHHNAILDEETGYHGEEDVLDKPTHQYQEDTAT
                     SLSSSGGKGDM"
     gene            complement(<951331..>951828)
                     /gene="STL1"
                     /locus_tag="AWJ20_2306"
                     /db_xref="GeneID:30034203"
     mRNA            complement(<951331..>951828)
                     /gene="STL1"
                     /locus_tag="AWJ20_2306"
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /transcript_id="XM_018879244.1"
                     /db_xref="GeneID:30034203"
     CDS             complement(951331..951828)
                     /gene="STL1"
                     /locus_tag="AWJ20_2306"
                     /codon_start=1
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /protein_id="XP_018737178.1"
                     /db_xref="GeneID:30034203"
                     /translation="MVEGALITAGIMISYWLDFGFFFAKGSVNWRFPIAFQIVFAIVI
                     VCFVLVSIHSFCSTYYNSDFLTFQQSLPDSPRWLIKKDRVEEARLIFSALDDVEPDHH
                     LITAQIEEIVATLIDEERSNAPIRRLFTFGREKHFHRAMLGFWNQAAQQLTGINLVGI
                     MREEV"
     gene            complement(<951898..>952176)
                     /gene="STL1"
                     /locus_tag="AWJ20_2307"
                     /db_xref="GeneID:30034204"
     mRNA            complement(<951898..>952176)
                     /gene="STL1"
                     /locus_tag="AWJ20_2307"
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /transcript_id="XM_018879245.1"
                     /db_xref="GeneID:30034204"
     CDS             complement(951898..952176)
                     /gene="STL1"
                     /locus_tag="AWJ20_2307"
                     /codon_start=1
                     /product="glucose-inactivated glycerol proton symporter
                     STL1"
                     /protein_id="XP_018737179.1"
                     /db_xref="GeneID:30034204"
                     /translation="MNDSTIQGTVVSLYEIGCLMGALATMRFGDQFGRRKVIFVGAIV
                     MTIGATLQCTSFSLAQLIVGRIVTGIGNGFITSTVSGTASCYLLLALG"
     gene            <955858..>956838
                     /gene="SPS19"
                     /locus_tag="AWJ20_2308"
                     /db_xref="GeneID:30034205"
     mRNA            <955858..>956838
                     /gene="SPS19"
                     /locus_tag="AWJ20_2308"
                     /product="Sps19p"
                     /transcript_id="XM_018879246.1"
                     /db_xref="GeneID:30034205"
     CDS             955858..956838
                     /gene="SPS19"
                     /locus_tag="AWJ20_2308"
                     /inference="similar to AA sequence:KEGG_Orthology:K13237"
                     /note="Peroxisomal 2,4-dienoyl-CoA reductase; auxiliary
                     enzyme of fatty acid beta-oxidation; homodimeric enzyme
                     required for growth and sporulation on petroselineate
                     medium; expression induced during late sporulation and in
                     the presence of oleate; GO_component: GO:0005782 -
                     peroxisomal matrix [Evidence IDA] [PMID 9268358];
                     GO_component: GO:0005777 - peroxisome [Evidence IEA,IEA];
                     GO_function: GO:0008670 - 2,4-dienoyl-CoA reductase
                     (NADPH) activity [Evidence IEA]; GO_function: GO:0008670 -
                     2,4-dienoyl-CoA reductase (NADPH) activity [Evidence
                     IDA,ISS] [PMID 9268358]; GO_function: GO:0016491 -
                     oxidoreductase activity [Evidence IEA]; GO_process:
                     GO:0030437 - ascospore formation [Evidence IEP,IMP] [PMID
                     7969036]; GO_process: GO:0009062 - fatty acid catabolic
                     process [Evidence IDA,ISS] [PMID 9268358]; GO_process:
                     GO:0055114 - oxidation-reduction process [Evidence IEA];
                     GO_process: GO:0030435 - sporulation resulting in
                     formation of a cellular spore [Evidence IEA]"
                     /codon_start=1
                     /product="Sps19p"
                     /protein_id="XP_018737180.1"
                     /db_xref="GeneID:30034205"
                     /translation="MSPPEETVTTGNNSSVADGPQKVVLPITPFETYPKARAAPKELI
                     GVEAALHAAKNPDFQAVSTIAGQFSLKDKVAIVTGGNSGIGLEYSVVLAELGAIVYVL
                     DLPEAPSEDYAACKAYIKKLATGGSLEYRVANVTDGPGMAKVTHEIAETHGRLDVCIA
                     NAGILGPVVDCHEYPADWFRKIMEVNVTGVFLTAQAAIKEMLERKIKGSVIFTASMSG
                     SIINKDMHWIPYTTAKAAVVQLAKAFACEVGTNEIRVNCISPGHIRTRMTEAYLGVEP
                     LIENCWAAQNPMNRLGSVYELRGTVAYLASDASTYTTGHDLQVCGGHTAW"
     gene            complement(<957086..>957586)
                     /locus_tag="AWJ20_2309"
                     /db_xref="GeneID:30034206"
     mRNA            complement(<957086..>957586)
                     /locus_tag="AWJ20_2309"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879247.1"
                     /db_xref="GeneID:30034206"
     CDS             complement(957086..957586)
                     /locus_tag="AWJ20_2309"
                     /inference="similar to AA sequence:KEGG_Orthology:K01808"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737181.1"
                     /db_xref="GeneID:30034206"
                     /translation="MARQYKIVVGCDNAGCDYKNAIKADLEKLPSVSQVIDVGVEHSK
                     DSKAYPSVAIAAAEKVANGEADRAILICGTGLGVAIAANKVKGIRAVTAHDSFSVERS
                     ILSNNAQILCMGQRVVGIELARRLAKEWMTYEFDTSSASAEKVAEIVNYENANANDAP
                     SQINGC"
     gene            <958231..>959997
                     /gene="DAK1"
                     /locus_tag="AWJ20_2310"
                     /db_xref="GeneID:30034208"
     mRNA            <958231..>959997
                     /gene="DAK1"
                     /locus_tag="AWJ20_2310"
                     /product="Dak1p"
                     /transcript_id="XM_018879249.1"
                     /db_xref="GeneID:30034208"
     CDS             958231..959997
                     /gene="DAK1"
                     /locus_tag="AWJ20_2310"
                     /inference="similar to AA sequence:KEGG_Orthology:K00863"
                     /note="Dihydroxyacetone kinase; required for
                     detoxification of dihydroxyacetone (DHA); involved in
                     stress adaptation; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 14562095]; GO_function: GO:0005524 -
                     ATP binding [Evidence IEA,IEA]; GO_function: GO:0004371 -
                     glycerone kinase activity [Evidence IEA,IEA]; GO_function:
                     GO:0004371 - glycerone kinase activity [Evidence IDA]
                     [PMID 12401799]; GO_function: GO:0004371 - glycerone
                     kinase activity [Evidence ISS] [PMID 9038161];
                     GO_function: GO:0016301 - kinase activity [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA]; GO_function: GO:0016740 - transferase activity
                     [Evidence IEA]; GO_function: GO:0050354 - triokinase
                     activity [Evidence IEA]; GO_process: GO:0019588 -
                     anaerobic glycerol catabolic process [Evidence IEA];
                     GO_process: GO:0097237 - cellular response to toxic
                     substance [Evidence IMP] [PMID 12401799]; GO_process:
                     GO:0019563 - glycerol catabolic process [Evidence ISS]
                     [PMID 9038161]; GO_process: GO:0006071 - glycerol
                     metabolic process [Evidence IEA,IEA]; GO_process:
                     GO:0016310 - phosphorylation [Evidence IEA]"
                     /codon_start=1
                     /product="Dak1p"
                     /protein_id="XP_018737182.1"
                     /db_xref="GeneID:30034208"
                     /translation="MSTKHFFPNQNGLVVRALKGVASQNPSLGVLESDKVLFHLDHDS
                     SKVSLLSGGGSGHEPAHSGYVGKGMLAAAVCGDVFASPNTKQIMNACKVVGSDDGYIF
                     IVTNYTGDMLHFGLACEKIKSHGTKVALIKSADDVSVGRTMGGSVGRRGLSGTIVINK
                     VLGGAAEAGSSFEVVEELGHAIASNIVTIGAGLDHCHVPGNSEEFGGLGPEECEIGLG
                     IHNEPGVTRLDEIPPIESLVKSLLGYLLDQSDSDRSFVKIESTDKVALMINNLGGLSI
                     IEQNAIVEVVLDKLSSEYGIVPIRVFAGHFMTSLNAPSFSITLLNITQSVTKGTSESK
                     IIEYLDAPTDAVNWPSNHYKTSRPIDLKSQVKSLPKSDDNVEKRTLDLLVDPSVLESK
                     LRTASNNLISAEPDLTKWDTKMGDGDCGKTLESGAMALLRSLDSGLASPGSIIDVLER
                     IVDITEENMGGTLGAIFGIYFASFSSSLKHIVSTNPNSDALKILAQSANEALDNLRLH
                     TAAKEGDRTVMDVLIPFCKALVSNYDLKEALEEAHQAAEKTKTLVPKLGRATYVGGVS
                     EMTVFPPDPGAWALYEILKGIL"
     gene            <960344..>961111
                     /gene="TPI1"
                     /locus_tag="AWJ20_2311"
                     /db_xref="GeneID:30034209"
     mRNA            <960344..>961111
                     /gene="TPI1"
                     /locus_tag="AWJ20_2311"
                     /product="triose-phosphate isomerase TPI1"
                     /transcript_id="XM_018879250.1"
                     /db_xref="GeneID:30034209"
     CDS             960344..961111
                     /gene="TPI1"
                     /locus_tag="AWJ20_2311"
                     /inference="similar to AA sequence:KEGG_Orthology:K01803"
                     /note="Triose phosphate isomerase, abundant glycolytic
                     enzyme; mRNA half-life is regulated by iron availability;
                     transcription is controlled by activators Reb1p, Gcr1p,
                     and Rap1p through binding sites in the 5' non-coding
                     region; inhibition of Tpi1p activity by PEP
                     (phosphoenolpyruvate) stimulates redox metabolism in
                     respiring cells; E104D mutation in human TPI causes a rare
                     autosomal disease; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11914276]; GO_component: GO:0005739 -
                     mitochondrion [Evidence IDA] [PMID 16962558];
                     GO_component: GO:0005886 - plasma membrane [Evidence IDA]
                     [PMID 16622836]; GO_function: GO:0003824 - catalytic
                     activity [Evidence IEA]; GO_function: GO:0016853 -
                     isomerase activity [Evidence IEA]; GO_function: GO:0004807
                     - triose-phosphate isomerase activity [Evidence IEA,IEA];
                     GO_function: GO:0004807 - triose-phosphate isomerase
                     activity [Evidence IDA] [PMID 236471]; GO_process:
                     GO:0006094 - gluconeogenesis [Evidence IEA,IEA];
                     GO_process: GO:0006096 - glycolytic process [Evidence
                     IEA,IEA,IEA]; GO_process: GO:0006096 - glycolytic process
                     [Evidence IMP] [PMID 11329176]; GO_process: GO:0008152 -
                     metabolic process [Evidence IEA]; GO_process: GO:0006098 -
                     pentose-phosphate shunt [Evidence IEA]"
                     /codon_start=1
                     /product="triose-phosphate isomerase TPI1"
                     /protein_id="XP_018737183.1"
                     /db_xref="GeneID:30034209"
                     /translation="MPVIGVSLKTYMSIKDTVSFFEELKSIVATSKDAGVEFFVAPDM
                     VSLGKIGAYIQENGRRDDYPQLAAQDCFWEDRGAYTGSVSPKSLKELGVQIVEVGHAE
                     RRAIFGETDEIVAKKAEAAFRNGLVPLLCVGEKVHDTVENAIDACVTQLRAVTNVISP
                     DCPLLVAYEPVWAIGKEKPADSEYVRGVATGIKKELAGRVGKSRVLYGGSAGPGGLFQ
                     SLYPCVDGLFLGRFGHKPANVKAVLSEVIQAAQSGAK"
     gene            complement(<961621..>963468)
                     /locus_tag="AWJ20_2312"
                     /db_xref="GeneID:30034210"
     mRNA            complement(<961621..>963468)
                     /locus_tag="AWJ20_2312"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879251.1"
                     /db_xref="GeneID:30034210"
     CDS             complement(961621..963468)
                     /locus_tag="AWJ20_2312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737184.1"
                     /db_xref="GeneID:30034210"
                     /translation="MTRQPYFRWLGPTAIAPPKDGTFRLLSVNLVSDEPDNGGKYVVV
                     ERQDKQSLYSKSSRSPTIPVREQIDTKAQSYAENLPPPPKSLYKLFNDKMANFLPYLP
                     HDIFEERLADGVISECLLFAMASLAERMAANSRKEYDSIGEENDKSQDNTEGTDEISL
                     AEKYAEAAKRLIIPHLSCPSVEIVFALLLIAYCEFGDDRDSGLWSWSGMAIRMCYDLG
                     LQKANTNEPDSWFSRNVFWSVVCLDRLISCGTGRATTIPDSVIEYELQPRWVKDSDGK
                     SRSDPFPYLCKLLLIVGKVSNYLNSCAESDAQKLMYNSKIGHPLSRSQIDMIEKFSAF
                     QQEVSDFYTNLPPDLLFDVQNFQCFAKIKCSPVFLLLHIWNQALVLAVHQPSLVYPKC
                     QLDITGLDQYPHAELTGSGAISIADMVTFADLIEPDSFLANPFLSQPIFMAACASLTL
                     RFSLRAPYQSQPIYKLERTYNTCRQTLNRMETIWRGISWHSRTLDSLAASEPDVDLTI
                     NSKVYVTTKDLGVVRRASVDEATRDWLAGEIRGRQVDDIYGMFIAGTIDGGVGNNQYE
                     TSPSSTGTEPRSDGFHDIGNRLNENGMMLFDSPQPTSNTTLIEEIFKIF"
     gene            complement(<964835..>964906)
                     /locus_tag="AWJ20_2313"
                     /db_xref="GeneID:30034211"
     tRNA            complement(<964835..>964906)
                     /locus_tag="AWJ20_2313"
                     /product="tRNA-His"
                     /db_xref="GeneID:30034211"
     gene            complement(<965405..>965476)
                     /locus_tag="AWJ20_2314"
                     /db_xref="GeneID:30034212"
     tRNA            complement(<965405..>965476)
                     /locus_tag="AWJ20_2314"
                     /product="tRNA-His"
                     /db_xref="GeneID:30034212"
     gene            complement(<965639..>966403)
                     /gene="SDS22"
                     /locus_tag="AWJ20_2315"
                     /db_xref="GeneID:30034213"
     mRNA            complement(<965639..>966403)
                     /gene="SDS22"
                     /locus_tag="AWJ20_2315"
                     /product="Sds22p"
                     /transcript_id="XM_018879252.1"
                     /db_xref="GeneID:30034213"
     CDS             complement(965639..966403)
                     /gene="SDS22"
                     /locus_tag="AWJ20_2315"
                     /inference="similar to AA sequence:KEGG_Orthology:K17550"
                     /note="Regulatory subunit of the type 1 protein
                     phosphatase (PP1) Glc7p; whether it functions as a
                     positive or negative regulator of Glc7p is controversial;
                     involved in the regulation of Glc7p nuclear localization
                     and function; GO_component: GO:0005737 - cytoplasm
                     [Evidence IDA] [PMID 11914276]; GO_component: GO:0005737 -
                     cytoplasm [Evidence IDA] [PMID 14562095]; GO_component:
                     GO:0005634 - nucleus [Evidence IEA,IEA]; GO_component:
                     GO:0005634 - nucleus [Evidence IDA] [PMID 11801737];
                     GO_component: GO:0005634 - nucleus [Evidence IDA] [PMID
                     11914276]; GO_component: GO:0005634 - nucleus [Evidence
                     IDA] [PMID 14562095]; GO_component: GO:0000164 - protein
                     phosphatase type 1 complex [Evidence IDA] [PMID 10775415];
                     GO_function: GO:0071862 - protein phosphatase type 1
                     activator activity [Evidence IGI] [PMID 11801737];
                     GO_function: GO:0071862 - protein phosphatase type 1
                     activator activity [Evidence IGI] [PMID 18172024];
                     GO_function: GO:0004865 - protein serine/threonine
                     phosphatase inhibitor activity [Evidence IGI,IMP] [PMID
                     17142459]; GO_process: GO:0007049 - cell cycle [Evidence
                     IEA]; GO_process: GO:0051301 - cell division [Evidence
                     IEA]; GO_process: GO:0007059 - chromosome segregation
                     [Evidence IMP] [PMID 11801737]; GO_process: GO:0051457 -
                     maintenance of protein location in nucleus [Evidence IMP]
                     [PMID 11801737]; GO_process: GO:0007067 - mitotic nuclear
                     division [Evidence IEA]"
                     /codon_start=1
                     /product="Sds22p"
                     /protein_id="XP_018737185.1"
                     /db_xref="GeneID:30034213"
                     /translation="MDGLEDLPEDLEELDLYDNRLTHVGHLDHFTPKMTTLDLSFNNI
                     KHIKHLDHLTGLSSLYLCQNQISKIVGLDQLKNITNLELGANKIREIKNLDGLVNLEQ
                     LWLGKNKITKLENLGHLKKLKILSIQANRIVKLEGLEELESLEELYISDNGIEKIEGL
                     DNNTKLTTLDVSSNRISELTNLRGLVNLEEFWASRNKISSFKNVEDELGKLPNLHTVY
                     FEHNPLQLENKVTYRNKLRLALGPSLQQIDATYIRN"
     gene            complement(<969267..>969593)
                     /gene="ACP1"
                     /locus_tag="AWJ20_2316"
                     /db_xref="GeneID:30034214"
     mRNA            complement(<969267..>969593)
                     /gene="ACP1"
                     /locus_tag="AWJ20_2316"
                     /product="Acp1p"
                     /transcript_id="XM_018879253.1"
                     /db_xref="GeneID:30034214"
     CDS             complement(969267..969593)
                     /gene="ACP1"
                     /locus_tag="AWJ20_2316"
                     /inference="similar to AA sequence:KEGG_Orthology:K03955"
                     /note="Mitochondrial matrix acyl carrier protein; involved
                     in biosynthesis of octanoate, which is a precursor to
                     lipoic acid; activated by phosphopantetheinylation
                     catalyzed by Ppt2p; GO_component: GO:0005739 -
                     mitochondrion [Evidence IEA,IEA]; GO_component: GO:0005739
                     - mitochondrion [Evidence IDA] [PMID 14576278];
                     GO_component: GO:0005739 - mitochondrion [Evidence IDA]
                     [PMID 16823961]; GO_component: GO:0070469 - respiratory
                     chain [Evidence IEA]; GO_function: GO:0000036 - ACP
                     phosphopantetheine attachment site binding involved in
                     fatty acid biosynthetic process [Evidence ISS] [PMID
                     8394042]; GO_process: GO:0006633 - fatty acid biosynthetic
                     process [Evidence IEA,IEA,IEA]; GO_process: GO:0006631 -
                     fatty acid metabolic process [Evidence IEA]; GO_process:
                     GO:0006629 - lipid metabolic process [Evidence IEA];
                     GO_process: GO:0009107 - lipoate biosynthetic process
                     [Evidence IMP] [PMID 9187370]; GO_process: GO:0055114 -
                     oxidation-reduction process [Evidence IEA]"
                     /codon_start=1
                     /product="Acp1p"
                     /protein_id="XP_018737186.1"
                     /db_xref="GeneID:30034214"
                     /translation="MFRMNASLIAKRASAAVTCRAAGSAAVRRPAFVNMLAMSRSYSA
                     SASGLNQKDVEDRIIKVFRAFDKIEDASKITPTANFSTELGLDSLDTVEVIVAVEEEF
                     GIEIPE"
     gene            complement(<971377..>973071)
                     /locus_tag="AWJ20_2317"
                     /db_xref="GeneID:30034215"
     mRNA            complement(<971377..>973071)
                     /locus_tag="AWJ20_2317"
                     /product="Myosin-Vb"
                     /transcript_id="XM_018879254.1"
                     /db_xref="GeneID:30034215"
     CDS             complement(971377..973071)
                     /locus_tag="AWJ20_2317"
                     /codon_start=1
                     /product="Myosin-Vb"
                     /protein_id="XP_018737187.1"
                     /db_xref="GeneID:30034215"
                     /translation="MAHPIAPAGTAKPEPADFGGPRLVPRLSKPERPTGLVTSKKWVV
                     PPRPKPGRKPGSKEGAKKRAVAAGAGGENGSGDSFTALREQLEKSRKENDELRNLVDE
                     FRSTSRSGSPVSNVPTVSVSKSGIVEGTVEPRQEEVWDGVRLLNQSNDAPLEASSDCG
                     FCDREGGCVCEDLGLKAGSSRTHVHEQDVITEKLESQRHNHSHNRTHNYGPHHDHSGN
                     HDHNEHSAQAHVDVHNNVHTHSQINGHASRNGLLPGETDLNTLENGSGSRSLQSAVRH
                     THHPSALAQFDHFSPVKAVPLKRSPRRVGNNGTTNPIVKKFKRLGEPAQITLTTGTEI
                     PANSKLVSETSEGTSPFEVGLSNTGFNAVEEADAKTSAHANPCGFCSDESPCLCADER
                     EGRTTTPTTTSTTSSSNGAISSESRGSFSMSPKGTRHFNNSTTVSSPSSVSLPPVSSV
                     TSRPPPYQQNVPSSSNPSLITPTGISTNPGSCTQCLSDPMSTLFCTSLSNVSAGSEVP
                     PEKLGMTVTCSQAYQVLSRHQKFPTYDLGAIVSTLISHDGKVGVQSITQALRKLDT"
     gene            complement(<973386..>975245)
                     /locus_tag="AWJ20_2318"
                     /db_xref="GeneID:30034216"
     mRNA            complement(<973386..>975245)
                     /locus_tag="AWJ20_2318"
                     /product="hypothetical protein"
                     /transcript_id="XM_018879255.1"
                     /db_xref="GeneID:30034216"
     CDS             complement(973386..975245)
                     /locus_tag="AWJ20_2318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_018737188.1"
                     /db_xref="GeneID:30034216"
                     /translation="MNDTQQDIWRGSIMIVTNDATSDYSTPPFLNVTIEPLVDPSASA
                     NTGVEGSALNGGSASHGNTTTVESNKIYGEYGVSFWRFDLNLNLIDSEQRVTYSINAG
                     SDSLGSSSPSPTETFYIPSRNQDMNIMFYSCNGFSLGVAPEKFKGQLWNDVLEQHENK
                     YHFHVMLGGGDQLYCDKVKIATESVKKWSEEKNPFKKRTAPMQPEEKAEIDQFYLWHY
                     ISWFGLGYFYGPHGRTLQPGWPKALAKIPMINIFDDHDIIDGFGSYTDGIMKSPHFSG
                     IGRAAFKYYLLFQHCVAPEEPTSKEPSWVMSPRPGPYMGEHARSVYARLGQSIAFYGL
                     DCRTERSHHQVCEDATYDAMFSRINHEVKQSNGQIKHLVIMLGVPIAYPRMVWLERIL
                     TSDLLMPLKMLTRKGYFSGLSNEFDDGIEILDDLDDHWCARHHKKERNEFVSRMQAFS
                     KSTGVRITILGGDVHLAGVGRFYSRKPVPPEKDYRHMLNIISSAIVNTPPPDKLADFL
                     NKRNKIHHFGSDTDEDMVKIFPVDVDNSHRNNDRLLPRRNWCSIIATHGQGQARRAGQ
                     INSTGEPPVSNSRETLYPDLPGTLSVILHMEKNDQDPASVTIPYEVLVPPLEL"
     gene            complement(<976463..>978091)
                     /gene="SST2"
                     /locus_tag="AWJ20_2319"
                     /db_xref="GeneID:30034217"
     mRNA            complement(<976463..>978091)
                     /gene="SST2"
                     /locus_tag="AWJ20_2319"
                     /product="GTPase-activating protein SST2"
                     /transcript_id="XM_018879256.1"
                     /db_xref="GeneID:30034217"
     CDS             complement(976463..978091)
                     /gene="SST2"
                     /locus_tag="AWJ20_2319"
                     /codon_start=1
                     /product="GTPase-activating protein SST2"
                     /protein_id="XP_018737189.1"
                     /db_xref="GeneID:30034217"
                     /translation="MVLSLRLSSKPQKEPSLFFARSFPFSFSVSDALKAMKNMSISVD
                     NGSTVTIIKCGIPDNGEYFLDKFLTAKLLHCPGSRTRETIKASVLLQPTAKGFHFVER
                     YCRRNGISNDNVSEMLLSEYNSMQCICLDRHHLTGEIMRSEGIVKLLFQRFMGPSPNT
                     YDASNPPDEIAINNLSRIYGQKVELSLHSPISLIFETGNMDQRVSPYAHRYFTHPDSD
                     SLMQYYVSSKGVRLHQTREFYDKRKSRVSVDFCVSGKAAVQWLSDCTDTIKPSESFAL
                     ASLFLKYKLLEPITLEPSISGSSDNIVVSRQAYYQLSDRGRRMVFWDRDHFFRHKSQV
                     EQTEEYEEDEFYTPGSSFVMDEDDESDEVSNSKHSSPGRNNNTNTSAITLQMILSDPA
                     MCHLFREYLEENLCQENLLFYKDMEKISDMYKHLKLLKKLPNDKEPIESYSTTILSAI
                     YGVLGRYFSPRAPYGLNIDAQIKRMIIEEMTTNQSLTNDNKNNNNKHETSALVDRMEP
                     LLEKARELAVKMMSQDSLQKFLRSSYYLSAVRSC"
     gene            complement(<978777..>980540)
                     /gene="MKK2"
                     /locus_tag="AWJ20_2320"
                     /db_xref="GeneID:30034219"
     mRNA            complement(<978777..>980540)
                     /gene="MKK2"
                     /locus_tag="AWJ20_2320"
                     /product="putative mitogen-activated protein kinase kinase
                     MKK2"
                     /transcript_id="XM_018879257.1"
                     /db_xref="GeneID:30034219"
     CDS             complement(978777..980540)
                     /gene="MKK2"
                     /locus_tag="AWJ20_2320"
                     /inference="similar to AA sequence:KEGG_Orthology:K08294"
                     /codon_start=1
                     /product="putative mitogen-activated protein kinase kinase
                     MKK2"
                     /protein_id="XP_018737190.1"
                     /db_xref="GeneID:30034219"
                     /translation="MSAPPLIRPPPKPASRMKLPGLQIPNSQSRSMSPVISPPKDEDI
                     SMSDSSSTTLLSSGLPTATPQYHNPTLATTTAKSIYTASASTSTPSLPSIITSDHQSI
                     ASLPMPVPRKSAHPFSHSNNSSSTGLHLSLNTNSETYGSYGSYGVSSTGDVTGTSNIG
                     GPYGSYGSYGSASTSLIVPPENYPSNRSPLSAASGLFSAEVLAAVRVGDDSSSLNDSD
                     VDHSMTVDSKSSSSGTSRLTATDSLGANGGLSTSVSSNSNSGYTTPNGSYLLSQSTSN
                     KSLSSEYDVEDLDEEGWAMVARQGDIVDMGRLGEGSGGSVSRCRLKNGKTIFALKEIT
                     TNPNPELQKQILRELQFNRSCNSPHIVKYYGTFLSNEFSSIFIAMEYCGGGSLEAIYK
                     RVKARNGRIGEKVLGKIAEGVLSGLSYLHERKIIHRDIKPQNILLDAKGQVKLCDFGV
                     SGEVVDSLATTFTGTSYYMAPERIQGQPYTVTSDVWSLGLTLMEVAQHRFPFLTEGHD
                     PLMPIELLTFIVNMPAPELQDEPQEGIKWSNSFRHFLSCCLEKDPKKRASPRQMLSHP
                     WMVGQRSKTVRMDKFVKECWN"
     gene            <984023..>984829
                     /gene="NAS6"
                     /locus_tag="AWJ20_2321"
                     /db_xref="GeneID:30034220"
     mRNA            <984023..>984829
                     /gene="NAS6"
                     /locus_tag="AWJ20_2321"
                     /product="Nas6p"
                     /transcript_id="XM_018879258.1"
                     /db_xref="GeneID:30034220"
     CDS             984023..984829
                     /gene="NAS6"
                     /locus_tag="AWJ20_2321"
                     /inference="similar to AA sequence:KEGG_Orthology:K06694"
                     /note="Assembly chaperone for the 19S proteasome
                     regulatory particle base; proteasome-interacting protein
                     involved in the assembly of the base subcomplex of the 19S
                     proteasomal regulatory particle (RP); ortholog of human
                     oncoprotein gankyrin, which interacts with the Rb tumor
                     suppressor and CDK4/6; GO_component: GO:0005829 - cytosol
                     [Evidence IDA] [PMID 19446323]; GO_component: GO:0005634 -
                     nucleus [Evidence IDA] [PMID 19446323]; GO_component:
                     GO:0005838 - proteasome regulatory particle [Evidence IDA]
                     [PMID 11029046]; GO_function: GO:0003674 -
                     molecular_function [Evidence ND]; GO_process: GO:0070682 -
                     proteasome regulatory particle assembly [Evidence IGI]
                     [PMID 19412159]; GO_process: GO:0070682 - proteasome
                     regulatory particle assembly [Evidence IGI,IMP] [PMID
                     19446322]; GO_process: GO:0070682 - proteasome regulatory
                     particle assembly [Evidence IGI,IMP] [PMID 19446323];
                     GO_process: GO:0006508 - proteolysis [Evidence IPI,ISS]
                     [PMID 11029046]"
                     /codon_start=1
                     /product="Nas6p"
                     /protein_id="XP_018737191.1"
                     /db_xref="GeneID:30034220"
                     /translation="MTESHGNSEASQAGKPLNEDSTPLALSENAESWPLHDAARDGKA
                     LLVKSILAENGKLVNSKDQDGRTPLFWAISTGGAEVTSTILKFVRDTRPRGFDLEEGD
                     EAGWTVVHISASTGQLDVIKQLVDIAKTVFSDDLDLDVQTKRGQTPLHFAVSKSHIDV
                     VKYLLEKGASPRTKDALNQNPLHRAAAVGSLPIVKLLIAAKTPLNATDRSGWTPLHHA
                     LAEGHGDVAIELISAGADQDRADAEGHTPMDVVVDDKVKKYVQVALSKQH"
     gene            complement(<985327..>985887)
                     /gene="RPL18A"
                     /locus_tag="AWJ20_2322"
                     /db_xref="GeneID:30034221"
     mRNA            complement(<985327..>985887)
                     /gene="RPL18A"
                     /locus_tag="AWJ20_2322"
                     /product="ribosomal 60S subunit protein L18A"
                     /transcript_id="XM_018879259.1"
                     /db_xref="GeneID:30034221"
     CDS             complement(985327..985887)
                     /gene="RPL18A"
                     /locus_tag="AWJ20_2322"
                     /inference="similar to AA sequence:KEGG_Orthology:K02883"
                     /note="Ribosomal 60S subunit protein L18A; intron of
                     RPL18A pre-mRNA forms stem-loop structures that are a
                     target for Rnt1p cleavage leading to degradation;
                     homologous to mammalian ribosomal protein L18, no
                     bacterial homolog; RPL18A has a paralog, RPL18B, that
                     arose from the whole genome duplication; GO_component:
                     GO:0005737 - cytoplasm [Evidence IEA,IEA]; GO_component:
                     GO:0022625 - cytosolic large ribosomal subunit [Evidence
                     IDA] [PMID 11983894]; GO_component: GO:0005622 -
                     intracellular [Evidence IEA]; GO_component: GO:0030529 -
                     ribonucleoprotein complex [Evidence IEA]; GO_component:
                     GO:0005840 - ribosome [Evidence IEA,IEA]; GO_function:
                     GO:0003735 - structural constituent of ribosome [Evidence
                     IEA]; GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IC] [PMID 11983894]; GO_process:
                     GO:0002181 - cytoplasmic translation [Evidence IC] [PMID
                     11983894]; GO_process: GO:0006412 - translation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L18A"
                     /protein_id="XP_018737192.1"
                     /db_xref="GeneID:30034221"
                     /translation="MGKDQFSKEHIRNSHRTAPKSDNVYLSLLVKLYRFLARRTDSNF
                     NKVILKSLFLSKINRPPVSVSRITRALKQKGAENKTIVVVGTVTDDNRLFEVPKTTVA
                     ALRFTAGARARIVKAGGEAITLDQLARRAPTGQNTLILRGPRASREAVRHFGMGPHKG
                     KAPRIQSKGRKFERARGRRRSRGFKV"
     gene            complement(<988923..>990764)
                     /gene="SMI1"
                     /locus_tag="AWJ20_2323"
                     /db_xref="GeneID:30034222"
     mRNA            complement(<988923..>990764)
                     /gene="SMI1"
                     /locus_tag="AWJ20_2323"
                     /product="Smi1p"
                     /transcript_id="XM_018879260.1"
                     /db_xref="GeneID:30034222"
     CDS             complement(988923..990764)
                     /gene="SMI1"
                     /locus_tag="AWJ20_2323"
                     /note="Protein involved in the regulation of cell wall
                     synthesis; proposed to be involved in coordinating cell
                     cycle progression with cell wall integrity; GO_component:
                     GO:0005935 - cellular bud neck [Evidence IDA] [PMID
                     10206705]; GO_component: GO:0000131 - incipient cellular
                     bud site [Evidence IDA] [PMID 10206705]; GO_component:
                     GO:0043332 - mating projection tip [Evidence IDA] [PMID
                     19053807]; GO_component: GO:0005634 - nucleus [Evidence
                     IEA,IEA]; GO_function: GO:0003677 - DNA binding [Evidence
                     IEA]; GO_function: GO:0003674 - molecular_function
                     [Evidence ND]; GO_process: GO:0042546 - cell wall
                     biogenesis [Evidence IEA]; GO_process: GO:0032995 -
                     regulation of fungal-type cell wall biogenesis [Evidence
                     IGI,IMP] [PMID 10206705]; GO_process: GO:0007346 -
                     regulation of mitotic cell cycle [Evidence IGI] [PMID
                     11410349]; GO_process: GO:0007346 - regulation of mitotic
                     cell cycle [Evidence IMP] [PMID 12823808]; GO_process:
                     GO:0006355 - regulation of transcription, DNA-templated
                     [Evidence IEA]; GO_process: GO:0006351 - transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /product="Smi1p"
                     /protein_id="XP_018737193.1"
                     /db_xref="GeneID:30034222"
                     /translation="MDKIFSSVQSFLHSVTTNDRYASYESQYRSSPNGRGPGASTKYR
                     RTPLGVTGNSVHDEIDGGSGSGTPPNGQNGPYGYRNSSSTSLDGPNSRNGSNTNLASS
                     STTSLNRGPYTPGMRSAQMGNGGNIPLQDYSDGIPAPPAAALSWKRIDRWVDANYPEL
                     YDQLSYPATSADLNELESDLDCTLPLEVRDSYMVHDGQERGGRPTGLFFNICILDLEG
                     IVEEWTHWKNTAIRLNNVVRSQRQQKQALSSSSAAASSSSSSQQQLRSVSASSSSSSS
                     ALVPPHMKQQAQQTPQQIQQQQQHYKNTLNWIQRQESVPEGAIQPVYAHPAWIPLAKD
                     FEGNNIAVDLAPGKKGRWGQVILFGRDFDRKYVIAPSWGAFLASFADDLEAGDHSIDE
                     DLEEGSLMFRAPNGRLIPYFDVLKSRVERSVRLARKQQGIQSPVIGSNGAGSMPGTRI
                     SRPSTPGHHGASSNSTITNGSTGTGANKANGSAAGSAPGRNLSSPKGQNLISPFQSTT
                     NLATPTSEPSESQSESKENTEELSEPAAETKTEDKPETKTDSEPATKSNDKPEPESKK
                     ESEADENPETTATESTESKKDTSASASASASDDEVDMLEDELTEVQI"
     gene            <994160..>994438
                     /gene="RPS15"
                     /locus_tag="AWJ20_2324"
                     /db_xref="GeneID:30034223"
     mRNA            <994160..>994438
                     /gene="RPS15"
                     /locus_tag="AWJ20_2324"
                     /product="ribosomal 40S subunit protein S15"
                     /transcript_id="XM_018879261.1"
                     /db_xref="GeneID:30034223"
     CDS