GenomeNet

Database: RefSeq
Entry: NC_036023
LinkDB: NC_036023
Original site: NC_036023 
LOCUS       NC_036023              46308 bp    DNA     linear   PLN 06-OCT-2017
DEFINITION  Kluyveromyces marxianus DMKU3-1042 mitochondrial DNA, complete
            genome.
ACCESSION   NC_036023
VERSION     NC_036023.1
DBLINK      BioProject: PRJNA413515
            BioSample: SAMD00067077
KEYWORDS    RefSeq.
SOURCE      mitochondrion Kluyveromyces marxianus DMKU3-1042
  ORGANISM  Kluyveromyces marxianus DMKU3-1042
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1
  AUTHORS   Lertwattanasakul,N., Kosaka,T., Hosoyama,A., Suzuki,Y.,
            Rodrussamee,N., Matsutani,M., Murata,M., Fujimoto,N., Suprayogi,
            Tsuchikane,K., Limtong,S., Fujita,N. and Yamada,M.
  TITLE     Genetic basis of the highly efficient yeast Kluyveromyces
            marxianus: complete genome sequence and transcriptome analyses
  JOURNAL   Biotechnol Biofuels 8, 47 (2015)
   PUBMED   25834639
  REMARK    DOI:10.1186/s13068-015-0227-x
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 46308)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 46308)
  AUTHORS   Yamada,M. and Kosaka,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-2011) Contact:Mamoru Yamada Yamaguchi University;
            1677-1 Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan URL
            :http://ds22.cc.yamaguchi-u.ac.jp/~jo-sei08/index.html
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP012221.
            DOGAN ; Database of Genomes Analyzed at NITE
            The database contains genome sequence data, physical maps and the
            genomic and proteomic data of the microorganisms analyzed.
            URL:http://www.bio.nite.go.jp/dogan/Top
            
            Please visit our web site.
            URL:http://www.bio.nite.go.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SPS phrap v. 0.990329
            Assembly Name         :: Kmar_1.0
            Genome Coverage       :: 8.4x
            Sequencing Technology :: Sanger ABI3730
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..46308
                     /organism="Kluyveromyces marxianus DMKU3-1042"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /strain="DMKU3-1042"
                     /db_xref="taxon:1003335"
     gene            547..1662
                     /gene="VAR1"
                     /locus_tag="CRD48_mgp01"
                     /old_locus_tag="KLMA_90001"
                     /db_xref="GeneID:34688661"
     CDS             547..1662
                     /gene="VAR1"
                     /locus_tag="CRD48_mgp01"
                     /old_locus_tag="KLMA_90001"
                     /note="mitochondrial"
                     /codon_start=1
                     /transl_table=3
                     /product="ribosomal protein VAR1"
                     /protein_id="YP_009433693.1"
                     /db_xref="GeneID:34688661"
                     /translation="MNMKNLNIIKNELNKINNNNKNQVNLLKDLLLLLNNKRLNNSLN
                     NKYIWNYLNELSNKGVKLQHLNNMNTWSSQIYKFNKNEEININIYDRLVTKLLTKLLT
                     ININNNIFKLIISKPIFEHNINKVNIKFFYYISNNNKNNNINNDNNKLINRLYNNYKL
                     SINDKLINLLNNNLNSISNILSLYYQKDVSFEPIQLKYNYMNSDILAKSLRIMNSKRS
                     LSMNKIKNLINNMPKLNDKLISQSYINNINNIMFNKYNNIITSINNNNDNDKLYNIVY
                     NNQNIDSIAMNILMYKYLVGLSIQLKGRLSSNKSISRSNTMNILKGTFNNYKTIWGNR
                     MINTYKLNYIPVNHNITNISDVNKNGKYNIKVKLNTI"
     misc_feature    691..1659
                     /gene="VAR1"
                     /locus_tag="CRD48_mgp01"
                     /old_locus_tag="KLMA_90001"
                     /note="Mitochondrial ribosomal protein (VAR1); Region:
                     VAR1; pfam05316"
                     /db_xref="CDD:283074"
     gene            2536..2620
                     /locus_tag="CRD48_mgt01"
                     /old_locus_tag="KLMA_R901"
                     /db_xref="GeneID:34688694"
     tRNA            2536..2620
                     /locus_tag="CRD48_mgt01"
                     /old_locus_tag="KLMA_R901"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:34688694"
     gene            2764..2837
                     /locus_tag="CRD48_mgt02"
                     /old_locus_tag="KLMA_R902"
                     /db_xref="GeneID:34688664"
     tRNA            2764..2837
                     /locus_tag="CRD48_mgt02"
                     /old_locus_tag="KLMA_R902"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:34688664"
     gene            2858..2930
                     /locus_tag="CRD48_mgt03"
                     /old_locus_tag="KLMA_R903"
                     /db_xref="GeneID:34688665"
     tRNA            2858..2930
                     /locus_tag="CRD48_mgt03"
                     /old_locus_tag="KLMA_R903"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:34688665"
     gene            3072..3144
                     /locus_tag="CRD48_mgt04"
                     /old_locus_tag="KLMA_R904"
                     /db_xref="GeneID:34688666"
     tRNA            3072..3144
                     /locus_tag="CRD48_mgt04"
                     /old_locus_tag="KLMA_R904"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:34688666"
     gene            3283..3370
                     /locus_tag="CRD48_mgt05"
                     /old_locus_tag="KLMA_R905"
                     /db_xref="GeneID:34688667"
     tRNA            3283..3370
                     /locus_tag="CRD48_mgt05"
                     /old_locus_tag="KLMA_R905"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34688667"
     gene            3755..3829
                     /locus_tag="CRD48_mgt06"
                     /old_locus_tag="KLMA_R906"
                     /db_xref="GeneID:34688668"
     tRNA            3755..3829
                     /locus_tag="CRD48_mgt06"
                     /old_locus_tag="KLMA_R906"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:34688668"
     gene            4300..4371
                     /locus_tag="CRD48_mgt07"
                     /old_locus_tag="KLMA_R907"
                     /db_xref="GeneID:34688669"
     tRNA            4300..4371
                     /locus_tag="CRD48_mgt07"
                     /old_locus_tag="KLMA_R907"
                     /product="tRNA-Val"
                     /db_xref="GeneID:34688669"
     gene            4516..5259
                     /gene="COX2"
                     /locus_tag="CRD48_mgp11"
                     /old_locus_tag="KLMA_90002"
                     /db_xref="GeneID:34688670"
     CDS             4516..5259
                     /gene="COX2"
                     /locus_tag="CRD48_mgp11"
                     /old_locus_tag="KLMA_90002"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome c oxidase subunit 2"
                     /protein_id="YP_009433694.1"
                     /db_xref="GeneID:34688670"
                     /translation="MFYLLNSIIMNDVPTPYGMYFQDSATPNQEGILELHDNIMFYLF
                     IILGLVSWLLFTIVRTYSKNPIAYKYIKHGQTIEIIWTIFPAVVLLIIAFPSFILLYL
                     CDEVISPAMTIKAIGLQWYWKYEYSDFINDNGETVEFESYVIPEDLLEEGQLRLLDTD
                     TSVVVPVDTHIRFVVTAADVIHDFAVPSLGIKVDASPGRLNQVSALIQREGVFYGQCS
                     EICGQSHSAMPIKIEAVSLPAFLEWLNDQ"
     misc_feature    4570..5250
                     /gene="COX2"
                     /locus_tag="CRD48_mgp11"
                     /old_locus_tag="KLMA_90002"
                     /note="cytochrome c oxidase subunit II; Provisional;
                     Region: COX2; MTH00154"
                     /db_xref="CDD:214438"
     gene            6991..7063
                     /locus_tag="CRD48_mgt08"
                     /old_locus_tag="KLMA_R908"
                     /db_xref="GeneID:34688692"
     tRNA            6991..7063
                     /locus_tag="CRD48_mgt08"
                     /old_locus_tag="KLMA_R908"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:34688692"
     gene            7066..7139
                     /locus_tag="CRD48_mgt09"
                     /old_locus_tag="KLMA_R909"
                     /db_xref="GeneID:34688671"
     tRNA            7066..7139
                     /locus_tag="CRD48_mgt09"
                     /old_locus_tag="KLMA_R909"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:34688671"
     gene            7518..8672
                     /gene="COB"
                     /locus_tag="CRD48_mgp10"
                     /old_locus_tag="KLMA_90003"
                     /db_xref="GeneID:34688672"
     CDS             7518..8672
                     /gene="COB"
                     /locus_tag="CRD48_mgp10"
                     /old_locus_tag="KLMA_90003"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome b"
                     /protein_id="YP_009433695.1"
                     /db_xref="GeneID:34688672"
                     /translation="MSFRKSNIYLNLVNSYMIDSPQPSSINYWWNLGSLLGLCLVIQI
                     ATGIFLAMHYSSNIELAFSSVEHIMRDVQGGWFIRYAHANGASFFFICMYIHIGKGLY
                     YGSYRSPRTLVWNVGVIIFVLTMAAAFLGYCLVYGQMSHWGATVITNLFSAIPLIGQD
                     IVLWLWGGFSVSNPTIQRFFAFHYLVPFIIAACVIMHLMALHTHGSSNPLGVTGNLDR
                     LPMHGYFIFKDLITVFVFLIFFSLFVFFSPNTLGHPDNYIPGNPLVTPASIVPEWYLL
                     PFYAILRSVPDKLLGVLTMFGAILILLVLPITDRSVIRGNAFKVFSKFFFFLFIANFI
                     LLGHLGECHVEVPFVTMGQIATVIYFGYFIVIVPVVSTIENVLFYVGRKN"
     misc_feature    7545..8615
                     /gene="COB"
                     /locus_tag="CRD48_mgp10"
                     /old_locus_tag="KLMA_90003"
                     /note="cytochrome b; Provisional; Region: CYTB; MTH00156"
                     /db_xref="CDD:214440"
     gene            12098..19739
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /old_locus_tag="KLMA_90004"
                     /db_xref="GeneID:34688695"
     CDS             join(12098..12484,14037..14369,17661..17840,19035..19739)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /old_locus_tag="KLMA_90004"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome c oxidase subunit 1"
                     /protein_id="YP_009433696.1"
                     /db_xref="GeneID:34688695"
                     /translation="MIERWLYSTNAKDIAVLYFIFAIFCGMAGTAMSLIIRLELAAPG
                     NQVLAGNHQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGASDMSFARLNNIS
                     FWCLPPALVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLL
                     GAINFIVTTLNMRTNGMTMHRLPLFVWAIFITAFLLLLSLPVLSAGVTMLLLDRNFNT
                     SFFEVAGGGDPVLYQHLFFIPIHPEVYILIIPGFGIISHIVSTYSKKPVFGEVSMVYA
                     MASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIYGGSIRL
                     AVPMLYAIAFLFLFTIGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAG
                     YYYWSPQILGLYYNEKLAQIQFWLIFVGANVIFLPMHFLGVNGMPRRIPDYPDAFAGW
                     NYVASIGSIIAVFSLFLYIYIVYDQLVNGLENKVNNKSVIYAKGPDFVESNQIFAINK
                     VKSSSIEFLLTSPPAVHTFNTPAVQS"
     misc_feature    join(12122..12484,14037..14369,17661..17840,19035..19598)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /old_locus_tag="KLMA_90004"
                     /note="Cytochrome C oxidase subunit I. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(12122..12124,12368..12370,12380..12382,12386..12388,
                     12407..12409,14082..14084,14094..14096,14148..14150,
                     14160..14162,14220..14222,14241..14243,14250..14252,
                     14274..14276,14301..14309,14322..14327,14331..14333,
                     14361..14363,17763..17765,17772..17774,17781..17786,
                     17796..17798)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12149..12151,12338..12340,12371..12373,12392..12394,
                     12401..12403,14118..14123,14139..14141,14151..14153)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12167..12169,12179..12181,12188..12190,12200..12202,
                     12446..12451,19332..19334,19551..19553,19560..19562)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12209..12211,12218..12223,19356..19358,19365..19370,
                     19467..19469,19521..19523)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(12263..12265,14331..14333,17733..17735,17742..17747,
                     17820..17828,17835..17837,19038..19040,19062..19064,
                     19086..19088,19095..19097,19116..19124,19158..19160,
                     19212..19217,19221..19223,19227..19241,19431..19436,
                     19446..19454,19479..19484)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(12281..12283,19266..19268,19278..19280,19404..19406,
                     19515..19517)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(12440..12442,12449..12451)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(14055..14057,14289..14300)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(14220..14222,14241..14243,14361..14363,17763..17765,
                     17772..17774,17781..17786,17796..17798)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(14331..14333,14346..14351,19224..19226,19236..19241,
                     19446..19448)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(17661..17663,17808..17813,19260..19262)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(17661..17663,17673..17675,17706..17708,17808..17813,
                     19080..19082,19089..19091)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(17811..17813,19236..19241,19446..19451)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    17826..17828
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    19119..19121
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(19263..19265,19446..19451)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(19359..19361,19530..19532)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(19467..19469,19479..19481)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp09"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     gene            14016..15371
                     /gene="aI5"
                     /locus_tag="CRD48_mgp08"
                     /old_locus_tag="KLMA_90005"
                     /db_xref="GeneID:34688690"
     CDS             14016..15371
                     /gene="aI5"
                     /locus_tag="CRD48_mgp08"
                     /old_locus_tag="KLMA_90005"
                     /codon_start=1
                     /transl_table=3
                     /product="cox1-i1 protein"
                     /protein_id="YP_009433697.1"
                     /db_xref="GeneID:34688690"
                     /translation="MYMYKIWYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFI
                     VTTLNMRTNGMTMHRLPLFVWAIFITAFLLLLSLPVLSAGVTMLLLDRNFNTSFFEVA
                     GGGDPVLYQHLFFIPIYTKLLNNNNNYLSSSFQLLTFNKDKFNFNEFYMKYKELKPNN
                     KIPNSKFLEWFIGYFENNGTFILMKKGEISVMITESSNNMINGTSLCNKEVPKDVLKY
                     IQSNLNMGNISELSKKDKTYKWYVNNRRDIILLSLIFNGNLVLPTKYGKFMIFLAKLN
                     EKLLKNNESMIILKNYCKLPTLNDSWLSGFIDGNSKFNLNINNNMNNNMNNNNNNRYG
                     TFSPIMGEKVPYNLKFKFSLSLKHNINKYVLEHILLLFNNNNNNTNNNISINNNIKDN
                     IWELSFKGLNNYLLINKYLKEYPLLTNKSYKLKNINYIINNKNNINKEEMKKLLKIIN
                     K"
     misc_feature    <14037..>14357
                     /gene="aI5"
                     /locus_tag="CRD48_mgp08"
                     /old_locus_tag="KLMA_90005"
                     /note="Heme-copper oxidase subunit I. Heme-copper oxidases
                     are transmembrane protein complexes in the respiratory
                     chains of prokaryotes and mitochondria which catalyze the
                     reduction of O2 and simultaneously pump protons across the
                     membrane. The superfamily is...; Region:
                     Heme_Cu_Oxidase_I; cl00275"
                     /db_xref="CDD:320873"
     gene            16200..17420
                     /gene="aI4"
                     /locus_tag="CRD48_mgp07"
                     /old_locus_tag="KLMA_90006"
                     /db_xref="GeneID:34688688"
     CDS             16200..17420
                     /gene="aI4"
                     /locus_tag="CRD48_mgp07"
                     /old_locus_tag="KLMA_90006"
                     /codon_start=1
                     /transl_table=3
                     /product="cox1-i2 protein"
                     /protein_id="YP_009433698.1"
                     /db_xref="GeneID:34688688"
                     /translation="MMMIMIKDSMLFRFGFFGQDGPLTFFTMLLEYNNIMEFMLLNST
                     MCWKLFLPATFTEYVKVAGNLLITIYMRPFIKNMAMKVKMLMNYNNNQQKTKNKFIFN
                     KFYLVGFSETMCGMFNYNNNNMIINNNTNMNINMSGTFSDMESEKVPMNNNNNNNNNY
                     NNHFNMSSMDNKDKFNEWLAGLIDGDGYFGITSKKYPNCEITLDLKDEKTLRQIQNKF
                     GGSIKLRNGINAIRYRLHNKEGMIKLINAVNGNIRNSKRLVQFNQVCNLLNIKVIPPI
                     DLNIDNAWFMGFFDADGTITYSLKNNNPQLTISVTNKYYMDVKYFKDVLGGNIYFDKA
                     QNGYFKWSIQSKKDILYFKDNYMKNNPSRTKKMNRLLLINTYYKLKDMKAYKEDINSC
                     LYKAWLKFNEKWNN"
     misc_feature    16734..16994
                     /gene="aI4"
                     /locus_tag="CRD48_mgp07"
                     /old_locus_tag="KLMA_90006"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:307213"
     gene            17658..18881
                     /gene="COX1"
                     /locus_tag="CRD48_mgp06"
                     /old_locus_tag="KLMA_90007"
                     /db_xref="GeneID:34688687"
     CDS             17658..18881
                     /gene="COX1"
                     /locus_tag="CRD48_mgp06"
                     /old_locus_tag="KLMA_90007"
                     /codon_start=1
                     /transl_table=3
                     /product="cox1-i3 protein"
                     /protein_id="YP_009433699.1"
                     /db_xref="GeneID:34688687"
                     /translation="MHPEVYILIIPGFGIISHIVSTYSKKPVFGEVSMVYAMASIGLL
                     GFLVWSHHMYIVGLDADTLKVLVSLNMVTYLLLFSYMPETLYYSKIMIHLFKLKYSEK
                     FMILFRNNISNNKQSASNLTSYENDKISEHRPIYNKLKDDESLGYYLSGLIEGNGNID
                     KKMISINMNYKDIKNAYYLKKMIGYGRVMKYSNTNTNTNINTNAATFSQCEKVAANMN
                     RNINIKLIFDNKNARKRVFELINGKLLGLSKYKQLLDMEYDKEFNLPIKPIVNFNLWD
                     NPWLSGFIDSKGSFIIKIIKSKMNKTDYNIKIMLKIEQEYNYLLKHVQNTLGGNIYIL
                     NKENNKTIYQYSSNNYKNAYNIIKYLSKFPPLHNSKYIHFLKWYKVYLIIQNKNHLNN
                     EGLDKIKSIKKNFRD"
     misc_feature    <17661..>17978
                     /gene="COX1"
                     /locus_tag="CRD48_mgp06"
                     /old_locus_tag="KLMA_90007"
                     /note="Heme-copper oxidase subunit I. Heme-copper oxidases
                     are transmembrane protein complexes in the respiratory
                     chains of prokaryotes and mitochondria which catalyze the
                     reduction of O2 and simultaneously pump protons across the
                     membrane. The superfamily is...; Region:
                     Heme_Cu_Oxidase_I; cl00275"
                     /db_xref="CDD:320873"
     misc_feature    order(17661..17663,17673..17675,17706..17708,17808..17813,
                     17874..17876,17883..17885)
                     /gene="COX1"
                     /locus_tag="CRD48_mgp06"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    18495..18800
                     /gene="COX1"
                     /locus_tag="CRD48_mgp06"
                     /old_locus_tag="KLMA_90007"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:307213"
     gene            23350..25045
                     /locus_tag="CRD48_mgr02"
                     /old_locus_tag="KLMA_R910"
                     /db_xref="GeneID:34688691"
     rRNA            23350..25045
                     /locus_tag="CRD48_mgr02"
                     /old_locus_tag="KLMA_R910"
                     /product="small ribosomal RNA"
                     /db_xref="GeneID:34688691"
     gene            25446..25516
                     /locus_tag="CRD48_mgt10"
                     /old_locus_tag="KLMA_R911"
                     /db_xref="GeneID:34688673"
     tRNA            25446..25516
                     /locus_tag="CRD48_mgt10"
                     /old_locus_tag="KLMA_R911"
                     /product="tRNA-Sec"
                     /db_xref="GeneID:34688673"
     gene            26099..26245
                     /locus_tag="CRD48_mgp05"
                     /old_locus_tag="KLMA_90009"
                     /db_xref="GeneID:34688674"
     CDS             26099..26245
                     /locus_tag="CRD48_mgp05"
                     /old_locus_tag="KLMA_90009"
                     /codon_start=1
                     /transl_table=3
                     /product="ATP synthase subunit 8"
                     /protein_id="YP_009433700.1"
                     /db_xref="GeneID:34688674"
                     /translation="MPQLVPFYFLNQLVYGFALVTILLVLFAQYFLPQILRLYVSRLF
                     ISKL"
     misc_feature    26099..26242
                     /locus_tag="CRD48_mgp05"
                     /old_locus_tag="KLMA_90009"
                     /note="Fungal ATP synthase protein 8 (A6L); Region:
                     Fun_ATP-synt_8; pfam05933"
                     /db_xref="CDD:283561"
     gene            26613..27383
                     /gene="ATP6"
                     /locus_tag="CRD48_mgp04"
                     /old_locus_tag="KLMA_90010"
                     /db_xref="GeneID:34688662"
     CDS             26613..27383
                     /gene="ATP6"
                     /locus_tag="CRD48_mgp04"
                     /old_locus_tag="KLMA_90010"
                     /codon_start=1
                     /transl_table=3
                     /product="ATP synthase subunit 6"
                     /protein_id="YP_009433701.1"
                     /db_xref="GeneID:34688662"
                     /translation="MLNLFITSPLDQFEIRVLMGFTSPLLDFSSLNFTTFSLYTVIVL
                     FTIIGLNTLTTNNNKIIGSKWFVSQEAIYDTILNMVKGQIGGKLWGFYFPLVYTFFFF
                     IFVSNLISMIPYSFALSAHLIFIVSLSSVVWLGATIIGLTKHGWVFFSLFVPGGTPLP
                     LVPLLVLIELLSYFARAISLGLRLSSNVLSGHLLLIILGGLLFNLMSISIITFVFGFI
                     PGIGLLAIVVLEFAISVIQAYVWAILTSSYLKDALYLH"
     misc_feature    26688..27371
                     /gene="ATP6"
                     /locus_tag="CRD48_mgp04"
                     /old_locus_tag="KLMA_90010"
                     /note="ATP synthase subunit 6 (eukaryotes),also subunit A
                     (prokaryotes); Region: ATP_synt_6_or_A; TIGR01131"
                     /db_xref="CDD:273458"
     gene            29735..30544
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /old_locus_tag="KLMA_90011"
                     /db_xref="GeneID:34688689"
     CDS             29735..30544
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /old_locus_tag="KLMA_90011"
                     /codon_start=1
                     /transl_table=3
                     /product="cytochrome c oxidase subunit 3"
                     /protein_id="YP_009433702.1"
                     /db_xref="GeneID:34688689"
                     /translation="MTHLERSKHQQFPFHLVAPSPWPIVVSFSLMALALSLALTMHGY
                     VGHMYLIYLSLITVTYSATLWFRDIIAEATYLGDHTIAVRKGINLGFLLFVVSEILIF
                     AGLFWAYFHSAMSPDITLGGVWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHGLV
                     AGNRKIALSGLFITFWLIVIFVTCQYIEYTNATFTITDGVYGSVFYAGTGLHFLHMVM
                     LAAMLGVNYWRMRNYHLTSTHHVGYETTIIYAHVLDIIWLFLYIVFYWWGV"
     misc_feature    29771..30541
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /old_locus_tag="KLMA_90011"
                     /note="Cytochrome c oxidase subunit III; Region: COX3;
                     pfam00510"
                     /db_xref="CDD:278911"
     misc_feature    order(29924..29926,29933..29938,29945..29947,29954..29962)
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(29927..29932,29939..29944,29951..29953,29969..29971,
                     30002..30007,30014..30016,30398..30400,30419..30421,
                     30455..30460)
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(29978..29980,29987..29992,30023..30025,30032..30034,
                     30044..30049,30065..30067,30329..30334,30341..30343,
                     30353..30355)
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    30113..30115
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(30137..30145,30194..30196,30272..30274,30302..30310,
                     30323..30331)
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    30230..30232
                     /gene="COX3"
                     /locus_tag="CRD48_mgp03"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            32021..32676
                     /locus_tag="CRD48_mgp02"
                     /old_locus_tag="KLMA_90012"
                     /db_xref="GeneID:34688693"
     CDS             join(32021..32182,32611..32676)
                     /locus_tag="CRD48_mgp02"
                     /old_locus_tag="KLMA_90012"
                     /codon_start=1
                     /transl_table=3
                     /product="ATP synthase subunit 9"
                     /protein_id="YP_009433703.1"
                     /db_xref="GeneID:34688693"
                     /translation="MQLVLAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLK
                     DTLFPFAILGALSEATGLFCLMISFLLLYAV"
     misc_feature    join(32024..32182,32611..32673)
                     /locus_tag="CRD48_mgp02"
                     /old_locus_tag="KLMA_90012"
                     /note="ATP synthase subunit C; Region: ATP-synt_C;
                     cl00466"
                     /db_xref="CDD:320987"
     gene            37942..41270
                     /locus_tag="CRD48_mgr01"
                     /old_locus_tag="KLMA_R912"
                     /db_xref="GeneID:34688663"
     rRNA            37942..41270
                     /locus_tag="CRD48_mgr01"
                     /old_locus_tag="KLMA_R912"
                     /product="large ribosomal RNA"
                     /db_xref="GeneID:34688663"
     gene            41940..42011
                     /locus_tag="CRD48_mgt11"
                     /old_locus_tag="KLMA_R913"
                     /db_xref="GeneID:34688675"
     tRNA            41940..42011
                     /locus_tag="CRD48_mgt11"
                     /old_locus_tag="KLMA_R913"
                     /product="tRNA-Met"
                     /db_xref="GeneID:34688675"
     gene            42252..42323
                     /locus_tag="CRD48_mgt12"
                     /old_locus_tag="KLMA_R914"
                     /db_xref="GeneID:34688676"
     tRNA            42252..42323
                     /locus_tag="CRD48_mgt12"
                     /old_locus_tag="KLMA_R914"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:34688676"
     gene            42718..42789
                     /locus_tag="CRD48_mgt13"
                     /old_locus_tag="KLMA_R915"
                     /db_xref="GeneID:34688677"
     tRNA            42718..42789
                     /locus_tag="CRD48_mgt13"
                     /old_locus_tag="KLMA_R915"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:34688677"
     gene            42800..42881
                     /locus_tag="CRD48_mgt14"
                     /old_locus_tag="KLMA_R916"
                     /db_xref="GeneID:34688678"
     tRNA            42800..42881
                     /locus_tag="CRD48_mgt14"
                     /old_locus_tag="KLMA_R916"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:34688678"
     gene            43175..43247
                     /locus_tag="CRD48_mgt15"
                     /old_locus_tag="KLMA_R917"
                     /db_xref="GeneID:34688679"
     tRNA            43175..43247
                     /locus_tag="CRD48_mgt15"
                     /old_locus_tag="KLMA_R917"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:34688679"
     gene            43277..43351
                     /locus_tag="CRD48_mgt16"
                     /old_locus_tag="KLMA_R918"
                     /db_xref="GeneID:34688680"
     tRNA            43277..43351
                     /locus_tag="CRD48_mgt16"
                     /old_locus_tag="KLMA_R918"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:34688680"
     gene            43408..43480
                     /locus_tag="CRD48_mgt17"
                     /old_locus_tag="KLMA_R919"
                     /db_xref="GeneID:34688681"
     tRNA            43408..43480
                     /locus_tag="CRD48_mgt17"
                     /old_locus_tag="KLMA_R919"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:34688681"
     gene            43493..43564
                     /locus_tag="CRD48_mgt18"
                     /old_locus_tag="KLMA_R920"
                     /db_xref="GeneID:34688682"
     tRNA            43493..43564
                     /locus_tag="CRD48_mgt18"
                     /old_locus_tag="KLMA_R920"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:34688682"
     gene            43965..44036
                     /locus_tag="CRD48_mgt19"
                     /old_locus_tag="KLMA_R921"
                     /db_xref="GeneID:34688683"
     tRNA            43965..44036
                     /locus_tag="CRD48_mgt19"
                     /old_locus_tag="KLMA_R921"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:34688683"
     gene            44205..44285
                     /locus_tag="CRD48_mgt20"
                     /old_locus_tag="KLMA_R922"
                     /db_xref="GeneID:34688684"
     tRNA            44205..44285
                     /locus_tag="CRD48_mgt20"
                     /old_locus_tag="KLMA_R922"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:34688684"
     gene            44341..44412
                     /locus_tag="CRD48_mgt21"
                     /old_locus_tag="KLMA_R923"
                     /db_xref="GeneID:34688685"
     tRNA            44341..44412
                     /locus_tag="CRD48_mgt21"
                     /old_locus_tag="KLMA_R923"
                     /product="tRNA-His"
                     /db_xref="GeneID:34688685"
     gene            44526..44598
                     /locus_tag="CRD48_mgt22"
                     /old_locus_tag="KLMA_R924"
                     /db_xref="GeneID:34688686"
     tRNA            44526..44598
                     /locus_tag="CRD48_mgt22"
                     /old_locus_tag="KLMA_R924"
                     /product="tRNA-Met"
                     /db_xref="GeneID:34688686"
ORIGIN      
        1 tgaatcccat taagaagaag tattatatta aaattaattc tcgccaaatt accactttaa
       61 atagtggtaa tttggcggat tatacataca tacatacatt tatatataca tatatataaa
      121 tatataaaaa tatataaaaa aatataattt atattaataa atagatatat tatatatatt
      181 cgccaaaatc ccactattag tgggattttg gcgtaataat attattcttt tattataaaa
      241 atatgtattt ttctttttat ataaataaaa gtttaaatat atattatata ttaaaatata
      301 tattatatgt taaaatatat attatatata aataatataa cgccaaaatc cctctttaag
      361 agggattttg gcgtataaga ttataattat aattattaaa attttaataa tttttattaa
      421 tttattaatt ataagtagta attatagaca taaatgttaa attattaaat aataatttat
      481 ctaataatat atatatatat ataatttata tatatatgat attatttcta ttaatatata
      541 tattaaataa acatgaaaaa cttaaacatt attaaaaatg aattaaataa aattaataat
      601 aataataaaa atcaagtaaa tttattaaaa gatttattat tattattaaa taataaaaga
      661 ttaaacaact cattaaataa taagtatatt tgaaattatt taaatgaatt aagtaataaa
      721 ggtgtaaaat tacaacattt aaataatatg aatacttgat cttcacaaat ttataaattt
      781 aataaaaatg aagaaattaa tattaatatt tatgatagat tagttactaa attattaact
      841 aaattattaa ctattaatat taataataat atctttaaat taattatttc aaaacctatc
      901 tttgaacata atattaataa agttaatatt aaattctttt attatatttc taataataat
      961 aaaaataata atattaataa tgataataat aaattaatta atagattata taataattat
     1021 aaattatcaa ttaatgataa attaattaat ttattaaata acaatttaaa tagtattagt
     1081 aatattttat cattatatta tcaaaaagat gtatcatttg agcctattca attaaaatat
     1141 aattatatga atagtgatat tttagctaaa tctttaagaa ttatgaattc aaaaagaagt
     1201 ttatcaatga ataaaattaa aaatttaatt aataatatgc ctaaattaaa tgataaatta
     1261 attagtcaat catatattaa taatattaat aatattatgt ttaataaata taataatatt
     1321 attacatcta ttaataataa taatgataat gataaattat ataatattgt atataataat
     1381 caaaatattg atagtattgc tatgaatatt ttaatgtata aatatttagt aggtttatca
     1441 attcaattaa aaggtagatt atcatcaaat aaatctattt caagatcaaa tactatgaat
     1501 attttaaaag gtacattcaa taattataaa actatttgag gtaatagaat gattaataca
     1561 tataaattaa attatattcc ggtaaatcat aatattacta atatttctga tgttaataaa
     1621 aatggtaaat ataatattaa agttaaatta aatactattt aaattattat taattaatta
     1681 attattataa ataaatacat aaatattctt tttatataat aataatagta agatttacta
     1741 ataataatta ttattattat ggctcgtcca ctgctttaaa gcagtggacg agccatatat
     1801 atatatatta tagatacata taatctttta ttctcttttt aaattatatt aaacccgcga
     1861 ctttttcaca attaatgtga aaaagtcgcg gctaatgtta attcttacta ataatataaa
     1921 tattatataa aatattatat aaattatata atatataatt atataaaata aatttatata
     1981 tacatatata tataaccgcc acttttcacc cataatgggt gaaaagtggc ggataatatt
     2041 tatttaatac atattattat ttgttaaata ttatatataa taatatattc tcttatttaa
     2101 ttaatataat tattattatt taatatatat ttataataat atatataata atatatatat
     2161 ctaatatata tagatccacc gaaaccatca ataaaatatt gatggtttcg gtgtatacaa
     2221 atattaatat ttactaataa taataattat ttataataat tataatattt atttatataa
     2281 aaatgaacat attaattata ttattcgcca aaatccccta ttaatagggg attttggcga
     2341 ttattatata tacataaatt tttaaattat tattatataa taatattacc cgccactttt
     2401 tcacattgtg aaaaagtggc ggggcaaata tttaatatta tttatatata aaatataagt
     2461 aaattagaag attatatatt aatatataat atataataaa taaaaataaa ataaaataaa
     2521 ataaaataaa atttaggagg gatctccaat gttggtaatt ggagttgagc tgtaaactca
     2581 atgactgtgt tcttcatagg ttcgattcct attcccttca atataaatat ataaaatata
     2641 taaaatataa aaatatataa atatttatta aagccccatt ttacttattt aataagtaaa
     2701 atggggcata atcatatatt ttattataaa taaataatat attaaaatat atatatatta
     2761 taaagttttt atagcttaat ggttaaagct tctcactgtt aatgagatga tataggttca
     2821 attcctatta aaaactatta ttatatttat taataaaggg gttatagtta aatttggtag
     2881 aacgaatgct ttgcatgcat ttaatatgag ttcaagtctc attaactcca tatatatata
     2941 tatatatata tttatataat ttataataat taattataat taatatatat cccgaaatta
     3001 cacttagtgt aatttcggga tttataaata gtattaatat tataatataa taatattata
     3061 tatattaaaa agaaactata attcaatcgg ttagaatagt attttgataa ggtaccaata
     3121 taggttcaag tcctattagt ttcaatatta aatttattta taataccgca ttaattacct
     3181 atttaaatag gtaattaatg cggtcaatta attaattaat aataatataa ttattattat
     3241 tatttatatt tattatatta tattatatat atatttatat aatggatggt tgactgagtg
     3301 gtttaaggtg taatacttga gatattataa gtcttttagg cttcgtaggt tcaaatccta
     3361 caccattcga atattatatt atattataat aaattatatt atattatttt ttgttataaa
     3421 aatttatatt attattataa tccgcataat accacttaat aagtggtatt atgcggatat
     3481 atatatttat atatatatta tatatatatt aaatacatat atttattatt aataatataa
     3541 ttattattat tattattatt atttatttat tataataata aaattatata taatatatct
     3601 ttacaatatt tctctatata tttttatata tatttcttta tatatttatt aataatataa
     3661 taatagatcc gcgacttttt ttataaaaaa gtcgcgggat gttaaaagta ccataatatt
     3721 tatttaatta ttattattat tattattatt ataaaggaaa tgttgtttaa aggttaaact
     3781 gttagattgc aaatctatac atttagagtt cgattctcta catttcttta aatatattaa
     3841 atattatatt aaatattata tatatatata ttgcccgcat aaatactact ataaagtagt
     3901 atttatgcgg gctaggctat ttaatttaat tttatattat taaaatataa tataattata
     3961 ttttatatta taagtatata ttatagtata tattatagta tatatatata aaaaatatat
     4021 ataaaaagta tatattaata ataatatatc ttaaatcccg ccattcattt gaaaaatgaa
     4081 tggcgggtta tatttatatt atatataaat aataatcaaa taaattattt attattatta
     4141 ttataataaa tattatataa tattatataa taaaaataat attatattat taatattaat
     4201 actaatattg gcactttttc atattataaa tatgaaaaag tgccttatat atatatatat
     4261 ataattatat atttttaatt ataagtaagt agaattaaat agagattagc ttaattggca
     4321 gagcattcgt tttacacgcg aaggacatga gttcaaatct cgtatctcta atataaaaat
     4381 attaatttaa taataataaa ttattatatt aataagtaat ttatatatat tatatatata
     4441 aataaagaaa atattaaaaa tattatatta atcaaagtaa tatcctttta tatagtgata
     4501 taaatatata attagatgtt ttatttatta aattcaatta ttatgaatga tgtaccaaca
     4561 ccttatggta tgtatttcca agattcagct acacctaatc aagaaggtat tttagaatta
     4621 catgataata ttatgttcta tttatttatt attttaggtt tagtatcttg attattattt
     4681 actattgtaa gaacatatag taaaaaccct attgcatata aatatattaa acatggtcaa
     4741 actattgaaa ttatttgaac aattttccct gcagtagtat tattaattat tgctttccct
     4801 tcattcattt tattatattt atgtgatgaa gttatttctc ctgctatgac tattaaagct
     4861 attggtttac aatgatattg aaaatatgaa tactcagatt tcattaatga taatggtgaa
     4921 acagtagaat ttgaatcata tgtaattcca gaagatttat tagaagaagg tcaattaaga
     4981 ttattagata ctgatacatc agtagtagta cctgttgata cacatattag atttgtagta
     5041 acagcagctg atgttattca tgattttgct gtacctagtt taggtattaa agttgatgct
     5101 tcaccaggta gattaaatca agtatctgct ttaattcaaa gagaaggtgt attctatgga
     5161 caatgttcag aaatttgtgg acaatcacat tcagctatgc ctattaaaat tgaagctgta
     5221 tcattacctg ctttcttaga atgattaaat gatcaataag ttagtattac aggtatattt
     5281 taaatattct tttataataa taataatata ttattattat atattataat aattaataaa
     5341 aattgattaa ttaattataa tccgccaaaa taccattaaa tggtattttg gcggaattgt
     5401 atatatatat atttttatat tatatgtatt atattatata ttatatatat ttttatatta
     5461 taatatatat tatatattta tttatcaata ttatgtaata tattttatat ataaaatcct
     5521 taaagaatat aataatccgc caaaatacca tttaatggta ttttggcgga ataatagatt
     5581 attatatatt ttaatattgc actggttgag gcttatttta ctcttttatt tatattatta
     5641 ttattataaa taatttttat ttaaataaga taatccgcca aaataccatt aaatggtatt
     5701 ttggcggaat tgtatatata tatattttta tattatatgt attatatata ttatatatat
     5761 ttatatatta tatatattat atattaactc ctattaggtc gccgccatta tatttatata
     5821 atggcggcga cattattatt attattatta taattattat tataataatt cttatttatg
     5881 aaacttctaa agaatataat aatccgccaa aataccaaag gtattttggc gggataatat
     5941 taaacattat tttttattta aatattcata agaaaattaa taagagaatc cgccaaaata
     6001 ccattataat ggtattttgg cgggataata tattattata tattttaata ataaataaat
     6061 taattaatta ataaataata atacaataat tatttattag tctcgcactg gttgaggctt
     6121 atcttacttt aataaatata aatcccgcga cttttttata aaaaaagtcg cgggtgagga
     6181 aaaaagggtt aatatatata tataatatat ataaatatta ttattaatta aattgcacag
     6241 gctgaagctt atcttccctt ttttaccttt gaaaaaaggt aaaaaaggga tatatttata
     6301 tattatttat tattattatt tttattataa ataattttta ttattattat ttttattatt
     6361 tataattatt attatatata tattgcatat ataatacaat aatattatat taatattcgc
     6421 caaaatacca ttataatggt attttggcgg ataataaatt atataattat acatttttat
     6481 aataaataaa taaataataa tcattattat aaagttgcac tagttgaagc tatatattat
     6541 tattataatt tttataatat aataattatt aataatttaa taaaaaaaat aatacaataa
     6601 ttataatccg ccaaaatacc atttaatggt attttggcgg atctaatata taatgtttaa
     6661 ttaattatat ttaatataat ttttatataa ttaattatta ttataataat aattatatat
     6721 atatatattg tatatataat acaataatat tatattaata ttcgccaaaa taccataata
     6781 tggtattttg gcgaagaata tatatgtatt agtatatatt taataatatg attatatatt
     6841 tttatataat atacttaaaa attataaaat aaattaaatt aaattatatt atattatatt
     6901 atataaggca ctttttcaca tttaaatgtg aaaaagtgcc attaatatat ttaatagatt
     6961 atttatatat taacaatata agttaatata gttatattag cttaattggt agagcattcg
     7021 ttttgtaatc gaaaggtttg gagttcgagt ctctaatata acatatgacc ttatcgtcta
     7081 atggttacga catcatctct tcatgttgaa aatatgggtt caattcccat taaggttatt
     7141 tattataatt attattaatt ataataataa tataaataat atataaatta tttatatatc
     7201 ctttttatat ttaaatataa ttatggattt gataataata ataaataaat aaataaattt
     7261 tattattatt atatataatt attatatata ttgcatatat aatacaataa tattatatta
     7321 tataataaaa aataatgtta atagatatat aatatattat tataaataaa ttatattacc
     7381 gcgattcctt taataaagga atcgcggtta ttaataatta gatattttat aataaatata
     7441 tatatattat aaatatatat ttttatatat attttattaa gattaagatt catataatat
     7501 aatatataaa ttaaattatg tcatttagaa aatctaatat ttatttaaat ttagtaaata
     7561 gttatatgat tgattctcca caaccttcat caattaatta ttgatgaaat ttaggatcat
     7621 tattaggatt atgtttagta attcaaattg caacaggtat ttttttagca atgcattatt
     7681 catctaatat tgaattagca ttctcatcag ttgaacatat tatgagagat gttcaaggag
     7741 gttgatttat tagatatgct catgctaatg gtgcatcatt cttctttatt tgtatgtata
     7801 ttcatattgg taaaggatta tattatggat catatagatc acctagaaca ttagtatgaa
     7861 acgttggtgt tattattttt gtattaacaa tggcagctgc attcttagga tattgtttag
     7921 tatatggaca aatgagtcat tgaggtgcta cagttattac taatttattc tcagctattc
     7981 cattaattgg acaagatatt gtattatgat tatgaggagg tttctcagta tctaacccta
     8041 caattcaaag attctttgca ttccattact tagtaccatt tattattgct gcttgtgtaa
     8101 ttatgcattt aatggcatta catacacatg gttcatcaaa tccattaggt gtaacaggta
     8161 atttagatag attaccaatg catggatact ttattttcaa agatttaatt acagtatttg
     8221 tattcttaat tttcttctca ttatttgtat tcttctcacc taatacatta ggacatcctg
     8281 ataactatat tccaggtaat ccattagtaa caccagcatc aattgtacct gaatgatact
     8341 tattaccatt ctatgctatt ttaagatcag tacctgataa attattagga gtattaacaa
     8401 tgtttggtgc tattttaatt ttattagtat tacctattac agatagaagt gttattagag
     8461 gtaatgcttt caaagtattc tctaaattct tcttcttctt atttattgct aatttcatct
     8521 tattaggaca tttaggtgaa tgtcatgtag aagttccatt tgttactatg ggacaaattg
     8581 ctacagttat ttacttcggt tactttattg taattgtacc agttgtatca acaattgaaa
     8641 atgtattatt ctatgtaggt agaaaaaatt aataataaat aaattaatta attaaatatt
     8701 cttttataat atattataat atatattttc tcttattaaa tataatattt tataataaaa
     8761 tattatgtaa gagaatatta tatctattta tatctggcac tttttcatac attttgtatg
     8821 aaaaagtgcc attattattt attattatta ttattatatt tatattatat attatatatt
     8881 atatattata atattataat attttatatt aaatattagc cgccactttt tcacactaat
     8941 tgtgaaaaag tggcgggttt agtatattat aattattatt ataattatta ttaatataat
     9001 gattaataaa taatgataaa ttataaattc gccaaattcc caaagggaat ttggcgaata
     9061 tgtattaaag atatatattt tatatttatt tttatatatt atatatatat aaatattttt
     9121 caatatgaaa tataaatata ttttatatat tattattatt attaaaatac taatctattt
     9181 atattatatt atatatatta tgtcgccgcc gaaggcggcg acatataata ttatatttta
     9241 tattatatat tatatattat atattatttt ataatattat aattattatt attataatta
     9301 ttctaattat tattattaat ataaataata aataatgata aattataaat tcgccaaatt
     9361 ccctttggga atttggcgag tatgtattat atatatatat atatatattt atttattata
     9421 tatttatttt aattatatat taatatttaa caatatagaa tgtaaatata tttatatatc
     9481 tggcactttt tcatatattt tatatgaaaa agtgccatta tttattattt attatttatt
     9541 atttattatt tattatttat tatttattat ttattattgt tattattatt attatattta
     9601 tgttttatat tatatatatt ataatatatt atatattatt atataatatt ataattttaa
     9661 ttattataaa tataattaat aaatataaat tcgccaaatt accaaaggta atttggcgag
     9721 tatctttcta ttaaagatat atattttata tttatttata tatattatat aaatattttt
     9781 aaataatatt aatctattta tattattata ttatatttat atattgtatt tttattataa
     9841 tatttattat tataataaat aataaataat ttctaattcg ccaaattccc tttgggaatt
     9901 tggcgagtat gtattaaata tatatttatt taatatatat ttatatatta tgaaatataa
     9961 atatatttta tatattatta ttattattaa ttaattatta tatattatct aatataatat
    10021 attatataac ataatttcgc caaaatcccc tttttaaaag gggattttgg cgaataatca
    10081 tatatatcat attattatta ttaattatta tggagaattt atatatataa ataataatat
    10141 tttattatta ttattataaa tttatttaaa ataaaatatt atatatatat gtataattcg
    10201 ccaaattacc tttggtaatt tggcgaatat tattcttatt attcttatta ttaatattat
    10261 tattttaatc tattaagtga taaattatat attattaata taataattaa ataaattata
    10321 attaataaat attatattat attatattat ataatataaa caatataatt acgccaaaat
    10381 gcctattaaa aggcattttg gcgtataatt aattatatat attatttttc ttttataaaa
    10441 tatatatttt tatttaaaat taataatata ttaaatattg ttctataata gaatttattc
    10501 attatatata atattttatt tattatatat aacgccaaaa tgccaaaggc attttggcgt
    10561 ataataaata tatatattat tattataact aattaatatt attattaata ttataattaa
    10621 tcttttactt aattaattaa tgtaatataa tgtaattaat attattttta tatataaaga
    10681 ataataaaaa tatgtttaat atatattatt attatctaat accgcctttt aatcctattc
    10741 tattaatagg attaaaaggc gaataattta ttttatttaa ggatatttta tatattatta
    10801 taattaattt attactaatt ataattttta ttatatatat aataaaatat atatattata
    10861 tatctattat agataaataa ataaatatat atatatataa cgccaaaatt cctttggaat
    10921 tttggcgtat aatctaatta atattattat tatcataatt attattataa ttatattata
    10981 ttatattatc aattttatta ttatattatt ttatattata ttaataatat attataaaaa
    11041 attattaaat atatatatac gccaaaattc caaaggaatt ttggcgaata ctattattga
    11101 tatttattat tattaataat attatatatt tttataaatt attattttaa attagaagtt
    11161 aatatattaa tataacatta ttatatatat aatttatata attatatatc cgccaaaatt
    11221 cctttggaat tttggcaatt tttattcttt acctaagaat atatatctta aaaataatat
    11281 tattatatta ttaataataa ataattataa ataaaaagga taaataaata aataataatc
    11341 cgccaaaatt cctttggaat tttggcggat aatatattat atgatatata tttaatttat
    11401 aaagaatatt atatttaata ttatttaata tatatatatg tatgtaaata aatatataaa
    11461 tatataaata acccgccaaa ttaccacttt tagtggtaat ttggcgggat ttaatttaat
    11521 acaatattat tattataatt aatttaatac aatattatta ttataattaa tttaatacaa
    11581 tattattatt tatattaatt taatacaata ttattattta tattatattt tttatattat
    11641 tatatataaa taagacataa ataaatatat ataacgccaa aattccaaag gaattttggc
    11701 gaataatctt attattatca tatatattat atatataatt ataattattt atattatttt
    11761 atattataaa taataatatt atttaaaaga aatataaaat atacgccaaa attccaaagg
    11821 aattttggcg aataatataa tatattataa tataatataa tattaatgga aaatatcaat
    11881 aataataata ttattatata atttttaatt tataagtaga atatattttt ataaaatgat
    11941 attcctaatt atataatata taaatataat atatattata tataacttta aaaatagaca
    12001 agaaatatta tgtaaaatta caaaataata taactaatct taaatatttt tattaaatat
    12061 gttatagata tttaaataaa agtataaaat taaatttatg atcgaaagat gattatattc
    12121 aacaaatgct aaagatattg cagtattata ctttatcttc gctattttct gtggtatggc
    12181 tggtacagct atgtcattaa ttattagatt agagttagct gctcccggta atcaagtatt
    12241 agccggaaat catcaattgt tcaacgtctt agtagttggg cacgccgtat tgatgatttt
    12301 cttcttagta atgcccgcat taattggagg ttttggtaac tatttattac ctttaatgat
    12361 tggtgcatca gatatgtctt ttgctagatt aaacaatatt tcattctgat gtttaccacc
    12421 tgctttagta tgtttagtaa catcaacttt agtagaatca ggtgcaggta caggatgaac
    12481 tgtattaatt ttattaatta tggaggaaat atgcagtttt aaaatgtcac tcgatgcgtg
    12541 aaaaatctta tataataata ataaatatat tattattata tgtttattaa actactcaat
    12601 tattttgcca atttttcata taaaatgaaa aattggcaaa tattttaaat tagtaaaaat
    12661 gtttaatatt atagatcaat atgccaggat aattttattt atctttcaga gactcaatgt
    12721 gacaaaaatt aaaaattatt caactataaa aactaataaa agttatttta atataaatga
    12781 atgattagta ggtttaacag atgctaatgg tttatttatt attaataata ataataataa
    12841 taataattta atatttaaaa ttacagtatt aaaaaataat gctcaattat tatataaaat
    12901 taaatcttat ttaaaaattg gttctattat ttataataat aatactaata aagtatctta
    12961 tattattaaa aataaaaacc atttattaaa tattattatt cctatttttg ataattattc
    13021 attattaaca tataataaaa aaatagatta tttaaaattt aaagaatatt tattattaaa
    13081 taataataat aataataata atgagaatcc cgcggaatat tctagttata tgactagaaa
    13141 ttccgcggga tttattaata tgaataataa tattaatatt aataataata ataatcatat
    13201 taatcaaatt ataactaaat cttgattaat tggttatatt gaaataaata attgttttta
    13261 tattaataaa tctttaaatt atgtacatat atttaattta attataaata aaaatgatta
    13321 taatatttta tataatatta aattattatt aaatattaag aatgaaatta tttatgaaaa
    13381 taatatatat aaattagaaa caataaataa tattgatatt gataatatta ttaaatattt
    13441 taaatttaat aatcataaat ctagattttt aggtttaaaa tcatatgaat ttaaaatttg
    13501 atgaagatca ttttataaat ataaaaataa taaaaataat tctaaattat tatttattaa
    13561 aaatttatta aataaagtaa ataattttta attttaaggt atagtccaaa caatatagta
    13621 atatattgaa atattattaa ttagattaat taataatata tatatatata tatatattta
    13681 tataatttat attaatatat ataataataa tataatataa tgtataatat tataataata
    13741 taatcccgcc actttttata aaaagtggcg ggtaagatta atgaataaat taattaatta
    13801 atcgccaaaa ttccaaagga attttggcga atataaatat atatcaaaat atatataata
    13861 taatatatat ataatatata tataatatta aaataataat attaatatat aatattataa
    13921 taaaaatatt aatataattc attaattaat taatcgccaa aattccaaag gaattttggc
    13981 gaatattaat tataataatt atatttttta tataaatata tatatataaa atttgatatc
    14041 ctccattatc ttcaatccaa gcccattcag gacctagtgt tgatttagct atttttgctt
    14101 tacatttaac ttctatttct tcattattag gtgctattaa tttcattgta actactttaa
    14161 atatgagaac aaatggtatg acaatgcata gattaccatt attcgtatga gctattttca
    14221 ttacagcttt cttattatta ttatcattac cagtattatc agctggagtt actatgttat
    14281 tattagatag aaacttcaat acttcattct tcgaagtagc tggtggtggt gatccagtat
    14341 tatatcaaca cttgtttttt atcccaattt atactaaatt attaaataat aataataatt
    14401 atttatcttc ttcttttcaa ttattaacat ttaataaaga taaattcaat tttaatgaat
    14461 tttatataaa atataaagaa ttaaaaccta ataataaaat tcctaattct aaatttttag
    14521 aatgatttat tggttatttt gaaaataatg gtacatttat tttaataaaa aaaggagaaa
    14581 tttctgtaat aattacagaa tcttctaata atatgattaa tggcacttct ttatgtaata
    14641 aagaagtgcc aaaagatgta ttaaaatata ttcaatctaa tttaaatata ggaaatatta
    14701 gtgaattatc taaaaaagat aaaacatata aatgatatgt taataataga agagatatta
    14761 ttttattatc tttaattttt aatggtaatt tagtattacc tactaaatat ggtaaattta
    14821 taattttttt agctaaatta aatgaaaaat tattaaaaaa taatgaatct ataattattt
    14881 taaaaaatta ttgtaaatta cctactttaa atgattcttg attatcagga tttattgatg
    14941 gtaatagtaa atttaattta aatattaata ataatataaa taataatata aataataata
    15001 ataataatag atatggcact ttttctccta ttataggaga aaaagtgcct tataacttaa
    15061 aatttaaatt ctctttatct ttaaaacata atattaataa atatgtatta gaacatattt
    15121 tattattatt taataataat aataataata ctaataataa tattagtatt aataataata
    15181 ttaaagataa tatttgagaa ttatcattta aaggtttaaa taattattta ttaattaata
    15241 aatatttaaa agaatatcca ttattaacta ataaatctta taaattaaaa aatattaatt
    15301 atattattaa taataaaaat aatattaata aagaagagat aaaaaaatta ttaaagatta
    15361 ttaataaata atcctgtgtc tcgccctctg cttaagcaga gggcgagacc tcaggtcagt
    15421 ataaataaaa atatttgaaa caaaggaaat agtttaacgt aagttaatta taaataatat
    15481 aacagtgtta aaaaaaagat tatattactt tttatatata taaatatata aaaagaataa
    15541 atattatata taatatatat atatatatat ataattaata tattaattga ataaaaatat
    15601 ataataaata atattatatt ataatttata tattattggc ccttatcttt ccttatttaa
    15661 aggaaagata agggcccaat taactattaa ttaattaatt ataataataa tttataatta
    15721 ttattataat ttttaatata tatatattat ttaatatact atttcctagt attataaata
    15781 aatatttata atgcaacatt gatggtacgg tcaacaatct ctcaaattta gaccgtcggt
    15841 tttatataat aataattatt attatatatg atcgctacag actgcttcat caatgggtga
    15901 tatatatata tatatattaa tatatatatt gcttaatgta cagtcggaat cacttattaa
    15961 tatataaaaa ttatatatat aaaattaaat aaatatataa taaaaaataa tatgaataaa
    16021 taatatatat atgggctttc cctttgctta ataagcaaag ggaaagcctt taataaaata
    16081 tattatatta atataatatc atatatgata ttatatttca ttatttatta tataatatat
    16141 ataattatat taataaggtc atatattttt atatgagata tatactatag agtcaattta
    16201 taataataat tataattaaa gatagtatat tatttagatt tggattcttc ggtcaagatg
    16261 gccccttaac attctttaca atattattag aatataataa tattatagag tttatattat
    16321 tgaattccac tatatgctgg aaattattct taccagccac ttttacagaa tatgtaaaag
    16381 tggcaggaaa tttattaatt actatttata taagaccatt tattaaaaat atggccataa
    16441 aagttaaaat attaataaat tataataaca atcagcagaa aaccaaaaat aaatttattt
    16501 ttaataaatt ttatttagta ggattctcag agactatatg tggaatattt aattataata
    16561 ataataatat gattattaat aataatacta atataaatat taatatgtct ggcacttttt
    16621 cagatataga atctgaaaaa gtgcctataa ataataataa taataataat aataattata
    16681 ataatcattt taatatatct tctatagata ataaagataa atttaatgaa tgattagctg
    16741 gtttaattga tggagatgga tattttggaa ttacaagtaa aaaatatcct aattgtgaaa
    16801 ttacattaga tttaaaagat gaaaaaacct taagacaaat tcaaaataaa tttggtggat
    16861 caattaaatt aagaaatgga attaatgcta ttagatatag attacataat aaagaaggta
    16921 taattaaatt aatcaatgct gttaatggta acattagaaa tagtaaaaga ttagttcaat
    16981 ttaaccaagt atgtaattta ttaaatatta aagttattcc acctattgat ttaaatattg
    17041 ataatgcttg atttataggt ttttttgatg ctgatggaac aattacttat tcattaaaaa
    17101 ataataatcc tcaattaaca atttcagtaa ctaataaata ttatatagat gtaaaatatt
    17161 ttaaagatgt attaggaggt aatatttatt ttgataaagc tcaaaatggt tattttaaat
    17221 gatcaattca aagtaaaaaa gatattttat attttaaaga taattatata aaaaataatc
    17281 cttcaagaac aaaaaaaata aatagattat tattaattaa tacatattat aaattaaaag
    17341 atataaaagc atataaagaa gatattaatt cttgtttata taaagcttga ttaaaattta
    17401 atgaaaaatg aaataattaa ataaagagat agtccaaatt tattattata aataattctt
    17461 ttatatataa tagtaataga taataatata tatagatata tattggcttt tttccactta
    17521 ataaagtgga aaaaagccat ttagaaatat attctattct tctataaggt cgccgccatt
    17581 atttataatg gcggcgacat tatattaata ttaatattat attatattaa aatattatat
    17641 attatttata ataataaatg catccagaag tttatatttt aattatccct ggttttggta
    17701 tcattagcca tattgtttca acatattcta aaaaaccagt attcggtgaa gtttcaatgg
    17761 tttatgctat ggcttcaatt ggtttattag gattcttagt ttgatcacat catatgtata
    17821 ttgtaggttt agatgcagat accttaaaag tcttagtgtc gttaaatatg gtaacatatt
    17881 tattattatt tagctatatg ccggaaactt tatactattc taagattata atccacttat
    17941 ttaaattaaa atattcggaa aaatttataa tcttatttag aaataatatt tctaataata
    18001 aacaatcggc aagtaattta acttcttatg aaaatgataa aatttctgaa catagaccaa
    18061 tttataataa attaaaagat gatgaatctt taggttatta tttatctggt ttaattgaag
    18121 gaaatggaaa tattgataaa aaaataatta gtattaatat aaattataaa gatattaaaa
    18181 atgcttatta tttaaaaaaa ataattggtt atggtagagt tataaaatat tcaaatacta
    18241 atactaatac taatattaat acaaatgccg cgactttttc acagtgtgaa aaagtcgcgg
    18301 ctaatataaa tagaaatatt aatattaaat taatttttga taataaaaat gcaagaaaaa
    18361 gagtatttga attaattaat ggtaaattat taggtttatc taaatataaa caattattag
    18421 atatagaata tgataaagaa tttaatttac caattaaacc tattgttaat tttaatttat
    18481 gagataatcc ttgattatca ggatttattg atagtaaagg ttcatttatt attaaaatta
    18541 ttaaatcaaa aataaataaa acagattata atattaaaat tatattaaaa attgaacaag
    18601 aatataatta tttattaaaa catgtacaaa atactttagg tggtaatatt tatattttaa
    18661 ataaagaaaa taataaaaca atttatcaat attcatctaa taattataaa aatgcttata
    18721 atattattaa atatttatca aaatttccac ctttacataa tagtaaatat attcatttct
    18781 taaaatgata taaagtatat ttaattattc aaaataaaaa tcatttaaat aatgaaggtt
    18841 tagataaaat taaatctatc aaaaagaact tcagagacta gtacgctaaa tatcctgtat
    18901 taaaatacag catttaaacc ttatataatt attaataata taataattat attaaataac
    18961 ccaacataga tatatctatg ttgggtatag gataaagata cagtccatta taaaattatt
    19021 attaattttt atagactaga gcttacttca cttcagctac aatgattatt gctatcccaa
    19081 ctggtattaa aattttctca tgattagcta ctatttatgg tggttcaatt agattagcag
    19141 tacctatgtt atatgctatc gccttcttat tcttattcac tattggtgga ttaacaggag
    19201 ttgctttagc taatgcttca ttagatgtag cattccatga tacatattat gtagtaggtc
    19261 acttccatta tgtattatca atgggtgcta tcttctcatt atttgcagga tattactatt
    19321 gaagtcctca aattttagga ttatactata atgaaaaatt agctcaaatt caattctgat
    19381 taatttttgt aggtgctaac gtaattttct tacctatgca tttcttagga gtaaatggta
    19441 tgcctagaag aattccagat tatcctgatg cttttgcagg ttgaaattat gttgcatcaa
    19501 ttggttcaat tattgctgta ttctctttat tcttatatat ttacattgta tacgatcaat
    19561 tagtaaatgg attagaaaat aaagtaaata acaaatcagt aatttatgct aaaggacctg
    19621 atttcgtaga atcaaatcaa attttcgcta ttaataaagt taaatcttca tctattgaat
    19681 tcttattaac ttctccacct gctgttcata cattcaatac accagcagta caatcataat
    19741 aatatatata ttatattata tatattattt ttcttaaata ttctttttta ttattaataa
    19801 attccttaaa ttaaactaac cgcgaatgta tttataatac attcgcggta tattatatat
    19861 ataattaata ttatttaata cttttttatt tattaatata tttatttatt attattataa
    19921 taaataataa acataaaaat agttagttaa ataaataatt aattacccgc cagtctccta
    19981 catagaagga gactggcgga ataatataac atatattatt tatatatata taaatagaat
    20041 aattattata tattcattat tataattttt tattattatt aaaattatta atataatata
    20101 atataatata attatataaa ataattaata gattattggc cttttaattg gttagaaaaa
    20161 ccaattaaaa ggcataatac atatatgttt ttatatattt aaatatatat aatatatatt
    20221 atatttatta cttaaaataa ataatagaag atttattata taataattat ttttattatt
    20281 attattatta tatatataat ttataaatta agatgacatt aattattggc cttttaattg
    20341 gttaattaac caattaaaag gccaaatata tatatattct ccttacgggg tcgccgcctt
    20401 cggcggcgac attacttatt ttttattata ttatttaaat aatataatat tttattttta
    20461 tataattatt attatataat ataataatat aatatactat actatactat actatatatt
    20521 attatataaa taaattaata aattattagc cttttaattg gttaatataa ccaattaaaa
    20581 ggcgtaatac atatataaaa atattaattt atattttatt acttaaatag tagaaaattt
    20641 tatataatta attaattatt tttattatta ttatatatat atatatatat ataatatata
    20701 aattaagatg atactaatta ttagcctttt aattggtttt taaaaaacca attaaaaggc
    20761 gtaatatata tatattgtat attttatttt tataatataa ataatattat atttttatta
    20821 tataatgatt attatatata taatataata taataaatga aataaatatt attatataat
    20881 aatagattat tcgcctttta attggttttt aaaaaccaat taaaaggcga gatatatata
    20941 tattgtatat attattatat atttatataa ataatatata tatttaatta tatatattta
    21001 attattttgt cgccgccatt ataaataatg gcggcgaccc cgtaaggagt aataatttat
    21061 tattaattaa ttaattaatt aaaataataa taattattta ttataatatc tatatataat
    21121 tataaaatta atataatatg atatgatata atataataat ataatattaa ttatatgcct
    21181 tttaattggt taattaacca attaaaaggc ataatatata tatatatata aatatacttt
    21241 ttaatatata ttttatatat aaaaatcaca aatgatatta attattatta aaaatataat
    21301 aataataata atattaatta tttaaataat attgtatatg aattaattaa ttattggcct
    21361 tttaattggt taattaacca attaaaaggc caaatatata tatattttta ttttatttta
    21421 tgtagataaa ttatatatta ataattttta attataatat aatatattat taatataata
    21481 taataatata tatataatat atattattat tatataaata aataaataaa taaataaatt
    21541 aattaattaa ttaattaatt atacgccttt taattggttt tcaataaaaa ggcgtaatac
    21601 atatatattt tatatattat taatatataa ttatataaat tatataataa tattcatatt
    21661 aatataaata taatattatt atcttcgtaa taattatatt aataattaat tattgccttt
    21721 taattggtta atataaccaa ttaaaaggca taatgtatat atatatatat cctttcttta
    21781 agatttatta aatatcataa gatattatat atatatgtat atattttata taatataaat
    21841 tacgcctcag acataaattt ttaattcatt aaattaaccg ccaatgtatt ataaatacat
    21901 tggcggtata gattataatt atattattta tatcattaat tttaattata tataattttt
    21961 aaatataata atataatatg atataatatg atataatata atattcttta aataatatta
    22021 attattggcc ttttaattgg ttaattaacc aattaaaagg ccaaatatat ttacatatct
    22081 atatatatta tataatgtaa attatataat aattatataa tattattata tattaattaa
    22141 ttataaatta aaaagtcaat attgtattgt atattaatta ataaattaat aaatttatta
    22201 ttggcctttt aattggtttt aaaaaccaat taaaaggcca aatatatata ttttatatta
    22261 ttttaatata ttatatattg tatatattta tttatatata atataatata atttatattt
    22321 ttaataaata tattaataaa taataattac cgccagtccc caccattggt ggggactggc
    22381 gatattagta tatactacta tataaatgcc acattttcac tatagtgaaa atgtggtaaa
    22441 gtataattaa tttttatatt attattcaat attattaata atatatattt atatatataa
    22501 tattaaataa ataataatat ttattatatt cttaattata aaattgtata atattatccc
    22561 gcgacttttt tataaaaaaa gtcgcgggac ttaacttatt aaaaataatt catttattcg
    22621 ccaattccaa tatcattgat attggaattg gcaaaatata tctatatact atatattata
    22681 tattactata tatattatat ttaatatata ttatattatt aaaccaaata agtaattaat
    22741 taattttata ttctccgcca attcataatc taatagatta tgaattggcg gaattataca
    22801 tattattaga tatctattat ttagatatat atttatattt aataataata ttgaataata
    22861 aaatatatat tattgaatat atatactatt atatattatt atattagctc cgccactaat
    22921 tttttttcac aattattgtg aggcgggtaa tatattactc gtcctttccc acatatatgt
    22981 gggaaaggac ggatatttat tctatattat tctcgaactt aattataata attaatatta
    23041 taataataat ttatattatt atataattat aataataata ataatatatt taccgccaca
    23101 tttttacatt gtaaaaatgt ggcggatagt aattgtatat ttaattaata tataatatat
    23161 atatttataa ttaataattt ttattaataa tttataataa taataataaa atatataata
    23221 tataataata ataatattaa taataataat aataataccg ccacttttta tttataaaaa
    23281 gtggcggggt ttaattttat atacaaacat ttattatctc tttttattta attttataag
    23341 taataaaata tataatatat atatatcata tatattataa tattaattag ataatttaaa
    23401 ataaaataat aaaaagaaca tgatgttggt tcagattaaa cgctaaataa ggacattaca
    23461 catgcaaatt aaacgtttat tatatatgta atataataaa tatgtagtgt acacgtgagt
    23521 aaaatttgga atttttaact ataaataaag ttaaatgctt tatagtattt atatataaat
    23581 ttatatatat aaatataaag attatataat tataatataa ttgtttatag taaagccaat
    23641 attggtttaa gatagtaggt aaattaaaag ttatacctag tcgacgatcc ataatcgata
    23701 attaacgtta gaacgatcac gttgactttg aaatatagtc aatatctata agatacagca
    23761 gtgaggaata ttggacaatg atcgaaagat tgatccagtt acttattaga atgatatatt
    23821 aattattaat attaaaaaaa taatatatat ttatatatat tattatatta tattaaataa
    23881 aaataatatt aattgattaa caataaagtt cataaataat taaaataatg atattaatta
    23941 cttgtattaa ttacaagtat atttatatat atatttatat atatatagat atatttaata
    24001 gtcctaacca aaatttgtgc cagcagttgc ggtaaaacaa tgggggcaag cgttaatcat
    24061 aatggcttaa agaattcgta gaattatata tattatatat atattagagt taataaatat
    24121 taattaaaga attataatag taaagatgaa ataataatga taattataag actggtatac
    24181 gtgaaaatat taattaatta ttaactgaca ttgaggaatg aaggctagag tagcaatccg
    24241 gattcgatac ccgagtagtt ctagcagtaa actatgaaca ccaattttta atatataata
    24301 ttaaaaataa aatgaaaatg taagtgttcc gcctgaagag tacgttcgca aggatgaaat
    24361 tcaagacaat agacggttac agacttaagc agtggagcat gttatttaat tcgatgatcc
    24421 ccgactaacc ttaccatatt ttgtatattt atttatataa tttatataaa taattacagg
    24481 cgttacatcg ttgtcttcag ttcgtgctgc aaagttttag attagtttca tgaacgaaca
    24541 aatctccata tgtatattta tcaattatac ataatatttt atatctattg gatatatgat
    24601 gaaaggaatt aagacaaatc atgatgatcc ttataatatg ggctatagac gtgctataat
    24661 taaatgataa caaaactata ttaaattatt ataaaaaata ataaattaat agtataaaac
    24721 atttaaatct ttaatatatt actatattat ttataatatg gattaatatc tgaaattcga
    24781 tattatgaaa aaagaattgc tagtaatacg taaattagta tgttacggtg aatactttaa
    24841 ctgtttcgca ctaattactc atcacgcgtt gaaacataat gttatctaaa tatatttata
    24901 tatttatata ttatatatat cttattatat ataattatat ttatattata aatatataag
    24961 aaatattacg aattaatgcg aagttgaaat acagttaccg taggggaacc tgcggtgggc
    25021 ttattaatat ctctaatatt ctcttccaat tattaataat aataattatt attattatta
    25081 aaatattttt aataaaataa attttattaa atttattaat taactaattc cgcggattat
    25141 ttataataat ccgcggatat tataattata tatatttata tattatatat aaatattatt
    25201 ataatatttt attaagtttt ctcttattta atgtaataat ggtcgccgcc attatataaa
    25261 tataatggcg gcgacatata ttattatatt attatattat tatataatta tattataaag
    25321 aagtaaacaa atatatattt tttatttatt ataaattata tattaaatat taacattata
    25381 tgttaatata tgacccgcca ctttgaaaaa gtggcgggtc ttttatttta atttttattt
    25441 taataaagga tatagtttaa tggtaaaact attgatttca aatcaatcgt taggagttcg
    25501 aatctcttta tccttgtatt attattatta ttatatataa aataaatatg ttatatattt
    25561 atttattaat tataattcgc caattcaata tcttagatat tgaattggcg atatatatat
    25621 atattattta attaaaacat tataaataat atatataaat tatatgttat aatatattta
    25681 taatattata ttataaatat aaaacccgcg actttttcac aatgtgaaaa agtcgcgggt
    25741 aatataaata taaatatgta atataaatat accgccaaaa tgccttttta aaaaggcatt
    25801 ttggcggatt attataataa tataatatta ataatattat atttatttat ttattattta
    25861 ctattaaaaa agtaaattat atataataat aaataaattt taaataaaaa tagtactata
    25921 tttatatata aatatatata taaatatata gatttattat tattatataa aataataata
    25981 aataattata ttaataaaat aaaacaatat tatataaata tatcgccaaa atgcctatat
    26041 aggcattttg gcgtataata tatttatagt aaattataaa aataagtata taaaaaatat
    26101 gccacaatta gtaccatttt atttcttaaa tcaattagta tatggatttg cattagtaac
    26161 tattttatta gtattatttg cacaatactt cttacctcaa attttaagat tatatgtatc
    26221 tagattattt atttcaaaat tataatttat atataatatt ttaagaggtt aaatattaat
    26281 aattaatata tattatatat attattaatt atacaattta tacaaaaccc gccacttttt
    26341 cacagaaaaa gtggcggcta atataatgta taaatatatt acattatatt atataatatt
    26401 tattatataa aaattaataa taataaaaat attattaata taatattata ttatgttata
    26461 ttatattata ataaattaag ttaaagggct cttcctttgc tttatagcaa aggaagagcc
    26521 ttaattataa ttaatttatt aattagttaa tatatataat tattatatat aataaattta
    26581 tattagatta tttataaaaa taaaataaaa atatgttaaa tttatttatt acatcaccat
    26641 tagatcaatt tgaaattaga gtattaatgg gatttacatc tccattatta gatttcagta
    26701 gtttaaactt tactactttc tcattatata cagtaattgt attatttaca attattggtt
    26761 taaatacatt aactactaat aataataaaa ttattggttc taaatgattt gtatctcaag
    26821 aagctattta tgatactatt ttaaatatgg ttaaaggaca aattggtggt aaattatgag
    26881 gattttactt cccattagtt tatacattct tcttctttat ctttgtaagt aacttaatta
    26941 gtatgattcc ttattcattt gcattatcag ctcatttaat tttcattgta tcattaagtt
    27001 cagttgtatg attaggtgct actattattg gtttaactaa acatggttga gtattcttct
    27061 cattatttgt acctggaggt actcctttac cattagtacc attattagta ttaattgaat
    27121 tattatcata ttttgctaga gctatttcat taggtttaag attatcaagt aatgtattat
    27181 caggtcattt attattaatt attttaggtg gattattatt taatttaatg tctattagta
    27241 ttattacatt tgtatttgga tttattccag gtattggatt attagctatt gtagtattag
    27301 aatttgcaat ttcagtaatt caagcttatg tatgagctat tttaacatct tcatatttaa
    27361 aagatgcttt atacttacat taattatata tagtatatat ataattatat tttaaatatt
    27421 cttattataa tataatataa tatattataa acaatattat aagatatata atcccaatat
    27481 ctctttattc aaaagagata ttgggataag tattattata taatatatat ttttaattta
    27541 aatttttata aaaatataat ttataataat aataataata atatatttac ataccgaaac
    27601 catcaatatt tatttgatgg tttcggtgga tctatatata tattgtagat atatattata
    27661 tatgtattta tattaattat tttaattaat attataaatt tatgttaaat ttatttatta
    27721 ataattaact aactaattaa ttaactaact aactaaataa ataaataaat aaatattcgc
    27781 caaaatgcct ttggcatttt ggcggataat atatataata ttatttatat tttatttata
    27841 aaatatataa atatttttta ttatatatga gtataagatc caaatccaaa ttaatatata
    27901 ttaatattta cgccaaaata ccacttattt aagtggtatt ttggcgaata aggtatatta
    27961 tatatattat attatattat attatattat attatattaa ttatataaaa aaaatatatt
    28021 tctcctattt aattaatata ttgtatatgt aagatattcg ccaaaatgcc tttggcattt
    28081 tggcgttata tatattattt ttaaataaat ataatatatt aatatttatt taattatatg
    28141 tgataaaact ttttatttat aattaaatat aaatataacc cgtccttttc catattaaat
    28201 atggaaaagg acggatattc attaattaat tctttttatt tatttattct aattataata
    28261 ttttaaatat ataataataa taattatata ataaataaaa ataaaataag taaaataata
    28321 ataattaata attaataatt aattagcccc gccacttttt caaagtggcg gctaatatat
    28381 taatatccgc caaattacta cttaagtagt aatttggcgg gtaatattta tatttatatt
    28441 ttatttgaat aaatacatat atatataaat atatatatat atacatatta tatataaata
    28501 tattaatatt ctatttaact cctcaatata aagtaaagat ggtcgccgcc attataaata
    28561 atggcggcga catatattta atatattaat ctatataatc tactatatat atttttaata
    28621 aaatgtgatg aataataaga ataataagtg tacataccta aaccataaaa tatttatggt
    28681 tttgtagtat acacacatat atatattaat tttattataa atattttatt attactcctc
    28741 aatataaagt ataaagtaaa gatggtcgcc gccattatta ataatggcgg cgacattatt
    28801 agtaaatatt agacccgcga ctttttttat aaaaaagtcg cggctgatat attaacttta
    28861 aatatatctt tttattatat tatttttaat aataaataat aaataaataa ttaataatat
    28921 aataatatag aataaaggag aatttattaa ttaatattcg cctttaattc cttataaata
    28981 taaggaatta aaggcgaatt atatatatta taattattaa atatttttgt aatattacaa
    29041 aaatattaat taaattatat aaaaaaaata tatattatta atttatatat ataatattat
    29101 aaagtaataa ttttatttat atatatttat aaaattaaat aataaataaa taataaataa
    29161 ataataaata aatgaatatt cgccattaat tccctataat tatagggaat taatggcgga
    29221 tttatatata tttataaata tattattcat tatttagata tagatctgag actttatata
    29281 ataaattagc ctcagattat ttaataatcc ttattacttt ttcacattaa ttaattaatt
    29341 aattaattaa ttaatttatt taattatccg ccttttaatc ctcttagtta aggggattaa
    29401 aaggcggaat tatattaatt atatataata tatatattac atatttttat tttaataaaa
    29461 taattattat tatttttata taaatataat aaagtaataa ttttattaat aaataaataa
    29521 ataaatattc gccattaatc cctaataatt attagggatt aatggcgaat aatataatat
    29581 tgttatacta taatataata tatattatta tatatttttt attaatatat atatatatat
    29641 aaaagtaatt atatatatct ttaaatagat ataattatac tataaattaa tatatatatt
    29701 aaatttataa aattatagaa aaatttataa aaaaatgaca catttagaaa gaagtaaaca
    29761 tcaacaattc cctttccatt tagtagctcc atcaccatga ccaattgtag tttcattttc
    29821 attaatggca ttagcattat cattagcatt aacaatgcat ggatatgtag gtcatatgta
    29881 tttaatttat ttatcattaa ttacagtaac atatagtgct actttatgat ttagagatat
    29941 tattgcagag gcaacatatt taggagatca tactattgct gtaagaaaag gtattaattt
    30001 aggtttctta ttatttgttg tatctgaaat tttaattttc gcaggattat tctgagctta
    30061 tttccattca gctatgagtc cagatattac attaggaggt gtatgaccac cagtaggaat
    30121 tcaagctgta caacctacag aattaccttt attaaatact attattttat tatcttcagg
    30181 tgctactatt acatatagtc atcatggttt agttgctggt aatagaaaaa ttgcattatc
    30241 aggattattt attacattct gattaattgt aattttcgta acttgtcaat atattgaata
    30301 tacaaatgct acattcacaa ttactgatgg tgtatatggt tcagtattct atgctggtac
    30361 aggattacat ttcttacata tggttatgtt agctgctatg ttaggagtaa attattgaag
    30421 aatgagaaat tatcatttaa catcaactca tcatgttgga tatgaaacaa caattattta
    30481 tgctcatgta ttagatatta tttgattatt cttatatatt gtattctatt gatgaggtgt
    30541 ataattatat aattaattat ataattatat ataaattatt attaaatatt cttattatta
    30601 atatatatat tattatttaa tatgtcttcc gccacttttt tataaaaaaa gtggcgggtt
    30661 tattatatta ttatattatt atattatata tattatatta tatatatgta ttatataata
    30721 ttagataata tatattttct tacttaatgt aataatggtc gccgccatta tatataatgg
    30781 cggcgacatt atgttatatt atatatatat ataatatatt ctcctaaatt attatttatg
    30841 taagcagtat taattatatt aaatatatat tataatatat aaataaatta ttaattaaaa
    30901 ataaatataa tattgaaaaa tatttgatta tccgccgata ttactatagt aatatcggcg
    30961 atatatttta tttatatcat attttttttt atagaattta tattaatata attaatataa
    31021 ataataataa tattttccta ttaaaattaa attgtcgtct tggacggcga tataatatat
    31081 gattattcgc caaaatggcc tataaaatag gccattttgg cgattatatt ataaatttat
    31141 aaatatatta tatatatata tatatatata taatataaat aaagaatatt aataaattat
    31201 aataataata aaaatataat attatatatt ttaagtcatt cgccaaaatg gcctatttta
    31261 taggccattt tggcgatatc tttatatatt atttatcttt aaatattata tatatttata
    31321 tttaaatatt ctatattata atatatattt tttattaaat aataataata aaatatattt
    31381 ttccgtgagg aaattatatt aattaatacg ccaaaatgcc tatttaatta aataggcatt
    31441 ttggcgttat atctatattt tttttatata taatatatta tatagctata tatataataa
    31501 taatattatt tgtcgccgcc attatatata atggcggcga ccttattaga ttaaggagaa
    31561 tttattttta ttaaattaat aataattatt atatattaaa ttataaaaat aaaatattaa
    31621 agaggaaaat tataataata aaagaatatt aataaaaaca cccgccaaat taccaaaggt
    31681 aatttggcaa tttaatatta tattcttttt atatatataa atatatattc taaatatata
    31741 atatttattt attacttaaa tataatttat acttattttt ccttatatat atgaaatata
    31801 cataaggaat agttaataat tataatataa attagctacc gccacttttt ataaataaaa
    31861 agtggcggat gatattacta tataagtaac tatttaatta aattaaataa taatattatt
    31921 attaaattat tttataatat atatatttat atatattata aaacataagt actttttatt
    31981 aatattaata tattaataat tagtataata taataacatt atgcaattag tattagcagc
    32041 taaatatatt ggagcaggta tctcaacaat tggattatta ggagcaggta ttggtattgc
    32101 tatcgtattc tcagcattaa tccaaggtgt ttcaagaaac ccttcattaa aagatacatt
    32161 attcccattc gctattttag gattaattta agcgagtcct aaaaatctat attattatta
    32221 tatattatat aataataatt taactttttt aataaaagag atattaaatt gggtgaattg
    32281 caagaaactc ctaatattta ataataataa ttaaatatgg acaatttgca gcgaagttta
    32341 taacaacctc cccgttattt ctcctttatt taaaaggata aataacgggt gtatttttat
    32401 ataattaaga ttattattta atataaaaat aagttataaa aacgttcaac gactagataa
    32461 tgagttaggt taacaataat ttatccacga gcgcccaata tcatatttaa tatatgataa
    32521 tgacatagtc taaacaatat agtaatatat tgagataata tttaaataat attatgattt
    32581 tacacaacta ttaggcttcc aactaatgtt gctttatcag aagctacagg tttattctgt
    32641 ttaatgattt cattcttatt attatacgct gtataattaa taacaattga aattaaatat
    32701 tttcaatatt ctttttaatt taattataaa ttaattaata ttattaaata ataatattat
    32761 ttatttcgcc aaaatgcctt tttaaaaggc attttggcgt atctattata tatttatatt
    32821 atatattaat aattaattat atatttttat atatataaat ataatatttt tatatatatt
    32881 atattatata tatgtataat tcgccaaatt accaaaggta atttggcgaa tattattatt
    32941 ctccttaata taataattat ttataatttt aattataata tatatattat attataatat
    33001 attatccgcc actttttctg tgaaaaagtg gcggggctaa ttaaataaat tattattaat
    33061 aaatattata ttctcctatt taatataata ataataatat aataataata atataattac
    33121 gccaaaatgc cttttaaaaa ggcattttgg cggattatta tatatataat aataattaat
    33181 ttattactaa ttatataata tataaatatt atatttatta ttttttatat aaattatata
    33241 tatatatgta tatatatata tgtatacata tatatgtgaa attcgccaaa ttaccactaa
    33301 aagtggtaat ttggcgagta ttatttatta ttttaattat tttactattt aataaggttt
    33361 acatctttat taatgtaatg acggaaatat atttaatata tattcaaata taaatataaa
    33421 ttagataata tattattaaa taaattaata ataatataat tataaattaa ttaataatac
    33481 aattccgcca aattaccttt ggtaatttgg cggataagca tataattatt atttatttta
    33541 atataaatat atatataata tttattattt atattttatt tatattttta tatatattat
    33601 aattatatat aatcttaaat attctttttt tttataataa ataataataa attaatatta
    33661 ttaaataata atgttattta tttcgccaaa atgcctttgg cattttggcg tatacattat
    33721 atatataatt attttaaata attaattata tataatattt atataaatat aatattttta
    33781 caaatatttt attatatata tatgtataat tcgccaaatt accaaaggta atttggcgaa
    33841 tattattatt attataatat ttcttctact taatataatt attattatta ttttaattat
    33901 tatatctaat atatatataa tatataatgg acctggaata aatatattat taaataaatt
    33961 aataataaga ttattatact ttaataatta taattaataa tataattccg ccaaattacc
    34021 aaaggtaatt tggcggatat tattgttata tttattattt aaattatata atttattatt
    34081 attattatta tataaattat attataaatt atataaataa tattattatt aataaatatt
    34141 atctctttaa tattatttgt ctaatattat ttcgccaaaa tgccaaaggc attttggcga
    34201 atcatatata atatatatat tattatatat atataattat tgattaatta ttaattatat
    34261 aatttattat tattattttt atatatttat ataaaaaaat attatatatg tatatatgta
    34321 taattcgcca aattaccaaa ggtaatttgg cgaatattat tattattata attatttatt
    34381 atttttatta ttatatctaa tatatattta atatatatta tattatatta tatatatatt
    34441 tatatttaat aaaaaattat taaataaaat tattatactc ttattaataa tataattccg
    34501 ccaaattacc aaaggtaatt tggcggataa ccataattct ttattattta tttatttatt
    34561 tattattata taaatattta atatttatta tattttattt ataataataa aattatatta
    34621 tatattataa tacaaattat tataaataaa taaacatata taacaatcgc caaaatgcct
    34681 atttaatagg cattttggcg tttaattaat taatataata ttcttttatt tttattatta
    34741 ttaagtaata attaatatta tttaaaaata aattaataat attatatagt tatataatat
    34801 ataatattat aaaacataat atatatacat aatgccaaaa tgcctattaa ataggcattt
    34861 tggcagatta ataaatataa tctgttaata tattattatt attttattaa aatatttata
    34921 ttctaatata taatatatat atatatataa atatatataa atttaaaaga taaataatat
    34981 ataaatatac cgccaaaatg cctattatag gcattttggc gaataattat catataaata
    35041 ttattaatta ttatataatt attaattata tattatatat aatattatat tatatttata
    35101 aataagtccg cgactttttt ataaaaaaag tcgcgatatg atattatgta taaataattc
    35161 gccaaattac caaaggtaat ttggcgaata ttcttatttt tattattcta ctttttaatt
    35221 atattcaata attaataata taattcttaa ttatttatta taatataata tttaatatta
    35281 ttttatgtat aatatttatt atattatata tataatatat agaaattatt aaaaatatat
    35341 aatatataat atatataacg ccaaaatgcc tatttaatag gcattttggc gtataattaa
    35401 tataatattc tttaattttt attattatta tttaataata atttatataa aaataaataa
    35461 ataatattat tatatataat agttatataa tatataatat tattgaagat aatgtaatac
    35521 ataacgccaa aatgcctatt aataggcatt ttggcgtatt aatataatat aatataattt
    35581 attaatatat tatattttta ttattattat tattttataa aaatatttat atataaatat
    35641 atataaattt aaagataaat aatatataaa cataccgcca aaatgcctat aaagtaggga
    35701 ttttggcgga ttaattttat aattaatatt attatataat taccattata tataatatat
    35761 attaaatata ttaaaaatat ataactgaaa cataaataaa tatatttaca tatcgccaaa
    35821 atcctttgga ttttggcgaa taatttaatt aataatattc tttttatttt agataaatat
    35881 atatttaaaa atttatttat aatataataa tatataatat aatcgccaaa atcccctatt
    35941 ttaatagggg attttggcga ataactcaat ataattatta taattattat tataataagg
    36001 agaatattta tatttatata tatataatta tttatataat ttatatatta ttatataata
    36061 tacatataat atacatatat attacgccaa aatccccttt ataggggatt ttggcgtatt
    36121 acctatataa tatttatata ttattaatat atatataata tatattatta ttataattat
    36181 tattatttat tatttatata taataataga tatatatact tatttattta aataaatatt
    36241 tatatttata accgccaaaa tcccctatta aataggggat tttggcgaat agtttaatta
    36301 ataatattat attattataa tttattatta tttattaatt aataagcttc ttgacttttt
    36361 tataaatata atataatata atttatataa tataatataa ccgccaaaat gcctatttat
    36421 taataggcat tttggcggat aacacaatac aatatattat tcaatattat atttaatata
    36481 attattttat atattatata atatattatt atataatata catatatata acgccaaaat
    36541 cccctttata ggggattttg gcgtattata gtagagataa tatttattat tataattata
    36601 atttattatt atttattata tatatttaat atataaatat atatacttat ttatataaat
    36661 taatatttaa aataaccgcc aaaatcccct attaaatagg ggattttggc gaataaataa
    36721 ataaattaat tatttgatat tattaatatt tattaatatt aatattttta ttttatatag
    36781 atatatatat aatatatata aagaatttat taataataac cgccaaaatc ccctatttaa
    36841 taggggattt tggcgtatta tatatataat agttagtata tataatatat atatatataa
    36901 tatttattat tattataatt aattattatt aataaaaata ttctttttat tttagatata
    36961 atatataaaa aaaatatatt tataatatat taataccgcc aaaatgccta ttaaataggc
    37021 attttggcgg atggataaca caatataata taatataata atatacaata taatataata
    37081 taatacaata taatataata aaatattgta taatataata tatataacgc caaaatccaa
    37141 aggattttgg cgtatgattt aattaatatc atatttttat tattattatt attttaattt
    37201 aatataattt atatattatt atataatata catatatata tatataacgc caaaatccct
    37261 ctttaagagg gattttggcg tattacagta tatataatat taattctatt attagaatta
    37321 ataatttatt attatttatt atttatattt attatattta ataataaata tatatactta
    37381 tttatataat atttataata acataaccgc caaaatcccc tatttaatag gggattttgg
    37441 cgaataattt aatcaattat atcatattat taatatttat tattattttt ataatatata
    37501 gatatatatt tataatatat atataaagaa tttattaata acaaccgcca aaatccccta
    37561 tttaataggg gattttggcg gatggattac acaatataat ataatacaat ataatattat
    37621 acaatacatt atattataat ataatataat ataatataat ataataatgt cgccgccttc
    37681 ggcggcgacc ccgtaaggag aacataatat aataaaatat tgtataatta caatataata
    37741 tatatatata acgccaaaat cccctattta ataggggatt ttggcgaata attacaataa
    37801 aaataagaat aatcaggata attataataa aaatagtcgc cgccgaaggc ggcgactccg
    37861 ttatattaag gagaattatt aaaataataa taattattaa ataaattata atatatattt
    37921 atatatataa aatataagta ataaataaat ataatttgaa atatttctta tataaattta
    37981 aagagataat caaggattat aaaagttatt aatagtcata ggttactaat aaaatatata
    38041 tattttatat atatattttt aaaacctaag gtaaacctga taaaaatata aattaagtga
    38101 actgaaacat ctaagtaact taaagaatat aaatcaacag agatattatg agtattggtg
    38161 agagaaaata atatagtcaa atttatatat ttataatata tataaataaa taagtattat
    38221 gtaaataaat tatgtaagaa tataggacaa actagttcta agactaaata ctattaataa
    38281 acaaaataag taccgtaagg gaaaataagt aattggttat tttataagca gttataaata
    38341 ttttatataa atattaataa cgtacctttt gtataatggg tcagcaagta attattatta
    38401 gcaaaattat tttaatataa ttataaataa tttgaatatt aaacattgta taatataata
    38461 atatatattt aatatatatt atagttagtt aatgataatt gacccgaaag cggacgatct
    38521 taatatgacc agacggttaa aaacggtcga acaggttgat gttgcaatat catctgatga
    38581 gtcgtgttaa gcggtgaaag acaaatctgg ttcgcagata gctggttttc cacgaaatat
    38641 atgttagtat agtctctatt aaataattaa tattattatt atatttttta tataataata
    38701 aagaatggta cagctataaa tattattatt tggggaataa ttgctatttt atcaaagata
    38761 tttaatctcg aaatgtttat taatattaat agagaatcag actgtgcgcg ataaggtgaa
    38821 cagtctaaag ggaaacagcc cagaataaga tataaagttc ttaattagat aataagtgaa
    38881 ataaatattt aaatattata atacaatcag ttaatgggtt tgacaataac cattttttaa
    38941 tgaacatgta acaatgcact gatctatttt ttttataaat aatatttaaa accataatta
    39001 tttttaataa ttatgtaaat aaataatata acggatcttt tttaattata attatctaac
    39061 tgaatatcta tataatatta tatataaata aatgtaatat tatggtagtg gaacatttaa
    39121 tgaataataa gtatattaat atttacggat taatatatga tatataaatt aaatagagaa
    39181 tgctgacatg agtaacgaaa aaaaggttta atccttttca cctaaagcat aaggtttaac
    39241 aataaaagta cggcccttaa gtaaaatatg aataaaatta tattgtacga taggtaaaat
    39301 ctaaatatat atattatatc tatattatat atattatatt ataatatata taaactaata
    39361 tagatcaaga aatagatata tatacaaata ccgtaatgta taccgactct ggtatgttag
    39421 tagagaatat gaaggtgaat tagataatta aagagaagga actcggcaaa aatagctcta
    39481 acgttagtca aaaaagagta aaaaaaacaa ggttgtccaa ctgtttacta aaaacaccgc
    39541 actttgcaaa aacgttaagt tatagtataa ggtgtgaact ctgctccatg cttaattaat
    39601 aaatatgaat aattattatg attattatat taaatttaag taaatagcag ccttattatg
    39661 agggttctaa ggtagcgaaa ttcctaggcc aataattgtg gtcctgcatg aatgacgtaa
    39721 tgatacaaca actgtctcct ctttaagcta agtgaaattg aattcgcagt gaagatgctg
    39781 tgtacctata gtaagacgaa aagacccttt gcagctttac tgtaattaga tagatcgaat
    39841 tattatgtat tttgttcagt atattaagta atagattata tataaatgaa atacttatct
    39901 aaatatctta aatattattt ttaataatat tttataataa ttcttatctt tataatatat
    39961 ttaattgata tatattctta aatatatatt atattatata atatttatat tgtataatat
    40021 aattaaagag aaaatctcta attggtagtt ttgatggggc gtcattttca gcaaaagtat
    40081 ctgaataagt ccatatataa attataatgt tattgattaa caaattatat attatatata
    40141 ataattattc acatctttat tttataatat gattttaatt ataatataaa ataaagtaaa
    40201 taatagaaaa gattatgtac agtaaaattg tcatgaaaac aataatatta aaaaatatta
    40261 aattaatata atggtataac tgtgcaacaa ttgtaacact cacaagtgaa acaagtacgt
    40321 aagtatggca taatgaacaa ataacactga ttgtaatggt tattgataac gaataaaagt
    40381 tacgctaggg ataatttttt gtcccattat atatatatat atatataaaa agataatata
    40441 tgtatatata attatccctt ttttaccttt ttcaaggaaa aaaaagggag taaattgggt
    40501 gaattgcaag gaactcctat tattatttaa taataattaa aaaataataa aataaataat
    40561 aaggacaatt tgcagcgaag cttataataa cctatttatt ataatattat aatattataa
    40621 taaagatttt ataagaacgt tcaacgacta gataatgagt taggttaaca ataatttatc
    40681 cacgagtgcc caatattaaa tattattata aatatttaat aatgacatag tctgaacaat
    40741 atagtaatat attgaaataa ttaattaaaa ataattatat aaacaaaatt gaacagggta
    40801 atataacgaa agagtagata ttgtaagtta tgtttgccac ctcgatgtcg actctaccta
    40861 tcctcctggt tgtaagtgct aggaagggtt tgactgttcg tcaattaaaa ggtaacgtga
    40921 gttgggttaa atacgatgtg aatcagtatg gtttctatct tctataggga atattatcaa
    40981 tttaaatctc atttttagta cgcaaggatc aaaatgaatt aatctatggt gtatctattg
    41041 attaatatat atttatatat attagtttat atataattat aattatattt aatataatta
    41101 taatgtataa ttaatcattg tagagaagct aaattaataa ataataagta ttgaatgcat
    41161 ataaatacga agtagtttta aagagataat ttataattaa ttttatacta aaatgtataa
    41221 taggattaaa tatttgatat ttaattacta atttaattat tatttatata agatcaaatt
    41281 atatttattt ataaaatata aaaaatatat taatgtatgt atcccttttt taccttttta
    41341 caaaggtaaa aaaggggttt aacatatatg taatatataa tatataatat tattaaatat
    41401 aatattaaat tataataatt cttattaata ttacccgcca ctttttcaca gtgtgaaaaa
    41461 gtggcgggtt tagtataaat aataacaatg tatccctttt tacaaaggta aaaagggatt
    41521 tgatatatat gtaatatata atattattat attagaataa taaataacaa taattattct
    41581 tataaatata tatataaaat atatatatat aaatattaat aataatgtat cccctttttt
    41641 acctttataa aaaggtaaaa aaggggaaat aaataatata taaatgtaca tataaatata
    41701 tctaaaatat ataattattt tatatggtat tagtcctaat aaatgatata taattatatt
    41761 aaataataat taataaatat tataaataat aattaattaa taaaaatata tataaaggcg
    41821 tcgaattggt atcaattcga cgccattaat taaattaacc aaaatatata ataaatataa
    41881 ttatatatta atatataata tatataaaag tatatatata tatattataa gtaaattaga
    41941 gcaatataat gtaattggta acatattagg ctcatgacct aaacatatac gttcaactcg
    42001 tattattgct aaataaataa attaattaaa gtcataatat atattaatta atataattaa
    42061 taatgaataa tattattaat tgccacattt ttacatagta aaaatgtggc gatataaata
    42121 aatgagataa ataattatta attaaatata taaattataa attatatata tatatattat
    42181 ataattatat atatatatat attgattgaa ataaatatta taaatatgct tattaatttt
    42241 atttattata acagatagag gccgaagggt taggcgcttt ctttgggaga aagagttagt
    42301 tagttcgaat ctatcctatc tgaataaaat atctatttaa aatatatata tataatatta
    42361 aatatattcc gcaaaaatac cacataaaat gtggtatttt tgcggatgat tataaattat
    42421 aactaactat atcttataga ttatatgtta ttaattatat attataatat aatatatcat
    42481 atatatataa aaatatgata tgtatatgta tatgagacat atatatatta cgacaaaatc
    42541 ccttataaag ggattttgtc gtcattaatt atttatattt aatttttatt aaaaaataat
    42601 aataataatt attaataaaa aaattatact aaatataatc aatataaata tattatccgc
    42661 cacattttat tcaaaatgtg gcggatgagg ttaatagata taagtaattg attaatagcc
    42721 tttatagctt agtggtaaag caataaattg aagatttatg tacatgtagt tcgattctca
    42781 ttaaaggcat tcatttatag ctactttggt ggaaatggta gacacgacac tcttaagatg
    42841 tgttatcgca agatatgaag gttcaaatcc tttaagtagt attataatat aatataataa
    42901 taattatatt cttcttaata taagatataa gatataaaga ggtcgccgcc attatattta
    42961 tataatggcg gcgacatatt atataaaata ttatataaat aataataata tatatatata
    43021 ttatatatat aattaattaa atatatataa aagataatat aatatatact agtataatat
    43081 aataccgccg aggtaaaatt acctcggcgg taagaatata tatttatata tataaataaa
    43141 tatattaatt atataattat tataattatt aaaatgaatc gtagactaat aggtaagtca
    43201 ccaaaatttg agtttggaat ttgtttgttc gaatcaaacc ggttcaatat atattattta
    43261 tatataatat atataatgag aatattgttt aatggtaaaa cagttgcctt ttaagcatcc
    43321 catgtttggt tcgattccaa ctattctcat ctaatatcat ttctcccctt ctttctataa
    43381 gaaagaaggg gataaattta tatataagct ctcttagctt aatggttaaa gcctaatact
    43441 tctaatatta agattctatg ttcgagtcat agagagagta tatttaaaat aaataggtat
    43501 aagttaattg gtaaactgaa tgtcttccaa acattgattg cgagttcaag tctcgctacc
    43561 tatataatta taataataat aatattataa ataataataa taataataat ataaaataat
    43621 gtcgccgcca ttatataaat ataatggcgg cgacctcata aaaagaatat aatataatat
    43681 ataataaata taaatataaa tataatataa atataaatat aaatatgagg gcttttttac
    43741 tgcttaagaa gcagtaaaaa agcctatata tgtatatata tataaatata ataataattt
    43801 attttattaa taatattgta ataatattat aatataatat ataataatat aatatactac
    43861 tataaatatt taatataaat attaatattc cgcgaagatt atttataatc ttcgcggaat
    43921 ttatatataa tatatattac atattttaga tatttattta taaaggatct gtagcttaat
    43981 agtaaagtcc catcttgtca cgatggttga tgtcagtgca agtctgatca gattcgtatt
    44041 aattaattaa ttaataataa taatatatat aaatatataa ttatatattt atataaatga
    44101 atatataaca tcaaaaccgc aacgaattaa taattcgttg cggtttaata taataatata
    44161 tatatatatt tataattata ataatattat tatattatta ataaggaaaa ttcaccattg
    44221 gtaaggtaga ttatttgcta cataattgaa ctatgttctt atgagttcga ctctcatatt
    44281 ttccgtatat ataatatata tatatattaa taatatataa taataaatta tatttaaaag
    44341 gtgaatatat ttcaaaggta gaaaatatgc ttgtggcgcg tctaatctga gttcgattct
    44401 cagtattcac ccttattata tttatatcat aatgccacat ttttactatg taaaaatgtg
    44461 gcaaatatac atatttaatt attattaaat aataataata ataataatat tattattata
    44521 tattaacttg tatagtttaa ttggttaaaa cattcgtctc ataagcgaaa catataggtt
    44581 caagtcctat tataagtatt tattattaaa ataatatata taattattat gtttaataat
    44641 taaaattatt atatgtcgcc gccattatat ataatggcgg cgacccctta agataataat
    44701 taataattcg ccaattaaat catattttta atatgattta attggcataa taaaatattc
    44761 aaatagatat tgtaatttat tattttaaat taatttttat atataaaata tataacatat
    44821 aatatataat atattatata tatctaacgc caaaatccaa aggattttgg cgtattatta
    44881 ataatataat attattatat ttttaatatt tattaataat ttatattata taaaaataat
    44941 tataaatatt atttgatata tatatataat atatatttaa aacataatat agatatattg
    45001 ccaaaattcc ctttgaattt tggcatcata tgttatatat attatatatt ataatataaa
    45061 attaaattat aatcatatat ataaagaaaa tattctcctt aatataacgg agtcgccgcc
    45121 attatttata atggcggcga cattaataat aattattatt ataataaata ataaatgaat
    45181 aaatgaatta attaactaat aattcaccaa ttaaatcata ttaataatat gatttaattg
    45241 gtgaaatcat atataaatat ttatatatcc tatgttatat taataaaaaa taatttaata
    45301 attatttata aaataaatat aaaatattta tttatttata taataaataa taaataatat
    45361 ataatgtata acgccaaaat cccactatta gtgggatttt ggcgtataat taataatata
    45421 attagtatta tatttttatt tatattatat atataaatta ttataataat aattatattt
    45481 aaaatatata aattatttat atatatatat atatatataa gaataaaaag tatatattct
    45541 ccgccaaaat accacttatt taagtggtat tttggcgtgg atttggatct tatactcata
    45601 ttataatttt ttatatgtta ttatttaaat tttatatata aaatatataa catataatct
    45661 aattaataat aataatatta attaattaat taataataat aataactata aacttccgcc
    45721 actttttcat aaaaaagtgg cgggttaata taatataata taattataag ataaatactt
    45781 attatgtcag aagctaatat attattttat aatttttaat aataataata ttttatttat
    45841 atatataaaa agtatataaa gtatatatat attatatata taatttattt ccgccaaatt
    45901 accaaaggta atttggcgga atattataat tataattatt attaattatt tttaatataa
    45961 ataattagta aaattaaata atatttttta tatattaatt aataatatat ttataaatag
    46021 aaatttaaat tttaatttaa ataaccgcca gtcccctcct taggagggga ctggcggtat
    46081 ggtatatatt tatttatata aataattaat taatgaatat taataataat aatatttttt
    46141 ttatattaat taatgaatat taataataat aataaataat aatatttttt atatattaat
    46201 taatatatat aaattatata taatattgat tattggcctt ttaattggtt tttaaaacca
    46261 attaaaaggc caaatatata tctattatat cgctgatatt ataaataa
//
DBGET integrated database retrieval system